1HB0B

Snapshots of serine protease catalysis: (d) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 10 for 2 minutes
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILRNNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title X-Ray Snapshots of Serine Protease Catalysis Reveal a Tetrahedral Intermediate
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hb0B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hb0B01
1ZPZA 1V2PT 1KY9A 1GBDA 4F49A 4UD9H 2AS9A 1GI3A 1QL8A 1FIWA 4YOIA 2XNIA 1O2WA 1YF4A 3P70B 1F2SE 1O2YA 1P09A 4DY7B 1DPOA 3OY5U 3SI4H 2PSXA 2STAE 1KSNA 1V3XA 1O34A 1RGQA 4D9RA 1ARCA 1RIWC 2FX4A 3PO1B 1KXEA 1MQ6A 4AFQA 2XC5A 1SVPA 3RXOA 1C5TA 4X0WU 2H9TH 4JYUH 3MH5A 5DG6A 1A46H 5ESBA 2WV5A 1HAPH 2G5VA 2YNAA 1GJBB 1HJAC 4WJG2 1J17T 1WCZA 4KTCA 5L2ZH 2PHBA 1YGCH 5AHGH 1S84A 1MTUA 1LTOA 3PLBA 1T31A 2TGPZ 3BTKE 1AE8H 4NA7A 5GWZA 4MPVA 1ZHMA 1G36A 4NZLA 3SUGA 2IPHA 3B8JA 2H6MA 3M35A 4ISIH 1GBLA 4OS1A 1GJDB 2ZP0H 1TX8A 3UFAA 4GAWA 3F6UH 1L2EA 2XWBI 3GY2A 1JRTA 1W2KH 3P8GA 1L4ZA 1RJXB 3GCOA 3M5LA 1C1UH 1OWEA 1UTKA 1CGJE 1ESAA 3P6ZB 2GKVE 1CO7E 1IQHA 2GGVB 3ZZ7A 5A8YA 2O8UA 3RXFA 2BQWB 4JZ1A 2XWAA 5DP5A 2VWMA 1LVMA 1AVGH 1KDQA 3V7TA 2IOTA 3TVJB 1EOJA 1V2VT 1QB1A 4TPYA 3U8OH 1IHSH 3PMBB 3OU0A 6LPRA 2TRMA 3LU9B 4ZHLU 5E0GA 1FZZA 5G4BA 5JB9S 1TB6H 1OYQA 2ZQ1A 4FXGH 3SV7A 1ZJDA 4IC5A 5GJ4B 4U2WA 3TH2H 2SGFE 1SGFG 1F5KU 1O3CA 1KXCA 1O2ZA 4CR9A 1P01A 1ELCA 2ZCHP 1D9IA 2YNBA 3JZ1B 1DFPA 2QC2A 5E2OA 1IOEA 1THPB 1A5IA 3RXHA 1C5RA 2ZDLA 3TGKE 1ZTJA 3A7XA 1YCPH 2HRVA 1AFQB 2A32A 4Y8ZA 5BRRE 6CHAB 4CHAB 5EQRA 2ALPA 2XCFA 1XXDA 5FBIA 5EG4A 2PUQH 4ZKOU 1P9SA 1FY3A 1ZTKA 4ZROA 4MNXA 4K3JA 4GUXA 4KELA 1JXPA 5CHAC 2ZPQA 1CGHA 1HAIH 1EKBB 3SJ8A 2GD4B 4B73A 2XXLA 2ZHWH 2R0LA 3GYLB 1C2EA 5EODA 2FOFA 1UTJA 2Y5HA 2AERH 3SU5A 2BB4A 2FZZA 1QRWA 1Y5UT 1AZ8A 1FAKH 1HYLA 4NWKA 3RXQA 2CN0H 2JH0D 3RU4T 2G00A 1TLDA 2WPLS 2ZDNA 4THNH 3VXFH 4ASHA 1W3CA 4Z6AH 1FUJA 1EJNA 2C4FH 1DANH 1GBBA 2BLQA 4U30A 5BPEA 2BOHB 3MU1A 2FMJA 1ESBA 5C5OA 3PM3A 3GY4A 2AH4X 2GVFA 1C5PA 1E36B 1GI8B 1B7XB 3E1XB 2TGTA 1O39A 1O33A 2VWNA 1Z7KA 4DJZB 3ATMA 1YCPM 1UVSH 2OD3B 1C5MD 1BTPA 3RMOH 5AVDA 2WV4A 4IC6A 3PMHB 1QL9A 3GY3A 4D8NA 7KMEH 3OYPA 4F4OC 3GDSA 1TFXA 4GSOA 4X8TH 1EUFA 3BTTE 1O3FA 3A7YA 3Q00A 1GMHG 3NPSA 1QQ4A 1V2MT 1BTXA 1O37A 1TX6A 1ZSKA 1O2QA 4I8KA 2FWWA 1IQNA 1BMLA 2FOHA 3M7QA 1CT4E 1ABJH 2ZU4A 2UWPA 2FIRH 3RM2H 2F83A 5JB8S 3SI3H 1AFEH 3M36A 3BTHE 1E35B 1LQEA 4Y8YA 5L6NH 2J34A 1PQ7A 3ZZ5A 4U01A 1FY4A 4WMFA 4YT6H 2PSYA 4I33A 2BVSH 4Q7XA 3SU6A 3K6YA 3TGJE 1EAUA 1C2FA 1O36A 2C8ZB 1G32B 3A80A 3Q3YA 1C2KA 4KTUA 4K1TA 3SW2B 5HGGA 4A92A 4DW2U 3CS0A 1BBRK 1N8OC 4XDEA 1H9HE 4H6SB 1A0HB 3RXCA 1GJ7B 1IHTH 1O2LA 8GCHG 3FZZA 4OS7A 1ZSLA 1EATA 4YO9A 3OTJE 1EJMA 2QXGA 3RXUA 3VB7A 2ZFFH 1QL7A 4GLYA 1KTSB 4MVNA 3QTOH 2ZO3H 1QJ6B 3L33A 1PJPA 2XC4A 1W0YH 3A88A 1O35A 2IN2A 1E38B 1O5GH 4FUFA 2FYQA 2C8WB 2FOBA 3RU4E 1ELDE 1Z8RA 4ABHA 1WUNH 1CBWB 4ABDA 2ZTXA 5LPRA 3BTFE 1FONA 2G4TA 2THFB 1BBRH 2QF3A 1EOLA 4AX9H 1EJAA 3L3TA 7GCHG 2BDCA 1SQOA 5ESTE 1TMBH 3A8BA 2AGGX 3GY6A 4ABGA 1U6QA 1VJ9U 5I25A 1VZQH 1C5NH 2KAIA 1H1BA 4MQAA 4GHTA 3GDVA 1BTHH 1LMWB 1RRKA 1F0SA 2GCHF 5HYOA 1GI5A 1HB0B 4M7GA 2GTBA 1H4WA 1O2OA 1W12U 3PROA 3KQCA 3NXPA 2F9VA 1LPZB 4YT7H 1GJ9B 3ATLA 4BNRA 1KTTB 1C2LA 1NN6A 1V2RT 4K8BA 2WINI 3ZZ8A 1LHFH 1F0TA 1AUTC 3RDZA 1D6WA 1P04A 1YPMH 2ANYA 1YLDA 2A0QB 2NU2E 3RLWH 5K7RA 2RDLA 3RMMH 3SOSA 5JBCS 1TNIA 2AYWA 1CA0C 1B0EA 1TPAE 2KAIB 2O8LA 1OX1A 2V35A 3I77A 1T8MA 1JRSA 2BXTH 2WPKS 1DSUA 3V3MA 1LKBA 1AE5A 1CE5A 1MCVA 1O3NA 3H7TA 1TNLA 4ZKRU 3STJA 5EPYA 1SSXA 1LHGH 1VCPA 4AG1A 1A61H 1CT0E 3ZZ4A 1HXEH 2ZU1A 4XBDA 4NA9H 2FOCA 4UFEH 1C4Y2 2XYAA 4NFFA 1HGTH 3LJOA 1SHHB 1ELGA 4FUIA 9ESTA 3E90B 1P2QA 3UPEA 2ZZUH 4JCNA 1XUHA 1ZHRA 3A85A 3QZRA 1WQVH 1QURH 4YLQH 3LT3A 1DWBH 2FS8A 1GI2A 3VB4A 2Z3EA 1RD3B 1ZPBA 1LHDH 2D1JA 3NZIA 2J38A 1BT7A 2FLRH 2Y5GA 3BG8A 1GHVH 1GJ8B 1Z6EA 3RC5A 2Z6BD 2ZNKH 3QDZB 4SGAE 2G81E 1C9PA 2I6QA 1G3BA 1TE0A 4ZXXH 3KHVA 1V2NT 1D3TB 2ZECA 4A1XA 3RP2A 2PLXA 2Z9KA 1LVBA 2NU4E 3ATKA 2NWNA 2PV9B 1S0RA 4Y79A 3QN7A 1AWHB 2BDIA 5T3HA 1PPFE 4JZFH 1DUAA 1P0SH 1SHYA 4B71A 1GHAF 4YESB 1UHBB 3SUDA 3K2UA 2G55A 3SHCH 4YOJA 3TU7H 3ZYDA 3PTBA 1MH0A 4XE4A 1QBVH 2GMTC 3B23B 1NROH 2EEKA 2FI3E 1EPTC 2XCNA 4NIXA 2BMGB 3TH4H 3HK6B 4D76A 1DY9A 2CV3A 1EZXC 1VJAU 3SJIA 4X8UH 3UTUH 3Q77A 4B2AA 1S5SA 3M5NA 2BDBA 4R0IA 3BSQA 3BG4B 4SGBE 2BHGA 4KKDA 1GVZA 2ZGHA 1HAVB 1GL0E 1SGNE 1O2MA 1QR3E 3ODFA 3TNTA 1VGCC 4BTUB 1O2XA 1P05A 2ZFTA 3UUZA 2JETB 1P02A 5EGMA 1ACBE 2JH5D 2ANWA 4GVUA 3IITA 1GHWH 3T26A 1QB6A 2A4RA 1O3LA 1A0LA 1GHZA 1O3EA 4JK5A 4LK4A 3BV9B 1P2IA 3UOUA 2B9LA 1W13U 4A7IB 3NWUA 1N6XA 5FHTA 1A7SA 3D23A 3M61U 1HAHH 3R0FA 3UR9A 4ZHMU 1V2QT 4X2XA 5F8XA 1GG6C 1M9UA 2ZHEH 3RXGA 1Y3WA 2ZC9H 3S7HB 6GCHG 5DO4H 1EZUC 1ZLRA 1CHOF 2VWLA 1CU1A 1KLJH 2BY5X 4Y7BA 1Z8JB 5JBBS 5DP7A 3E0NB 1ANBA 2FI5E 1LPGB 1AZZA 2FTLE 2GCTC 1DWEH 2W3IA 1TX7A 5EXNA 3LGTA 2XRCA 2CJIA 4IN1A 4BAMB 1O2PA 1TPOA 1BITA 4Q80A 2ULLA 3TIUA 1G2LA 1GBFA 1LO6A 1NFYA 1O2GH 2PKSC 2GZ9A 1FQ3A 3F9GA 8LPRA 2QXJA 1Z71A 2TGDA 1BQYA 5E0HA 2Y5FA 3KGPA 4XSKU 4GHQA 5FCKA 2Y82A 5E8EH 1BMMH 1TAWA 1N6YA 3WY8A 5DK1A 3A8DA 2ODYB 4TY6A 1YC0A 1ANEA 2H9EH 1DICA 3A81A 4O3TA 1TOMH 2QV1A 2C93B 2WPJS 1XXFA 1NFWA 2Z3DA 4VGCC 1ZSJA 1HAZB 1IQJA 1BTZA 1SBWA 1UTMA 3SGQE 3D62A 1SG8B 3RXEA 3EA9A 3JZ2B 3ZVGA 2B0FA 3MH4A 2TBSA 1VITH 2VGCC 3TK9A 4XBCA 4KP0A 4NCYA 2R2WU 4E06H 3OY6U 5HXFA 1TABE 1BIOA 5FPYA 2OXSA 3SGBE 1MZAA 1BRAA 3SUFA 4JZDH 1V2TT 1RS0A 4Q2KA 3SNDA 5CHAB 1O2JA 1MU8B 2FESH 3UQOA 1O2TA 4FUHA 4I8LA 2XBWA 1V2JT 1O5DH 1MUEB 1C2GA 1ID5H 1DLKB 2BTCE 5EXMA 1FIZA 2NU1E 1BHXF 4BXWA 1MBMA 3M5MA 2BX3A 1SB1H 2V0BA 1O3AA 1INCA 1RTFB 1UO6A 4O3UA 1C5XB 3VGCB 3MU0A 1DVAH 3K65B 1H8IH 1XM1A 5DGJA 4UFFH 1G3CA 3I29A 5A8ZA 1K1MA 2CHAC 3LPRA 4INKA 2FOMB 3W95A 4B2CA 4BTTB 1C1PA 4DIHH 1BMNH 1GJAB 4RN6A 4GCHF 2G52A 4X6PA 2ZHDA 5C67A 3LGUA 4ISOA 3ZVAA 2ZDMA 1OKXA 2OLGA 4AORA 4WXVA 1XKBC 2CMYA 2XBVA 2G4UA 4ABJA 1MBQA 2F9BH 1F92A 2RA3A 2Z9GA 2OC8A 4MPXA 1DXPA 1O3BA 2AIQA 1O38A 4Y11E 2EI7A 3RXRA 1NY22 3S0NA 3SU3A 1TMTH 1GCTC 3QK1A 3L6PA 2ZHFH 4YLUA 2YOLA 1A4WH 1WQSA 2P8OC 1MTSA 3A83A 4E7NA 4X6MA 3A86A 3GY5A 1HJ9A 2VIVA 1O5EH 5EQQA 1J16A 2A45B 2ZDAH 5C20A 1F0RA 1DUEA 2P3UB 3S69A 2ZF0H 2Y81A 3EDXB 3RXKA 5H4IB 3E3TA 1JWTA 1K1JA 2ZCKP 1TBQH 4ZMAH 2J9NA 1Q31A 1J14A 3FANA 2GDDA 1MCTA 1OPHB 4MNVA 3OSYA 3MHWU 2XBXA 5DPAA 3S9BA 4X1NU 1A3EH 3O8CA 5F6MA 1UVTH 2GV7A 2BYAX 1PQ8A 5HM2A 3KQDA 2AEIH 3VPKA 1K1OA 3ENSB 1GMCF 1T8OA 3AAVA 1AI8H 3MOCA 4HTCH 1W7GH 2UUKB 1SGFA 1AB9C 2BZ6H 5C2ZA 4RKOB 1QFKH 2O8WA 4ZKSU 1OYTH 1P2JA 1EB1H 1JIRA 5GPIB 4JYVH 5TCCA 3SU0A 1NS3A 2LNCA 2FODA 3GCHB 2A5AA 1HJ8A 4ZAEA 1BTWA 3T62A 1A5GH 5L2YH 2P95A 4ABAA 2SGQE 5K0HA 2FDAA 2JKHA 4Y76A 3UR6A 3V13A 3SV6A 2BDYA 3PTNA 3SNAA 1UVUH 3PO1C 4ABBA 3PLKA 3LGWA 1BTYA 1SQTA 3MNXA 1CVWH 3LGYA 5A2MH 4A1VA 3GY7A 1UK3A 1YM0A 5EPNA 2ZU3A 4ZUHA 3M7UA 3Q76A 1HLTH 1YP9A 5DP4A 4IN2A 2DE9A 2XTTB 1FAXA 2F9UA 2XBYA 2ZI2H 1FN8A 2EI6A 1UTPA 1L1JA 1V6DA 1ELTA 3M3SA 4DOQA 1XUKA 1FXYA 2HNTF 1W10U 1L1GA 1HAOH 2OUAA 2RCEA 3AVZA 1IQFA 1TWXB 2TIOA 1XX9A 3MYWA 1BJUA 4IMQA 1GBJA 3SV8A 5LPEA 1D4PB 1O3HA 3SHAH 4I7YH 5JBTA 1AHTH 1PFXC 2OINA 1UTQA 1ZPCA 1LPKB 2FOGA 4WMEA 1ANDA 5FAHA 1P03A 2CXVA 2GZ7A 3BTEE 1GMHF 4WVPE 3ELAH 4AYYB 1GBKA 2R9PA 3PYHA 2O8MA 1IQGA 3BTQE 1KXDA 3MU4A 8ESTE 3AW1A 2PGBB 3RXMA 4ABIA 4UFDH 1B0FA 2BQ7B 4FUCA 3A7ZA 1QNJA 1E0FD 2FYRA 3VXEH 1LQDB 1T8NA 2GT8A 3TITA 4K1SA 3UNQA 1C5WB 5A0AE 4B76A 1QGFA 2IJOB 2ESTE 1MTNC 5FBEA 2Z3CA 5F8ZA 1C1RA 1OWKA 3AW0A 3ZZBA 2P16A 1JOUB 2EA3A 1IQEA 3CENA 2STBE 1P10A 1GBTA 1DLEA 1AUJA 2P3TB 1AU8A 3AASA 3RXJA 2PGQB 1Y5BT 9LPRA 2BD4A 1EZQA 4CRBA 1PYTD 4E05H 5FCRA 4Q7ZA 1DY8A 8GCHF 3LIWA 1YPEH 4BAOB 1OSSA 3TH3H 1XVOA 3E91A 4HFPB 1Z8GA 4X2YA 1AFQC 1SC8U 1AWFH 2PKAA 3E0PB 3ZZCA 1V2LT 2J2UA 3E16B 1MD7A 4UEHH 1BOQA 3ZZ3A 4CREA 1X7AC 2EI8A 3TJUA 1S0QA 2FI4E 4BTIB 1O2NA 1YPJH 5IYTA 1IQIA 3ZVFA 1S83A 3TJOA 2HNTE 3MU5A 3RC4A 2BD9A 2AGIX 3SNCA 2I6SA 1ZOMA 3SN8A 2B8OH 4JK6A 2BY8X 4KTSA 1DXWA 1VITF 4Q7YA 1KLIH 3LONA 2O8TA 7ESTE 2PKAB 3V12A 2C3SA 1C2IA 1YBWA 4Y7AA 1DX5M 1Z1JA 1UTNA 2GZ8A 2UUFB 3QGNB 3ZYEA 1OP8A 2B5TB 1Z6JH 1LHCH 3D65E 4HGCA 2GMTB 4NG9H 4CRGA 1O32A 3LGVA 1NU7B 1O3MA 3O8BA 2H2ZA 1W14U 2BVRH 2DE8A 1K1PA 1O2UA 1V2WT 2GP9B 4BAKB 2VIWA 5GDSH 1FY8E 3LKWA 3R3GB 2DUCA 1ELEE 1FV9A 1ANCA 1AVXA 3P17H 3LJJA 3NUMA 3TPIZ 2GT7A 1TRYA 5AFZH 1O31A 5C1XA 1F7ZA 1JIMA 1VGCB 1ESTA 1O2VA 3EYDA 2P3FH 1BMAA 3PMAB 2P94A 4TY7A 1Y3XA 3RXTA 1RTKA 3QTVH 2AMPA 3QO6A 5EW1H 4OS6A 2QXHA 1FI8A 1C5QA 3LC3A 2AFQB 2ASUB 1G2MA 4X8VH 4LOYH 4ISHH 3HATH 1HAYB 4CH8B 1B5GH 1GHBF 5T6FA 1O3GA 1KXBA 1MAXA 2B7DH 1QA7A 3U69H 3ZZDA 3RXBA 3S9AA 1PPCE 1IQLA 4Y8XA 1SGQE 1AY6H 1S81A 3ZVCA 3RXLA 1BTUA 1DS2E 2P93A 3ESTA 3KIDU 1LVOA 1O2SA 3MMGA 1GJ4H 1UCYK 1P2NA 3T29A 2OC0A 1EQ9A 1DSTA 5C1UA 2RG3A 2Z9JA 2H1UA 3BN9A 1ZGVA 2VH0A 3TGIE 2HNTC 5C3NA 1NESE 1YYY1 3PB1E 4X1PU 3TK6A 4X6NA 2W7SA 2BX4A 3NK8A 2QYIA 2FLBH 3M7TA 3UQVA 1UHBA 1GMDG 2HOBA 1NT1A 4FVBA 3PWBA 3T28A 1ELFA 3BTDE 2BLOA 1UCYH 1DITH 1D6RA 2J4IA 2FM2A 4TYDA 1P12E 1SMFE 3M5OA 2R3UA 4FUGA 2A7CA 4H4FA 5EW2H 2GX4A 2OBOA 1EAWA 1C1WH 1HAVA 1SLVB 4JZEH 1CBWC 2BXUH 1MU6B 1LKAA 4IGDA 3CS7A 1V2UT 5EU8A 3VEQB 1WTHD 5GCHF 4FU8A 2WYGA 2PTCE 4ZXYH 4O03A 4KGAA 1Y3YA 1S6HA 1XVMA 1ETTH 1K9OE 3MNSA 2VGCB 1SOTA 4DVAU 1O3OA 1G9IE 4UE7H 2C8XB 1WOFA 1WSSH 4X2VA 3EGKH 2QAAA 5DJ7A 3FP6E 1RIWB 2W5EA 1GHAG 2W3KA 1NRPH 1UVOA 4NA8A 3PV4A 2XW9A 4CBOA 2BD3A 1TBZH 5FPSA 1HCGA 5LH8A 4O9VA 3LH3A 2WYJA 1DM4B 3T2NA 3GCTG 3E6PH 3BEIB 2PWXA 4X8SH 1HJAB 1TALA 1CT2E 1QY6A 2ZA5A 4X1QU 4U32A 3NCLA 5FXLA 1C1NA 1ZMJA 1ELAA 2ZGCA 3SV2H 2VWOA 2SGAA 1KIGH 3GYMA 5A0BA 1ETSH 1GDQA 3SQEE 2WPIS 2CHAB 2AMDA 1P3CA 3PLPA 1CQQA 2BD2A 2BD8A 1NZQH 1QTFA 3GY8A 1K21H 4B1TA 3LGIA 3UWJH 4X6OA 4CBNA 1UK2A 3P95A 1YPKH 1TOCB 1HIAA 2F91A 1NM6A 5DP6A 4MLFB 3ZZAA 1ETRH 1ZRKA 1OWIA 4MPWA 1J15A 4WH8A 5JBAS 1ZR0A 1TGNA 1QJ1B 1NRNH 1GL1A 3V0XA 1YKTA 1GCTB 5C1YA 1T8LA 3KN2A 3PWCA 1A3BH 4K8YA 1KXFA 1TPPA 3QWCH 1EAXA 3BTWE 1RXPA 3LC5A 3M3TA 4AFZA 1HPGA 4ESTE 1CHOG 1NFUA 1O5FH 2VIOA 1GVLA 1SOZA 3S9CA 1MAYA 2CF9H 1FJSA 1HIAB 5CMXH 1BRCE 4R8TB 1QRZA 3U1IB 1HAGE 4XFQA 4OS2A 2BY6X 1KXAA 1RTLA 3MNCA 1TNKA 3TJNA 3ZZ9A 3LOXA 2HWLB 1A2CH 3SU1A 4RSPA 3BIUH 2F9PA 1O2RA 2BM2A 2H5CA 1UTLM 2J92A 2O9QA 3ATIA 1SLXB 2ZDVH 4J2YB 1C2JA 5F03A 2ZTYA 4WWYA 1RFNA 1LDTT 1O2IA 1OP0A 3CP7A 1ELVA 1TYNA 3KL6A 3RM0H 3A8AA 4K60A 4CRAA 3C27B 1ZMNA 4NIWA 4D7GA 5GXPA 4Y10E 3F9HA 3EQ0H 4NSYA 1J8AA 4OGXA 4A6LA 2Y7XA 1TPSA 1SGPE 2ZU2A 1Y8TA 2SGPE 1XUIA 2ZFPH 1DE7H 4UONA 2OC1A 3HKJB 4IBLH 4BOHA 1P9UA 2FOEA 3K9XB 4AOQA 1QB9A 3SO3A 2VVUA 1EXFA 1IAUA 1NO9H 3MTYA 1IQMA 3BEFB 1WBGB 1J9CH 3BG4C 3UOPA 1SGDE 1HUTH 1F0UA 2A7JA 1S6FA 1PPZA 2D26C 2Q6GA 4WF8A 4UDWH 3PMJA 1GI1A 1GI7B 2VB0A 4WMDA 3DUXH 5DKMA 2A2QH 3UY9A 2JETC 3RLYH 1Q3XA 3VB3A 5T6DA 1H9IE 2WPHS 1WAYB 3SNBA 1EAIA 1LHEH 4JMYA 4AZ2B 2FTMA 1FY5A 2ZFRH 1QIXB 3SORA 3HPTB 1BB0B 2A2XH 1C5VA 1TIOA 4FU7A 2SNVA 5B6OA 2WUCA 2Z94A 2OC7A 3KCGH 3SBKA 1JMOH 4DG4A 5TCAA 1GI0A 1OWJA 1YLCA 1SPJA 3U9AH 4XBBA 1ZMLA 1EZSC 3D49H 2H9HA 1GGDC 2Q6DA 4MTBA 1XUGA 3C1KA 1D3QB 3QZQA 2HPPH 1ABIH 1O2KA 1QQUA 1EX3A 5E2PA 2FOAA 4K69A 4GCHG 4NGAH 1GJCB 2TGAA 2FP7B 2AMQA 1GHYH 5A09A 1SGRE 1P2KA 3RUOA 1ZYOA 2G8TA 2VIPA 2ANMH 2ZGXH 3KF2A 2PR3A 1AD8H 4ABFA 4NZQA 1N1LA 1QCPA 3UWIA 3FFGA 3RMNH 2GDEH 4MPUA 1HBTH 1C1SA 2FEQH 5A8XA 1TA2A 1BDAA 1YPGH 5ABWA 2WUBA 2HLCA 3BEUA 1EP6A 4INLA 1YCPK 2ANKH 3U8RH 2OTVA 4OS4A 1ZGIA 2CGAA 1MTNB 2QCYA 1OOKB 1TRMA 1UJ1A 5DP3A 5I46H 1D3DB 1BHXB 1ZTLA 4ZH8A 2NU0E 1C1MA 1HNEE 3EA8A 1W7XH 5CE1A 2J95A 1C2DA 4TWWA 2BLVA 5E0JA 3Q3KA 2ZTZA 1VCQA 4HZHA 1PPEE 1QBNA 3BTME 4X2WA 1C5UA 1N8OB 1BBRE 1KDQB 3QGJA 2VJ1A 4FUJA 4AGKA 4B75A 2Z7FE 5LPFA 2ZWLH 1AGJA 5DP9A 3KQEA 4FUDA 3SJKA 1L4DA 4DIIH 1CGIE 1ARBA 5FX5A 1TQ0B 3GICB 1GVKB 2UWLA 1GMCG 1JBUH 1W8BH 4IMZA 3SV9A 2ZFQH 1V2ST 1TNHA 3TNSA 4K2YA 3N7OA 5EXLA 1VCWA 1C1VH 1L0ZA 3RXPA 7LPRA 1FY1A 1GDNA 2SNWA 3P8OA 1QA0A 2BY7X 4ISNA 1TNGA 1SGIB 1NTPA 1FN6A 4CH2B 3MO3A 4CRDA 2OQ5A 2FXRA 3NKKA 2G51A 1XKAC 1BJVA 1SFIA 2PW8H 2ALVA 1GBEA 1QJ7B 1KLTA 3T5FH 1TGCA 1LVYA 2FPZA 8KME2 2FS9A 1C5LH 1GHXH 1Y59T 3VGCC 1SLUB 3FP8E 1GBCA 2HVXA 1UMAH 4INHA 2BDAA 5JPMH 2LPRA 3ZV9A 5EOKA 3A82A 4AYVB 2M5TA 4AFUA 1C1QA 1O5CB 4PROA 2NU3E 1TBRH 4D7FA 1GDUA 2P59A 5SGAE 2CF8H 1CA0B 1THSH 3EAJA 2ZHQH 3GOVB 2Q6FA 1TGBA 4QT8C 1MTVA 2W7UA 1SGTA 4OGYA 1MTWA 2ZKSA 2QA9E 1LCYA 2A4OA 1HFDA 3A8CA 1QHRB 3FAOA 3O8RA 1BRUP 1G3DA 1OWHA 3A84A 3TLOA 1PPHE 3S7KB 1DT2A 2A4GA 2VVVA 2UWOA 2Z9IA 3U1JB 1DDJA 2UUYA 4CR5A 2V3HH 3ZZ6A 3BF6H 5C5NA 1P06A 5ETXA 4IS5A 2BVXH 2PTNA 1DOJA 2A5KA 2D2DA 3MU8A 3K6ZA 1AVWA 4CRCA 1P57B 2SFAA 1GJ6A 4DT7B 1Y5AT 3ZVEA 1SLWB 2F9NA 4FU9A 4CRFA 1S82A 1WYKA 4IW4E 1UCYE 1GBAA 2ZPSA 1GBIA 3KNXA 3ATWA 1GCDA 3B9FH 1ELBA 5FPTA 3SJOA 4K1EA 4B74A 1O3IA 3P8NA 1K1LA 3Q3XA 2VIDA 4O97A 4ZHAA 4HI3A 1NC6A 2R0KA 1P2MA 2W26A 3G01A 6CHAC 1QBOA 2ODQA 4CHAC 4ISLA 1HRTH 1HAXB 1K22H 5F8TA 2VIQA 2BDGA 1MKXK 3GCNA 3GCHC 4A1TA 5J4QA 2ZCLP 1TGTA 1EPTA 2SGDE 1H8DH 3URCA 7GCHF 2C90B 4DURA 3ZVDA 3RU4D 2BY9X 3ZV8A 3RXVA 1O5BB 5EQSA 2ZIQH 4JZIA 4WXIA 1THRH 1XMNB 1PPGE 3P92A 3SJ9A 1BUIA 3IG6B 2Z9LA 1C4U2 3MO6A 5GIBA 5A0CA 4K5ZA 1TGSZ 1BA8B 1EPTB 3MFJA 1MKXH 4FUBA 1ZHPA 2V6NA 1DWCH 3F9FA 4I32A 4OS5A 3RC6A 3RMLH 1MQ5A 1VITG 3SZNA 2BLWA 1K1NA 1AQ7A 4LZ4B 1Y3UA 2D8WA 4I8GA 1C4V2 3SQHE 3A7TA 1GBHA 3A7VA 3TJVA 2GCHG 3MH7A 1AMHA 4MNWA 1P2OA 5JDUB 3RXAA 3ZVBA 1O3DA 3DHKH 3TK5A 3T25A 3SU4A 3LH1A 3I78A 1PPBH 3E8LA 3VFEA 1NU9A 1YPLH 2OQUA 4BANB 1FPCH 1K1IA 4GPGA 1TQ7B 1HXFH 3UNSA 1C1TA 1L1NA 3RXIA 1FNIA 4ABEA 1C5YB 1SFQB 4YTAA 1C5OH 1GJ5H 1EASA 1BCUH 1EP5A 1PYTC 1GG6B 1C5SA 1Z1IA 2OCVB 2SGEE 3BIVH 1G37A 3KEEA 1WV7H 1DWDH 1SI5H 1V2OT 4UFGH 5AF9H 2AIPA 3IWMA 2ZPRA 1O3PB 2VU8E 3A89A 5L30H 4WY3A 4DGJA 4BXSA 3SNEA 4X1SU 2ODPA 3O8DA 1GHBG 2BD7A 2GCTB 1UVPA 3W94A 2XC0A 1WTGH 4YZUA 4I8JA 2QF0A 1GMDF 1T32A 3KQBA 4X1RU 1O2HA 4Y0YE 2FO9A 1T7CA 3STIA 1NPMA 2BZAA 2BOKA 1A0JA 2BD5A 2F9OA 1ORFA 1YPHE 2EC9H 1C9TA 2PKSB 4FUEA 5HM9A 3DD2H 3GDUA 3VB5A 1OP2A 2A7HA 1D3PB 1SL3A 4JYTA 2OBQA 3RXSA 5J4SA 1KYNA 5TJXA 3QLPH 3VB6A 3M37A 5PTPA 3RXDA 4TWYA 1E34B 3DFJA 2ZEBA 2UUJB 4LXBH 4D9QA 1P8VC 1O5AB 2JH6D 3MO9A 3H5CB 5T6GA 4A5TS 1TMUH 3ITIA 1GWAA 2V3OH 2R2MB 4VGCB 3T27A 1V2KT 4H42U 3DT0H 1C2MA 1GI4A 3M3VA 3QUMP 4LZ1H 1Q2WA 4NFEA 1K2I1 1TRNA 4BAQB 2WPMS 1HDTH 1P11E 1S85A 1SQAA 2ZG0H 3FZDA 4MNYA 1FMGA 3HGPA 1EB2A 2FX6A 2H5DA 2OP9A 4Y71A 1AKSA 4I8HA 2PFEA 1GI6A 4WH6A 1ZJKA 1C1OA 4Y6DA 5JYIA 1MMJN 1SGEE 3URDA 1VR1H 1Y3VA 3GCTF 2ILNA 1SGCA 2VH6A 3MI4A 5GCHG 1T4VH 2A1DB 1ZRBA 4XOJA 1GPZA 2VNTA 3GISB 1WU1A 4AB8A 4MG3A 2QXIA 3FVFB 1MKWK 4YOGA 1O30A 1XUFA 2AGEX 1NRSH 4BAHB 5HMAA 3AAUA 1F5LA 3U8TH 1FLEE 1BZXE 4H6TA 3UREA 5LGOA 1UTOA 1AKSB 2ZQ2A 1TNJA 1FDPA 4FVDA 2K1QA 1IQKA 1XUJA 1BRBE 1MZDA 3FP7E 3SGAE 1O3KA 4AN7A 3F68H 2Y6TA 4DCDA 3OX7U 6GCHF 3A7WA 1OS8A 2G5NA 4TPIZ 4YM9A 1K28D 1W11U 2TPIZ 3ODDA 4Z0KA 1NFXA 3A87A 1YPHC 1C5ZB 1P3EA 3HGNA 4AFSA 1NRQH 1MKWH 1OWDA 4RKJB 2HALA 2QGRA 2ZGBH 1H9LB 1HV7A 1SGYE 1UK4A 1ZZZA 1QRXA 4MDSA 4AG2A 2ZGJA 4J1YA 2QY0B 1GGDB 3MNBA 2C8YB 3EE0B 1E37B 2A31A 2P8OB 4AB9A 4NSVA 1TONA 1C2HA 5IDKA 2ZU5A 2HGTH 4NIYA 2Y7ZA 3SUEA 3F9EA 3QX5H 2J94A 1O3JA 4NWLA 1CSOE 1A5HA 3HK3B 2Y80A 3P8FA 4E7RG 2RA0A 3LDXH 2BDHA 4NIVA 2BQ6B 3F1SB 4Y0ZE 3EA7A 2F3CE 2HPQH 2A5IA 5AFYH 4AGJA 3DA9B 1OXGA 1FPHH 5FX6A 3UIRA 3SU2A 1SR5C 1GI9B 4B2BA 2GV6A 1AIXH 1TA6A 2ZDKA 1W0ZU 2PUXB 2Q1JA 5DP8A 3BTGE 3H7OA 4ZKNU 1NRRH 3UNRA 1PQ5A 1O0DH 3MH6A 1PQAA 1Z8IB 1AN1E 6ESTA 1G3EA 2R3YA 2VVCA 1AB9B 1CA8B 1G30B 4I31A 2QIQA 1T4UH 1A1RA 2QN5T 1F5RA 2VINA 1MD8A 1GBMA 1CHGA 2ZFSA 3MWIU 3HKIB 3DFLA 3U98H 1AO5A 2A4QA
chains in the Genus database with same CATH superfamily
1ZPZA 1V2PT 1KY9A 1GBDA 4F49A 4UD9H 2AS9A 1GI3A 1QL8A 1FIWA 4YOIA 2XNIA 1O2WA 1YF4A 3P70B 1F2SE 1O2YA 1P09A 4DY7B 1DPOA 3OY5U 3SI4H 2PSXA 2STAE 1KSNA 1V3XA 1O34A 2K8IA 1RGQA 4D9RA 1ARCA 1RIWC 2FX4A 3PO1B 1KXEA 1MQ6A 4AFQA 2XC5A 1SVPA 3RXOA 1C5TA 4X0WU 2H9TH 4JYUH 3MH5A 5DG6A 1A46H 5ESBA 2WV5A 1HAPH 2G5VA 2YNAA 1GJBB 2KZ4A 1HJAC 4WJG2 1J17T 1WCZA 4KTCA 5L2ZH 2PHBA 1YGCH 5AHGH 1S84A 1MTUA 1LTOA 3PLBA 1T31A 2TGPZ 3BTKE 1AE8H 4NA7A 5GWZA 4MPVA 1ZHMA 1G36A 4NZLA 3SUGA 2IPHA 3B8JA 2H6MA 3M35A 4ISIH 3CNRA 1GBLA 4OS1A 1H8HD 1GJDB 2ZP0H 1TX8A 3UFAA 4GAWA 3F6UH 1L2EA 2XWBI 2VBCA 3GY2A 1JRTA 1W2KH 3P8GA 1L4ZA 1RJXB 3GCOA 3M5LA 1C1UH 1OWEA 1UTKA 1CGJE 1ESAA 1SQRA 3P6ZB 2GKVE 1CO7E 1IQHA 2GGVB 3ZZ7A 5A8YA 2O8UA 3OFND 3RXFA 2BQWB 4JZ1A 2XWAA 5DP5A 2VWMA 1LVMA 1AVGH 1KDQA 3UAIC 3V7TA 2IOTA 3TVJB 1EOJA 1V2VT 1QB1A 4TPYA 5C0UA 3U8OH 1IHSH 3PMBB 3OU0A 6LPRA 2TRMA 3LU9B 4ZHLU 5E0GA 1FZZA 5G4BA 5JB9S 1TB6H 1OYQA 2ZQ1A 4FXGH 3SV7A 1ZJDA 4IC5A 5GJ4B 4U2WA 3TH2H 2SGFE 1SGFG 1F5KU 1O3CA 1KXCA 2W6ID 1O2ZA 4CR9A 1P01A 1ELCA 2ZCHP 1D9IA 2YNBA 3JZ1B 3PRBA 1DFPA 2QC2A 5E2OA 5C0TA 1IOEA 1THPB 1A5IA 3RXHA 1C5RA 2ZDLA 3TGKE 1ZTJA 3A7XA 1YCPH 2HRVA 1AFQB 1WDIA 2EQNA 2A32A 4Y8ZA 5BRRE 6CHAB 4CHAB 5EQRA 3F2HA 2ALPA 2XCFA 1XXDA 5FBIA 5EG4A 2PUQH 2OK5A 4ZKOU 1P9SA 1FY3A 1ZTKA 4ZROA 4MNXA 4TSFD 4K3JA 4GUXA 4KELA 1JXPA 5CHAC 2ZPQA 1CGHA 1HAIH 1EKBB 3SJ8A 2GD4B 4B73A 2XXLA 2ZHWH 2R0LA 3GYLB 1C2EA 5EODA 2FOFA 1UTJA 2Y5HA 2AERH 3SU5A 2BB4A 4B6FA 2FZZA 3OEHD 3OE7D 1QRWA 1Y5UT 2V3MA 1AZ8A 1FAKH 1HYLA 4NWKA 3RXQA 2CN0H 2JH0D 3RU4T 2G00A 1TLDA 2WPLS 2ZDNA 4THNH 3VXFH 4ASHA 1W3CA 4Z6AH 1FUJA 1EJNA 2C4FH 1DANH 1GBBA 2BLQA 4U30A 5BPEA 3KYFA 2BOHB 2WHXA 3MU1A 2FMJA 1ESBA 5C5OA 3PM3A 3GY4A 2AH4X 2GVFA 1C5PA 1E36B 1GI8B 1B7XB 3E1XB 2TGTA 1O39A 1O33A 2F43B 2VWNA 1Z7KA 4DJZB 3ATMA 1YCPM 1UVSH 2OD3B 1C5MD 1BTPA 3RMOH 5AVDA 2WV4A 4IC6A 3PMHB 2JIZD 1QL9A 3GY3A 4D8NA 7KMEH 3OYPA 4F4OC 3GDSA 1TFXA 4GSOA 4X8TH 1EUFA 3BTTE 1O3FA 3A7YA 3Q00A 1GMHG 3NPSA 1QQ4A 1V2MT 1BTXA 1O37A 1TX6A 5EIYA 2RFKC 1ZSKA 1O2QA 4I8KA 2FWWA 1IQNA 1BMLA 2J97A 2FOHA 3M7QA 1CT4E 1ABJH 2ZU4A 2UWPA 2FIRH 3RM2H 2F83A 5JB8S 3SI3H 1AFEH 2RDEA 3BTHE 1YWUA 3M36A 1E35B 1LQEA 4Y8YA 5L6NH 2J34A 1PQ7A 3ZZ5A 4U01A 1FY4A 4WMFA 4YT6H 2PSYA 4I33A 2BVSH 4Q7XA 3SU6A 3K6YA 3TGJE 1EAUA 1C2FA 4XD7D 1O36A 2C8ZB 1G32B 3A80A 3Q3YA 1C2KA 4KTUA 4K1TA 3SW2B 5HGGA 4A92A 4DW2U 3CS0A 1BBRK 1N8OC 4XDEA 1H9HE 4H6SB 1A0HB 3RXCA 1GJ7B 2EY4C 1IHTH 1O2LA 8GCHG 3F0OA 3FZZA 4OS7A 1ZSLA 1EATA 4YO9A 3OTJE 1EJMA 2QXGA 3RXUA 3VB7A 2ZFFH 1QL7A 4GLYA 1KTSB 4MVNA 3QTOH 2ZO3H 1QJ6B 3L33A 1PJPA 2XC4A 1W0YH 3A88A 1O35A 2IN2A 1E38B 1O5GH 4FUFA 2FYQA 2C8WB 2FOBA 3RU4E 1ELDE 1Z8RA 4ABHA 1WUNH 1CBWB 4ABDA 2ZTXA 5LPRA 3BTFE 1FONA 2G4TA 2THFB 1BBRH 2QF3A 1EOLA 4AX9H 1EJAA 1W0JD 3L3TA 7GCHG 2BDCA 2JDID 1SQOA 5ESTE 1TMBH 3A8BA 2AGGX 3GY6A 4ABGA 1U6QA 1VJ9U 5I25A 1VZQH 1C5NH 2KAIA 1H1BA 2PP6A 4MQAA 4GHTA 3GDVA 1BTHH 1LMWB 1RRKA 1F0SA 2GCHF 5HYOA 1GI5A 1HB0B 4M7GA 2GTBA 1H4WA 1O2OA 1W12U 3PROA 3KQCA 3NXPA 2F9VA 1LPZB 4YT7H 1GJ9B 3ATLA 4BNRA 1KTTB 1C2LA 1NN6A 1V2RT 4K8BA 2WINI 3ZZ8A 1LHFH 1F0TA 1AUTC 3RDZA 1D6WA 1P04A 1YPMH 2ANYA 1YLDA 2A0QB 2NU2E 3RLWH 5K7RA 3F2FA 2RDLA 3RMMH 3SOSA 5JBCS 1TNIA 2AHME 2AYWA 1CA0C 1B0EA 1TPAE 2KAIB 3KYGA 2O8LA 1OX1A 2V35A 3I77A 1T8MA 1JRSA 4I86A 2BXTH 2WPKS 1DSUA 3V3MA 1LKBA 1AE5A 1CE5A 1MCVA 1O3NA 2K0QA 3H7TA 1TNLA 4ZKRU 3STJA 5EPYA 1SSXA 1LHGH 1VCPA 4AG1A 1A61H 1CT0E 3ZZ4A 1E1RD 1HXEH 2ZU1A 4XBDA 4NA9H 2FOCA 4UFEH 1C4Y2 2XYAA 4NFFA 2YMSB 1HGTH 3LJOA 1SHHB 1ELGA 4FUIA 9ESTA 3E90B 1P2QA 3UPEA 2ZZUH 4JCNA 1XUHA 1ZHRA 3A85A 3QZRA 1WQVH 1QURH 4YLQH 3LT3A 1DWBH 2FS8A 1GI2A 3VB4A 1COWD 2Z3EA 1RD3B 1ZPBA 1LHDH 2F4LA 2D1JA 3NZIA 2J38A 1BT7A 5EJLA 2FLRH 2Y5GA 3BG8A 3F3BA 1GHVH 1GJ8B 1Z6EA 3RC5A 2Z6BD 5HKKD 2ZNKH 3QDZB 4SGAE 2G81E 1C9PA 2I6QA 1G3BA 1TE0A 4ZXXH 3OTPA 3KHVA 1V2NT 1D3TB 2ZECA 5T1VA 4A1XA 3RP2A 2PLXA 2Z9KA 1LVBA 2NU4E 3ATKA 2NWNA 2PV9B 1S0RA 4Y79A 3QN7A 1AWHB 2BDIA 5T3HA 1PPFE 4JZFH 1DUAA 1P0SH 1SHYA 4B71A 1GHAF 4YESB 1UHBB 3SUDA 1OHHD 2G55A 3K2UA 3SHCH 4YOJA 3TU7H 3ZYDA 3PTBA 3DCLA 1MH0A 4XE4A 1QBVH 2GMTC 3B23B 1NROH 2EEKA 2FI3E 3SYJA 1EPTC 2XCNA 4NIXA 2BMGB 3TH4H 3HK6B 4D76A 2HLDD 3U28C 1DY9A 1K0HA 2CV3A 1EZXC 1VJAU 3SJIA 4X8UH 3UTUH 3Q77A 4B2AA 1S5SA 3M5NA 2BDBA 4R0IA 3BSQA 3BG4B 4SGBE 2BHGA 4KKDA 1GVZA 2ZGHA 1HAVB 1GL0E 1SGNE 1O2MA 1QR3E 3ODFA 3TNTA 1VGCC 4BTUB 1O2XA 5F53A 1P05A 2ZFTA 3UUZA 2JETB 1P02A 5EGMA 1ACBE 2JH5D 2ANWA 4GVUA 3IITA 1GHWH 3T26A 1QB6A 2A4RA 1O3LA 1A0LA 1GHZA 1O3EA 4JK5A 4LK4A 3BV9B 1P2IA 3UOUA 2B9LA 1W13U 4A7IB 3NWUA 1N6XA 5FHTA 1A7SA 3D23A 3M61U 2WSSD 1HAHH 3R0FA 2KCAA 3UR9A 4ZHMU 1V2QT 4X2XA 5F8XA 1GG6C 1M9UA 2ZHEH 3RXGA 1Y3WA 2ZC9H 3S7HB 6GCHG 5DO4H 1EZUC 1ZLRA 1CHOF 2VWLA 1CU1A 1KLJH 2BY5X 4Y7BA 1Z8JB 5JBBS 5DP7A 3E0NB 5B6LA 1ANBA 2FI5E 1LPGB 1AZZA 2FTLE 2GCTC 1DWEH 2J98B 2W3IA 4P02A 1TX7A 5EXNA 3LGTA 2XRCA 2CJIA 4IN1A 4BAMB 1O2PA 1TPOA 1BITA 4Q80A 2ULLA 3TIUA 1G2LA 1GBFA 1LO6A 1NFYA 3H09A 1O2GH 2PKSC 2GZ9A 1FQ3A 3F9GA 8LPRA 2QXJA 1Z71A 2TGDA 1BQYA 5E0HA 2Y5FA 3KGPA 4XSKU 4GHQA 5FCKA 2Y82A 5E8EH 1BMMH 1TAWA 1N6YA 3WY8A 3KQ5A 5DK1A 3A8DA 2ODYB 4TY6A 1YC0A 1ANEA 2H9EH 1DICA 3A81A 4O3TA 1TOMH 2QV1A 2C93B 2WPJS 1XXFA 1NFWA 2Z3DA 4VGCC 1ZSJA 1HAZB 1IQJA 1BTZA 1SBWA 1UTMA 3SGQE 3D62A 1SG8B 3RXEA 3EA9A 3JZ2B 3ZVGA 2B0FA 3MH4A 2TBSA 1VITH 2VGCC 3TK9A 4XBCA 4KP0A 4NCYA 2R2WU 4E06H 4Q63A 3OY6U 5HXFA 2J5UA 1TABE 1BIOA 5FPYA 2OXSA 3SGBE 1MZAA 1BRAA 3SUFA 4JZDH 1V2TT 1RS0A 4Q2KA 5HIYA 3SNDA 1SKYE 5CHAB 2QF5A 1O2JA 3AK5A 1MU8B 2FESH 3UQOA 1O2TA 4FUHA 4I8LA 2XBWA 1V2JT 1O5DH 1MUEB 1C2GA 1ID5H 1DLKB 2BTCE 5EXMA 1FIZA 2NU1E 1BHXF 4BXWA 1MBMA 3M5MA 2BX3A 1SB1H 1UW7A 2V0BA 1O3AA 1INCA 1RTFB 1UO6A 4O3UA 1C5XB 3VGCB 3MU0A 1DVAH 3K65B 1H8IH 1XM1A 5DGJA 4UFFH 1G3CA 3I29A 5A8ZA 1K1MA 2CHAC 3LPRA 4INKA 2FOMB 3W95A 4B2CA 4BTTB 1C1PA 4DIHH 1BMNH 1GJAB 4RN6A 4GCHF 2G52A 4X6PA 2ZHDA 5C67A 3LGUA 4ISOA 3ZVAA 2ZDMA 1OKXA 2OLGA 4AORA 4WXVA 1XKBC 2CMYA 2XBVA 2G4UA 4ABJA 1MBQA 2F9BH 1F92A 2RA3A 2Z9GA 2OC8A 4MPXA 1DXPA 1O3BA 2AIQA 1O38A 4Y11E 2EI7A 3RXRA 1NY22 3S0NA 3SU3A 1TMTH 1GCTC 3DSGA 3QK1A 3L6PA 2ZHFH 4YLUA 2YOLA 1A4WH 1WQSA 2P8OC 1MTSA 1WXRA 3A83A 4E7NA 4X6MA 4M9FA 3A86A 3GY5A 1HJ9A 2VIVA 1O5EH 5EQQA 1J16A 2A45B 2ZDAH 5C20A 1F0RA 1DUEA 2P3UB 3S69A 2ZF0H 2Y81A 3EDXB 3RXKA 5H4IB 3E3TA 1JWTA 1K1JA 2ZCKP 1TBQH 4ZMAH 2J9NA 1Q31A 1J14A 3FANA 2GDDA 1MCTA 1OPHB 4MNVA 3OSYA 3MHWU 2XBXA 5DPAA 3S9BA 4X1NU 1A3EH 3O8CA 5F6MA 1UVTH 2GV7A 2BYAX 1NBMD 1PQ8A 5HM2A 3KQDA 2AEIH 3VPKA 1K1OA 3ENSB 1GMCF 1T8OA 3AAVA 1AI8H 3MOCA 4HTCH 1W7GH 2UUKB 1SGFA 1AB9C 2BZ6H 5C2ZA 4RKOB 1QFKH 2O8WA 4ZKSU 1OYTH 1P2JA 1EB1H 1JIRA 5GPIB 4JYVH 5TCCA 3SU0A 1NS3A 2LNCA 2FODA 3GCHB 2A5AA 1HJ8A 4ZAEA 1BTWA 3T62A 1A5GH 5L2YH 2P95A 4ABAA 2SGQE 3SZEA 5K0HA 2FDAA 2JKHA 4Y76A 3UR6A 3V13A 3SV6A 2BDYA 3PTNA 3SNAA 1UVUH 3PO1C 4FETA 4ABBA 2IPQX 3PLKA 3LGWA 1BTYA 1SQTA 3MNXA 1CVWH 3LGYA 5A2MH 4A1VA 3DSPA 3GY7A 1UK3A 1YM0A 5EPNA 2ZU3A 4ZUHA 3M7UA 3Q76A 1HLTH 1YP9A 5DP4A 4IN2A 3W1EA 2DE9A 2XTTB 1FAXA 2F9UA 2XBYA 2ZI2H 1FN8A 2EI6A 1UTPA 1L1JA 1V6DA 1ELTA 3M3SA 4DOQA 1XUKA 1FXYA 2HNTF 1W10U 1L1GA 1HAOH 2OUAA 2RCEA 3AVZA 1IQFA 1TWXB 2TIOA 1XX9A 3MYWA 1BJUA 4IMQA 1GBJA 3SV8A 5LPEA 1D4PB 1O3HA 3SHAH 4I7YH 5JBTA 1AHTH 1PFXC 2OINA 1UTQA 1ZPCA 1LPKB 2KCPA 2FOGA 3PRDA 4WMEA 1ANDA 5FAHA 1P03A 2CXVA 2GZ7A 3BTEE 1GMHF 4WVPE 3ELAH 4AYYB 1GBKA 2R9PA 3PYHA 2O8MA 1IQGA 3BTQE 1KXDA 2KM0A 3MU4A 8ESTE 3AW1A 2PGBB 3RXMA 4ABIA 1EFRD 4UFDH 1B0FA 2BQ7B 4FUCA 3A7ZA 1QNJA 1E0FD 2FYRA 3VXEH 1LQDB 1T8NA 2GT8A 3TITA 4K1SA 3UNQA 1C5WB 5A0AE 5C17A 4B76A 3PV2A 2CK3D 1QGFA 2IJOB 2ESTE 1MTNC 5FBEA 2Z3CA 2JJ1D 5F8ZA 1C1RA 1OWKA 3AW0A 3ZZBA 2P16A 1JOUB 2EA3A 1IQEA 3CENA 2STBE 1P10A 1GBTA 1DLEA 1AUJA 2P3TB 1AU8A 3AASA 3RXJA 2PGQB 1Y5BT 4RT1A 9LPRA 2BD4A 1EZQA 4CRBA 1PYTD 4E05H 5FCRA 4Q7ZA 1DY8A 8GCHF 3LIWA 1YPEH 4BAOB 1OSSA 3TH3H 1XVOA 3E91A 4HFPB 1Z8GA 4X2YA 1AFQC 1SC8U 1AWFH 2PKAA 3E0PB 3ZZCA 1V2LT 2J2UA 3E16B 1MD7A 4UEHH 1BOQA 3ZZ3A 4CREA 1X7AC 2EI8A 2KR7A 3OAAD 3TJUA 1S0QA 2FI4E 4BTIB 1O2NA 1YPJH 5IYTA 1IQIA 3ZVFA 1S83A 3TJOA 2HNTE 3MU5A 3RC4A 2BD9A 2AGIX 3SNCA 2I6SA 1ZOMA 3SN8A 2B8OH 4JK6A 2BY8X 4KTSA 1DXWA 1VITF 4Q7YA 1KLIH 3LONA 2O8TA 7ESTE 2PKAB 3V12A 2C3SA 3N7DA 1C2IA 1YBWA 4Y7AA 1DX5M 1Z1JA 4DT4A 1UTNA 2GZ8A 2UUFB 3QGNB 3ZYEA 1OP8A 3FKSD 2B5TB 1Z6JH 1LHCH 3D65E 4HGCA 2GMTB 4NG9H 4CRGA 1O32A 3LGVA 1NU7B 1O3MA 3O8BA 2H2ZA 1W14U 2BVRH 2DE8A 1K1PA 1O2UA 1V2WT 2GP9B 4BAKB 2VIWA 5GDSH 1FY8E 2HVYB 3LKWA 3R3GB 2DUCA 1ELEE 1FV9A 1ANCA 1AVXA 3P17H 3LJJA 3NUMA 2KCOA 3N99A 3TPIZ 2GT7A 1TRYA 5AFZH 1O31A 5C1XA 1F7ZA 1JIMA 1VGCB 1ESTA 1O2VA 3EYDA 2P3FH 1BMAA 3PMAB 2P94A 4TY7A 1Y3XA 3RXTA 1RTKA 3QTVH 2AMPA 3QO6A 5EW1H 4OS6A 2QXHA 1FI8A 1C5QA 3LC3A 2AFQB 2ASUB 1G2MA 4X8VH 4LOYH 4ISHH 3HATH 1HAYB 4CH8B 1B5GH 1GHBF 5T6FA 1O3GA 1KXBA 1MAXA 2B7DH 1QA7A 3U69H 3ZZDA 5KGOA 3RXBA 3S9AA 1PPCE 1IQLA 4Y8XA 1SGQE 1AY6H 1S81A 2WZQA 3ZVCA 3RXLA 1BTUA 1DS2E 2P93A 3ESTA 3KIDU 1LVOA 1O2SA 3MMGA 1GJ4H 1UCYK 1P2NA 3T29A 2OC0A 1EQ9A 2V7QD 5EJ1A 1DSTA 5C1UA 2RG3A 2Z9JA 2H1UA 3BN9A 1ZGVA 2VH0A 3TGIE 2HNTC 5C3NA 1NESE 1YYY1 3PB1E 4X1PU 3TK6A 4X6NA 2W7SA 2BX4A 4XRNA 3NK8A 2YMSD 2QYIA 4ASUD 2FLBH 3M7TA 3UQVA 1UHBA 1GMDG 2HOBA 1NT1A 4FVBA 3PWBA 3T28A 1ELFA 3BTDE 2BLOA 1UCYH 2XNDD 1DITH 1D6RA 2J4IA 2FM2A 4TYDA 1P12E 1SMFE 3M5OA 2R3UA 4FUGA 2A7CA 4H4FA 5EW2H 2GX4A 2OBOA 1EAWA 1C1WH 5CHBA 1HAVA 1SLVB 4JZEH 1CBWC 2BXUH 1MU6B 1LKAA 4IGDA 3CS7A 1V2UT 5EU8A 3VEQB 1WTHD 5GCHF 4FU8A 3WWBA 2WYGA 2PTCE 4ZXYH 4O03A 4KGAA 1Y3YA 1S6HA 1XVMA 1ETTH 1K9OE 3MNSA 2VGCB 1SOTA 4DVAU 1O3OA 3GS9A 1G9IE 4UE7H 2C8XB 1WOFA 1WSSH 4X2VA 3EGKH 2QAAA 5DJ7A 3FP6E 1RIWB 2W5EA 1GHAG 2W3KA 1NRPH 1UVOA 4NA8A 3PV4A 2XW9A 4CBOA 2BD3A 1TBZH 5FPSA 1HCGA 5LH8A 4O9VA 3LH3A 2WYJA 1DM4B 3T2NA 3GCTG 3E6PH 3BEIB 2PWXA 4X8SH 1HJAB 1TALA 1CT2E 1QY6A 2ZA5A 4X1QU 4U32A 3NCLA 5FXLA 1C1NA 1ZMJA 1ELAA 2ZGCA 3SV2H 2J98A 2VWOA 2SGAA 1KIGH 3GYMA 5A0BA 3UB0A 1ETSH 1GDQA 3SQEE 2WPIS 2CHAB 2AMDA 1P3CA 3PLPA 1CQQA 2BD2A 2BD8A 1NZQH 1QTFA 3GY8A 1K21H 4B1TA 3LGIA 3UWJH 1KMHB 4B6EA 4X6OA 4CBNA 1UK2A 3P95A 1YPKH 1TOCB 1HIAA 2F91A 1NM6A 5DP6A 4MLFB 3ZZAA 1ETRH 1ZRKA 1OWIA 4MPWA 1J15A 3OEED 4WH8A 5JBAS 1ZR0A 1TGNA 1QJ1B 1NRNH 1GL1A 3V0XA 1YKTA 1GCTB 5C1YA 1T8LA 3KN2A 3PWCA 1A3BH 4K8YA 1KXFA 1TPPA 3QWCH 1EAXA 3BTWE 1RXPA 3LC5A 3M3TA 2IJD1 1HPGA 4AFZA 4ESTE 1CHOG 1NFUA 1O5FH 2VIOA 5DN6D 1GVLA 1SOZA 3S9CA 1MAYA 2CF9H 1FJSA 1HIAB 5CMXH 1BRCE 4R8TB 1QRZA 3U1IB 1HAGE 4XFQA 3NRLA 4OS2A 2BY6X 1KXAA 3ZIAD 1RTLA 3MNCA 1TNKA 3TJNA 3ZZ9A 3LOXA 2HWLB 1A2CH 3SU1A 4RSPA 3BIUH 1E79D 2F9PA 1O2RA 2BM2A 2H5CA 1UTLM 4ACAA 2J92A 2O9QA 3ATIA 1SLXB 2ZDVH 4J2YB 1C2JA 5F03A 2ZTYA 4WWYA 1RFNA 1LDTT 1O2IA 1OP0A 3CP7A 1ELVA 1TYNA 3KL6A 3RM0H 3A8AA 4K60A 2XOKD 4CRAA 3C27B 4Z1MD 1ZMNA 4NIWA 4D7GA 5GXPA 4Y10E 3F9HA 3EQ0H 4NSYA 1J8AA 4OGXA 4ACBA 4A6LA 2Y7XA 1TPSA 1SGPE 2ZU2A 1Y8TA 2SGPE 1XUIA 2ZFPH 1DE7H 4UONA 2OC1A 3HKJB 4IBLH 4BOHA 1P9UA 2FOEA 3K9XB 4AOQA 1QB9A 3SO3A 2VVUA 1EXFA 1IAUA 1NO9H 3MTYA 1IQMA 3BEFB 1WBGB 1J9CH 3BG4C 3UOPA 1SGDE 1HUTH 1F0UA 2A7JA 1S6FA 1PPZA 2D26C 2Q6GA 4WF8A 4UDWH 3PMJA 1GI1A 1GI7B 2VB0A 4WMDA 3DUXH 5DKMA 2A2QH 3UY9A 2JETC 3RLYH 1Q3XA 3VB3A 5T6DA 1H9IE 1W0KD 2WPHS 1WAYB 3SNBA 1EAIA 1LHEH 4JMYA 4AZ2B 2FTMA 1FY5A 2ZFRH 1QIXB 3SORA 3HPTB 1BB0B 2LELA 2A2XH 1C5VA 1TIOA 4FU7A 2SNVA 5B6OA 2WUCA 2Z94A 2OC7A 3KCGH 3SBKA 1JMOH 4DG4A 5TCAA 1GI0A 1OWJA 1YLCA 1SPJA 3U9AH 4XBBA 1ZMLA 1EZSC 3D49H 2H9HA 1GGDC 2Q6DA 4MTBA 1XUGA 3C1KA 1D3QB 3QZQA 2HPPH 1ABIH 1O2KA 1QQUA 1EX3A 5E2PA 2FOAA 4K69A 4GCHG 4NGAH 1GJCB 2TGAA 2FP7B 2AMQA 1GHYH 5A09A 1SGRE 1P2KA 3RUOA 1ZYOA 2G8TA 2VIPA 2ANMH 2ZGXH 3KF2A 2PR3A 1AD8H 4ABFA 4NZQA 1N1LA 3F2GA 1QCPA 3UWIA 3FFGA 3RMNH 2GDEH 4MPUA 1HBTH 1C1SA 2FEQH 5A8XA 1TA2A 1BDAA 1YPGH 5ABWA 2WUBA 2HLCA 3BEUA 1EP6A 4INLA 1YCPK 2ANKH 3U8RH 2OTVA 4OS4A 1ZGIA 2CGAA 1MTNB 2QCYA 1OOKB 1TRMA 1UJ1A 5DP3A 5I46H 1D3DB 1BHXB 1ZTLA 4ZH8A 2NU0E 1C1MA 1HNEE 3EA8A 1W7XH 5CE1A 2J95A 3VG8A 1C2DA 4TWWA 2BLVA 5E0JA 3Q3KA 1NBME 4OM9A 2ZTZA 1VCQA 4HZHA 1PPEE 1QBNA 3BTME 4X2WA 1C5UA 1N8OB 1BBRE 1KDQB 3QGJA 2VJ1A 4FUJA 4AGKA 4B75A 2Z7FE 5LPFA 2ZWLH 1AGJA 5DP9A 3KQEA 4FUDA 3SJKA 1L4DA 4DIIH 1CGIE 1ARBA 5FX5A 1TQ0B 3GICB 1GVKB 2UWLA 1GMCG 1JBUH 1W8BH 4IMZA 3SV9A 2ZFQH 1V2ST 1TNHA 3TNSA 4K2YA 3N7OA 5EXLA 1VCWA 1C1VH 1L0ZA 3RXPA 7LPRA 1FY1A 1GDNA 2SNWA 3P8OA 1QA0A 2BY7X 4ISNA 1TNGA 1SGIB 1NTPA 1FN6A 4FOUC 4CH2B 3MO3A 4CRDA 2OQ5A 2FXRA 3NKKA 2G51A 1XKAC 1BJVA 1SFIA 2M2AA 2PW8H 2ALVA 1GBEA 1QJ7B 1KLTA 3T5FH 1TGCA 1LVYA 2FPZA 8KME2 2FS9A 1C5LH 3DSOA 1GHXH 1Y59T 3VGCC 1SLUB 3FP8E 1GBCA 2HVXA 1UMAH 4INHA 2BDAA 5JPMH 2LPRA 3ZV9A 1BMFD 5EOKA 3A82A 4AYVB 2M5TA 4AFUA 1C1QA 1O5CB 4PROA 2NU3E 1TBRH 4D7FA 1GDUA 2P59A 5SGAE 2CF8H 1CA0B 1THSH 3EAJA 2ZHQH 3GOVB 2Q6FA 1TGBA 4QT8C 1MTVA 2LP6A 2W7UA 1SGTA 4OGYA 1MTWA 2ZKSA 2QA9E 3PV5A 4YXWD 2W6JD 2WV9A 1LCYA 2A4OA 1HFDA 3A8CA 1QHRB 3FAOA 3O8RA 4AC9A 1BRUP 1G3DA 1OWHA 2L74A 3A84A 3TLOA 1PPHE 3S7KB 1DT2A 2A4GA 2L6OA 2VVVA 2UWOA 2Z9IA 3U1JB 1DDJA 2UUYA 4CR5A 2V3HH 3ZZ6A 3BF6H 5C5NA 1YLNA 1P06A 5ETXA 4IS5A 2BVXH 2PTNA 1DOJA 2A5KA 2D2DA 3MU8A 3K6ZA 1AVWA 4CRCA 1P57B 2SFAA 1GJ6A 4DT7B 1Y5AT 3ZVEA 1SLWB 2F9NA 4FU9A 4CRFA 1S82A 1WYKA 4IW4E 1UCYE 1GBAA 2KCYA 2ZPSA 1GBIA 3KNXA 3ATWA 1GCDA 3B9FH 4TT3D 1ELBA 5FPTA 3SJOA 4K1EA 4B74A 1O3IA 3P8NA 1K1LA 3MQKC 3Q3XA 2VIDA 4O97A 4ZHAA 4HI3A 1NC6A 2R0KA 1P2MA 2W26A 3G01A 6CHAC 1QBOA 2ODQA 4CHAC 4ISLA 1HRTH 1HAXB 1K22H 5F8TA 2VIQA 2BDGA 5GNDA 2GJGA 1MKXK 3GCNA 3GCHC 4A1TA 5J4QA 2ZCLP 1TGTA 1EPTA 2SGDE 1H8DH 3URCA 7GCHF 4HG6A 2C90B 4DURA 5DSFA 3ZVDA 3RU4D 2BY9X 3ZV8A 3RXVA 1O5BB 5EQSA 2ZIQH 4JZIA 4WXIA 1THRH 1XMNB 1PPGE 3WW7A 3P92A 3SJ9A 1BUIA 3IG6B 2Z9LA 1C4U2 3MO6A 5GIBA 5A0CA 2KX4A 4K5ZA 1TGSZ 1BA8B 1EPTB 3MFJA 1MKXH 4FUBA 1YY3A 1ZHPA 2V6NA 1DWCH 3F9FA 4I32A 4OS5A 3RC6A 3RMLH 1MQ5A 1VITG 3SZNA 1MABB 2BLWA 1K1NA 1AQ7A 4LZ4B 1Y3UA 2D8WA 4I8GA 1C4V2 3SQHE 3A7TA 1GBHA 3A7VA 3TJVA 2GCHG 3MH7A 1AMHA 4MNWA 1P2OA 4ZCNA 5JDUB 1E1QD 3RXAA 3ZVBA 1O3DA 3DHKH 3TK5A 3T25A 3SU4A 3LH1A 3I78A 1PPBH 3E8LA 3VFEA 1NU9A 1YPLH 2OQUA 4BANB 1FPCH 1K1IA 4GPGA 1TQ7B 1HXFH 1FX0B 3UNSA 1C1TA 1L1NA 3RXIA 1FNIA 4ABEA 1C5YB 1SFQB 4YTAA 1C5OH 1GJ5H 1EASA 1BCUH 1EP5A 1PYTC 1GG6B 1C5SA 1Z1IA 2OCVB 2SGEE 5EJZA 3BIVH 1G37A 3KEEA 1WV7H 1DWDH 1SI5H 1V2OT 4Q4LA 4UFGH 5AF9H 5KEDA 2AIPA 3IWMA 2ZPRA 1O3PB 2VU8E 3A89A 5L30H 4WY3A 4DGJA 4BXSA 3SNEA 4X1SU 2ODPA 3O8DA 1GHBG 2BD7A 2GCTB 1UVPA 1S6LA 3W94A 2JJ2D 2XC0A 1WTGH 4YZUA 4I8JA 2QF0A 1GMDF 1T32A 3KQBA 4X1RU 1O2HA 4Y0YE 2FO9A 1T7CA 3STIA 1NPMA 2BZAA 2BOKA 1A0JA 2BD5A 2F9OA 1ORFA 1YPHE 2EC9H 1C9TA 2PKSB 4FUEA 5HM9A 3DD2H 3GDUA 3VB5A 1OP2A 2A7HA 1D3PB 1SL3A 4JYTA 2OBQA 3RXSA 5J4SA 1KYNA 3WWFA 5TJXA 3QLPH 3VB6A 3M37A 5PTPA 3RXDA 4TWYA 1E34B 3DFJA 2ZEBA 2UUJB 4LXBH 4D9QA 1P8VC 1O5AB 2JH6D 3MO9A 3H5CB 5T6GA 4A5TS 1TMUH 3ITIA 1GWAA 1VKYA 2V3OH 2R2MB 2QF4A 4VGCB 3T27A 1V2KT 4H42U 3DT0H 1C2MA 1GI4A 3M3VA 4F55A 3QUMP 4LZ1H 1Q2WA 4NFEA 1K2I1 1TRNA 4BAQB 5HIZA 2WPMS 1HDTH 1P11E 1S85A 1SQAA 2ZG0H 3FZDA 4MNYA 1FMGA 3HGPA 1EB2A 2FX6A 2H5DA 2OP9A 4Y71A 1AKSA 4I8HA 2PFEA 1GI6A 4WH6A 1ZJKA 1C1OA 4Y6DA 5JYIA 1MMJN 1SGEE 3F0PA 3URDA 1VR1H 1Y3VA 3GCTF 2ILNA 1SGCA 2VH6A 3MI4A 4RI0A 5GCHG 1T4VH 2A1DB 1ZRBA 4XOJA 1GPZA 2VNTA 3GISB 1WU1A 4AB8A 4MG3A 2QXIA 3FO8D 3FVFB 1MKWK 4YOGA 1O30A 1XUFA 2AGEX 1NRSH 4BAHB 5HMAA 3AAUA 1F5LA 3U8TH 1FLEE 1BZXE 4H6TA 3UREA 5LGOA 1UTOA 1AKSB 2ZQ2A 1TNJA 1FDPA 4FVDA 2K1QA 1IQKA 1XUJA 1BRBE 1MZDA 3FP7E 3SGAE 1O3KA 4AN7A 3F68H 2Y6TA 4DCDA 5CDFE 3OX7U 6GCHF 3A7WA 1OS8A 2G5NA 4TPIZ 4YM9A 1K28D 4F48B 1W11U 2TPIZ 3ODDA 4Z0KA 1NFXA 3A87A 1YPHC 1C5ZB 1P3EA 3HGNA 4AFSA 1NRQH 1MKWH 1OWDA 4RKJB 2HALA 2QGRA 3FOAA 4RT0A 4P00A 1H8ED 2ZGBH 1H9LB 2YMSC 1HV7A 1SGYE 1UK4A 1ZZZA 2QE7D 1QRXA 4MDSA 4AG2A 2ZGJA 4J1YA 2QY0B 1GGDB 3MNBA 2C8YB 3EE0B 1E37B 2A31A 2P8OB 4AB9A 4NSVA 1TONA 1C2HA 2KFWA 5IDKA 2ZU5A 2HGTH 4NIYA 2Y7ZA 3SUEA 3F9EA 3QX5H 5KECA 2J94A 1O3JA 5FL7D 4NWLA 1CSOE 1A5HA 3HK3B 2Y80A 3P8FA 3N7EA 2RA0A 3LDXH 2BDHA 4NIVA 4E7RG 2BQ6B 3F1SB 4Y0ZE 3EA7A 2F3CE 2HPQH 2A5IA 5AFYH 4AGJA 3DA9B 1OXGA 1FPHH 5FX6A 3UIRA 3SU2A 1SR5C 1GI9B 1QZ8A 2GV6A 4B2BA 1AIXH 1TA6A 2ZDKA 1W0ZU 2PUXB 2Q1JA 5DP8A 3BTGE 3H7OA 4ZKNU 1NRRH 3UNRA 1PQ5A 1O0DH 3MH6A 1PQAA 2WPDD 1Z8IB 1AN1E 6ESTA 1G3EA 5IK2D 2R3YA 2VVCA 1AB9B 1CA8B 1G30B 4I31A 2QIQA 1T4UH 1A1RA 2QN5T 1F5RA 3FN8A 2VINA 5C94A 1MD8A 1GBMA 1CHGA 2ZFSA 3MWIU 3EE7A 3HKIB 3DFLA 3U98H 1AO5A 2A4QA
chains in the Genus database with same CATH topology
1ZPZA 1V2PT 1KY9A 1GBDA 4F49A 4UD9H 2AS9A 1GI3A 1QL8A 1FIWA 4YOIA 2XNIA 1O2WA 1YF4A 3P70B 1F2SE 1O2YA 1P09A 4DY7B 1DPOA 3OY5U 3SI4H 2PSXA 2STAE 1KSNA 1V3XA 1O34A 1RGQA 4D9RA 1ARCA 1RIWC 2FX4A 3PO1B 1KXEA 1MQ6A 4AFQA 2XC5A 1SVPA 3RXOA 1C5TA 4X0WU 2H9TH 4JYUH 3MH5A 5DG6A 1A46H 5ESBA 2WV5A 1HAPH 2G5VA 2YNAA 1GJBB 1HJAC 4WJG2 1J17T 1WCZA 4KTCA 5L2ZH 2PHBA 1YGCH 5AHGH 1S84A 1MTUA 1LTOA 3PLBA 1T31A 2TGPZ 3BTKE 1AE8H 4NA7A 5GWZA 4MPVA 1ZHMA 1G36A 4NZLA 3SUGA 2IPHA 3B8JA 2H6MA 3M35A 4ISIH 1GBLA 4OS1A 1GJDB 2ZP0H 1TX8A 3UFAA 4GAWA 3F6UH 1L2EA 2XWBI 3GY2A 1JRTA 1W2KH 3P8GA 1L4ZA 1RJXB 3GCOA 3M5LA 1C1UH 1OWEA 1UTKA 1CGJE 1ESAA 3P6ZB 2GKVE 1CO7E 1IQHA 2GGVB 3ZZ7A 5A8YA 2O8UA 3RXFA 2BQWB 4JZ1A 2XWAA 5DP5A 2VWMA 1LVMA 1AVGH 1KDQA 3V7TA 2IOTA 3TVJB 1EOJA 1V2VT 1QB1A 4TPYA 3U8OH 1IHSH 3PMBB 3OU0A 6LPRA 2TRMA 3LU9B 4ZHLU 5E0GA 1FZZA 5G4BA 5JB9S 1TB6H 1OYQA 2ZQ1A 4FXGH 3SV7A 1ZJDA 4IC5A 5GJ4B 4U2WA 3TH2H 2SGFE 1SGFG 1F5KU 1O3CA 1KXCA 1O2ZA 4CR9A 1P01A 1ELCA 2ZCHP 1D9IA 2YNBA 3JZ1B 1DFPA 2QC2A 5E2OA 1IOEA 1THPB 1A5IA 3RXHA 1C5RA 2ZDLA 3TGKE 1ZTJA 3A7XA 1YCPH 2HRVA 1AFQB 2A32A 4Y8ZA 5BRRE 6CHAB 4CHAB 5EQRA 2ALPA 2XCFA 1XXDA 5FBIA 5EG4A 2PUQH 4ZKOU 1P9SA 1FY3A 1ZTKA 4ZROA 4MNXA 4K3JA 4GUXA 4KELA 1JXPA 5CHAC 2ZPQA 1CGHA 1HAIH 1EKBB 3SJ8A 2GD4B 4B73A 2XXLA 2ZHWH 2R0LA 3GYLB 1C2EA 5EODA 2FOFA 1UTJA 2Y5HA 2AERH 3SU5A 2BB4A 2FZZA 1QRWA 1Y5UT 1AZ8A 1FAKH 1HYLA 4NWKA 3RXQA 2CN0H 2JH0D 3RU4T 2G00A 1TLDA 2WPLS 2ZDNA 4THNH 3VXFH 4ASHA 1W3CA 4Z6AH 1FUJA 1EJNA 2C4FH 1DANH 1GBBA 2BLQA 4U30A 5BPEA 2BOHB 3MU1A 2FMJA 1ESBA 5C5OA 3PM3A 3GY4A 2AH4X 2GVFA 1C5PA 1E36B 1GI8B 1B7XB 3E1XB 2TGTA 1O39A 1O33A 2VWNA 1Z7KA 4DJZB 3ATMA 1YCPM 1UVSH 2OD3B 1C5MD 1BTPA 3RMOH 5AVDA 2WV4A 4IC6A 3PMHB 1QL9A 3GY3A 4D8NA 7KMEH 3OYPA 4F4OC 3GDSA 1TFXA 4GSOA 4X8TH 1EUFA 3BTTE 1O3FA 3A7YA 3Q00A 1GMHG 3NPSA 1QQ4A 1V2MT 1BTXA 1O37A 1TX6A 1ZSKA 1O2QA 4I8KA 2FWWA 1IQNA 1BMLA 2FOHA 3M7QA 1CT4E 1ABJH 2ZU4A 2UWPA 2FIRH 3RM2H 2F83A 5JB8S 3SI3H 1AFEH 3M36A 3BTHE 1E35B 1LQEA 4Y8YA 5L6NH 2J34A 1PQ7A 3ZZ5A 4U01A 1FY4A 4WMFA 4YT6H 2PSYA 4I33A 2BVSH 4Q7XA 3SU6A 3K6YA 3TGJE 1EAUA 1C2FA 1O36A 2C8ZB 1G32B 3A80A 3Q3YA 1C2KA 4KTUA 4K1TA 3SW2B 5HGGA 4A92A 4DW2U 3CS0A 1BBRK 1N8OC 4XDEA 1H9HE 4H6SB 1A0HB 3RXCA 1GJ7B 1IHTH 1O2LA 8GCHG 3FZZA 4OS7A 1ZSLA 1EATA 4YO9A 3OTJE 1EJMA 2QXGA 3RXUA 3VB7A 2ZFFH 1QL7A 4GLYA 1KTSB 4MVNA 3QTOH 2ZO3H 1QJ6B 3L33A 1PJPA 2XC4A 1W0YH 3A88A 1O35A 2IN2A 1E38B 1O5GH 4FUFA 2FYQA 2C8WB 2FOBA 3RU4E 1ELDE 1Z8RA 4ABHA 1WUNH 1CBWB 4ABDA 2ZTXA 5LPRA 3BTFE 1FONA 2G4TA 2THFB 1BBRH 2QF3A 1EOLA 4AX9H 1EJAA 3L3TA 7GCHG 2BDCA 1SQOA 5ESTE 1TMBH 3A8BA 2AGGX 3GY6A 4ABGA 1U6QA 1VJ9U 5I25A 1VZQH 1C5NH 2KAIA 1H1BA 4MQAA 4GHTA 3GDVA 1BTHH 1LMWB 1RRKA 1F0SA 2GCHF 5HYOA 1GI5A 1HB0B 4M7GA 2GTBA 1H4WA 1O2OA 1W12U 3PROA 3KQCA 3NXPA 2F9VA 1LPZB 4YT7H 1GJ9B 3ATLA 4BNRA 1KTTB 1C2LA 1NN6A 1V2RT 4K8BA 2WINI 3ZZ8A 1LHFH 1F0TA 1AUTC 3RDZA 1D6WA 1P04A 1YPMH 2ANYA 1YLDA 2A0QB 2NU2E 3RLWH 5K7RA 2RDLA 3RMMH 3SOSA 5JBCS 1TNIA 2AYWA 1CA0C 1B0EA 1TPAE 2KAIB 2O8LA 1OX1A 2V35A 3I77A 1T8MA 1JRSA 2BXTH 2WPKS 1DSUA 3V3MA 1LKBA 1AE5A 1CE5A 1MCVA 1O3NA 3H7TA 1TNLA 4ZKRU 3STJA 5EPYA 1SSXA 1LHGH 1VCPA 4AG1A 1A61H 1CT0E 3ZZ4A 1HXEH 2ZU1A 4XBDA 4NA9H 2FOCA 4UFEH 1C4Y2 2XYAA 4NFFA 1HGTH 3LJOA 1SHHB 1ELGA 4FUIA 9ESTA 3E90B 1P2QA 3UPEA 2ZZUH 4JCNA 1XUHA 1ZHRA 3A85A 3QZRA 1WQVH 1QURH 4YLQH 3LT3A 1DWBH 2FS8A 1GI2A 3VB4A 2Z3EA 1RD3B 1ZPBA 1LHDH 2D1JA 3NZIA 2J38A 1BT7A 2FLRH 2Y5GA 3BG8A 1GHVH 1GJ8B 1Z6EA 3RC5A 2Z6BD 2ZNKH 3QDZB 4SGAE 2G81E 1C9PA 2I6QA 1G3BA 1TE0A 4ZXXH 3KHVA 1V2NT 1D3TB 2ZECA 4A1XA 3RP2A 2PLXA 2Z9KA 1LVBA 2NU4E 3ATKA 2NWNA 2PV9B 1S0RA 4Y79A 3QN7A 1AWHB 2BDIA 5T3HA 1PPFE 4JZFH 1DUAA 1P0SH 1SHYA 4B71A 1GHAF 4YESB 1UHBB 3SUDA 3K2UA 2G55A 3SHCH 4YOJA 3TU7H 3ZYDA 3PTBA 1MH0A 4XE4A 1QBVH 2GMTC 3B23B 1NROH 2EEKA 2FI3E 1EPTC 2XCNA 4NIXA 2BMGB 3TH4H 3HK6B 4D76A 1DY9A 2CV3A 1EZXC 1VJAU 3SJIA 4X8UH 3UTUH 3Q77A 4B2AA 1S5SA 3M5NA 2BDBA 4R0IA 3BSQA 3BG4B 4SGBE 2BHGA 4KKDA 1GVZA 2ZGHA 1HAVB 1GL0E 1SGNE 1O2MA 1QR3E 3ODFA 3TNTA 1VGCC 4BTUB 1O2XA 1P05A 2ZFTA 3UUZA 2JETB 1P02A 5EGMA 1ACBE 2JH5D 2ANWA 4GVUA 3IITA 1GHWH 3T26A 1QB6A 2A4RA 1O3LA 1A0LA 1GHZA 1O3EA 4JK5A 4LK4A 3BV9B 1P2IA 3UOUA 2B9LA 1W13U 4A7IB 3NWUA 1N6XA 5FHTA 1A7SA 3D23A 3M61U 1HAHH 3R0FA 3UR9A 4ZHMU 1V2QT 4X2XA 5F8XA 1GG6C 1M9UA 2ZHEH 3RXGA 1Y3WA 2ZC9H 3S7HB 6GCHG 5DO4H 1EZUC 1ZLRA 1CHOF 2VWLA 1CU1A 1KLJH 2BY5X 4Y7BA 1Z8JB 5JBBS 5DP7A 3E0NB 1ANBA 2FI5E 1LPGB 1AZZA 2FTLE 2GCTC 1DWEH 2W3IA 1TX7A 5EXNA 3LGTA 2XRCA 2CJIA 4IN1A 4BAMB 1O2PA 1TPOA 1BITA 4Q80A 2ULLA 3TIUA 1G2LA 1GBFA 1LO6A 1NFYA 1O2GH 2PKSC 2GZ9A 1FQ3A 3F9GA 8LPRA 2QXJA 1Z71A 2TGDA 1BQYA 5E0HA 2Y5FA 3KGPA 4XSKU 4GHQA 5FCKA 2Y82A 5E8EH 1BMMH 1TAWA 1N6YA 3WY8A 5DK1A 3A8DA 2ODYB 4TY6A 1YC0A 1ANEA 2H9EH 1DICA 3A81A 4O3TA 1TOMH 2QV1A 2C93B 2WPJS 1XXFA 1NFWA 2Z3DA 4VGCC 1ZSJA 1HAZB 1IQJA 1BTZA 1SBWA 1UTMA 3SGQE 3D62A 1SG8B 3RXEA 3EA9A 3JZ2B 3ZVGA 2B0FA 3MH4A 2TBSA 1VITH 2VGCC 3TK9A 4XBCA 4KP0A 4NCYA 2R2WU 4E06H 3OY6U 5HXFA 1TABE 1BIOA 5FPYA 2OXSA 3SGBE 1MZAA 1BRAA 3SUFA 4JZDH 1V2TT 1RS0A 4Q2KA 3SNDA 5CHAB 1O2JA 1MU8B 2FESH 3UQOA 1O2TA 4FUHA 4I8LA 2XBWA 1V2JT 1O5DH 1MUEB 1C2GA 1ID5H 1DLKB 2BTCE 5EXMA 1FIZA 2NU1E 1BHXF 4BXWA 1MBMA 3M5MA 2BX3A 1SB1H 2V0BA 1O3AA 1INCA 1RTFB 1UO6A 4O3UA 1C5XB 3VGCB 3MU0A 1DVAH 3K65B 1H8IH 1XM1A 5DGJA 4UFFH 1G3CA 3I29A 5A8ZA 1K1MA 2CHAC 3LPRA 4INKA 2FOMB 3W95A 4B2CA 4BTTB 1C1PA 4DIHH 1BMNH 1GJAB 4RN6A 4GCHF 2G52A 4X6PA 2ZHDA 5C67A 3LGUA 4ISOA 3ZVAA 2ZDMA 1OKXA 2OLGA 4AORA 4WXVA 1XKBC 2CMYA 2XBVA 2G4UA 4ABJA 1MBQA 2F9BH 1F92A 2RA3A 2Z9GA 2OC8A 4MPXA 1DXPA 1O3BA 2AIQA 1O38A 4Y11E 2EI7A 3RXRA 1NY22 3S0NA 3SU3A 1TMTH 1GCTC 3QK1A 3L6PA 2ZHFH 4YLUA 2YOLA 1A4WH 1WQSA 2P8OC 1MTSA 3A83A 4E7NA 4X6MA 3A86A 3GY5A 1HJ9A 2VIVA 1O5EH 5EQQA 1J16A 2A45B 2ZDAH 5C20A 1F0RA 1DUEA 2P3UB 3S69A 2ZF0H 2Y81A 3EDXB 3RXKA 5H4IB 3E3TA 1JWTA 1K1JA 2ZCKP 1TBQH 4ZMAH 2J9NA 1Q31A 1J14A 3FANA 2GDDA 1MCTA 1OPHB 4MNVA 3OSYA 3MHWU 2XBXA 5DPAA 3S9BA 4X1NU 1A3EH 3O8CA 5F6MA 1UVTH 2GV7A 2BYAX 1PQ8A 5HM2A 3KQDA 2AEIH 3VPKA 1K1OA 3ENSB 1GMCF 1T8OA 3AAVA 1AI8H 3MOCA 4HTCH 1W7GH 2UUKB 1SGFA 1AB9C 2BZ6H 5C2ZA 4RKOB 1QFKH 2O8WA 4ZKSU 1OYTH 1P2JA 1EB1H 1JIRA 5GPIB 4JYVH 5TCCA 3SU0A 1NS3A 2LNCA 2FODA 3GCHB 2A5AA 1HJ8A 4ZAEA 1BTWA 3T62A 1A5GH 5L2YH 2P95A 4ABAA 2SGQE 5K0HA 2FDAA 2JKHA 4Y76A 3UR6A 3V13A 3SV6A 2BDYA 3PTNA 3SNAA 1UVUH 3PO1C 4ABBA 3PLKA 3LGWA 1BTYA 1SQTA 3MNXA 1CVWH 3LGYA 5A2MH 4A1VA 3GY7A 1UK3A 1YM0A 5EPNA 2ZU3A 4ZUHA 3M7UA 3Q76A 1HLTH 1YP9A 5DP4A 4IN2A 2DE9A 2XTTB 1FAXA 2F9UA 2XBYA 2ZI2H 1FN8A 2EI6A 1UTPA 1L1JA 1V6DA 1ELTA 3M3SA 4DOQA 1XUKA 1FXYA 2HNTF 1W10U 1L1GA 1HAOH 2OUAA 2RCEA 3AVZA 1IQFA 1TWXB 2TIOA 1XX9A 3MYWA 1BJUA 4IMQA 1GBJA 3SV8A 5LPEA 1D4PB 1O3HA 3SHAH 4I7YH 5JBTA 1AHTH 1PFXC 2OINA 1UTQA 1ZPCA 1LPKB 2FOGA 4WMEA 1ANDA 5FAHA 1P03A 2CXVA 2GZ7A 3BTEE 1GMHF 4WVPE 3ELAH 4AYYB 1GBKA 2R9PA 3PYHA 2O8MA 1IQGA 3BTQE 1KXDA 3MU4A 8ESTE 3AW1A 2PGBB 3RXMA 4ABIA 4UFDH 1B0FA 2BQ7B 4FUCA 3A7ZA 1QNJA 1E0FD 2FYRA 3VXEH 1LQDB 1T8NA 2GT8A 3TITA 4K1SA 3UNQA 1C5WB 5A0AE 4B76A 1QGFA 2IJOB 2ESTE 1MTNC 5FBEA 2Z3CA 5F8ZA 1C1RA 1OWKA 3AW0A 3ZZBA 2P16A 1JOUB 2EA3A 1IQEA 3CENA 2STBE 1P10A 1GBTA 1DLEA 1AUJA 2P3TB 1AU8A 3AASA 3RXJA 2PGQB 1Y5BT 9LPRA 2BD4A 1EZQA 4CRBA 1PYTD 4E05H 5FCRA 4Q7ZA 1DY8A 8GCHF 3LIWA 1YPEH 4BAOB 1OSSA 3TH3H 1XVOA 3E91A 4HFPB 1Z8GA 4X2YA 1AFQC 1SC8U 1AWFH 2PKAA 3E0PB 3ZZCA 1V2LT 2J2UA 3E16B 1MD7A 4UEHH 1BOQA 3ZZ3A 4CREA 1X7AC 2EI8A 3TJUA 1S0QA 2FI4E 4BTIB 1O2NA 1YPJH 5IYTA 1IQIA 3ZVFA 1S83A 3TJOA 2HNTE 3MU5A 3RC4A 2BD9A 2AGIX 3SNCA 2I6SA 1ZOMA 3SN8A 2B8OH 4JK6A 2BY8X 4KTSA 1DXWA 1VITF 4Q7YA 1KLIH 3LONA 2O8TA 7ESTE 2PKAB 3V12A 2C3SA 1C2IA 1YBWA 4Y7AA 1DX5M 1Z1JA 1UTNA 2GZ8A 2UUFB 3QGNB 3ZYEA 1OP8A 2B5TB 1Z6JH 1LHCH 3D65E 4HGCA 2GMTB 4NG9H 4CRGA 1O32A 3LGVA 1NU7B