1HB8A

Structure of bovine acyl-coa binding protein in tetragonal crystal form
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
86
structure length
86
Chain Sequence
b'SQAEFDKAAEEVKHLKTKPADEEMLFIYSHYKQATVGDINTERPGMLDFKGKAKWDAWNELKGTSKEDAMKAYIDKVEELKKKYGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACYL-COA BINDING PROTEIN
publication title Binding Site Differences Revealed by Crystal Structures of Plasmodium Falciparum and Bovine Acyl-Coa Binding Protein
pubmed doi rcsb
molecule tags Acyl-coenzyme a binding protein
total genus 35
structure length 86
sequence length 86
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2001-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00887 ACBP Acyl CoA binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 1hb8A00
3QIJA 3WA0A 4ZRKA 4ZRIA 2YVCA 5IJMA 2D2QA 2LBBA 3FP5A 1Y19B 3FLVA 3IVFA 3PZDA 1ST7A 2HRJA 4HDQA 1H4RA 4CYEA 2CQUA 2AL6A 4HDOA 1MK7B 2FJ9A 1MIZB 2I1JA 2J0KA 2D10A 4ZRJA 1HB6A 3X23A 4EKUA 2RQ1A 1ISNA 1E5WA 2J0JA 1J19A 2EMSA 2D11A 1SGHA 3BINA 2I1KA 1MIXA 4F7GA 1NTIA 2WH5A 1HB8A 1NI2A 3EPYA 1GC6A 4NY0A 3AU5A 1GG3A 3G9WA 1EF1A 4DXAB 3ZDTA 2ABDA 2FDQA 3PVLA 2CB8A 1ACAA 2AEHA 1MK9B 4P7IA 3U8ZA 1HBKA 3U7DA 2J0MA 2EMTA 4YL8A 2ZPYA 2HE7A 2COPA 1NVLA 1GC7A 3AU4A
chains in the Genus database with same CATH superfamily
3QIJA 2R82A 4ILHA 4ZRIA 5IJMA 4JKFA 3IVFA 1H4RA 4CYEA 4HDOA 4EKUA 1VBGA 1HB6A 2I1KA 1HB8A 4DXAB 3G9WA 1EF1A 1KC7A 2CB8A 2DIKA 3U8ZA 1HBKA 4JKBA 4YL8A 3X23A 1ISNA 1GC7A 3WA0A 4GXBA 3FP5A 1Y19B 2HRJA 2COPA 4JK9A 4ZRJA 2D10A 1E5WA 4JKGA 4TKNA 3E9PA 1GGOA 1SGHA 3BINA 1KBLA 1NTIA 2WH5A 3E9OA 2FDQA 4JKEA 1JDEA 1MK9B 4P7IA 3U7DA 4JK7A 2J0MA 4ILGB 2HE7A 1NVLA 4ZRKA 2YVCA 2LBBA 1VBHA 1ST7A 2CQUA 2AL6A 1MK7B 2FJ9A 1MIZB 2I1JA 2J0KA 2X0SA 2RQ1A 4JKCA 2EMSA 4F7GA 3SBTA 4NY0A 1GG3A 4JK8A 3ZDTA 3E9LA 2ABDA 2AEHA 4JKAA 4JKGB 3E66A 2EMTA 1DIKA 3AU4A 2D2QA 4JKDA 3FLVA 3PZDA 4HDQA 2J0JA 1J19A 2D11A 4JKHA 1MIXA 3EPYA 1NI2A 1GC6A 3AU5A 5JVLA 3PVLA 1ACAA 4ILJA 2ZPYA 3ENBA 3SBGA
chains in the Genus database with same CATH topology
3QIJA 2R82A 4ILHA 4ZRIA 5IJMA 4JKFA 3IVFA 1H4RA 4CYEA 4HDOA 4EKUA 1VBGA 1HB6A 2I1KA 1HB8A 4DXAB 3G9WA 1EF1A 1KC7A 2CB8A 2DIKA 3U8ZA 1HBKA 4JKBA 4YL8A 3X23A 1ISNA 1GC7A 3WA0A 4GXBA 3FP5A 1Y19B 2HRJA 2COPA 4JK9A 4ZRJA 2D10A 1E5WA 4JKGA 4TKNA 3E9PA 1GGOA 1SGHA 3BINA 1KBLA 1NTIA 2WH5A 3E9OA 2FDQA 4JKEA 1JDEA 1MK9B 4P7IA 3U7DA 4JK7A 2J0MA 4ILGB 2HE7A 1NVLA 4ZRKA 2YVCA 2LBBA 1VBHA 1ST7A 2CQUA 2AL6A 1MK7B 2FJ9A 1MIZB 2I1JA 2J0KA 2X0SA 2RQ1A 4JKCA 2EMSA 4F7GA 3SBTA 4NY0A 1GG3A 4JK8A 3ZDTA 3E9LA 2ABDA 2AEHA 4JKAA 4JKGB 3E66A 2EMTA 1DIKA 3AU4A 2D2QA 4JKDA 3FLVA 3PZDA 4HDQA 2J0JA 1J19A 2D11A 4JKHA 1MIXA 3EPYA 1NI2A 1GC6A 3AU5A 5JVLA 3PVLA 1ACAA 4ILJA 2ZPYA 3ENBA 3SBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QIJ A;  3WA0 A;  4ZRK A;  4ZRI A;  2YVC A;  5IJM A;  2D2Q A;  2LBB A;  3FP5 A;  1Y19 B;  3FLV A;  3IVF A;  3PZD A;  1ST7 A;  2HRJ A;  4HDQ A;  1H4R A;  4CYE A;  2CQU A;  2AL6 A;  4HDO A;  1MK7 B;  2FJ9 A;  1MIZ B;  2I1J A;  2J0K A;  2D10 A;  4ZRJ A;  1HB6 A;  3X23 A;  4EKU A;  2RQ1 A;  1ISN A;  1E5W A;  2J0J A;  1J19 A;  2EMS A;  2D11 A;  1SGH A;  3BIN A;  2I1K A;  1MIX A;  4F7G A;  1NTI A;  2WH5 A;  1HB8 A;  1NI2 A;  3EPY A;  1GC6 A;  4NY0 A;  3AU5 A;  1GG3 A;  3G9W A;  1EF1 A;  4DXA B;  3ZDT A;  2ABD A;  2FDQ A;  3PVL A;  2CB8 A;  1ACA A;  2AEH A;  1MK9 B;  4P7I A;  3U8Z A;  1HBK A;  3U7D A;  2J0M A;  2EMT A;  4YL8 A;  2ZPY A;  2HE7 A;  2COP A;  1NVL A;  1GC7 A;  3AU4 A; 
#chains in the Genus database with same CATH topology
 3QIJ A;  2R82 A;  4ILH A;  4ZRI A;  5IJM A;  4JKF A;  3IVF A;  1H4R A;  4CYE A;  4HDO A;  4EKU A;  1VBG A;  1HB6 A;  2I1K A;  1HB8 A;  4DXA B;  3G9W A;  1EF1 A;  1KC7 A;  2CB8 A;  2DIK A;  3U8Z A;  1HBK A;  4JKB A;  4YL8 A;  3X23 A;  1ISN A;  1GC7 A;  3WA0 A;  4GXB A;  3FP5 A;  1Y19 B;  2HRJ A;  2COP A;  4JK9 A;  4ZRJ A;  2D10 A;  1E5W A;  4JKG A;  4TKN A;  3E9P A;  1GGO A;  1SGH A;  3BIN A;  1KBL A;  1NTI A;  2WH5 A;  3E9O A;  2FDQ A;  4JKE A;  1JDE A;  1MK9 B;  4P7I A;  3U7D A;  4JK7 A;  2J0M A;  4ILG B;  2HE7 A;  1NVL A;  4ZRK A;  2YVC A;  2LBB A;  1VBH A;  1ST7 A;  2CQU A;  2AL6 A;  1MK7 B;  2FJ9 A;  1MIZ B;  2I1J A;  2J0K A;  2X0S A;  2RQ1 A;  4JKC A;  2EMS A;  4F7G A;  3SBT A;  4NY0 A;  1GG3 A;  4JK8 A;  3ZDT A;  3E9L A;  2ABD A;  2AEH A;  4JKA A;  4JKG B;  3E66 A;  2EMT A;  1DIK A;  3AU4 A;  2D2Q A;  4JKD A;  3FLV A;  3PZD A;  4HDQ A;  2J0J A;  1J19 A;  2D11 A;  4JKH A;  1MIX A;  3EPY A;  1NI2 A;  1GC6 A;  3AU5 A;  5JVL A;  3PVL A;  1ACA A;  4ILJ A;  2ZPY A;  3ENB A;  3SBG A; 
#chains in the Genus database with same CATH homology
 3QIJ A;  2R82 A;  4ILH A;  4ZRI A;  5IJM A;  4JKF A;  3IVF A;  1H4R A;  4CYE A;  4HDO A;  4EKU A;  1VBG A;  1HB6 A;  2I1K A;  1HB8 A;  4DXA B;  3G9W A;  1EF1 A;  1KC7 A;  2CB8 A;  2DIK A;  3U8Z A;  1HBK A;  4JKB A;  4YL8 A;  3X23 A;  1ISN A;  1GC7 A;  3WA0 A;  4GXB A;  3FP5 A;  1Y19 B;  2HRJ A;  2COP A;  4JK9 A;  4ZRJ A;  2D10 A;  1E5W A;  4JKG A;  4TKN A;  3E9P A;  1GGO A;  1SGH A;  3BIN A;  1KBL A;  1NTI A;  2WH5 A;  3E9O A;  2FDQ A;  4JKE A;  1JDE A;  1MK9 B;  4P7I A;  3U7D A;  4JK7 A;  2J0M A;  4ILG B;  2HE7 A;  1NVL A;  4ZRK A;  2YVC A;  2LBB A;  1VBH A;  1ST7 A;  2CQU A;  2AL6 A;  1MK7 B;  2FJ9 A;  1MIZ B;  2I1J A;  2J0K A;  2X0S A;  2RQ1 A;  4JKC A;  2EMS A;  4F7G A;  3SBT A;  4NY0 A;  1GG3 A;  4JK8 A;  3ZDT A;  3E9L A;  2ABD A;  2AEH A;  4JKA A;  4JKG B;  3E66 A;  2EMT A;  1DIK A;  3AU4 A;  2D2Q A;  4JKD A;  3FLV A;  3PZD A;  4HDQ A;  2J0J A;  1J19 A;  2D11 A;  4JKH A;  1MIX A;  3EPY A;  1NI2 A;  1GC6 A;  3AU5 A;  5JVL A;  3PVL A;  1ACA A;  4ILJ A;  2ZPY A;  3ENB A;  3SBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...