1HB6A

Structure of bovine acyl-coa binding protein in orthorhombic crystal form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding Site Differences Revealed by Crystal Structures of Plasmodium Falciparum and Bovine Acyl-Coa Binding Protein
pubmed doi rcsb
molecule tags Acyl-coenzyme a binding protein
molecule keywords ACYL-COA BINDING PROTEIN
total genus 36
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hb6A00
1MK7B 1GC7A 2FJ9A 2HE7A 1NTIA 1HBKA 1MIZB 3BINA 2RQ1A 3PVLA 4NY0A 2D10A 2D11A 3FLVA 3WA0A 4ZRJA 2WH5A 3AU4A 2EMSA 3EPYA 1ISNA 1GG3A 2I1KA 1NI2A 3AU5A 3G9WA 4HDOA 1HB6A 4P7IA 4ZRKA 3U8ZA 2CB8A 2COPA 4EKUA 2CQUA 1EF1A 2AL6A 2HRJA 2I1JA 3FP5A 5IJMA 2J0JA 2YVCA 2ZPYA 1J19A 3X23A 2LBBA 2J0KA 1E5WA 1MK9B 2AEHA 2D2QA 2FDQA 4HDQA 4CYEA 4DXAB 4F7GA 1Y19B 3QIJA 3PZDA 1NVLA 2J0MA 1ST7A 3IVFA 3U7DA 3ZDTA 1GC6A 1H4RA 2ABDA 1ACAA 2EMTA 1SGHA 4YL8A 4ZRIA 1MIXA 1HB8A
chains in the Genus database with same CATH superfamily
2X0SA 1MK7B 1GC7A 2HE7A 1JDEA 1HBKA 3BINA 2RQ1A 2D10A 3FLVA 4ZRJA 2EMSA 3EPYA 1ISNA 3U8ZA 4EKUA 1EF1A 1J19A 4CYEA 2AEHA 1MK9B 2FDQA 1NVLA 1ST7A 3ZDTA 1H4RA 4GXBA 2EMTA 1GGOA 3E9LA 2D11A 2WH5A 1GG3A 2I1KA 4HDOA 1HB6A 4JKBA 2CQUA 2AL6A 2J0JA 4JKAA 3PZDA 1DIKA 4JKFA 2ABDA 3E66A 4JK7A 4YL8A 3PVLA 4ILGB 1NTIA 1MIZB 3WA0A 4TKNA 3SBTA 4JKCA 4ILHA 4P7IA 3SBGA 3E9PA 2COPA 1VBGA 2HRJA 2R82A 2YVCA 2DIKA 2ZPYA 4JKHA 2D2QA 4HDQA 4DXAB 3QIJA 4JK9A 3E9OA 1ACAA 4JKGB 1SGHA 4ZRIA 1MIXA 3X23A 1HB8A 4JKGA 1VBHA 2FJ9A 1KBLA 4JK8A 4NY0A 4ILJA 3AU4A 4JKEA 1KC7A 3AU5A 1NI2A 3G9WA 4JKDA 4ZRKA 2CB8A 2I1JA 3FP5A 5IJMA 3ENBA 2LBBA 2J0KA 1E5WA 4F7GA 1Y19B 2J0MA 3IVFA 3U7DA 1GC6A 5JVLA
chains in the Genus database with same CATH topology
2X0SA 1MK7B 1GC7A 2HE7A 1JDEA 1HBKA 3BINA 2RQ1A 2D10A 3FLVA 4ZRJA 2EMSA 3EPYA 1ISNA 3U8ZA 4EKUA 1EF1A 1J19A 4CYEA 2AEHA 1MK9B 2FDQA 1NVLA 1ST7A 3ZDTA 1H4RA 4GXBA 2EMTA 1GGOA 3E9LA 2D11A 2WH5A 1GG3A 2I1KA 4HDOA 1HB6A 4JKBA 2CQUA 2AL6A 2J0JA 4JKAA 3PZDA 1DIKA 4JKFA 2ABDA 3E66A 4JK7A 4YL8A 3PVLA 4ILGB 1NTIA 1MIZB 3WA0A 4TKNA 3SBTA 4JKCA 4ILHA 4P7IA 3SBGA 3E9PA 2COPA 1VBGA 2HRJA 2R82A 2YVCA 2DIKA 2ZPYA 4JKHA 2D2QA 4HDQA 4DXAB 3QIJA 4JK9A 3E9OA 1ACAA 4JKGB 1SGHA 4ZRIA 1MIXA 3X23A 1HB8A 4JKGA 1VBHA 2FJ9A 1KBLA 4JK8A 4NY0A 4ILJA 3AU4A 4JKEA 1KC7A 3AU5A 1NI2A 3G9WA 4JKDA 4ZRKA 2CB8A 2I1JA 3FP5A 5IJMA 3ENBA 2LBBA 2J0KA 1E5WA 4F7GA 1Y19B 2J0MA 3IVFA 3U7DA 1GC6A 5JVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MK7 B;  1GC7 A;  2FJ9 A;  2HE7 A;  1NTI A;  1HBK A;  1MIZ B;  3BIN A;  2RQ1 A;  3PVL A;  4NY0 A;  2D10 A;  2D11 A;  3FLV A;  3WA0 A;  4ZRJ A;  2WH5 A;  3AU4 A;  2EMS A;  3EPY A;  1ISN A;  1GG3 A;  2I1K A;  1NI2 A;  3AU5 A;  3G9W A;  4HDO A;  1HB6 A;  4P7I A;  4ZRK A;  3U8Z A;  2CB8 A;  2COP A;  4EKU A;  2CQU A;  1EF1 A;  2AL6 A;  2HRJ A;  2I1J A;  3FP5 A;  5IJM A;  2J0J A;  2YVC A;  2ZPY A;  1J19 A;  3X23 A;  2LBB A;  2J0K A;  1E5W A;  1MK9 B;  2AEH A;  2D2Q A;  2FDQ A;  4HDQ A;  4CYE A;  4DXA B;  4F7G A;  1Y19 B;  3QIJ A;  3PZD A;  1NVL A;  2J0M A;  1ST7 A;  3IVF A;  3U7D A;  3ZDT A;  1GC6 A;  1H4R A;  2ABD A;  1ACA A;  2EMT A;  1SGH A;  4YL8 A;  4ZRI A;  1MIX A;  1HB8 A; 
#chains in the Genus database with same CATH topology
 2X0S A;  1MK7 B;  1GC7 A;  2HE7 A;  1JDE A;  1HBK A;  3BIN A;  2RQ1 A;  2D10 A;  3FLV A;  4ZRJ A;  2EMS A;  3EPY A;  1ISN A;  3U8Z A;  4EKU A;  1EF1 A;  1J19 A;  4CYE A;  2AEH A;  1MK9 B;  2FDQ A;  1NVL A;  1ST7 A;  3ZDT A;  1H4R A;  4GXB A;  2EMT A;  1GGO A;  3E9L A;  2D11 A;  2WH5 A;  1GG3 A;  2I1K A;  4HDO A;  1HB6 A;  4JKB A;  2CQU A;  2AL6 A;  2J0J A;  4JKA A;  3PZD A;  1DIK A;  4JKF A;  2ABD A;  3E66 A;  4JK7 A;  4YL8 A;  3PVL A;  4ILG B;  1NTI A;  1MIZ B;  3WA0 A;  4TKN A;  3SBT A;  4JKC A;  4ILH A;  4P7I A;  3SBG A;  3E9P A;  2COP A;  1VBG A;  2HRJ A;  2R82 A;  2YVC A;  2DIK A;  2ZPY A;  4JKH A;  2D2Q A;  4HDQ A;  4DXA B;  3QIJ A;  4JK9 A;  3E9O A;  1ACA A;  4JKG B;  1SGH A;  4ZRI A;  1MIX A;  3X23 A;  1HB8 A;  4JKG A;  1VBH A;  2FJ9 A;  1KBL A;  4JK8 A;  4NY0 A;  4ILJ A;  3AU4 A;  4JKE A;  1KC7 A;  3AU5 A;  1NI2 A;  3G9W A;  4JKD A;  4ZRK A;  2CB8 A;  2I1J A;  3FP5 A;  5IJM A;  3ENB A;  2LBB A;  2J0K A;  1E5W A;  4F7G A;  1Y19 B;  2J0M A;  3IVF A;  3U7D A;  1GC6 A;  5JVL A; 
#chains in the Genus database with same CATH homology
 2X0S A;  1MK7 B;  1GC7 A;  2HE7 A;  1JDE A;  1HBK A;  3BIN A;  2RQ1 A;  2D10 A;  3FLV A;  4ZRJ A;  2EMS A;  3EPY A;  1ISN A;  3U8Z A;  4EKU A;  1EF1 A;  1J19 A;  4CYE A;  2AEH A;  1MK9 B;  2FDQ A;  1NVL A;  1ST7 A;  3ZDT A;  1H4R A;  4GXB A;  2EMT A;  1GGO A;  3E9L A;  2D11 A;  2WH5 A;  1GG3 A;  2I1K A;  4HDO A;  1HB6 A;  4JKB A;  2CQU A;  2AL6 A;  2J0J A;  4JKA A;  3PZD A;  1DIK A;  4JKF A;  2ABD A;  3E66 A;  4JK7 A;  4YL8 A;  3PVL A;  4ILG B;  1NTI A;  1MIZ B;  3WA0 A;  4TKN A;  3SBT A;  4JKC A;  4ILH A;  4P7I A;  3SBG A;  3E9P A;  2COP A;  1VBG A;  2HRJ A;  2R82 A;  2YVC A;  2DIK A;  2ZPY A;  4JKH A;  2D2Q A;  4HDQ A;  4DXA B;  3QIJ A;  4JK9 A;  3E9O A;  1ACA A;  4JKG B;  1SGH A;  4ZRI A;  1MIX A;  3X23 A;  1HB8 A;  4JKG A;  1VBH A;  2FJ9 A;  1KBL A;  4JK8 A;  4NY0 A;  4ILJ A;  3AU4 A;  4JKE A;  1KC7 A;  3AU5 A;  1NI2 A;  3G9W A;  4JKD A;  4ZRK A;  2CB8 A;  2I1J A;  3FP5 A;  5IJM A;  3ENB A;  2LBB A;  2J0K A;  1E5W A;  4F7G A;  1Y19 B;  2J0M A;  3IVF A;  3U7D A;  1GC6 A;  5JVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...