1HB6A

Structure of bovine acyl-coa binding protein in orthorhombic crystal form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA BINDING PROTEIN
publication title Binding Site Differences Revealed by Crystal Structures of Plasmodium Falciparum and Bovine Acyl-Coa Binding Protein
pubmed doi rcsb
molecule tags Acyl-coenzyme a binding protein
total genus 36
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hb6A00
1J19A 1NI2A 3QIJA 2I1JA 3WA0A 1ST7A 5IJMA 1HB8A 2AEHA 2EMSA 2RQ1A 3U8ZA 1GG3A 2J0MA 1MIXA 2HE7A 2YVCA 3ZDTA 4F7GA 2I1KA 4ZRJA 2EMTA 2FDQA 1NVLA 2J0KA 4NY0A 2FJ9A 3U7DA 2HRJA 3AU4A 4HDOA 2D10A 1HBKA 3G9WA 4EKUA 1MIZB 4P7IA 3FLVA 1MK7B 1NTIA 2LBBA 2WH5A 3X23A 1Y19B 3AU5A 1GC7A 1GC6A 2CB8A 1EF1A 3BINA 4DXAB 3EPYA 2D11A 4YL8A 1HB6A 3PZDA 3PVLA 1H4RA 1MK9B 1SGHA 1E5WA 2ABDA 2ZPYA 3IVFA 1ACAA 4ZRIA 4ZRKA 4HDQA 2COPA 2CQUA 4CYEA 1ISNA 2AL6A 3FP5A 2J0JA 2D2QA
chains in the Genus database with same CATH superfamily
1NI2A 3QIJA 3ENBA 2AEHA 2DIKA 1GG3A 2YVCA 3E66A 4F7GA 5JVLA 2I1KA 1DIKA 2D10A 4JK8A 4JKBA 4JKEA 4EKUA 4GXBA 2LBBA 3X23A 1KC7A 1EF1A 2R82A 4TKNA 3EPYA 3E9PA 4YL8A 1HB6A 1JDEA 1SGHA 4ZRKA 2X0SA 2AL6A 1J19A 5IJMA 3U8ZA 1MIXA 2FDQA 4JK7A 4P7IA 1MK7B 1NTIA 2WH5A 4JKCA 3AU5A 3SBGA 1GC7A 3BINA 2D11A 4JKGA 1MK9B 2ABDA 3IVFA 1ACAA 4HDQA 2COPA 2CQUA 4ILGB 4JKGB 3SBTA 1ISNA 3FP5A 4ILJA 3WA0A 2RQ1A 2J0MA 2HE7A 4JKDA 2EMTA 2J0KA 4NY0A 2HRJA 1VBHA 3AU4A 1HBKA 3G9WA 1VBGA 3FLVA 1Y19B 1GC6A 4JK9A 4DXAB 1KBLA 3PVLA 4ZRIA 2J0JA 2D2QA 2I1JA 1ST7A 1HB8A 2EMSA 3ZDTA 4JKHA 4ZRJA 1NVLA 2FJ9A 3U7DA 4HDOA 1MIZB 3E9LA 4JKFA 3E9OA 2CB8A 1GGOA 3PZDA 4ILHA 1H4RA 4JKAA 2ZPYA 1E5WA 4CYEA
chains in the Genus database with same CATH topology
1NI2A 3QIJA 3ENBA 2AEHA 2DIKA 1GG3A 2YVCA 3E66A 4F7GA 5JVLA 2I1KA 1DIKA 2D10A 4JK8A 4JKBA 4JKEA 4EKUA 4GXBA 2LBBA 3X23A 1KC7A 1EF1A 2R82A 4TKNA 3EPYA 3E9PA 4YL8A 1HB6A 1JDEA 1SGHA 4ZRKA 2X0SA 2AL6A 1J19A 5IJMA 3U8ZA 1MIXA 2FDQA 4JK7A 4P7IA 1MK7B 1NTIA 2WH5A 4JKCA 3AU5A 3SBGA 1GC7A 3BINA 2D11A 4JKGA 1MK9B 2ABDA 3IVFA 1ACAA 4HDQA 2COPA 2CQUA 4ILGB 4JKGB 3SBTA 1ISNA 3FP5A 4ILJA 3WA0A 2RQ1A 2J0MA 2HE7A 4JKDA 2EMTA 2J0KA 4NY0A 2HRJA 1VBHA 3AU4A 1HBKA 3G9WA 1VBGA 3FLVA 1Y19B 1GC6A 4JK9A 4DXAB 1KBLA 3PVLA 4ZRIA 2J0JA 2D2QA 2I1JA 1ST7A 1HB8A 2EMSA 3ZDTA 4JKHA 4ZRJA 1NVLA 2FJ9A 3U7DA 4HDOA 1MIZB 3E9LA 4JKFA 3E9OA 2CB8A 1GGOA 3PZDA 4ILHA 1H4RA 4JKAA 2ZPYA 1E5WA 4CYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J19 A;  1NI2 A;  3QIJ A;  2I1J A;  3WA0 A;  1ST7 A;  5IJM A;  1HB8 A;  2AEH A;  2EMS A;  2RQ1 A;  3U8Z A;  1GG3 A;  2J0M A;  1MIX A;  2HE7 A;  2YVC A;  3ZDT A;  4F7G A;  2I1K A;  4ZRJ A;  2EMT A;  2FDQ A;  1NVL A;  2J0K A;  4NY0 A;  2FJ9 A;  3U7D A;  2HRJ A;  3AU4 A;  4HDO A;  2D10 A;  1HBK A;  3G9W A;  4EKU A;  1MIZ B;  4P7I A;  3FLV A;  1MK7 B;  1NTI A;  2LBB A;  2WH5 A;  3X23 A;  1Y19 B;  3AU5 A;  1GC7 A;  1GC6 A;  2CB8 A;  1EF1 A;  3BIN A;  4DXA B;  3EPY A;  2D11 A;  4YL8 A;  1HB6 A;  3PZD A;  3PVL A;  1H4R A;  1MK9 B;  1SGH A;  1E5W A;  2ABD A;  2ZPY A;  3IVF A;  1ACA A;  4ZRI A;  4ZRK A;  4HDQ A;  2COP A;  2CQU A;  4CYE A;  1ISN A;  2AL6 A;  3FP5 A;  2J0J A;  2D2Q A; 
#chains in the Genus database with same CATH topology
 1NI2 A;  3QIJ A;  3ENB A;  2AEH A;  2DIK A;  1GG3 A;  2YVC A;  3E66 A;  4F7G A;  5JVL A;  2I1K A;  1DIK A;  2D10 A;  4JK8 A;  4JKB A;  4JKE A;  4EKU A;  4GXB A;  2LBB A;  3X23 A;  1KC7 A;  1EF1 A;  2R82 A;  4TKN A;  3EPY A;  3E9P A;  4YL8 A;  1HB6 A;  1JDE A;  1SGH A;  4ZRK A;  2X0S A;  2AL6 A;  1J19 A;  5IJM A;  3U8Z A;  1MIX A;  2FDQ A;  4JK7 A;  4P7I A;  1MK7 B;  1NTI A;  2WH5 A;  4JKC A;  3AU5 A;  3SBG A;  1GC7 A;  3BIN A;  2D11 A;  4JKG A;  1MK9 B;  2ABD A;  3IVF A;  1ACA A;  4HDQ A;  2COP A;  2CQU A;  4ILG B;  4JKG B;  3SBT A;  1ISN A;  3FP5 A;  4ILJ A;  3WA0 A;  2RQ1 A;  2J0M A;  2HE7 A;  4JKD A;  2EMT A;  2J0K A;  4NY0 A;  2HRJ A;  1VBH A;  3AU4 A;  1HBK A;  3G9W A;  1VBG A;  3FLV A;  1Y19 B;  1GC6 A;  4JK9 A;  4DXA B;  1KBL A;  3PVL A;  4ZRI A;  2J0J A;  2D2Q A;  2I1J A;  1ST7 A;  1HB8 A;  2EMS A;  3ZDT A;  4JKH A;  4ZRJ A;  1NVL A;  2FJ9 A;  3U7D A;  4HDO A;  1MIZ B;  3E9L A;  4JKF A;  3E9O A;  2CB8 A;  1GGO A;  3PZD A;  4ILH A;  1H4R A;  4JKA A;  2ZPY A;  1E5W A;  4CYE A; 
#chains in the Genus database with same CATH homology
 1NI2 A;  3QIJ A;  3ENB A;  2AEH A;  2DIK A;  1GG3 A;  2YVC A;  3E66 A;  4F7G A;  5JVL A;  2I1K A;  1DIK A;  2D10 A;  4JK8 A;  4JKB A;  4JKE A;  4EKU A;  4GXB A;  2LBB A;  3X23 A;  1KC7 A;  1EF1 A;  2R82 A;  4TKN A;  3EPY A;  3E9P A;  4YL8 A;  1HB6 A;  1JDE A;  1SGH A;  4ZRK A;  2X0S A;  2AL6 A;  1J19 A;  5IJM A;  3U8Z A;  1MIX A;  2FDQ A;  4JK7 A;  4P7I A;  1MK7 B;  1NTI A;  2WH5 A;  4JKC A;  3AU5 A;  3SBG A;  1GC7 A;  3BIN A;  2D11 A;  4JKG A;  1MK9 B;  2ABD A;  3IVF A;  1ACA A;  4HDQ A;  2COP A;  2CQU A;  4ILG B;  4JKG B;  3SBT A;  1ISN A;  3FP5 A;  4ILJ A;  3WA0 A;  2RQ1 A;  2J0M A;  2HE7 A;  4JKD A;  2EMT A;  2J0K A;  4NY0 A;  2HRJ A;  1VBH A;  3AU4 A;  1HBK A;  3G9W A;  1VBG A;  3FLV A;  1Y19 B;  1GC6 A;  4JK9 A;  4DXA B;  1KBL A;  3PVL A;  4ZRI A;  2J0J A;  2D2Q A;  2I1J A;  1ST7 A;  1HB8 A;  2EMS A;  3ZDT A;  4JKH A;  4ZRJ A;  1NVL A;  2FJ9 A;  3U7D A;  4HDO A;  1MIZ B;  3E9L A;  4JKF A;  3E9O A;  2CB8 A;  1GGO A;  3PZD A;  4ILH A;  1H4R A;  4JKA A;  2ZPY A;  1E5W A;  4CYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...