1HB6A

Structure of bovine acyl-coa binding protein in orthorhombic crystal form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
86
structure length
86
Chain Sequence
b'SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA BINDING PROTEIN
publication title Binding Site Differences Revealed by Crystal Structures of Plasmodium Falciparum and Bovine Acyl-Coa Binding Protein
pubmed doi rcsb
molecule tags Acyl-coenzyme a binding protein
total genus 36
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2001-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hb6A00
4NY0A 2EMSA 1MK7B 1ISNA 1HBKA 2AEHA 1Y19B 1SGHA 1HB8A 1GG3A 2I1KA 2J0MA 3WA0A 3FP5A 3IVFA 2I1JA 4ZRJA 2J0KA 2WH5A 1ACAA 4HDQA 1J19A 1E5WA 1NI2A 1NVLA 3PZDA 3U8ZA 4ZRKA 2EMTA 2AL6A 2ABDA 4YL8A 2RQ1A 4CYEA 5IJMA 3G9WA 1MK9B 2FJ9A 2HE7A 2ZPYA 3X23A 4HDOA 3QIJA 3EPYA 4ZRIA 1MIZB 1ST7A 2D2QA 2D11A 2J0JA 4DXAB 1NTIA 3BINA 1GC6A 3AU5A 3AU4A 2CB8A 3ZDTA 3PVLA 3U7DA 4EKUA 2YVCA 2FDQA 1GC7A 1MIXA 2LBBA 2HRJA 4F7GA 1H4RA 2COPA 4P7IA 1EF1A 2CQUA 2D10A 3FLVA 1HB6A
chains in the Genus database with same CATH superfamily
3SBTA 2X0SA 2I1JA 4ILHA 1ACAA 3SBGA 1VBHA 2EMTA 2ABDA 1VBGA 4YL8A 2ZPYA 4ZRIA 2D11A 2CB8A 4JKBA 2YVCA 2FDQA 4JKGA 4JKHA 1MIXA 2LBBA 2HRJA 4TKNA 1EF1A 2CQUA 4JKFA 2AEHA 1HB6A 1MK7B 1HBKA 2J0MA 1SGHA 1HB8A 1GG3A 1JDEA 1KC7A 3E9LA 4ZRJA 4JK9A 3PZDA 1GGOA 2AL6A 4CYEA 5IJMA 2HE7A 4HDOA 3QIJA 1ST7A 4ILJA 2D2QA 3BINA 1GC6A 4JKDA 1GC7A 3E9OA 2D10A 3FLVA 4NY0A 1ISNA 1KBLA 1Y19B 4JKCA 3IVFA 4JKEA 1J19A 4JKGB 4GXBA 2RQ1A 3ENBA 1MK9B 3X23A 3EPYA 1MIZB 2J0JA 2R82A 1NTIA 3AU4A 3AU5A 2DIKA 3U7DA 2COPA 3E9PA 4P7IA 2EMSA 2I1KA 3WA0A 3FP5A 2J0KA 2WH5A 1DIKA 1NI2A 1E5WA 1NVLA 3U8ZA 4ZRKA 5JVLA 3G9WA 2FJ9A 4JKAA 4JK7A 4DXAB 4ILGB 3ZDTA 3PVLA 4EKUA 4F7GA 1H4RA 3E66A 4HDQA 4JK8A
chains in the Genus database with same CATH topology
3SBTA 2X0SA 2I1JA 4ILHA 1ACAA 3SBGA 1VBHA 2EMTA 2ABDA 1VBGA 4YL8A 2ZPYA 4ZRIA 2D11A 2CB8A 4JKBA 2YVCA 2FDQA 4JKGA 4JKHA 1MIXA 2LBBA 2HRJA 4TKNA 1EF1A 2CQUA 4JKFA 2AEHA 1HB6A 1MK7B 1HBKA 2J0MA 1SGHA 1HB8A 1GG3A 1JDEA 1KC7A 3E9LA 4ZRJA 4JK9A 3PZDA 1GGOA 2AL6A 4CYEA 5IJMA 2HE7A 4HDOA 3QIJA 1ST7A 4ILJA 2D2QA 3BINA 1GC6A 4JKDA 1GC7A 3E9OA 2D10A 3FLVA 4NY0A 1ISNA 1KBLA 1Y19B 4JKCA 3IVFA 4JKEA 1J19A 4JKGB 4GXBA 2RQ1A 3ENBA 1MK9B 3X23A 3EPYA 1MIZB 2J0JA 2R82A 1NTIA 3AU4A 3AU5A 2DIKA 3U7DA 2COPA 3E9PA 4P7IA 2EMSA 2I1KA 3WA0A 3FP5A 2J0KA 2WH5A 1DIKA 1NI2A 1E5WA 1NVLA 3U8ZA 4ZRKA 5JVLA 3G9WA 2FJ9A 4JKAA 4JK7A 4DXAB 4ILGB 3ZDTA 3PVLA 4EKUA 4F7GA 1H4RA 3E66A 4HDQA 4JK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NY0 A;  2EMS A;  1MK7 B;  1ISN A;  1HBK A;  2AEH A;  1Y19 B;  1SGH A;  1HB8 A;  1GG3 A;  2I1K A;  2J0M A;  3WA0 A;  3FP5 A;  3IVF A;  2I1J A;  4ZRJ A;  2J0K A;  2WH5 A;  1ACA A;  4HDQ A;  1J19 A;  1E5W A;  1NI2 A;  1NVL A;  3PZD A;  3U8Z A;  4ZRK A;  2EMT A;  2AL6 A;  2ABD A;  4YL8 A;  2RQ1 A;  4CYE A;  5IJM A;  3G9W A;  1MK9 B;  2FJ9 A;  2HE7 A;  2ZPY A;  3X23 A;  4HDO A;  3QIJ A;  3EPY A;  4ZRI A;  1MIZ B;  1ST7 A;  2D2Q A;  2D11 A;  2J0J A;  4DXA B;  1NTI A;  3BIN A;  1GC6 A;  3AU5 A;  3AU4 A;  2CB8 A;  3ZDT A;  3PVL A;  3U7D A;  4EKU A;  2YVC A;  2FDQ A;  1GC7 A;  1MIX A;  2LBB A;  2HRJ A;  4F7G A;  1H4R A;  2COP A;  4P7I A;  1EF1 A;  2CQU A;  2D10 A;  3FLV A;  1HB6 A; 
#chains in the Genus database with same CATH topology
 3SBT A;  2X0S A;  2I1J A;  4ILH A;  1ACA A;  3SBG A;  1VBH A;  2EMT A;  2ABD A;  1VBG A;  4YL8 A;  2ZPY A;  4ZRI A;  2D11 A;  2CB8 A;  4JKB A;  2YVC A;  2FDQ A;  4JKG A;  4JKH A;  1MIX A;  2LBB A;  2HRJ A;  4TKN A;  1EF1 A;  2CQU A;  4JKF A;  2AEH A;  1HB6 A;  1MK7 B;  1HBK A;  2J0M A;  1SGH A;  1HB8 A;  1GG3 A;  1JDE A;  1KC7 A;  3E9L A;  4ZRJ A;  4JK9 A;  3PZD A;  1GGO A;  2AL6 A;  4CYE A;  5IJM A;  2HE7 A;  4HDO A;  3QIJ A;  1ST7 A;  4ILJ A;  2D2Q A;  3BIN A;  1GC6 A;  4JKD A;  1GC7 A;  3E9O A;  2D10 A;  3FLV A;  4NY0 A;  1ISN A;  1KBL A;  1Y19 B;  4JKC A;  3IVF A;  4JKE A;  1J19 A;  4JKG B;  4GXB A;  2RQ1 A;  3ENB A;  1MK9 B;  3X23 A;  3EPY A;  1MIZ B;  2J0J A;  2R82 A;  1NTI A;  3AU4 A;  3AU5 A;  2DIK A;  3U7D A;  2COP A;  3E9P A;  4P7I A;  2EMS A;  2I1K A;  3WA0 A;  3FP5 A;  2J0K A;  2WH5 A;  1DIK A;  1NI2 A;  1E5W A;  1NVL A;  3U8Z A;  4ZRK A;  5JVL A;  3G9W A;  2FJ9 A;  4JKA A;  4JK7 A;  4DXA B;  4ILG B;  3ZDT A;  3PVL A;  4EKU A;  4F7G A;  1H4R A;  3E66 A;  4HDQ A;  4JK8 A; 
#chains in the Genus database with same CATH homology
 3SBT A;  2X0S A;  2I1J A;  4ILH A;  1ACA A;  3SBG A;  1VBH A;  2EMT A;  2ABD A;  1VBG A;  4YL8 A;  2ZPY A;  4ZRI A;  2D11 A;  2CB8 A;  4JKB A;  2YVC A;  2FDQ A;  4JKG A;  4JKH A;  1MIX A;  2LBB A;  2HRJ A;  4TKN A;  1EF1 A;  2CQU A;  4JKF A;  2AEH A;  1HB6 A;  1MK7 B;  1HBK A;  2J0M A;  1SGH A;  1HB8 A;  1GG3 A;  1JDE A;  1KC7 A;  3E9L A;  4ZRJ A;  4JK9 A;  3PZD A;  1GGO A;  2AL6 A;  4CYE A;  5IJM A;  2HE7 A;  4HDO A;  3QIJ A;  1ST7 A;  4ILJ A;  2D2Q A;  3BIN A;  1GC6 A;  4JKD A;  1GC7 A;  3E9O A;  2D10 A;  3FLV A;  4NY0 A;  1ISN A;  1KBL A;  1Y19 B;  4JKC A;  3IVF A;  4JKE A;  1J19 A;  4JKG B;  4GXB A;  2RQ1 A;  3ENB A;  1MK9 B;  3X23 A;  3EPY A;  1MIZ B;  2J0J A;  2R82 A;  1NTI A;  3AU4 A;  3AU5 A;  2DIK A;  3U7D A;  2COP A;  3E9P A;  4P7I A;  2EMS A;  2I1K A;  3WA0 A;  3FP5 A;  2J0K A;  2WH5 A;  1DIK A;  1NI2 A;  1E5W A;  1NVL A;  3U8Z A;  4ZRK A;  5JVL A;  3G9W A;  2FJ9 A;  4JKA A;  4JK7 A;  4DXA B;  4ILG B;  3ZDT A;  3PVL A;  4EKU A;  4F7G A;  1H4R A;  3E66 A;  4HDQ A;  4JK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...