1HB0B

Snapshots of serine protease catalysis: (d) acyl-enzyme intermediate between porcine pancreatic elastase and human beta-casomorphin-7 jumped to ph 10 for 2 minutes
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILRNNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Snapshots of Serine Protease Catalysis Reveal a Tetrahedral Intermediate
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords ELASTASE 1
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2001-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hb0B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hb0B01
1N6YA 2ZO3H 2A4QA 1GMDG 3S0NA 3CP7A 2ZECA 2A31A 1C5NH 4FU8A 2BOHB 2UUJB 3NKKA 1ZTLA 2VINA 4QT8C 2QF0A 1F0TA 1O2NA 1OP8A 1KLIH 4B74A 1AGJA 2WV4A 3GCNA 1FZZA 1O38A 4YLQH 1P11E 3SGBE 4XBBA 1O3IA 2BXTH 2VVVA 2ZCKP 4UFEH 1W0YH 1F0RA 3MU1A 2OCVB 2ZHDA 1THSH 4OGXA 1TPSA 1A5IA 1Z6EA 1TABE 3TU7H 2ZP0H 4Y7AA 3MH5A 4MPXA 3FP8E 2ZDMA 5A8YA 2Z3DA 5FHTA 3MU0A 4MQAA 8GCHF 1C2DA 1TA2A 2FESH 1YPJH 4HGCA 1TYNA 4Q80A 3ZZ7A 1XM1A 2BVRH 1TB6H 4K3JA 5GIBA 1HIAB 2J34A 1HDTH 4BTIB 1QA0A 1DPOA 1IOEA 4WVPE 1QRXA 4CREA 3A7TA 2UWLA 2WPIS 1TRNA 1IQLA 3BEFB 1O2SA 2Y5FA 2V3OH 2VWNA 1Y5UT 1PPCE 3M36A 1B7XB 1O3OA 5C5NA 1O37A 1XUHA 2QCYA 4KP0A 3SJIA 3VB6A 1AD8H 1EP6A 4NA7A 5LPEA 2HPQH 2WPMS 1MTNC 1GI2A 3TGJE 2GT8A 2B0FA 2QYIA 1MU6B 1HBTH 1HAGE 4YO9A 1G2MA 2D26C 4IBLH 2BOKA 1WU1A 5EGMA 1AB9C 4GUXA 3S69A 1V2JT 3SV7A 1LQDB 4NG9H 2H2ZA 1V2VT 4KELA 4B76A 4NIWA 3VXEH 1GJ8B 3GICB 3LOXA 1NN6A 3SU0A 1BOQA 1K1MA 3OU0A 3IG6B 3ATIA 3AW1A 1C5MD 4U2WA 2VIOA 3ZYEA 1ABIH 3Q3XA 3NZIA 2R9PA 1ID5H 1F5RA 2WPKS 2LPRA 2CHAC 5T6DA 2EA3A 4FU7A 3U98H 4MDSA 3UQVA 1V2ST 2J4IA 1YPEH 2XWAA 3AASA 3SJKA 3UNQA 3PLBA 3GOVB 5DJ7A 1INCA 2GCHG 1WV7H 1FPCH 1BBRE 3V7TA 1DXWA 3NWUA 2IPHA 3GCOA 4AN7A 2FPZA 3MH7A 4K8BA 1CE5A 4YT7H 4IGDA 1LDTT 1GHBF 1SGNE 1OWHA 1SGIB 4D9RA 2ZPSA 1DDJA 1UK3A 4WF8A 2XCFA 1EZQA 1P06A 1T8OA 2H9HA 4CRCA 4DGJA 2GVFA 4CHAB 1F2SE 1H9LB 2PW8H 2ZKSA 3RXQA 4O3UA 2OBOA 3GY2A 4ZMAH 1O2KA 1D3PB 2YNBA 3RXSA 1MTWA 5FPYA 4AGJA 4WMFA 1BJVA 4D9QA 1BRUP 1NU7B 4Q7XA 3PMBB 1TALA 2B9LA 3ZZ3A 5F8TA 2TGTA 5T6FA 2F9VA 4FXGH 1QQUA 2ODPA 1JIMA 4F49A 1C1QA 4Q7YA 1NO9H 4H4FA 5GJ4B 2GV7A 1C5RA 2V6NA 3L6PA 2BD9A 5HMAA 1SGFG 3PLKA 2K1QA 2JETC 2HNTC 1UTPA 2ALVA 2BDAA 1TRYA 4KGAA 2Z7FE 3MH6A 3ODFA 2W3KA 3RMMH 1DE7H 2PUXB 5DKMA 4K2YA 2WYGA 4B2BA 5C1UA 3RC5A 1UHBB 3KQEA 3RXLA 1W0ZU 3STIA 1GVKB 5BRRE 1N8OB 3E1XB 3D49H 1A4WH 1A46H 4OGYA 1EKBB 3EAJA 4ABJA 1H1BA 3UFAA 1G30B 2PFEA 4WWYA 2A32A 4K69A 1SGCA 1BTPA 1O2YA 1O2WA 1P3CA 1GWAA 5E0HA 2J94A 1DLEA 5ABWA 3TVJB 3GISB 3PLPA 1IAUA 3T29A 1QRWA 5EQQA 3M7UA 4YZUA 1J17T 5C2ZA 3PWCA 1LQEA 2Z9JA 1DSTA 1EPTC 5AHGH 1L4ZA 1HAXB 3A80A 3ZVGA 2O8LA 1V2LT 2P3TB 2FTMA 1H8DH 4ZKNU 5DP4A 1GJBB 2AIQA 2FOHA 3IITA 1DFPA 1C1RA 3OSYA 2AH4X 3BF6H 4TWYA 1QTFA 2FOEA 1RGQA 1S0RA 1KTSB 4NA9H 4FUGA 2VB0A 1BA8B 4XDEA 3R0FA 2Z9LA 4BANB 2F9BH 2H5DA 1DVAH 1IHSH 1TOMH 1XMNB 2P95A 3A86A 4E7RG 1O2HA 3Q76A 1SR5C 2QC2A 1P2NA 2A5KA 4GHTA 3E90B 4DG4A 3SQHE 3S9AA 1ABJH 1GJ4H 4X6PA 1O3MA 5AF9H 2CHAB 1FDPA 3A89A 1C1MA 2C8WB 4NGAH 2ZGXH 1O2RA 1LKAA 1Z1IA 3ELAH 2G51A 1GI1A 2FEQH 1A1RA 3QLPH 1ZGIA 2EI6A 3RXDA 4MNXA 3C1KA 4AB9A 3DA9B 1CBWC 1ZMLA 5C20A 2BDIA 1LTOA 5DP8A 3QO6A 4NA8A 1TBQH 1O3HA 2ZPQA 1DY9A 3BTQE 3PMJA 1O32A 2A4RA 2BD2A 1JXPA 2BLQA 2TIOA 4ISHH 2BTCE 1C2JA 3TGKE 4I32A 3UREA 5K0HA 2G5NA 4ISIH 2WYJA 2GV6A 2Y82A 1C5OH 1RTLA 2HLCA 3N7OA 1TGTA 1C5TA 3BG4C 2ZU1A 1UTNA 3H7TA 1L2EA 1QL8A 3RMNH 3TJVA 3RU4E 1CT4E 2PV9B 1W3CA 1TA6A 1YKTA 1Z1JA 3MH4A 2A5IA 3QGJA 3PB1E 5E0JA 2FLBH 1ACBE 1T31A 2R2WU 1GVLA 2PSYA 4ZH8A 3ENSB 3TH4H 1P12E 3MU4A 1BMLA 1FJSA 1W11U 1GHYH 1FIZA 2NU2E 4ZHLU 1NRRH 1SQAA 5A8ZA 1P03A 1G32B 2TGAA 3MNCA 4X1QU 1F5LA 2AFQB 2BX4A 1DX5M 1DXPA 2CF8H 1AI8H 4AYYB 3RXVA 3F68H 1AWFH 1MTNB 1C5XB 1S82A 1C5LH 1TIOA 1YLCA 1FXYA 1TFXA 7ESTE 2BD5A 4DIHH 1O3FA 2P93A 1GMDF 4IS5A 3ZVCA 1SB1H 1S85A 1D6RA 4PROA 1B0EA 2OBQA 1AKSA 1SLUB 1HV7A 5A8XA 4UFGH 4NWKA 1C5PA 1GBMA 3SBKA 1C1WH 4D76A 4RN6A 3GDSA 4BOHA 3PO1C 5G4BA 3SNAA 2UUKB 5DP5A 1ELAA 3SZNA 1THRH 4JZEH 1ZPCA 3URDA 1V2RT 3URCA 1QJ6B 2ZI2H 6GCHG 3QDZB 2ZGCA 1GBJA 3TLOA 3LGTA 1E35B 1JRSA 3ZYDA 5J4SA 3M5NA 1GJ9B 3CS7A 5DG6A 1O2PA 1GJ7B 1GBCA 4O9VA 2UUFB 2C8XB 4B2CA 3M5LA 2FP7B 1SGPE 1C1UH 1GI8B 5PTPA 1YF4A 3Q3KA 1DUAA 4U01A 2BLOA 4AOQA 3ZVAA 1Z7KA 2ANMH 1KXCA 4YM9A 3RLYH 1NPMA 3F9EA 1YYY1 3QTOH 2ZDNA 3F9HA 1O3LA 4ZKSU 5LH8A 1BZXE 2AEIH 5CE1A 5C1YA 1BTUA 1EJAA 3LONA 1GBBA 1SG8B 1LCYA 4OS6A 5TCAA 3LH3A 4ABFA 2ODQA 1VCQA 1C5ZB 4R8TB 4FVBA 2A0QB 3I29A 2R3UA 4WJG2 1TWXB 2A7JA 1C2LA 1O2QA 2G8TA 5ETXA 9LPRA 3B9FH 4A1VA 4FUDA 1BBRH 1YPMH 1AVWA 1P2MA 5DP7A 2NU0E 3E16B 1AVXA 1GL1A 1EP5A 4MG3A 1ELDE 3BTGE 2FLRH 2B5TB 3K6YA 1O2OA 1U6QA 4OS5A 1Y3UA 2CXVA 1NRNH 2HNTE 3Q00A 1C2FA 2ZU3A 4LOYH 3KIDU 2FS8A 1RJXB 2Q6GA 1O5AB 4FUIA 1O5BB 3T2NA 1F0SA 1GMHF 3UOUA 2BQ7B 1BRBE 1OWIA 3RXJA 1VGCC 1BDAA 1ZYOA 1QFKH 3ATMA 1LVOA 1OP2A 3BN9A 3W94A 3C27B 4SGBE 2SNVA 2WUBA 3UWIA 3BSQA 4B1TA 1FY8E 1UTOA 2Q6DA 2FS9A 1FUJA 3SNCA 1F0UA 2FODA 5E2PA 3LGVA 2QXJA 8LPRA 3A81A 2WPLS 3TJNA 1JOUB 5F03A 4FUBA 2C93B 2HOBA 1K2I1 4FU9A 4XBCA 2NWNA 1YPHE 2GCTC 1TONA 5FX5A 3O8BA 1TMTH 1XUIA 3PM3A 3SU4A 3MMGA 1K21H 2WPHS 1Y5BT 1C4Y2 1ELCA 1O3NA 1ZMJA 5C67A 3BEUA 1K1IA 3T27A 5A0CA 4Q7ZA 4Y76A 4ISLA 3MNBA 2C4FH 4NWLA 5CHAB 1YGCH 1HYLA 2BVSH 1BBRK 1S6FA 3TGIE 1A61H 4K1EA 1T8LA 4MNWA 1GBLA 1DWEH 2J92A 1VGCB 2OTVA 1A5GH 3ATLA 1CA8B 1V6DA 4ABHA 1C5VA 4LK4A 2W7SA 1QB6A 1ELFA 1P0SH 2BY9X 1LKBA 1Z8GA 5JBAS 2VGCB 4UE7H 1O2VA 1IQNA 2Q6FA 4RKOB 2FYQA 2SGFE 1C2EA 1NTPA 3VXFH 1O2GH 1LVYA 1OSSA 1OYQA 2H5CA 3U1IB 1HUTH 5FBEA 3ZZCA 1J9CH 1BMAA 1O33A 6CHAC 4O3TA 2W26A 1UTKA 4ZXXH 4LZ1H 4ZKRU 1LVBA 2PTNA 4FUEA 2TBSA 2Z3EA 1V2WT 4K8YA 4ABDA 3SO3A 2PKAB 4TYDA 4X8SH 4INLA 1UCYE 1UMAH 3KQBA 1GJAB 3UNSA 2BY7X 5DGJA 3BTWE 2BDGA 3V3MA 1ANDA 3M35A 4R0IA 2R2MB 1ZJKA 3A87A 1SLXB 1QNJA 2Z94A 2O8UA 1TE0A 2VGCC 1GCTB 2BM2A 2QAAA 2ZCLP 2FOFA 2XC4A 1L0ZA 2W7UA 4DCDA 5JDUB 4HFPB 1EX3A 3LPRA 1GCTC 1O3JA 1GHBG 2ZTXA 4IMZA 1HXFH 4JK5A 2O9QA 1PQ5A 1AFEH 1T4UH 1LHCH 1T8NA 3NPSA 1G3BA 1V2MT 1EQ9A 1GG6B 1PFXC 4WY3A 1NU9A 4FUHA 1P04A 2GT7A 1AKSB 2Y7ZA 1EOJA 2G5VA 2VH0A 1OPHB 1W12U 5C1XA 1HAVB 3RXTA 3UIRA 1MCTA 3LKWA 1FMGA 1ORFA 2QV1A 2D1JA 3SJ8A 1GMHG 1HJAC 1KLJH 4Z6AH 2WINI 2QA9E 3DUXH 1AFQC 1HAYB 2D8WA 1YCPH 2SFAA 1KLTA 1XXDA 3MNXA 1GI9B 5CMXH 2ZIQH 1ETTH 4WH6A 2XWBI 4AORA 4JZFH 5C3NA 1MQ6A 7KMEH 1YM0A 4XSKU 3FVFB 1O0DH 2FO9A 1Y5AT 1SGQE 1Y3XA 3G01A 1FY5A 1HAPH 2O8TA 2FOAA 3A83A 1CHOF 1O5CB 4YLUA 1O35A 3TK5A 3E3TA 3ZV9A 1BTXA 1EPTB 2IN2A 3TJOA 1K1OA 1FI8A 1EAUA 1O30A 2J2UA 2SGDE 7GCHF 1DWCH 3HATH 2W3IA 2H1UA 2CN0H 5L2ZH 3RXOA 3BTFE 3FFGA 2AGGX 2DE8A 3HPTB 4ZXYH 3SU2A 1V2TT 2V3HH 3KQCA 2FOGA 2VIQA 1SHHB 5I46H 3Q77A 3TH3H 1O5FH 2YOLA 3FZDA 3ZZDA 1PYTC 1NRSH 1A0LA 2HVXA 3PTNA 1XUGA 1Z8JB 1TQ0B 2THFB 1AFQB 4ABIA 2Z9KA 2A2XH 3ZVFA 1SGDE 3VEQB 2DE9A 3PMHB 4ZHMU 2Y5HA 4Q2KA 1LPKB 3RMOH 2ZDVH 1KXEA 2ZTZA 1L1NA 2ZFRH 2ZHFH 1P57B 3RC4A 3UTUH 3EA7A 1XKBC 1GBEA 2GDDA 2A45B 3PMAB 1J16A 1TAWA 3V12A 1DUEA 2Y5GA 1KTTB 1CT2E 3T26A 1IQGA 3A85A 4O97A 2HRVA 4DIIH 4D7GA 1GJ5H 1GHZA 3W95A 1BITA 1OWKA 1JBUH 4Y8YA 2SGPE 2ANWA 1AQ7A 2FXRA 4JYUH 1RS0A 3SGAE 4CBNA 3DT0H 1HIAA 3EA9A 4AGKA 4GCHF 4UDWH 2OLGA 2BD4A 1TX8A 2XBXA 1SMFE 2AGIX 1TRMA 2GDEH 1AE5A 3OY6U 2FOMB 1SHYA 2R0LA 1C5QA 2STAE 3DFJA 3KHVA 1DWBH 1MD8A 2O8WA 1PPGE 3K6ZA 5FCRA 1W10U 3H7OA 1QBNA 3A8BA 3GY6A 3RXBA 3FP7E 4TY7A 4ZHAA 1NFXA 2P16A 2OXSA 1EUFA 5T6GA 1GDNA 1GI0A 2BDBA 3KNXA 2ZU2A 4GVUA 4X1SU 1PPZA 3ODDA 6GCHF 1VR1H 3P6ZB 1UCYH 3FANA 1TNLA 3LGUA 4I33A 4AFQA 2BXUH 4BXWA 1C2GA 1EZXC 1O2ZA 5GPIB 2GZ9A 2IJOB 1YC0A 2CMYA 3RM2H 1E34B 1DOJA 2BDHA 2RDLA 1F5KU 1MBQA 2ZWLH 5JYIA 4ASHA 3RP2A 1J8AA 1XX9A 2VH6A 1K22H 1RD3B 5JBCS 2SGAA 1SGFA 2OINA 1K1JA 3U9AH 2AYWA 2ULLA 2ZFTA 1WSSH 1FAKH 4INKA 1Y59T 3UR9A 1WOFA 1MZAA 4YESB 2A7CA 1PQ7A 2XYAA 2ZDKA 4NSVA 5AVDA 2P8OB 1BUIA 1HXEH 3A82A 1P02A 2RA0A 4JZDH 4KTUA 4K60A 4J2YB 1VITH 5JBBS 2GX4A 5EQSA 1C4V2 4MPWA 5TJXA 1QIXB 1UVSH 3HK6B 1GG6C 3PO1B 4AG2A 4DT7B 2A7HA 2UUYA 2ZGBH 1BQYA 3ITIA 1QBVH 1EZSC 1P09A 1G3CA 1LPGB 2VU8E 1EATA 4MVNA 3SUGA 1GHXH 2BQWB 1ZPZA 1GI7B 2ZZUH 5AFYH 2QN5T 2Z9GA 4JYVH 3ZZAA 3EDXB 1SGEE 2VWLA 4INHA 1OXGA 1IQJA 1O3PB 1OKXA 3EGKH 1GGDC 2VIPA 3A88A 1ZTKA 4M7GA 2CV3A 4X6NA 2BHGA 1O3KA 5ESBA 3I78A 2FX6A 1BHXF 1GI6A 2ZU5A 3SV2H 3K65B 4DOQA 2JH5D 3UOPA 3RXMA 1VJAU 3SU6A 1A3BH 7GCHG 4CH8B 1LHFH 1NESE 1O5EH 1T8MA 3WY8A 2A5AA 2FDAA 3P17H 4NSYA 2Z6BD 2OD3B 3P8GA 3MO3A 4WH8A 1A0JA 3A7VA 2EI7A 3RXPA 5DO4H 1C9TA 5EPYA 3KEEA 1G36A 1TNJA 4TPIZ 3SNDA 4CRFA 1MKWK 2BD7A 1LHDH 1JRTA 1SLWB 5FAHA 2IOTA 2JH0D 3GY3A 1KXAA 3QTVH 4O03A 1G2LA 4VGCB 1HJ9A 4ISOA 1XXFA 5EXMA 4IC6A 1NS3A 3KQDA 1W7GH 2BD3A 2SNWA 3A8AA 3DFLA 3SQEE 2B8OH 3RXIA 1CHOG 3BG4B 2O8MA 2WUCA 4ABBA 3DHKH 4TPYA 1GI4A 1RTFB 1ELTA 3A7WA 4U30A 1O2LA 1IQMA 1E36B 2KAIB 4IC5A 1QHRB 5JBTA 5DP3A 1WBGB 1K1PA 1ELEE 1XKAC 2FYRA 3MU5A 2ZHEH 1IQHA 1HNEE 1HAIH 1IQEA 5F8ZA 5BPEA 1KXDA 3GCHC 1KSNA 1TMUH 6LPRA 4X2XA 1UVTH 1YBWA 6CHAB 4CRGA 1ZHPA 2G52A 1NC6A 3M7TA 3SOSA 3VB5A 2C3SA 4YTAA 1AVGH 1D4PB 1OX1A 1P9SA 2BDCA 4IW4E 3M7QA 1ZR0A 4ZKOU 3F1SB 3CENA 1TNKA 3QGNB 3RXUA 1IQKA 5EG4A 2QY0B 2BZAA 1E38B 1P9UA 3RMLH 4H42U 1YP9A 4A6LA 3LDXH 1AUJA 1ANEA 1DLKB 1YPLH 1O36A 2ZA5A 2FOCA 1FN8A 1IHTH 3LT3A 1SLVB 4JZIA 2XW9A 4CH2B 3FAOA 3E6PH 1GCDA 3LU9B 2AMDA 1AHTH 1WAYB 3BTHE 1DSUA 4WMEA 1OOKB 1CGHA 2P94A 2VIDA 2CGAA 1T7CA 5EQRA 3A7ZA 2R0KA 2DUCA 1K1LA 3LJJA 1PJPA 4NZLA 1O5GH 1MTSA 2I6SA 4XOJA 2Z9IA 1GBTA 2BYAX 3ZVEA 3QWCH 1EXFA 3MWIU 1CBWB 2VIVA 3CS0A 2R3YA 3E0NB 5HXFA 1QL7A 2KAIA 4OS7A 2XBWA 1JWTA 1T32A 1O31A 4A7IB 4CR9A 1RTKA 1HJAB 4AFZA 3B23B 4Y0YE 3RLWH 3GY5A 4MPUA 5LGOA 2PWXA 3VPKA 1QGFA 3VGCC 2F3CE 1BRAA 3HGPA 4JMYA 4UONA 1PQAA 1QB9A 1THPB 1MCVA 3BIUH 1G3DA 5B6OA 1DS2E 3SGQE 2F91A 1WUNH 1P01A 1Q3XA 2BQ6B 5EPNA 3D23A 4GAWA 1HAVA 2SGQE 5HGGA 1ZTJA 2PHBA 4ESTE 3ZZ4A 1EB1H 1SC8U 1MMJN 3T5FH 2V0BA 4MLFB 3SJOA 1T4VH 2YNAA 3RXRA 4CBOA 1GGDB 3O8DA 1ELBA 3V0XA 1H4WA 5HM9A 1S84A 4YOJA 3OTJE 5GXPA 3U8TH 4JZ1A 3GYLB 1MUEB 1QURH 3KCGH 4NZQA 4AZ2B 3UY9A 1H8IH 1TPAE 3M5OA 2AIPA 3HKJB 1LHEH 1OWJA 1PPBH 1OYTH 1C2IA 2G81E 4DY7B 1MKWH 4WXVA 2RA3A 2BY6X 1ZZZA 3SNBA 3VB7A 4I31A 2J9NA 4D7FA 1CU1A 3H5CB 3L3TA 4BNRA 2H9EH 3Q3YA 1C4U2 4H6TA 1WQSA 1ARCA 3SUEA 1BTWA 6ESTA 3E91A 2GCHF 2QXHA 1UHBA 3IWMA 2OC0A 1EAXA 1Y3VA 1FONA 4ZUHA 2ZHQH 4CRDA 3SW2B 1HAOH 2GKVE 2XRCA 1MAYA 5AFZH 8GCHG 1FY1A 3MTYA 2VWOA 2ZFSA 3RXHA 4AG1A 3BTEE 2FTLE 1SFIA 2G00A 1Q2WA 2JKHA 4FUCA 4H6SB 4A1XA 1FIWA 2FZZA 1FPHH 4WMDA 4X8TH 1CO7E 4U32A 5GCHG 1V2UT 1C1OA 1LMWB 2XTTB 1ESBA 4UD9H 1UTJA 3P8OA 2PTCE 4NCYA 1F7ZA 3BTME 1NT1A 1Y8TA 1W2KH 3GCTG 4WXIA 5E2OA 4I8KA 4X6OA 1EZUC 1XUFA 4DVAU 1GBAA 1SQOA 3SV6A 1QR3E 3GCTF 1F92A 1RIWC 2UWPA 1MKXK 4E05H 1O3GA 2XBVA 1KXBA 1VCPA 1AZ8A 1S83A 3P70B 3O8RA 1A2CH 1GJ6A 5A09A 2BB4A 1CQQA 4GCHG 1MQ5A 4BAQB 2B7DH 1UVOA 2RCEA 3P95A 4X1RU 1O2UA 1ELGA 1ZPBA 5I25A 1UO6A 1DITH 3ZZ6A 4E7NA 1XUKA 2AERH 3GDUA 1NRQH 5FX6A 3B8JA 1MZDA 1MD7A 4XFQA 2BZ6H 3E8LA 1HLTH 1BB0B 3K9XB 4Y71A 2ZHWH 1BTHH 2GZ7A 1LO6A 2ILNA 2PGBB 1EASA 3AVZA 1HAHH 2HNTF 4ABAA 2VIWA 4TWWA 2AS9A 2Y6TA 4E06H 1TGBA 3TNSA 9ESTA 4I8JA 1BCUH 2TGDA 1LPZB 1WCZA 5H4IB 3QUMP 3VB3A 1D6WA 1GL0E 1EPTA 4GPGA 3SI3H 1HRTH 3U8RH 1P8VC 1SBWA 4TY6A 1JIRA 1HB0B 1RFNA 4BXSA 4Y0ZE 3SORA 4OS1A 3S9CA 1SI5H 1TPOA 1MTUA 1QB1A 1OS8A 1CGIE 5DP6A 3S9BA 3K2UA 1S0QA 5FPTA 2J95A 1P2QA 1X7AC 1UK4A 3SV8A 1HFDA 4DJZB 5IDKA 1TX7A 5EU8A 1UVPA 1O2XA 1ETSH 1SPJA 4HI3A 1YPKH 3HGNA 1BRCE 1S6HA 2GTBA 2W5EA 2VWMA 1A0HB 1B0FA 1GDQA 1XVOA 3JZ2B 1BTZA 4GLYA 1OWEA 5EXLA 1KYNA 1FNIA 2UWOA 3QZRA 4MNVA 5A2MH 2F9UA 2I6QA 1YCPM 1XVMA 1SFQB 1BTYA 4Y11E 1ZRBA 1UTMA 4CR5A 1YPHC 2H6MA 1BHXB 1NROH 2GMTB 2GZ8A 1FN6A 4SGAE 1L1JA 1ZJDA 2OQUA 1SGYE 1P10A 2GD4B 2C8ZB 1AIXH 1C5WB 3ZZ5A 3FP6E 3LGWA 1SVPA 2P59A 5HM2A 2QF3A 1C9PA 3TITA 1GBHA 1GDUA 4HZHA 1L4DA 3RXGA 4AFSA 3EYDA 1VITG 1V2PT 2FX4A 1KDQA 2PKAA 2ZQ2A 1V2KT 2FWWA 2FIRH 2Y81A 1LHGH 1UCYK 1VITF 4X8UH 1K28D 2V35A 1ETRH 3ATKA 3MU8A 2ANKH 3GY4A 1RRKA 2Y7XA 2F9NA 3LC5A 3M37A 1VCWA 2ZPRA 3F9FA 1VZQH 3ZZ9A 3KN2A 1EAIA 4IN1A 1N8OC 3A8DA 2BX3A 1H9IE 1FY3A 3RXAA 3UR6A 5TCCA 1C2HA 1H9HE 3SJ9A 1FAXA 2F9OA 2GMTC 1W8BH 1EJMA 3VFEA 3ATWA 1D3QB 7LPRA 3RXCA 4UFFH 4B71A 3DD2H 1RXPA 1O34A 1P3EA 5K7RA 1KXFA 3EA8A 2NU3E 2ZF0H 3HKIB 1EAWA 1WYKA 2XC0A 5L6NH 1ZGVA 1ANBA 2ZG0H 1K9OE 1V3XA 1C2MA 3SU1A 1NFYA 1UK2A 1O2IA 3SHCH 1EB2A 4A92A 3LGIA 3RDZA 3GDVA 1SSXA 1WTGH 4A5TS 4BAOB 3SU5A 3R3GB 1O2TA 3RU4T 1O2JA 1G37A 1FLEE 1QL9A 4YT6H 4I8LA 1WTHD 1Z6JH 4J1YA 1DICA 1RIWB 2TPIZ 2J38A 1P2OA 5EW2H 4Z0KA 2PGQB 3ZZBA 1Q31A 3SUDA 1QJ7B 1C5UA 2OC1A 1LVMA 3BTTE 1N1LA 4KKDA 4NFEA 1O3BA 4JYTA 1PQ8A 3T62A 2FI3E 1TNHA 4Y10E 4AFUA 4MPVA 4B2AA 3RC6A 3MFJA 1UTLM 1DWDH 1HGTH 1O3DA 1BIOA 2PR3A 3LGYA 3P8NA 4KTSA 4OS4A 5JPMH 3ESTA 4RKJB 4DURA 2OC8A 1ZSJA 2STBE 3L33A 1GI5A 1GHWH 1SGRE 3MOCA 1SOZA 4KTCA 3S7HB 1PPFE 1BT7A 1FY4A 2ZQ1A 3D65E 4X1NU 2F83A 4AB8A 1O2MA 1PPEE 1O39A 3MO9A 3M3TA 4GSOA 4VGCC 4ABEA 2ZNKH 4FUJA 4MTBA 1ZHRA 2ZTYA 4Y79A 1C5YB 4K1SA 5LPFA 2M5TA 1GHVH 4I7YH 1B5GH 3SHAH 1MU8B 1P2JA 1AMHA 4UFDH 4X2YA 4X8VH 1A7SA 2P3FH 1O3CA 3BTDE 4A1TA 2BY8X 2WPJS 3BV9B 1FV9A 1QY6A 1OP0A 2FI4E 2XCNA 4D8NA 1AU8A 2BY5X 2A4GA 3QK1A 3STJA 1PYTD 1AO5A 1JMOH 4NIYA 1GMCF 5C5OA 3M61U 3SI4H 4CRBA 1HCGA 2ZFPH 3GCHB 1MH0A 3VB4A 5EOKA 2F9PA 1KIGH 2QIQA 2FI5E 1TGNA 3EQ0H 2Z3CA 3PV4A 3BTKE 3F9GA 1C1TA 4ZROA 4CRAA 3M3VA 5L2YH 1IQFA 1Z8IB 2BLWA 4THNH 2PKSC 1S5SA 1TX6A 1BMNH 8ESTE 1D3TB 4XBDA 3VGCB 3RU4D 3M3SA 3AAUA 5EODA 1P2KA 3LIWA 1J14A 3PYHA 1V2OT 1AB9B 5JB9S 1SL3A 4AYVB 3TNTA 1C1NA 2P3UB 1GJDB 3GY7A 2TGPZ 3UUZA 1TNGA 3BG8A 5FCKA 4NIVA 4NFFA 3ZVDA 1TQ7B 1ESTA 3NK8A 2VVCA 2BD8A 5F8XA 1GHAG 1CVWH 3QX5H 1TMBH 5JB8S 3M5MA 5FPSA 4YOGA 1O5DH 2FOBA 2C90B 1UJ1A 1GHAF 4MNYA 1QQ4A 3KL6A 2EEKA 3T28A 3V13A 2XC5A 3U69H 1QBOA 3T25A 4BTTB 1NY22 2CJIA 1G3EA 1V2QT 1CGJE 3QN7A 1MTVA 2GGVB 2XXLA 2WV5A 3HK3B 4FVDA 2ESTE 1ZOMA 1GPZA 4NIXA 2HALA 3MO6A 1DY8A 3P8FA 5LPRA 1P05A 2G4UA 1W7XH 2NU1E 1KDQB 1AUTC 3PTBA 1O3AA 1AY6H 2ZCHP 3NUMA 3UPEA 4CHAC 4BTUB 2OQ5A 4F4OC 1TGSZ 3TK6A 4I8HA 3TJUA 1CT0E 3KGPA 1GBFA 3SV9A 1AN1E 3RXEA 1GMCG 1C1SA 1ZRKA 3KF2A 5HYOA 2LNCA 1TGCA 1QA7A 1Y3WA 2SGEE 4Y7BA 5IYTA 1OWDA 3TH2H 2BVXH 3PROA 3SU3A 3AAVA 2BDYA 3F6UH 3ZVBA 2OP9A 1W13U 2ALPA 1A3EH 3MNSA 1SQTA 3FZZA 1PPHE 1SOTA 1HJ8A 4YOIA 1CHGA 1NM6A 5EW1H 3LC3A 5DP9A 3ZZ8A 1C1VH 1YPGH 4Y8ZA 1CSOE 4LZ4B 1C5SA 1DM4B 1GJCB 1W14U 2QXGA 4IN2A 5A0AE 2ZU4A 1HAZB 4AX9H 4BAHB 2EI8A 1TBZH 5DK1A 1MKXH 2GCTB 1BMMH 1WQVH 3MYWA 2FMJA 2VVUA 2XNIA 2ZFFH 4ISNA 4GHQA 5SGAE 1GVZA 1BJUA 1EJNA 3EE0B 1G9IE 4JCNA 1C1PA 5CHAC 1Z71A 3RXKA 4X2WA 4RSPA 1GBKA 2BMGB 3BIVH 4X6MA 2JH6D 2G4TA 3A7YA 1ZHMA 4BAMB 2Y80A 4I8GA 4ZAEA 2Q1JA 3A7XA 4X2VA 3D62A 2P8OC 3JZ1B 1GBIA 3A8CA 2EC9H 2ZEBA 3OY5U 1E37B 3AW0A 1L1GA 4JK6A 2BLVA 2ANYA 4K1TA 2HPPH 1GBDA 4X0WU 5J4QA 2C8YB 3A84A 2PLXA 3MHWU 1ESAA 1J15A 2ZGHA 5FBIA 4ABGA 1GI3A 1ZSLA 4OS2A 5F6MA 1TLDA 2TRMA 1E0FD 1YLDA 3UQOA 3SNEA 2HWLB 3P92A 1MBMA 3OX7U 2XBYA 4BAKB 1Y3YA 2A4OA 2FM2A 2PUQH 2PKSB 1DT2A 3PWBA 4B73A 1TOCB 1ARBA 1QJ1B 1KY9A 3O8CA 3U8OH 1AZZA 1NRPH 3GYMA 1AE8H 4X1PU 3RXFA 1TBRH 1QCPA 2ZC9H 2OC7A 1XUJA 2ZDLA 1D3DB 1ZLRA 1NZQH 1YCPK 2ODYB 3RUOA 2GP9B 1CA0C 2NU4E 1UTQA 3TK9A 1TPPA 5E8EH 3UNRA 4UEHH 3U1JB 4HTCH 5FXLA 3GY8A 1HPGA 2RG3A 1C2KA 2H9TH 1ZSKA 2QGRA 1EOLA 2AMQA 5ESTE 5E0GA 4Y6DA 4DW2U 3NCLA 2ZDAH 4IMQA 1SGTA 3SN8A 5GWZA 1AWHB 4LXBH 3LH1A 4XE4A 2OUAA 2ASUB 2AGEX 1UVUH 1VJ9U 3I77A 3MI4A 3NXPA 1S81A 1Z8RA 2CF9H 1NFWA 2JETB 1TNIA 1V2NT 5EXNA 2QXIA 1FQ3A 1NFUA 3LJOA 1M9UA 2D2DA 3BEIB 2VJ1A 3S7KB 2A1DB 3ZV8A 2G55A 5T3HA 2ZFQH 3TPIZ 2PSXA 1IQIA 1MAXA 1N6XA 5GCHF 3TIUA 4FUFA 1D9IA 1ZMNA 5DPAA 1QRZA 3E0PB 1A5HA 1K1NA 1O3EA 1ANCA 4Y8XA 1P2IA 2VNTA 4K5ZA 1DANH 2AMPA 3UWJH 5L30H 5A0BA 3OYPA 1ELVA 2HGTH 2ZGJA 3RM0H 4B75A 8KME2 1CA0B 5GDSH 3QZQA 2A2QH 3SUFA
chains in the Genus database with same CATH superfamily
2KZ4A 1N6YA 2ZO3H 2A4QA 1GMDG 3S0NA 3CP7A 2ZECA 2A31A 1C5NH 4FU8A 2LP6A 5T1VA 2BOHB 2UUJB 3NKKA 1ZTLA 2VINA 4QT8C 2QF0A 1F0TA 1O2NA 1OP8A 1KLIH 4B74A 1AGJA 2WV4A 3GCNA 1FZZA 1O38A 4YLQH 1P11E 3SGBE 4XBBA 1YWUA 1O3IA 2BXTH 3FKSD 2VVVA 2ZCKP 4UFEH 1W0YH 1F0RA 2CK3D 3MU1A 2OCVB 2K8IA 2ZHDA 4YXWD 1THSH 2YMSD 4OGXA 1TPSA 1A5IA 1Z6EA 1TABE 3TU7H 2ZP0H 4Y7AA 3MH5A 4MPXA 3FP8E 2ZDMA 5A8YA 2Z3DA 5FHTA 3MU0A 4MQAA 8GCHF 1C2DA 1TA2A 2FESH 1YPJH 4HGCA 1TYNA 4Q80A 3ZZ7A 1XM1A 2BVRH 1TB6H 4K3JA 5GIBA 1HIAB 2J34A 1HDTH 4BTIB 1QA0A 1DPOA 1IOEA 4WVPE 1QRXA 4CREA 3A7TA 2UWLA 2WPIS 1TRNA 1IQLA 3BEFB 1O2SA 2Y5FA 2V3OH 2VWNA 1Y5UT 2LELA 1PPCE 3M36A 1B7XB 1O3OA 5C5NA 1O37A 1XUHA 2QCYA 4KP0A 3SJIA 3VB6A 1AD8H 1EP6A 4NA7A 5LPEA 2HPQH 2WPMS 1MTNC 1GI2A 3TGJE 2GT8A 2B0FA 2QYIA 3UAIC 1MU6B 2RFKC 1HBTH 2OK5A 1HAGE 4YO9A 1G2MA 2D26C 4IBLH 2BOKA 1WU1A 5EGMA 1AB9C 4GUXA 3S69A 1V2JT 3SV7A 1LQDB 4NG9H 2H2ZA 1V2VT 4KELA 4B76A 4NIWA 3VXEH 1GJ8B 3GICB 3LOXA 1NN6A 3SU0A 1BOQA 1K1MA 3OU0A 3IG6B 3ATIA 3AW1A 1C5MD 4U2WA 3SYJA 2VIOA 3ZYEA 1ABIH 3Q3XA 3NZIA 2R9PA 1ID5H 1F5RA 2WPKS 2LPRA 2CHAC 5T6DA 2EA3A 4FU7A 3U98H 4MDSA 3UQVA 1V2ST 2J4IA 1YPEH 2XWAA 3AASA 3SJKA 3UNQA 3PLBA 3GOVB 5DJ7A 1INCA 2GCHG 2KX4A 1WV7H 1FPCH 1BBRE 3V7TA 1DXWA 3NWUA 2IPHA 3GCOA 4AN7A 2FPZA 3MH7A 4K8BA 1CE5A 4YT7H 4IGDA 1LDTT 1GHBF 1SGNE 1OWHA 2J98B 1SGIB 2K0QA 4D9RA 2ZPSA 1DDJA 3PRDA 1UK3A 4WF8A 2XCFA 1EZQA 1P06A 1T8OA 2H9HA 4CRCA 4DGJA 2GVFA 4RT0A 4CHAB 1F2SE 1H9LB 2PW8H 2ZKSA 3RXQA 4F48B 4O3UA 2OBOA 3GY2A 4ZMAH 1O2KA 1D3PB 2YNBA 3RXSA 1MTWA 5FPYA 4AGJA 4WMFA 1BJVA 4D9QA 1BRUP 1NU7B 4Q7XA 3PMBB 1TALA 2B9LA 3ZZ3A 5F8TA 2TGTA 5T6FA 2F9VA 4FXGH 5KGOA 1QQUA 2ODPA 2J97A 1JIMA 4F49A 1C1QA 4Q7YA 1NO9H 4H4FA 5GJ4B 2GV7A 1C5RA 2V6NA 3L6PA 2BD9A 5HMAA 1SGFG 3PLKA 2JDID 2K1QA 5F53A 4AC9A 2JETC 2HNTC 1UTPA 2ALVA 2BDAA 1TRYA 4KGAA 2Z7FE 3MH6A 3ODFA 2W3KA 4Q63A 3RMMH 1DE7H 2PUXB 5DKMA 4K2YA 2WYGA 4B2BA 5C1UA 4P00A 3RC5A 1UHBB 3KQEA 3RXLA 1W0ZU 3STIA 1GVKB 5BRRE 1N8OB 3E1XB 3D49H 1A4WH 1A46H 4OGYA 1EKBB 3EAJA 4ABJA 1H1BA 3UFAA 1G30B 2PFEA 4WWYA 2A32A 4K69A 1SGCA 1BTPA 1O2YA 1O2WA 1P3CA 1GWAA 5E0HA 2J94A 1DLEA 5ABWA 3TVJB 3GISB 3PLPA 1IAUA 3T29A 1QRWA 5EQQA 3M7UA 4YZUA 1J17T 5C2ZA 3PWCA 1LQEA 2Z9JA 1DSTA 1EPTC 5AHGH 1L4ZA 1HAXB 3A80A 3ZVGA 2O8LA 1V2LT 2P3TB 2FTMA 1H8DH 4ZKNU 5DP4A 1GJBB 2AIQA 2FOHA 3IITA 1DFPA 1C1RA 3OSYA 2AH4X 3BF6H 4TWYA 1QTFA 2QF4A 2FOEA 1RGQA 1S0RA 1KTSB 4NA9H 4FUGA 2VB0A 1BA8B 4XDEA 3R0FA 2J98A 2Z9LA 4BANB 2F9BH 2H5DA 1DVAH 1IHSH 1TOMH 1XMNB 2P95A 3A86A 4E7RG 1O2HA 4ASUD 3Q76A 1SR5C 2QC2A 1P2NA 2A5KA 4GHTA 3E90B 4DG4A 3SQHE 3S9AA 1ABJH 1GJ4H 4X6PA 1O3MA 5AF9H 2CHAB 1FDPA 3A89A 1C1MA 2C8WB 4NGAH 2ZGXH 1O2RA 1LKAA 1Z1IA 1SKYE 3ELAH 2G51A 1GI1A 2FEQH 5FL7D 1A1RA 3QLPH 1ZGIA 2EI6A 3RXDA 4MNXA 3C1KA 4AB9A 3DA9B 1CBWC 1ZMLA 5C20A 2BDIA 1LTOA 5DP8A 3QO6A 4NA8A 1TBQH 1O3HA 2ZPQA 2KM0A 1DY9A 3BTQE 3F0PA 3PMJA 1O32A 2A4RA 2BD2A 1JXPA 2BLQA 2TIOA 4ISHH 2BTCE 3N7EA 1C2JA 3TGKE 4I32A 3UREA 5K0HA 2G5NA 4ISIH 2WYJA 3GS9A 2GV6A 2Y82A 1C5OH 1RTLA 2HLCA 3N7OA 1TGTA 1C5TA 3BG4C 3F0OA 2ZU1A 4ZCNA 1UTNA 3H7TA 1L2EA 1QL8A 3RMNH 3TJVA 3EE7A 3RU4E 1CT4E 2PV9B 1W3CA 1TA6A 5HIYA 1YKTA 1Z1JA 3MH4A 2A5IA 3QGJA 3PB1E 5E0JA 2FLBH 2R2WU 1ACBE 1T31A 1GVLA 2PSYA 4ZH8A 3ENSB 3TH4H 1P12E 3MU4A 1BMLA 1FJSA 1W11U 1GHYH 1FIZA 2NU2E 4ZHLU 1NRRH 1SQAA 5A8ZA 1P03A 1G32B 2TGAA 3MNCA 4X1QU 2HVYB 1F5LA 2AFQB 2BX4A 1DX5M 1DXPA 2CF8H 1AI8H 4AYYB 3RXVA 3F68H 1AWFH 1MTNB 1C5XB 1S82A 1C5LH 1TIOA 1YLCA 1FXYA 1TFXA 7ESTE 2BD5A 4DIHH 1O3FA 2P93A 1GMDF 4IS5A 3ZVCA 1SB1H 1S85A 1D6RA 4PROA 1B0EA 2KCPA 2OBQA 1AKSA 1SLUB 1HV7A 5A8XA 4UFGH 4NWKA 1C5PA 1GBMA 3SBKA 1C1WH 4D76A 4RN6A 3GDSA 4I86A 4BOHA 3PO1C 5G4BA 3SNAA 2UUKB 5DP5A 1ELAA 3SZNA 1THRH 4JZEH 1ZPCA 3URDA 1V2RT 3URCA 1QJ6B 2ZI2H 1S6LA 6GCHG 3AK5A 3QDZB 2ZGCA 1GBJA 1BMFD 3TLOA 3LGTA 1E35B 1JRSA 3ZYDA 5J4SA 3M5NA 1GJ9B 3CS7A 5DG6A 1O2PA 1GJ7B 1GBCA 4O9VA 2UUFB 2C8XB 4B2CA 3M5LA 2FP7B 1SGPE 1C1UH 1GI8B 5PTPA 1YF4A 3Q3KA 1DUAA 4U01A 2BLOA 4AOQA 3ZVAA 1Z7KA 2ANMH 1KXCA 4YM9A 3RLYH 1NPMA 3F9EA 1YYY1 3QTOH 2ZDNA 3F9HA 1O3LA 4ZKSU 5LH8A 1BZXE 2AEIH 5CE1A 5C1YA 1BTUA 1EJAA 2KCYA 1GBBA 1SG8B 2JJ1D 1LCYA 3LONA 4OS6A 3LH3A 3N7DA 5TCAA 4ABFA 2ODQA 1VCQA 1C5ZB 4R8TB 4FVBA 2A0QB 3I29A 2R3UA 4WJG2 1TWXB 2A7JA 1C2LA 1O2QA 2G8TA 5ETXA 9LPRA 3B9FH 4A1VA 4FUDA 1BBRH 1YPMH 2AHME 1AVWA 1P2MA 2WZQA 5DP7A 2NU0E 3E16B 1AVXA 1GL1A 1EP5A 4MG3A 1ELDE 3BTGE 2FLRH 2B5TB 3K6YA 1O2OA 1U6QA 4OS5A 2GJGA 1Y3UA 2CXVA 1NRNH 2HNTE 5HKKD 3Q00A 1C2FA 2ZU3A 4LOYH 3KIDU 2FS8A 2XNDD 1RJXB 2Q6GA 1O5AB 4FUIA 1O5BB 3T2NA 1F0SA 1GMHF 3UOUA 2BQ7B 1BRBE 1OWIA 3RXJA 1VGCC 1BDAA 1ZYOA 1QFKH 3ATMA 1LVOA 1OP2A 3BN9A 3W94A 3C27B 4SGBE 2SNVA 2WUBA 3UWIA 3BSQA 4B1TA 1FY8E 1UTOA 2Q6DA 2FS9A 1FUJA 3SNCA 1WDIA 1F0UA 2FODA 3PV5A 5E2PA 3LGVA 2QXJA 8LPRA 3A81A 2WPLS 3TJNA 1JOUB 3OAAD 5F03A 4FUBA 2C93B 3F2GA 2HOBA 1K2I1 4FU9A 4XBCA 2NWNA 1YPHE 2GCTC 1TONA 5FX5A 3ZIAD 3O8BA 1TMTH 1XUIA 3PM3A 3SU4A 3MMGA 1K21H 2WPHS 1Y5BT 1C4Y2 1ELCA 1O3NA 1ZMJA 5C67A 3BEUA 1K1IA 3T27A 5A0CA 4Q7ZA 4Y76A 4ISLA 3MNBA 2C4FH 4NWLA 5CHAB 1YGCH 1HYLA 2BVSH 1BBRK 1S6FA 3TGIE 1A61H 4K1EA 1T8LA 4MNWA 1GBLA 1DWEH 1H8ED 2OTVA 1VGCB 2J92A 1A5GH 3ATLA 1CA8B 1V6DA 4ABHA 1C5VA 4LK4A 2W7SA 1QB6A 1ELFA 1P0SH 2BY9X 1LKBA 1Z8GA 5JBAS 2VGCB 4UE7H 1O2VA 1IQNA 2Q6FA 4RKOB 4M9FA 2FYQA 2SGFE 1C2EA 1NTPA 3VXFH 1O2GH 1LVYA 1OSSA 1OYQA 2H5CA 3U1IB 4RT1A 3OTPA 1HUTH 5FBEA 3ZZCA 1J9CH 1BMAA 1O33A 6CHAC 4O3TA 2W26A 1UTKA 4ZXXH 4LZ1H 4ZKRU 1LVBA 2PTNA 4FUEA 2TBSA 2Z3EA 1V2WT 4K8YA 4ABDA 3SO3A 2PKAB 4TYDA 5EJLA 4X8SH 4INLA 1UCYE 1UMAH 3KQBA 4TT3D 1GJAB 3UNSA 2BY7X 5DGJA 3BTWE 2BDGA 3V3MA 1ANDA 3M35A 4R0IA 2R2MB 1ZJKA 3A87A 1SLXB 1QNJA 2Z94A 2O8UA 1TE0A 2VGCC 1GCTB 2BM2A 2QAAA 2ZCLP 2FOFA 2XC4A 1L0ZA 2W7UA 4DCDA 5JDUB 2L6OA 4HFPB 1EX3A 3LPRA 2F43B 1GCTC 1O3JA 1GHBG 2ZTXA 4IMZA 1HXFH 4JK5A 2O9QA 1PQ5A 1AFEH 1T4UH 1LHCH 1T8NA 3NPSA 1G3BA 1V2MT 1EQ9A 3W1EA 1GG6B 1PFXC 4WY3A 1NU9A 4FUHA 1P04A 2GT7A 1AKSB 2Y7ZA 1EOJA 2G5VA 2VH0A 1OPHB 1W12U 5C1XA 1HAVB 3RXTA 3UIRA 1MCTA 3LKWA 1FMGA 1ORFA 2QV1A 2D1JA 3SJ8A 1GMHG 1HJAC 1KLJH 4Z6AH 2WINI 3F2FA 2QA9E 1FX0B 3DUXH 1AFQC 1HAYB 2D8WA 2W6JD 1YCPH 2SFAA 1KLTA 1XXDA 3MNXA 1GI9B 1VKYA 5CMXH 2ZIQH 1ETTH 4WH6A 2XWBI 4AORA 4JZFH 5C3NA 1MQ6A 7KMEH 1YM0A 4XSKU 3FVFB 1O0DH 2FO9A 1Y5AT 1SGQE 1Y3XA 3G01A 1FY5A 1HAPH 2O8TA 2FOAA 3A83A 1CHOF 1O5CB 4YLUA 1O35A 3TK5A 3E3TA 3ZV9A 1BTXA 1EPTB 2IN2A 3TJOA 1K1OA 1FI8A 1EAUA 1O30A 2J2UA 2SGDE 7GCHF 1DWCH 3HATH 2W3IA 2H1UA 2CN0H 5L2ZH 3RXOA 3BTFE 3FFGA 2AGGX 2DE8A 3HPTB 4ZXYH 3SU2A 4OM9A 1V2TT 2V3HH 3KQCA 2FOGA 2VBCA 2VIQA 1SHHB 5I46H 3Q77A 3KYFA 3TH3H 3F2HA 1O5FH 2YOLA 3FZDA 3ZZDA 1PYTC 1NRSH 1A0LA 2HVXA 1QZ8A 3PTNA 1XUGA 1Z8JB 1TQ0B 2THFB 1AFQB 4ABIA 2Z9KA 2A2XH 3ZVFA 1SGDE 3VEQB 2DE9A 3PMHB 4ZHMU 2Y5HA 4Q2KA 1LPKB 3RMOH 2ZDVH 1KXEA 2ZTZA 4ACBA 1L1NA 2ZFRH 2ZHFH 1P57B 3RC4A 3UTUH 3EA7A 1XKBC 1GBEA 2GDDA 2A45B 3PMAB 1J16A 1TAWA 3V12A 1DUEA 2Y5GA 1KTTB 1CT2E 3T26A 1IQGA 2L74A 3A85A 4O97A 2HRVA 4DIIH 4D7GA 1GJ5H 1GHZA 3W95A 1BITA 5HIZA 5C17A 1OWKA 1JBUH 4Y8YA 3VG8A 2SGPE 2ANWA 1AQ7A 2FXRA 4JYUH 1RS0A 3KQ5A 3SGAE 4CBNA 3DT0H 1HIAA 3EA9A 4AGKA 4GCHF 4UDWH 1NBME 2OLGA 2BD4A 1TX8A 1SMFE 2AGIX 1TRMA 2GDEH 2XBXA 1AE5A 3OY6U 2FOMB 1SHYA 2R0LA 1C5QA 2STAE 3DFJA 3KHVA 1DWBH 1MD8A 2XOKD 2O8WA 1PPGE 3K6ZA 5FCRA 1W10U 3H7OA 1QBNA 3A8BA 4P02A 3GY6A 3RXBA 3FP7E 4TY7A 4ZHAA 1NFXA 2P16A 2OXSA 1EUFA 5T6GA 1GDNA 1GI0A 2BDBA 3KNXA 2ZU2A 4GVUA 4X1SU 1PPZA 3ODDA 6GCHF 1VR1H 3P6ZB 1UCYH 3FANA 1TNLA 3LGUA 4I33A 4AFQA 2BXUH 2JJ2D 4BXWA 1C2GA 1EZXC 1O2ZA 5GPIB 2GZ9A 2IJOB 1YC0A 2CMYA 3RM2H 1E34B 1WXRA 1DOJA 2BDHA 2RDLA 1F5KU 1MBQA 2ZWLH 4HG6A 5JYIA 4ASHA 3RP2A 1J8AA 1XX9A 2VH6A 1K22H 1RD3B 5JBCS 2SGAA 1SGFA 2OINA 1K1JA 3U9AH 4TSFD 2AYWA 2ULLA 2ZFTA 1WSSH 1FAKH 3OE7D 4INKA 1Y59T 3UR9A 1UW7A 1WOFA 1MZAA 4YESB 4ACAA 2A7CA 1PQ7A 2XYAA 2ZDKA 4NSVA 5AVDA 5EIYA 3MQKC 2P8OB 1BUIA 1HXEH 3A82A 1P02A 2RA0A 4JZDH 4KTUA 4K60A 4J2YB 1VITH 5JBBS 2GX4A 5EQSA 1W0JD 1C4V2 4MPWA 5TJXA 1QIXB 1UVSH 3HK6B 4FOUC 1GG6C 3PO1B 4AG2A 4DT7B 2A7HA 2UUYA 2ZGBH 1BQYA 3ITIA 1QBVH 1EZSC 1P09A 1G3CA 1LPGB 2VU8E 1EATA 4MVNA 3SUGA 1GHXH 2BQWB 1ZPZA 1GI7B 2ZZUH 1NBMD 5AFYH 2QN5T 2Z9GA 4JYVH 3ZZAA 3EDXB 1SGEE 2VWLA 4INHA 2IJD1 1OXGA 1IQJA 1O3PB 1OKXA 3EGKH 1GGDC 2VIPA 3A88A 1ZTKA 4M7GA 2CV3A 4X6NA 2BHGA 1O3KA 5ESBA 3I78A 2FX6A 1BHXF 1GI6A 2ZU5A 3SV2H 3K65B 4DOQA 2JH5D 3UOPA 3RXMA 1VJAU 3SU6A 1A3BH 7GCHG 4CH8B 1LHFH 1NESE 1O5EH 1T8MA 3WY8A 2A5AA 2FDAA 3P17H 4NSYA 2Z6BD 2OD3B 3P8GA 5EJ1A 3MO3A 4WH8A 1A0JA 3A7VA 2EI7A 3RXPA 5DO4H 1C9TA 5EPYA 3KEEA 1G36A 1TNJA 2F4LA 4TPIZ 3SNDA 4CRFA 3FN8A 1MKWK 2BD7A 1LHDH 1JRTA 1SLWB 5FAHA 2IOTA 2JH0D 3GY3A 1KXAA 3QTVH 4O03A 1G2LA 4VGCB 1HJ9A 4ISOA 1XXFA 5EXMA 4IC6A 1NS3A 3KQDA 3SZEA 1W7GH 2BD3A 2SNWA 3A8AA 3DFLA 3SQEE 2B8OH 3RXIA 1CHOG 3PRBA 3BG4B 2O8MA 2WUCA 4ABBA 3DHKH 4TPYA 1GI4A 1RTFB 1ELTA 3A7WA 4U30A 1O2LA 1IQMA 2J5UA 1E36B 2KAIB 4IC5A 1QHRB 4XRNA 5DP3A 5JBTA 1WBGB 1K1PA 1ELEE 2KFWA 1XKAC 2FYRA 3MU5A 2ZHEH 1IQHA 1HNEE 1HAIH 1IQEA 5F8ZA 5BPEA 1KXDA 3GCHC 1KSNA 1TMUH 6LPRA 4X2XA 1UVTH 1YBWA 6CHAB 4CRGA 1ZHPA 2G52A 1NC6A 3M7TA 3SOSA 3VB5A 5DSFA 2C3SA 4YTAA 1AVGH 1D4PB 1OX1A 1P9SA 2BDCA 4IW4E 3M7QA 1ZR0A 4ZKOU 3F1SB 3CENA 1TNKA 3QGNB 3RXUA 1IQKA 5EG4A 2QY0B 2BZAA 5C94A 1E38B 1P9UA 3RMLH 4H42U 1YP9A 4A6LA 3LDXH 1AUJA 1ANEA 1DLKB 1YPLH 1O36A 2ZA5A 2FOCA 1EFRD 1FN8A 1IHTH 3LT3A 1SLVB 4JZIA 2XW9A 4CH2B 3FAOA 3E6PH 1GCDA 3LU9B 2AMDA 1AHTH 1WAYB 3BTHE 1DSUA 4WMEA 1OOKB 1CGHA 2P94A 2VIDA 2CGAA 1T7CA 5EQRA 3A7ZA 2R0KA 2DUCA 1K1LA 3LJJA 1PJPA 4NZLA 1O5GH 1MTSA 2I6SA 4XOJA 2Z9IA 1GBTA 2BYAX 3ZVEA 3QWCH 1EXFA 3MWIU 1CBWB 2VIVA 3CS0A 2R3YA 1YLNA 3E0NB 5HXFA 1QL7A 2KAIA 4OS7A 2XBWA 1JWTA 1T32A 1O31A 4A7IB 4CR9A 1RTKA 1HJAB 4AFZA 3B23B 4Y0YE 2IPQX 3DSGA 3RLWH 3GY5A 4MPUA 4XD7D 5LGOA 2PWXA 3VPKA 1QGFA 3VGCC 2F3CE 1BRAA 3HGPA 4JMYA 4UONA 1PQAA 1QB9A 4RI0A 1THPB 1MCVA 5KEDA 3BIUH 1G3DA 5B6OA 1DS2E 3SGQE 2F91A 1WUNH 1P01A 1Q3XA 2BQ6B 4Q4LA 5EPNA 3D23A 4GAWA 1HAVA 2SGQE 5HGGA 1ZTJA 2PHBA 5B6LA 4ESTE 5CHBA 3ZZ4A 1EB1H 1SC8U 1MMJN 3T5FH 2V0BA 4MLFB 3SJOA 1T4VH 2YNAA 3RXRA 4CBOA 1GGDB 3O8DA 1ELBA 3V0XA 1H4WA 5HM9A 1S84A 4YOJA 3OTJE 5GXPA 3U8TH 4JZ1A 3GYLB 1MUEB 1QURH 3KCGH 4NZQA 4AZ2B 3UY9A 1H8IH 1TPAE 3M5OA 2AIPA 3HKJB 1LHEH 1OWJA 1PPBH 1OYTH 1C2IA 2G81E 4DY7B 1MKWH 4WXVA 2WHXA 2RA3A 2BY6X 1ZZZA 3OEED 3SNBA 3VB7A 4I31A 2J9NA 4D7FA 1CU1A 3H5CB 3L3TA 4BNRA 2H9EH 3Q3YA 1C4U2 4H6TA 1WQSA 1ARCA 3SUEA 1BTWA 6ESTA 3E91A 2GCHF 2YMSC 2QXHA 1UHBA 3IWMA 2OC0A 1EAXA 1Y3VA 1FONA 4ZUHA 2ZHQH 4CRDA 3SW2B 1HAOH 2GKVE 2XRCA 1MAYA 5AFZH 8GCHG 1FY1A 1E1RD 3MTYA 2VWOA 2ZFSA 3RXHA 4AG1A 3BTEE 2FTLE 1SFIA 2G00A 3DSOA 1Q2WA 2JKHA 4FUCA 4H6SB 4A1XA 1FIWA 2FZZA 1FPHH 4WMDA 4X8TH 1CO7E 4U32A 5GCHG 1V2UT 1C1OA 1LMWB 2XTTB 1ESBA 4UD9H 1UTJA 3P8OA 2PTCE 4NCYA 1F7ZA 3BTME 1NT1A 1Y8TA 1W2KH 3GCTG 4WXIA 5E2OA 3WWFA 4I8KA 4X6OA 1EZUC 1XUFA 4DVAU 1GBAA 1SQOA 3SV6A 1QR3E 3GCTF 1F92A 1RIWC 2UWPA 1MKXK 4E05H 1O3GA 2XBVA 1KXBA 1VCPA 1AZ8A 1S83A 3P70B 3O8RA 1A2CH 1GJ6A 5A09A 2BB4A 1CQQA 4GCHG 1MQ5A 4BAQB 2B7DH 1UVOA 2RCEA 3P95A 4X1RU 1O2UA 1ELGA 1ZPBA 5I25A 1UO6A 1DITH 3ZZ6A 4E7NA 1XUKA 2AERH 3GDUA 1NRQH 5FX6A 3F3BA 3B8JA 1MZDA 1MD7A 4XFQA 2BZ6H 3E8LA 1HLTH 1BB0B 3K9XB 4Y71A 2ZHWH 1BTHH 2GZ7A 3WWBA 1LO6A 2ILNA 5KECA 2PGBB 1EASA 3AVZA 1HAHH 2HNTF 4ABAA 2VIWA 4TWWA 2AS9A 2Y6TA 4E06H 1TGBA 3TNSA 9ESTA 4I8JA 1BCUH 2TGDA 1LPZB 1WCZA 5H4IB 3QUMP 3VB3A 1D6WA 1GL0E 1EPTA 4GPGA 3SI3H 1HRTH 3U8RH 1P8VC 1SBWA 4TY6A 1JIRA 1HB0B 1RFNA 4BXSA 4Y0ZE 3SORA 4OS1A 3S9CA 1SI5H 1TPOA 1MTUA 1QB1A 1E79D 1OS8A 1CGIE 5DP6A 3S9BA 3K2UA 1S0QA 5FPTA 2J95A 1P2QA 1X7AC 2PP6A 1UK4A 3SV8A 1HFDA 2WSSD 4DJZB 5IDKA 1TX7A 5EU8A 1UVPA 2HLDD 1O2XA 1ETSH 2RDEA 1SPJA 4HI3A 1YPKH 3HGNA 1BRCE 1S6HA 2GTBA 2W5EA 2VWMA 1A0HB 1B0FA 1GDQA 1XVOA 3JZ2B 1BTZA 4GLYA 1OWEA 5EXLA 1KYNA 4FETA 1FNIA 2UWOA 3QZRA 4MNVA 5A2MH 2F9UA 2I6QA 1YCPM 1XVMA 1SFQB 1BTYA 4Y11E 1ZRBA 1UTMA 4CR5A 1YPHC 2H6MA 1BHXB 1NROH 2GMTB 2GZ8A 1FN6A 4SGAE 1L1JA 1ZJDA 2OQUA 1SGYE 1P10A 2GD4B 2C8ZB 1AIXH 1C5WB 3ZZ5A 3FP6E 3LGWA 1SVPA 2P59A 5HM2A 3PV2A 2QF3A 1C9PA 3TITA 1GBHA 1GDUA 4HZHA 1L4DA 3RXGA 4AFSA 3EYDA 1VITG 1V2PT 2FX4A 1KDQA 2PKAA 2ZQ2A 1V2KT 2FWWA 2FIRH 2Y81A 1LHGH 1UCYK 1VITF 4X8UH 1K28D 2V35A 1ETRH 3ATKA 3MU8A 2ANKH 3GY4A 1RRKA 2Y7XA 2F9NA 3LC5A 3M37A 1VCWA 2ZPRA 3F9FA 1VZQH 3ZZ9A 3KN2A 5DN6D 1EAIA 4IN1A 1N8OC 3A8DA 2BX3A 1H9IE 1FY3A 3RXAA 3UR6A 5TCCA 1C2HA 1H9HE 1COWD 3SJ9A 1FAXA 2F9OA 2GMTC 1W8BH 1EJMA 3VFEA 3ATWA 1D3QB 7LPRA 3RXCA 4UFFH 4B71A 3DD2H 1RXPA 3U28C 1O34A 1P3EA 5K7RA 1KXFA 3EA8A 2NU3E 2ZF0H 3HKIB 1EAWA 1WYKA 2XC0A 4Z1MD 5L6NH 1ZGVA 1ANBA 2ZG0H 1K9OE 1V3XA 1C2MA 3SU1A 1NFYA 1UK2A 1O2IA 3SHCH 1EB2A 4A92A 3LGIA 3RDZA 5CDFE 3GDVA 1SSXA 1WTGH 4A5TS 4BAOB 3SU5A 3R3GB 1O2TA 3RU4T 1O2JA 1G37A 2QE7D 1MABB 1FLEE 1QL9A 4YT6H 4I8LA 1WTHD 1Z6JH 4J1YA 3WW7A 1DICA 1RIWB 2TPIZ 2J38A 1P2OA 5EW2H 4Z0KA 2PGQB 3ZZBA 1Q31A 1YY3A 1QJ7B 1C5UA 3SUDA 2OC1A 1LVMA 3BTTE 1N1LA 4KKDA 4NFEA 1O3BA 4JYTA 1PQ8A 3T62A 2FI3E 1TNHA 4Y10E 4AFUA 1H8HD 4MPVA 4B2AA 3RC6A 3MFJA 1UTLM 1DWDH 1HGTH 1O3DA 1BIOA 2PR3A 3LGYA 3P8NA 4KTSA 4OS4A 5JPMH 3ESTA 4RKJB 4DURA 2OC8A 1ZSJA 2STBE 3L33A 1OHHD 1GI5A 1GHWH 1SGRE 3MOCA 1SOZA 2KCOA 4KTCA 3S7HB 1PPFE 1BT7A 1FY4A 3FO8D 2ZQ1A 3D65E 4X1NU 2F83A 4AB8A 1O2MA 1PPEE 1O39A 3MO9A 2KCAA 3M3TA 4GSOA 4VGCC 4ABEA 2ZNKH 4FUJA 4MTBA 1ZHRA 2ZTYA 4Y79A 1C5YB 4K1SA 5LPFA 2M5TA 1GHVH 4I7YH 3OFND 1B5GH 3SHAH 1MU8B 1P2JA 1AMHA 4UFDH 4X2YA 4X8VH 1A7SA 2P3FH 1KMHB 1O3CA 3BTDE 4A1TA 2BY8X 2WPJS 3BV9B 1FV9A 1QY6A 1OP0A 2FI4E 2XCNA 4D8NA 1AU8A 2BY5X 2A4GA 3QK1A 3STJA 1PYTD 1AO5A 1JMOH 4NIYA 1GMCF 5C5OA 3M61U 3SI4H 4CRBA 1HCGA 2ZFPH 3GCHB 1MH0A 3VB4A 5EOKA 2F9PA 1KIGH 2QIQA 2FI5E 1TGNA 3EQ0H 2Z3CA 3PV4A 3BTKE 3F9GA 1C1TA 2WV9A 4ZROA 4CRAA 3M3VA 5L2YH 1IQFA 1SQRA 1Z8IB 5C0TA 2BLWA 3H09A 4THNH 2PKSC 1S5SA 1TX6A 1BMNH 8ESTE 1D3TB 3N99A 4XBDA 3VGCB 3RU4D 3M3SA 3AAUA 5EODA 1P2KA 3LIWA 1J14A 3PYHA 1V2OT 1AB9B 5JB9S 1SL3A 4AYVB 3TNTA 1C1NA 2P3UB 1GJDB 3GY7A 2TGPZ 3UUZA 1TNGA 3BG8A 5FCKA 4NIVA 4NFFA 3ZVDA 1TQ7B 1ESTA 3NK8A 2VVCA 2BD8A 5F8XA 1GHAG 1CVWH 3QX5H 1TMBH 5JB8S 3M5MA 5FPSA 4YOGA 1O5DH 2FOBA 2C90B 1UJ1A 1GHAF 4MNYA 1QQ4A 3KL6A 2EEKA 3T28A 3V13A 2XC5A 3U69H 1QBOA 3T25A 4BTTB 1NY22 2CJIA 5GNDA 5C0UA 1G3EA 1V2QT 1CGJE 3QN7A 1MTVA 2GGVB 2XXLA 2WV5A 3HK3B 4FVDA 2ESTE 1ZOMA 1GPZA 2W6ID 4NIXA 2HALA 3MO6A 1DY8A 3P8FA 5LPRA 4F55A 1P05A 2G4UA 1W7XH 2NU1E 1KDQB 1AUTC 3PTBA 1O3AA 1AY6H 2ZCHP 3NUMA 3UPEA 4CHAC 4BTUB 2OQ5A 4F4OC 1TGSZ 3TK6A 4I8HA 3TJUA 1CT0E 3KGPA 1GBFA 3SV9A 1AN1E 2KR7A 3RXEA 1GMCG 4B6FA 1C1SA 1ZRKA 2V7QD 3KF2A 5HYOA 2LNCA 1TGCA 1QA7A 1Y3WA 2SGEE 4Y7BA 5IYTA 1OWDA 3TH2H 2BVXH 3PROA 3SU3A 3AAVA 2BDYA 3F6UH 3ZVBA 2OP9A 1W13U 2ALPA 3NRLA 1A3EH 3MNSA 1SQTA 3FZZA 1PPHE 1SOTA 1HJ8A 4YOIA 1CHGA 1NM6A 5EW1H 2QF5A 3LC3A 5DP9A 3ZZ8A 1C1VH 1YPGH 4Y8ZA 1CSOE 4LZ4B 1C5SA 1DM4B 1GJCB 1W14U 1K0HA 2QXGA 4IN2A 5A0AE 2ZU4A 1HAZB 4AX9H 4BAHB 2EI8A 1TBZH 5DK1A 1MKXH 2GCTB 1BMMH 1WQVH 3MYWA 2FMJA 2VVUA 2XNIA 2ZFFH 2V3MA 4ISNA 4GHQA 5SGAE 1GVZA 1BJUA 1EJNA 3EE0B 1G9IE 4JCNA 1C1PA 5CHAC 1Z71A 3RXKA 4X2WA 4RSPA 1GBKA 2BMGB 3BIVH 4X6MA 2JH6D 2EQNA 2G4TA 3A7YA 1E1QD 1ZHMA 4BAMB 2Y80A 3KYGA 4I8GA 4ZAEA 3DSPA 2Q1JA 3A7XA 4X2VA 3D62A 2WPDD 2P8OC 3JZ1B 1GBIA 3A8CA 2EC9H 2EY4C 2ZEBA 3OY5U 1E37B 3AW0A 1L1GA 4JK6A 2BLVA 2ANYA 4K1TA 2HPPH 1GBDA 3UB0A 4X0WU 5J4QA 2C8YB 3A84A 2PLXA 3MHWU 1ESAA 1J15A 2ZGHA 5FBIA 4ABGA 1GI3A 1ZSLA 1W0KD 3DCLA 1TLDA 4OS2A 2TRMA 1E0FD 1YLDA 5F6MA 3OEHD 3SNEA 3UQOA 4DT4A 2HWLB 3P92A 1MBMA 3OX7U 2XBYA 4BAKB 1Y3YA 2A4OA 2FM2A 2PUQH 2PKSB 1DT2A 3PWBA 4B73A 1TOCB 1ARBA 1QJ1B 5IK2D 1KY9A 3O8CA 3U8OH 1AZZA 1NRPH 3GYMA 1AE8H 4X1PU 3RXFA 1TBRH 1QCPA 2ZC9H 2OC7A 1XUJA 2ZDLA 1D3DB 1ZLRA 1NZQH 1YCPK 2ODYB 3RUOA 2GP9B 5EJZA 1CA0C 2NU4E 1UTQA 3CNRA 3TK9A 1TPPA 5E8EH 3UNRA 4UEHH 3U1JB 4HTCH 5FXLA 3GY8A 1HPGA 2RG3A 1C2KA 2H9TH 1ZSKA 2QGRA 2M2AA 1EOLA 2AMQA 5ESTE 3FOAA 5E0GA 4Y6DA 4DW2U 3NCLA 2ZDAH 4IMQA 1SGTA 2JIZD 3SN8A 5GWZA 1AWHB 4LXBH 3LH1A 4XE4A 2OUAA 2ASUB 2AGEX 1UVUH 1VJ9U 3I77A 3MI4A 3NXPA 1S81A 1Z8RA 2CF9H 1NFWA 2JETB 1TNIA 1V2NT 5EXNA 2QXIA 1FQ3A 1NFUA 3LJOA 1M9UA 2D2DA 3BEIB 2VJ1A 3S7KB 2A1DB 3ZV8A 2G55A 5T3HA 2ZFQH 3TPIZ 2PSXA 1IQIA 1MAXA 1N6XA 5GCHF 3TIUA 4FUFA 1D9IA 1ZMNA 5DPAA 1QRZA 3E0PB 1A5HA 1K1NA 4B6EA 1O3EA 1ANCA 4Y8XA 1P2IA 2VNTA 4K5ZA 1DANH 2AMPA 3UWJH 5L30H 5A0BA 3OYPA 1ELVA 2HGTH 2ZGJA 3RM0H 4B75A 8KME2 1CA0B 2YMSB 5GDSH 3QZQA 2A2QH 3SUFA
chains in the Genus database with same CATH topology
1N6YA 2ZO3H 2A4QA 1GMDG 3S0NA 3CP7A 2ZECA 2A31A 1C5NH 4FU8A 2BOHB 2UUJB 3NKKA 1ZTLA 2VINA 4QT8C 2QF0A 1F0TA 1O2NA 1OP8A 1KLIH 4B74A 1AGJA 2WV4A 3GCNA 1FZZA 1O38A 4YLQH 1P11E 3SGBE 4XBBA 1O3IA 2BXTH 2VVVA 2ZCKP 4UFEH 1W0YH 1F0RA 3MU1A 2OCVB 2ZHDA 1THSH 4OGXA 1TPSA 1A5IA 1Z6EA 1TABE 3TU7H 2ZP0H 4Y7AA 3MH5A 4MPXA 3FP8E 2ZDMA 5A8YA 2Z3DA 5FHTA 3MU0A 4MQAA 8GCHF 1C2DA 1TA2A 2FESH 1YPJH 4HGCA 1TYNA 4Q80A 3ZZ7A 1XM1A 2BVRH 1TB6H 4K3JA 5GIBA 1HIAB 2J34A 1HDTH 4BTIB 1QA0A 1DPOA 1IOEA 4WVPE 1QRXA 4CREA 3A7TA 2UWLA 2WPIS 1TRNA 1IQLA 3BEFB 1O2SA 2Y5FA 2V3OH 2VWNA 1Y5UT 1PPCE 3M36A 1B7XB 1O3OA 5C5NA 1O37A 1XUHA 2QCYA 4KP0A 3SJIA 3VB6A 1AD8H 1EP6A 4NA7A 5LPEA 2HPQH 2WPMS 1MTNC 1GI2A 3TGJE 2GT8A 2B0FA 2QYIA 1MU6B 1HBTH 1HAGE 4YO9A 1G2MA 2D26C 4IBLH 2BOKA 1WU1A 5EGMA 1AB9C 4GUXA 3S69A 1V2JT 3SV7A 1LQDB 4NG9H 2H2ZA 1V2VT 4KELA 4B76A 4NIWA 3VXEH 1GJ8B 3GICB 3LOXA 1NN6A 3SU0A 1BOQA 1K1MA 3OU0A 3IG6B 3ATIA 3AW1A 1C5MD 4U2WA 2VIOA 3ZYEA 1ABIH 3Q3XA 3NZIA 2R9PA 1ID5H 1F5RA 2WPKS 2LPRA 2CHAC 5T6DA 2EA3A 4FU7A 3U98H 4MDSA 3UQVA 1V2ST 2J4IA 1YPEH 2XWAA 3AASA 3SJKA 3UNQA 3PLBA 3GOVB 5DJ7A 1INCA 2GCHG 1WV7H 1FPCH 1BBRE 3V7TA 1DXWA 3NWUA 2IPHA 3GCOA 4AN7A 2FPZA 3MH7A 4K8BA 1CE5A 4YT7H 4IGDA 1LDTT 1GHBF 1SGNE 1OWHA 1SGIB 4D9RA 2ZPSA 1DDJA 1UK3A 4WF8A 2XCFA 1EZQA 1P06A 1T8OA 2H9HA 4CRCA 4DGJA 2GVFA 4CHAB 1F2SE 1H9LB 2PW8H 2ZKSA 3RXQA 4O3UA 2OBOA 3GY2A 4ZMAH 1O2KA 1D3PB 2YNBA 3RXSA 1MTWA 5FPYA 4AGJA 4WMFA 1BJVA 4D9QA 1BRUP 1NU7B 4Q7XA 3PMBB 1TALA 2B9LA 3ZZ3A 5F8TA 2TGTA 5T6FA 2F9VA 4FXGH 1QQUA 2ODPA 1JIMA 4F49A 1C1QA 4Q7YA 1NO9H 4H4FA 5GJ4B 2GV7A 1C5RA 2V6NA 3L6PA 2BD9A 5HMAA 1SGFG 3PLKA 2K1QA 2JETC 2HNTC 1UTPA 2ALVA 2BDAA 1TRYA 4KGAA 2Z7FE 3MH6A 3ODFA 2W3KA 3RMMH 1DE7H 2PUXB 5DKMA 4K2YA 2WYGA 4B2BA 5C1UA 3RC5A 1UHBB 3KQEA 3RXLA 1W0ZU 3STIA 1GVKB 5BRRE 1N8OB 3E1XB 3D49H 1A4WH 1A46H 4OGYA 1EKBB 3EAJA 4ABJA 1H1BA 3UFAA 1G30B 2PFEA 4WWYA 2A32A 4K69A 1SGCA 1BTPA 1O2YA 1O2WA 1P3CA 1GWAA 5E0HA 2J94A 1DLEA 5ABWA 3TVJB 3GISB 3PLPA 1IAUA 3T29A 1QRWA 5EQQA 3M7UA 4YZUA 1J17T 5C2ZA 3PWCA 1LQEA 2Z9JA 1DSTA 1EPTC 5AHGH 1L4ZA 1HAXB 3A80A 3ZVGA 2O8LA 1V2LT 2P3TB 2FTMA 1H8DH 4ZKNU 5DP4A 1GJBB 2AIQA 2FOHA 3IITA 1DFPA 1C1RA 3OSYA 2AH4X 3BF6H 4TWYA 1QTFA 2FOEA 1RGQA 1S0RA 1KTSB 4NA9H 4FUGA 2VB0A 1BA8B 4XDEA 3R0FA 2Z9LA 4BANB 2F9BH 2H5DA 1DVAH 1IHSH 1TOMH 1XMNB 2P95A 3A86A 4E7RG 1O2HA 3Q76A 1SR5C 2QC2A 1P2NA 2A5KA 4GHTA 3E90B 4DG4A 3SQHE 3S9AA 1ABJH 1GJ4H 4X6PA 1O3MA 5AF9H 2CHAB 1FDPA 3A89A 1C1MA 2C8WB 4NGAH 2ZGXH 1O2RA 1LKAA 1Z1IA 3ELAH 2G51A 1GI1A 2FEQH 1A1RA 3QLPH 1ZGIA 2EI6A 3RXDA 4MNXA 3C1KA 4AB9A 3DA9B 1CBWC 1ZMLA 5C20A 2BDIA 1LTOA 5DP8A 3QO6A 4NA8A 1TBQH 1O3HA 2ZPQA 1DY9A 3BTQE 3PMJA 1O32A 2A4RA 2BD2A 1JXPA 2BLQA 2TIOA 4ISHH 2BTCE 1C2JA 3TGKE 4I32A 3UREA 5K0HA 2G5NA 4ISIH 2WYJA 2GV6A 2Y82A 1C5OH 1RTLA 2HLCA 3N7OA 1TGTA 1C5TA 3BG4C 2ZU1A 1UTNA 3H7TA 1L2EA 1QL8A 3RMNH 3TJVA 3RU4E 1CT4E 2PV9B 1W3CA 1TA6A 1YKTA 1Z1JA 3MH4A 2A5IA 3QGJA 3PB1E 5E0JA 2FLBH 1ACBE 1T31A 2R2WU 1GVLA 2PSYA 4ZH8A 3ENSB 3TH4H 1P12E 3MU4A 1BMLA 1FJSA 1W11U 1GHYH 1FIZA 2NU2E 4ZHLU 1NRRH 1SQAA 5A8ZA 1P03A 1G32B 2TGAA 3MNCA 4X1QU 1F5LA 2AFQB 2BX4A 1DX5M 1DXPA 2CF8H 1AI8H 4AYYB 3RXVA 3F68H 1AWFH 1MTNB 1C5XB 1S82A 1C5LH 1TIOA 1YLCA 1FXYA 1TFXA 7ESTE 2BD5A 4DIHH 1O3FA 2P93A 1GMDF 4IS5A 3ZVCA 1SB1H 1S85A 1D6RA 4PROA 1B0EA 2OBQA 1AKSA 1SLUB 1HV7A 5A8XA 4UFGH 4NWKA 1C5PA 1GBMA 3SBKA 1C1WH 4D76A 4RN6A 3GDSA 4BOHA 3PO1C 5G4BA 3SNAA 2UUKB 5DP5A 1ELAA 3SZNA 1THRH 4JZEH 1ZPCA 3URDA 1V2RT 3URCA 1QJ6B 2ZI2H 6GCHG 3QDZB 2ZGCA 1GBJA 3TLOA 3LGTA 1E35B 1JRSA 3ZYDA 5J4SA 3M5NA 1GJ9B 3CS7A 5DG6A 1O2PA 1GJ7B 1GBCA 4O9VA 2UUFB 2C8XB 4B2CA 3M5LA 2FP7B 1SGPE 1C1UH 1GI8B 5PTPA 1YF4A 3Q3KA 1DUAA 4U01A 2BLOA 4AOQA 3ZVAA 1Z7KA 2ANMH 1KXCA 4YM9A 3RLYH 1NPMA 3F9EA 1YYY1 3QTOH 2ZDNA 3F9HA 1O3LA 4ZKSU 5LH8A 1BZXE 2AEIH 5CE1A 5C1YA 1BTUA 1EJAA 3LONA 1GBBA 1SG8B 1LCYA 4OS6A 5TCAA 3LH3A 4ABFA 2ODQA 1VCQA 1C5ZB 4R8TB 4FVBA 2A0QB 3I29A 2R3UA 4WJG2 1TWXB 2A7JA 1C2LA 1O2QA 2G8TA 5ETXA 9LPRA 3B9FH 4A1VA 4FUDA 1BBRH 1YPMH 1AVWA 1P2MA 5DP7A 2NU0E 3E16B 1AVXA 1GL1A 1EP5A 4MG3A 1ELDE 3BTGE 2FLRH 2B5TB 3K6YA 1O2OA 1U6QA 4OS5A 1Y3UA 2CXVA 1NRNH 2HNTE 3Q00A 1C2FA 2ZU3A 4LOYH 3KIDU 2FS8A 1RJXB 2Q6GA 1O5AB 4FUIA 1O5BB 3T2NA 1F0SA 1GMHF 3UOUA 2BQ7B 1BRBE 1OWIA 3RXJA 1VGCC 1BDAA 1ZYOA 1QFKH 3ATMA 1LVOA 1OP2A 3BN9A 3W94A 3C27B 4SGBE 2SNVA 2WUBA 3UWIA 3BSQA 4B1TA 1FY8E 1UTOA 2Q6DA 2FS9A 1FUJA 3SNCA 1F0UA 2FODA 5E2PA 3LGVA 2QXJA 8LPRA 3A81A 2WPLS 3TJNA 1JOUB 5F03A 4FUBA 2C93B 2HOBA 1K2I1 4FU9A 4XBCA 2NWNA 1YPHE 2GCTC 1TONA 5FX5A 3O8BA 1TMTH 1XUIA 3PM3A 3SU4A 3MMGA 1K21H 2WPHS 1Y5BT 1C4Y2 1ELCA 1O3NA 1ZMJA 5C67A 3BEUA 1K1IA 3T27A 5A0CA 4Q7ZA 4Y76A 4ISLA 3MNBA 2C4FH 4NWLA 5CHAB 1YGCH 1HYLA 2BVSH 1BBRK 1S6FA 3TGIE 1A61H 4K1EA 1T8LA 4MNWA 1GBLA 1DWEH 2J92A 1VGCB 2OTVA 1A5GH 3ATLA 1CA8B 1V6DA 4ABHA 1C5VA 4LK4A 2W7SA 1QB6A 1ELFA 1P0SH 2BY9X 1LKBA 1Z8GA 5JBAS 2VGCB 4UE7H 1O2VA 1IQNA 2Q6FA 4RKOB 2FYQA 2SGFE 1C2EA 1NTPA 3VXFH 1O2GH 1LVYA 1OSSA 1OYQA 2H5CA 3U1IB 1HUTH 5FBEA 3ZZCA 1J9CH 1BMAA 1O33A 6CHAC 4O3TA 2W26A 1UTKA 4ZXXH 4LZ1H 4ZKRU 1LVBA 2PTNA 4FUEA 2TBSA 2Z3EA 1V2WT 4K8YA 4ABDA 3SO3A 2PKAB 4TYDA 4X8SH 4INLA 1UCYE 1UMAH 3KQBA 1GJAB 3UNSA 2BY7X 5DGJA 3BTWE 2BDGA 3V3MA 1ANDA 3M35A 4R0IA 2R2MB 1ZJKA 3A87A 1SLXB 1QNJA 2Z94A 2O8UA 1TE0A 2VGCC 1GCTB 2BM2A 2QAAA 2ZCLP 2FOFA 2XC4A 1L0ZA 2W7UA 4DCDA 5JDUB 4HFPB 1EX3A 3LPRA 1GCTC 1O3JA 1GHBG 2ZTXA 4IMZA 1HXFH 4JK5A 2O9QA 1PQ5A 1AFEH 1T4UH 1LHCH 1T8NA 3NPSA 1G3BA 1V2MT 1EQ9A 1GG6B 1PFXC 4WY3A 1NU9A 4FUHA 1P04A 2GT7A 1AKSB 2Y7ZA 1EOJA 2G5VA 2VH0A 1OPHB 1W12U 5C1XA 1HAVB 3RXTA 3UIRA 1MCTA 3LKWA 1FMGA 1ORFA 2QV1A 2D1JA 3SJ8A 1GMHG 1HJAC 1KLJH 4Z6AH 2WINI 2QA9E 3DUXH 1AFQC 1HAYB 2D8WA 1YCPH 2SFAA 1KLTA 1XXDA 3MNXA 1GI9B 5CMXH 2ZIQH 1ETTH 4WH6A 2XWBI 4AORA 4JZFH 5C3NA 1MQ6A 7KMEH 1YM0A 4XSKU 3FVFB 1O0DH 2FO9A 1Y5AT 1SGQE 1Y3XA 3G01A 1FY5A 1HAPH 2O8TA 2FOAA 3A83A 1CHOF 1O5CB 4YLUA 1O35A 3TK5A 3E3TA 3ZV9A 1BTXA 1EPTB 2IN2A 3TJOA 1K1OA 1FI8A 1EAUA 1O30A 2J2UA 2SGDE 7GCHF 1DWCH 3HATH 2W3IA 2H1UA 2CN0H 5L2ZH 3RXOA 3BTFE 3FFGA 2AGGX 2DE8A 3HPTB 4ZXYH 3SU2A 1V2TT 2V3HH 3KQCA 2FOGA 2VIQA 1SHHB 5I46H 3Q77A 3TH3H 1O5FH 2YOLA 3FZDA 3ZZDA 1PYTC 1NRSH 1A0LA 2HVXA 3PTNA 1XUGA 1Z8JB 1TQ0B 2THFB 1AFQB 4ABIA 2Z9KA 2A2XH 3ZVFA 1SGDE 3VEQB 2DE9A 3PMHB 4ZHMU 2Y5HA 4Q2KA 1LPKB 3RMOH 2ZDVH 1KXEA 2ZTZA 1L1NA 2ZFRH 2ZHFH 1P57B 3RC4A 3UTUH 3EA7A 1XKBC 1GBEA 2GDDA 2A45B 3PMAB 1J16A 1TAWA 3V12A 1DUEA 2Y5GA 1KTTB 1CT2E 3T26A 1IQGA 3A85A 4O97A 2HRVA 4DIIH 4D7GA 1GJ5H 1GHZA 3W95A 1BITA 1OWKA 1JBUH 4Y8YA 2SGPE 2ANWA 1AQ7A 2FXRA 4JYUH 1RS0A 3SGAE 4CBNA 3DT0H 1HIAA 3EA9A 4AGKA 4GCHF 4UDWH 2OLGA 2BD4A 1TX8A 2XBXA 1SMFE 2AGIX 1TRMA 2GDEH 1AE5A 3OY6U 2FOMB 1SHYA 2R0LA 1C5QA 2STAE 3DFJA 3KHVA 1DWBH 1MD8A 2O8WA 1PPGE 3K6ZA 5FCRA 1W10U 3H7OA 1QBNA 3A8BA 3GY6A 3RXBA 3FP7E 4TY7A 4ZHAA 1NFXA 2P16A 2OXSA 1EUFA 5T6GA 1GDNA 1GI0A 2BDBA 3KNXA 2ZU2A 4GVUA 4X1SU 1PPZA 3ODDA 6GCHF 1VR1H 3P6ZB 1UCYH 3FANA 1TNLA 3LGUA 4I33A 4AFQA 2BXUH 4BXWA 1C2GA 1EZXC 1O2ZA 5GPIB 2GZ9A 2IJOB 1YC0A 2CMYA 3RM2H 1E34B 1DOJA 2BDHA 2RDLA 1F5KU 1MBQA 2ZWLH 5JYIA 4ASHA 3RP2A 1J8AA 1XX9A 2VH6A 1K22H 1RD3B 5JBCS 2SGAA 1SGFA 2OINA 1K1JA 3U9AH 2AYWA 2ULLA 2ZFTA 1WSSH 1FAKH 4INKA 1Y59T 3UR9A 1WOFA 1MZAA 4YESB 2A7CA 1PQ7A 2XYAA 2ZDKA 4NSVA 5AVDA 2P8OB 1BUIA 1HXEH 3A82A 1P02A 2RA0A 4JZDH 4KTUA 4K60A 4J2YB 1VITH 5JBBS 2GX4A 5EQSA 1C4V2 4MPWA 5TJXA 1QIXB 1UVSH 3HK6B 1GG6C 3PO1B 4AG2A 4DT7B 2A7HA 2UUYA 2ZGBH 1BQYA 3ITIA 1QBVH 1EZSC 1P09A 1G3CA 1LPGB 2VU8E 1EATA 4MVNA 3SUGA 1GHXH 2BQWB 1ZPZA 1GI7B 2ZZUH 5AFYH 2QN5T 2Z9GA 4JYVH 3ZZAA 3EDXB 1SGEE 2VWLA 4INHA 1OXGA 1IQJA 1O3PB 1OKXA 3EGKH 1GGDC 2VIPA 3A88A 1ZTKA 4M7GA 2CV3A 4X6NA 2BHGA 1O3KA 5ESBA 3I78A 2FX6A 1BHXF 1GI6A 2ZU5A 3SV2H 3K65B 4DOQA 2JH5D 3UOPA 3RXMA 1VJAU 3SU6A 1A3BH 7GCHG 4CH8B 1LHFH