1HB8A

Structure of bovine acyl-coa binding protein in tetragonal crystal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA BINDING PROTEIN
publication title Binding Site Differences Revealed by Crystal Structures of Plasmodium Falciparum and Bovine Acyl-Coa Binding Protein
pubmed doi rcsb
molecule tags Acyl-coenzyme a binding protein
total genus 35
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hb8A00
1MIZB 3PVLA 2ZPYA 1SGHA 3AU4A 4DXAB 1NVLA 1HB6A 2FDQA 2J0MA 4NY0A 4F7GA 3G9WA 2COPA 3EPYA 1MK7B 3FP5A 2RQ1A 2HRJA 1HBKA 2CB8A 2I1JA 3FLVA 4EKUA 2EMTA 3PZDA 1ST7A 3QIJA 4ZRKA 1GG3A 4YL8A 2D10A 2D2QA 3U7DA 3ZDTA 1NI2A 2LBBA 2AEHA 3WA0A 1J19A 2CQUA 2D11A 3U8ZA 5IJMA 1GC7A 3AU5A 1H4RA 2AL6A 1MIXA 2I1KA 3IVFA 1E5WA 1ACAA 4P7IA 4HDOA 2J0JA 2WH5A 3X23A 1MK9B 1Y19B 2HE7A 2ABDA 2YVCA 2FJ9A 1GC6A 1NTIA 3BINA 4HDQA 2EMSA 4ZRIA 4ZRJA 4CYEA 2J0KA 1EF1A 1ISNA 1HB8A
chains in the Genus database with same CATH superfamily
3AU4A 4ILHA 1KC7A 1DIKA 2I1JA 2CB8A 3SBGA 3QIJA 1GG3A 2D2QA 2AEHA 3WA0A 1GC7A 2AL6A 4P7IA 4HDOA 3X23A 1GC6A 4HDQA 4ZRIA 4ZRJA 4GXBA 2R82A 3E9OA 1ISNA 1HB6A 2FDQA 2J0MA 4NY0A 3G9WA 1MK7B 2X0SA 3FLVA 4EKUA 4JKGB 4JKHA 2D10A 2LBBA 1VBHA 1J19A 2D11A 3AU5A 1E5WA 1MK9B 1Y19B 2HE7A 2ABDA 2YVCA 4CYEA 4ILJA 2EMSA 2DIKA 3PVLA 2ZPYA 4ILGB 4DXAB 4F7GA 2COPA 3EPYA 3FP5A 4JK8A 1HBKA 3PZDA 4ZRKA 1VBGA 3E66A 4YL8A 4JKDA 4JKCA 4JKGA 2CQUA 4JKFA 3U8ZA 5IJMA 1GGOA 1H4RA 3E9PA 1MIXA 3IVFA 1ACAA 3ENBA 4JK9A 4TKNA 2J0JA 2WH5A 1NTIA 3BINA 2J0KA 1HB8A 1MIZB 1SGHA 1NVLA 3SBTA 5JVLA 2RQ1A 2EMTA 1ST7A 1JDEA 3U7DA 3ZDTA 3E9LA 1NI2A 4JK7A 2I1KA 1KBLA 4JKBA 4JKEA 2FJ9A 1EF1A 4JKAA 2HRJA
chains in the Genus database with same CATH topology
3AU4A 4ILHA 1KC7A 1DIKA 2I1JA 2CB8A 3SBGA 3QIJA 1GG3A 2D2QA 2AEHA 3WA0A 1GC7A 2AL6A 4P7IA 4HDOA 3X23A 1GC6A 4HDQA 4ZRIA 4ZRJA 4GXBA 2R82A 3E9OA 1ISNA 1HB6A 2FDQA 2J0MA 4NY0A 3G9WA 1MK7B 2X0SA 3FLVA 4EKUA 4JKGB 4JKHA 2D10A 2LBBA 1VBHA 1J19A 2D11A 3AU5A 1E5WA 1MK9B 1Y19B 2HE7A 2ABDA 2YVCA 4CYEA 4ILJA 2EMSA 2DIKA 3PVLA 2ZPYA 4ILGB 4DXAB 4F7GA 2COPA 3EPYA 3FP5A 4JK8A 1HBKA 3PZDA 4ZRKA 1VBGA 3E66A 4YL8A 4JKDA 4JKCA 4JKGA 2CQUA 4JKFA 3U8ZA 5IJMA 1GGOA 1H4RA 3E9PA 1MIXA 3IVFA 1ACAA 3ENBA 4JK9A 4TKNA 2J0JA 2WH5A 1NTIA 3BINA 2J0KA 1HB8A 1MIZB 1SGHA 1NVLA 3SBTA 5JVLA 2RQ1A 2EMTA 1ST7A 1JDEA 3U7DA 3ZDTA 3E9LA 1NI2A 4JK7A 2I1KA 1KBLA 4JKBA 4JKEA 2FJ9A 1EF1A 4JKAA 2HRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIZ B;  3PVL A;  2ZPY A;  1SGH A;  3AU4 A;  4DXA B;  1NVL A;  1HB6 A;  2FDQ A;  2J0M A;  4NY0 A;  4F7G A;  3G9W A;  2COP A;  3EPY A;  1MK7 B;  3FP5 A;  2RQ1 A;  2HRJ A;  1HBK A;  2CB8 A;  2I1J A;  3FLV A;  4EKU A;  2EMT A;  3PZD A;  1ST7 A;  3QIJ A;  4ZRK A;  1GG3 A;  4YL8 A;  2D10 A;  2D2Q A;  3U7D A;  3ZDT A;  1NI2 A;  2LBB A;  2AEH A;  3WA0 A;  1J19 A;  2CQU A;  2D11 A;  3U8Z A;  5IJM A;  1GC7 A;  3AU5 A;  1H4R A;  2AL6 A;  1MIX A;  2I1K A;  3IVF A;  1E5W A;  1ACA A;  4P7I A;  4HDO A;  2J0J A;  2WH5 A;  3X23 A;  1MK9 B;  1Y19 B;  2HE7 A;  2ABD A;  2YVC A;  2FJ9 A;  1GC6 A;  1NTI A;  3BIN A;  4HDQ A;  2EMS A;  4ZRI A;  4ZRJ A;  4CYE A;  2J0K A;  1EF1 A;  1ISN A;  1HB8 A; 
#chains in the Genus database with same CATH topology
 3AU4 A;  4ILH A;  1KC7 A;  1DIK A;  2I1J A;  2CB8 A;  3SBG A;  3QIJ A;  1GG3 A;  2D2Q A;  2AEH A;  3WA0 A;  1GC7 A;  2AL6 A;  4P7I A;  4HDO A;  3X23 A;  1GC6 A;  4HDQ A;  4ZRI A;  4ZRJ A;  4GXB A;  2R82 A;  3E9O A;  1ISN A;  1HB6 A;  2FDQ A;  2J0M A;  4NY0 A;  3G9W A;  1MK7 B;  2X0S A;  3FLV A;  4EKU A;  4JKG B;  4JKH A;  2D10 A;  2LBB A;  1VBH A;  1J19 A;  2D11 A;  3AU5 A;  1E5W A;  1MK9 B;  1Y19 B;  2HE7 A;  2ABD A;  2YVC A;  4CYE A;  4ILJ A;  2EMS A;  2DIK A;  3PVL A;  2ZPY A;  4ILG B;  4DXA B;  4F7G A;  2COP A;  3EPY A;  3FP5 A;  4JK8 A;  1HBK A;  3PZD A;  4ZRK A;  1VBG A;  3E66 A;  4YL8 A;  4JKD A;  4JKC A;  4JKG A;  2CQU A;  4JKF A;  3U8Z A;  5IJM A;  1GGO A;  1H4R A;  3E9P A;  1MIX A;  3IVF A;  1ACA A;  3ENB A;  4JK9 A;  4TKN A;  2J0J A;  2WH5 A;  1NTI A;  3BIN A;  2J0K A;  1HB8 A;  1MIZ B;  1SGH A;  1NVL A;  3SBT A;  5JVL A;  2RQ1 A;  2EMT A;  1ST7 A;  1JDE A;  3U7D A;  3ZDT A;  3E9L A;  1NI2 A;  4JK7 A;  2I1K A;  1KBL A;  4JKB A;  4JKE A;  2FJ9 A;  1EF1 A;  4JKA A;  2HRJ A; 
#chains in the Genus database with same CATH homology
 3AU4 A;  4ILH A;  1KC7 A;  1DIK A;  2I1J A;  2CB8 A;  3SBG A;  3QIJ A;  1GG3 A;  2D2Q A;  2AEH A;  3WA0 A;  1GC7 A;  2AL6 A;  4P7I A;  4HDO A;  3X23 A;  1GC6 A;  4HDQ A;  4ZRI A;  4ZRJ A;  4GXB A;  2R82 A;  3E9O A;  1ISN A;  1HB6 A;  2FDQ A;  2J0M A;  4NY0 A;  3G9W A;  1MK7 B;  2X0S A;  3FLV A;  4EKU A;  4JKG B;  4JKH A;  2D10 A;  2LBB A;  1VBH A;  1J19 A;  2D11 A;  3AU5 A;  1E5W A;  1MK9 B;  1Y19 B;  2HE7 A;  2ABD A;  2YVC A;  4CYE A;  4ILJ A;  2EMS A;  2DIK A;  3PVL A;  2ZPY A;  4ILG B;  4DXA B;  4F7G A;  2COP A;  3EPY A;  3FP5 A;  4JK8 A;  1HBK A;  3PZD A;  4ZRK A;  1VBG A;  3E66 A;  4YL8 A;  4JKD A;  4JKC A;  4JKG A;  2CQU A;  4JKF A;  3U8Z A;  5IJM A;  1GGO A;  1H4R A;  3E9P A;  1MIX A;  3IVF A;  1ACA A;  3ENB A;  4JK9 A;  4TKN A;  2J0J A;  2WH5 A;  1NTI A;  3BIN A;  2J0K A;  1HB8 A;  1MIZ B;  1SGH A;  1NVL A;  3SBT A;  5JVL A;  2RQ1 A;  2EMT A;  1ST7 A;  1JDE A;  3U7D A;  3ZDT A;  3E9L A;  1NI2 A;  4JK7 A;  2I1K A;  1KBL A;  4JKB A;  4JKE A;  2FJ9 A;  1EF1 A;  4JKA A;  2HRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...