1HBRA

R-state form of chicken hemoglobin d
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
141
structure length
141
Chain Sequence
MLTAEDKKLIQQAWEKAASHQEEFGAEALTRMFTTYPQTKTYFPHFDLSPGSDQVRGHGKKVLGALGNAVKNVDNLSQAMAELSNLHAYNLRVDPVNFKLLSQCIQVVLAVHMGKDYTPEVHAAFDKFLSAVSAVLAEKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural and functional analysis of the hemoglobin D component from chicken.
pubmed doi rcsb
molecule tags Oxygen storage/transport
molecule keywords PROTEIN (HEMOGLOBIN D)
total genus 52
structure length 141
sequence length 141
chains with identical sequence C
ec nomenclature
pdb deposition date 1998-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00042 Globin Globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 1hbrA00
102MA 1DXVB 1M9PB 3UHTA 5JDOE 3ZJHA 4N7NA 1Q1FA 1HLMA 1CH4A 1URYA 3GOUB 3UHZA 1J41B 2KSCA 3LB1A 1Y7ZB 2GKNA 4N7PA 1QSIB 1SPEA 3PT7A 1HGBA 3UH6A 4TYXA 5JGGA 1HACB 3WHMA 2ZS1C 2QSSB 3GDJB 1O1LB 1VXHA 3HRWA 2W72A 2EKUA 3ZJMA 1JF4A 1YENB 3EOKB 5JGGB 5E83A 1NZ3A 1FN3A 1C7CA 4MQCB 1YOHA 1DO1A 2MGDA 3O89A 1B86A 1LFTA 1Y4RA 3R0GA 4MQJB 5CNEA 5E83B 2PGHB 3BJ2A 4FWXA 1TESA 1MWBA 1U7SA 1HCOB 2R4ZA 3ZJLA 3NL7B 3HYUA 4MBNA 1SI4A 1MZ0A 2HBGA 3QM5A 3PI1A 1J7SA 2WTGA 4ILZA 1RQAB 4M4AA 4MU5A 3NFEA 1R1YB 3W4UA 1CQXA 1Y0DA 5E29B 1YEQB 1RQ4A 2LH1A 1YHEA 1GBVA 2FRIX 1O1IA 3UBVA 1MLMA 1MODA 2SPLA 3BJ3B 5HY8B 1UFJA 1BZ0A 1O1IB 3AQ9A 1MLJA 6HBWA 1SPGB 1LH1A 5EE4C 2MGLA 5JDOD 3QM7A 4C0NA 1UFPA 1A3NA 1J52A 1WLAA 1QXDA 1Y4GA 3ASEA 3WCTB 1MOCA 1O1KB 1VXCA 1CIKA 1J40A 1MLKA 1MTKA 2Z6NA 1IBEB 3R5IB 3OK5A 1H97A 5JDOC 1HV4A 2V1FA 5AZRA 1UIWA 2G3HA 5SW7B 4L2MA 1CIOA 3ED9A 3OO4A 111MA 3G53A 5CNBA 1COHA 1YMBA 3PT8B 1A9WE 1HSYA 1MLOA 5F0BA 5CN6A 1ASHA 3S1JA 1YCAA 1J7WA 1CO8A 4N7NB 1Y7GB 2R4YA 2Z8AA 1V75B 1YDZB 1IBEA 4ROLA 5CNGA 1FHJA 3EDAA 3S48C 1HDBA 1Y31B 2DN1B 4U8UA 3ZJNA 3OVUC 2OLPA 2BLIA 1QI8B 3P5QA 4MPMA 5EUIA 5MBAA 2OHBA 4YU4B 3UBCA 1CG8B 1O1NA 2G14A 4MQCA 4FC3A 4ROMA 2HBSA 1G09A 2MGGA 1O1JB 1NZ2A 1YGFB 1YIHB 1IT3A 1VWTA 1YE2B 1MNOA 1YH9B 3LHBA 1S5YB 3ARLA 1LFQA 2HHBA 2D60B 1Y8HB 3MJPA 3MJPB 1K1KB 1CP0A 1FLPA 4WJGA 2B7HB 4DC8A 3W4UB 110MA 3AT5B 4KN3A 1O1LA 3HRWB 1A6KA 3NMLA 1BZ6A 1JP8A 1MOHA 1XY0B 1YIEB 2SPNA 1SPGA 2ZSSA 1BVDA 2DHBA 1FSXA 1V9QA 2NSSA 5CMVA 1MLRA 4YU4A 5HLXA 1MCYA 2HHDA 5KERA 3K3UA 3M3AA 1T1NB 3ECZA 1MYIA 4F6JA 3GDJA 5C6EA 2VLZA 3EU1A 2QLSA 1RTEA 1RPSB 3FH9B 2ZLXB 1JZKA 2ZFBA 1YEVA 1DWSA 5CN5A 3BJ3A 3FH9A 1LTWA 1XZ2B 3PELB 2D5ZB 2ZFBB 5D1VA 3WFUA 1YIEA 3GQPA 3SZKA 1YZIA 2Z6SA 1YHRA 1YHUD 2BLJM 5CNDA 2G12A 2W72B 3VRGB 1Y22B 1AZIA 4HRTB 1YVTB 4UURA 3H58A 2DXMB 2QMBA 1BUWA 3UHXA 2HHEA 2Z6NB 3WCPA 1W92A 1Y0TB 3G52A 3QJBB 2DC3A 3UGZA 2G0XA 1MDNA 1URVA 1XYEB 1NS9B 1UT0A 1MLSA 1WVPA 3HF4A 3NFEB 3OJ1A 1BIJA 3HHBA 1QI8A 1PBXA 1L2KA 1HBHA 4FWZA 1LJWA 3UHIA 1SDLA 3QZZA 2DN2A 1Y31A 1IT2A 2ZLVA 5M3SA 5HY8A 4F6BA 2QSPA 2IG3A 2SPOA 1S5XB 1LFLB 1U7RA 1YEVB 3KMFA 2ZSZA 3HXNB 3UHHA 3WR1B 1CH1A 1A0UA 2G0ZA 2D6CA 3HEPA 3UHCA 1Y8WB 1HDBB 1O1OB 2DN1A 1HGAA 3DHRB 2QFKA 3G46A 4F68A 1N9FA 3UH7A 104MA 1XZ5A 1MBSA 4F6FA 1VRFA 1YHUC 1GBUB 1EBTA 3UHKA 4F6DA 1Z8UB 2YRSB 2EVKA 1EWAA 3ZJPA 1HDAB 1YEOB 1YEOA 1CMYB 3D1KB 3HEOA 2MBWA 4MQHB 1JY7B 1JY7A 3QZXA 3HF4B 1CMYA 4DC7A 3OO4B 3DHTB 1AJ9B 2HZ2A 2OH9A 1JP6A 1ABYA 4MQKA 1QSIA 1UX9A 1C7CB 1OFKA 3UHEA 4FH7A 2W31A 5D5RA 3LQDA 2MGEA 4HRRB 3ZOMA 5E6EA 1MLHA 1JWNA 1YMCA 3SDNA 3PI9A 1FDHA 2GRFA 2O5TX 5CN8A 1YHRB 4M4AB 1HGBB 1HLBA 3CIUA 108MA 1Y0TA 2EVPA 2AV0A 1ECNA 1FHJB 1AJHA 2XKHA 3GKVA 3GYSA 1JL6A 1G0BB 2V1JA 1MLQA 5ILRA 1D8UA 5AB8A 1HDSA 3G4YA 3GYSB 4HBIA 2AUPA 2O5LX 1MLFA 3VHBA 3WCUD 2HBCB 4H2LB 1GDIA 2R4WA 1DXTA 3EOKA 3HHBB 5CN4A 3AT5A 1GDKA 1NPGA 3IC2A 1Y85B 1SDLB 1YFFA 5EOHA 2HCOB 1PBXB 1THBB 2W6WA 1GZXB 1Y09A 2PGHA 3QJEA 4G1VA 5IKSA 1J7YB 1BZPA 3E55A 1DUOA 1FAWB 1Y0AA 1CLSA 3S66B 1ECOA 1RQ4B 3D1AB 4DWUA 1HBRA 1KD2A 3QJDA 3VRFB 1OBMA 3ONZA 3PI8B 5EV5A 4HHBA 2B7HA 1XQ5A 2ZS0D 1JEBB 1EW6A 1Y4BA 3UHQA 6HBWB 1JP9A 2GKMA 1HBBA 3OO5B 1R1XB 4MQGA 1GDJA 2MGJA 1MOBA 4HSXA 1DXVA 2D5ZA 5KKKA 1YVTA 1Y4VB 2AURA 2FAMA 2VLYA 1V4XB 3M39A 2VHBA 4MQHA 5C6YA 2ZLXA 1NIHB 4AVEA 2MYCA 2ZLWB 1YOGA 1A3OA 2DN3B 2DN3A 1RVWB 1XZ7B 1LFYA 4IROA 4IROB 3AQ5A 4NZIA 1VXEA 1BJEA 2C0KA 1PMBA 2G11A 3GQGA 1NEJB 3MVCA 1Y5KA 2ZS0B 3AQ7A 1XZVB 1GVHA 2BK9A 3P5QB 2H8FB 1LFZB 1YCBA 3WCVD 3RJ6A 1OR4A 1LHSA 1DLWA 3MKBB 4VHBA 1AJGA 1RTXA 1OUTA 1SI4B 1BABA 3WR1A 2ZSPA 1A4FB 3WCUA 3M38A 3KMFC 1UMOA 1G09B 3ZJJA 1Y8HA 101MA 3UGYA 1GCVA 3QJCB 1CO9A 4F6IA 1CG5B 1Y83A 3OGBA 5EYSA 3A59A 1MWCA 1HBBB 4NXAA 1G0BA 4WJG1 3LB3A 1CG8A 5JDOF 2LH5A 1XZVA 1GLIB 1Y85A 3ZJOA 1Y8WA 2MHBB 3ZJRA 1YG5A 1DLYA 1YHUA 1XXTB 4H0BA 1MBNA 3AT6A 1X9FD 3OZUA 1S5YA 3HXNA 1MNKA 1J41A 1NS6A 1A6GA 1Y7DA 1S5XA 2ZSRA 1LH6A 1Y5FA 1O1KA 1IDRA 2D2NB 1Y7CA 1YHEB 3EU1B 2AA1B 1Y2ZB 1HBRB 1KD2B 1SDKB 1A6NA 4HRRA 3UI0A 2W6VB 2AV3A 1HBGA 4XDIA 3G4WA 1NQPB 1J7WB 1V4UB 3ECXA 1S61A 3WTGB 4ROMB 2V1KA 3MYNA 4U8UC 1HHOA 1O1PA 1Y0CA 4M4BB 3BCQA 3BJ1A 1CH5A 3WCVA 1Y8IB 1EMYA 5MBNA 1CH7A 1MTIA 1BZRA 2HBEB 1HABA 3IC0A 1I3DA 1NS9A 1Y46B 3WCTD 2GL3A 2LH6A 1EBCA 2ZLTB 1Y4QB 1VHBA 1VXAA 2R50A 1CH3A 3B75B 3AT6B 2QSPB 4WCHD 1JZLA 3PI2A 1Y0DB 2DXMA 3A0GB 5JOMA 2MGHA 2SPMA 1N9IA 1SHRB 1SHRA 2O5SX 5AZQA 2ZLWA 1G08B 2VEBA 2XKIA 3AQ6A 4HHBB 1DUKA 3VAUA 1LH2A 3ARKA 1YGDB 4L7YA 1LFLA 3IA3B 2ZSYA 1YEUB 3LR9A 1BZZA 3G4RA 2VM0A 2V1EA 1H1XA 2ZFOC 3QM9A 3DHRA 1NPFA 1DTMA 1Y4PB 2R80A 3G4QA 1O16A 1X46A 3DUTA 2MHBA 2HCOA 1NGKA 2JHOA 3A5BA 4ODCA 3IC2B 3TM3A 1MYZA 1DKEA 1VXFA 1Y35B 3BOMA 2VRYA 1HDAA 1XZUA 1K0YB 4NK1A 2QU0B 1MLUA 1S6AA 1Y0AB 2HHEB 3TLDA 4MXLA 2D2ND 2HBFB 3GKTA 1NS6B 1ABYB 4MQKB 1MYMA 2VLXA 2G0RA 2VYZA 2BMMA 1MLGA 1JW8A 1COHB 2OIFA 5CHRA 1OUUA 4X0LA 1YHUB 3V2VA 3PI9B 1ABSA 1GBUA 4O4ZA 2EB9A 3ODQA 3PI4A 2VYYA 4NI0B 1LHTA 4N7PB 5HLQA 4G1BA 3ECLA 4YU3B 2ZT4A 1YGDA 4L7YB 4NI0A 3UHNA 1VXGA 2ZS1A 4NK2A 5CNCA 1JL7A 3UH3A 1WMUB 1RPSA 2O5MX 1XZ7A 1BZ1B 3D7OA 4AVDA 2ZWJA 1HBSA 1BIJB 3QQRA 4H2LA 4UIQA 4N8TB 2DN2B 1CBMA 2MGCA 1YG5B 4U8UB 3WHMB 2D5XB 2ZSTA 3KUOA 1HDSB 1LFVB 1Y4QA 3GK9A 3RGKA 2DHBB 3CY5B 5HAVA 1XZ4B 1LFTB 1MNJA 3ZOLA 1Y5JA 3ZHWA 3D17B 3A9MA 2Z85A 1O1NB 1CLSB 5EQMA 3UHBA 3DR9A 2BW9M 4KMVA 1Y5JB 2O58X 3HENA 3S65A 105MA 1S56A 3WFWA 2GNVA 1DXUA 7HBIA 1FDHG 1VWTB 3K8BB 5HLUA 1NXFA 1OR6A 4ROLB 1O1MA 1ABWA 3WCWA 2HBCA 3LB4A 1XZ5B 2ZSNA 2D2NA 2ZFOB 1MYJA 1J3ZA 5CHQA 4B4YA 1XZ4A 2MYAA 4OF9A 3M3BA 1RSEA 2AA1A 1T1NA 3OO5A 1C40B 1C7DB 5KERB 1Y4PA 2R1HA 4IT8A 1NIHA 2HZ3A 2OHAA 3D7OB 1DXDA 1Y7DB 2RAOB 1DTIA 6HBIA 2NRLA 3UHDA 4C44A 1HBAB 2LH3A 3G4VA 3PELA 1HV4B 3NMMB 1FN3B 2RAOA 1HRMA 2ZSQA 1KFRA 1UC3A 2D2MD 1A01B 4PQ6A 4ESAA 3IXFA 1R1XA 2H8DA 2MGFA 3WFXA 3PI3A 1MKOA 3ODQB 1Y22A 2H35B 1N9XA 3PT8A 2D2NC 1V75A 1OUTB 2ZT0A 4M4BA 2ZSOA 3NL7A 2G0VA 1XCHA 1HHOB 2W6YA 1BZZB 1QPWA 1YEUA 3S66A 1V4WB 1LH5A 1J40B 2FRFA 3RJNB 1CG5A 1Y83B 2NSRA 2HBDA 2ZT1A 1HBHB 1Y5KB 2D5XA 1IOPA 1FCSA 3PI8A 2O5BX 3MYMA 2MGMA 1QSHB 1NWIA 5ILPA 2W72C 1F63A 4FWYA 2GRHA 1C40A 4JACA 2E2YA 1YE2A 3LQDB 1MTJA 2PEGB 3MOUA 3BJ2B 2GDMA 5EE4D 2R4XA 1GDLA 1B86B 1Y4RB 4MQJA 3ZJIA 2O5OX 2BKMA 3CIUB 3WCTA 3NG6B 1MLNA 1IWHB 1O1OA 1OFJA 1K0YA 1J3YB 2LH2A 4F4OA 2AUQA 1HJTA 2MGAA 3ONZB 1S69A 5B84A 1DO3A 1A0ZB 3WCUC 1YVQB 1TU9A 1OJ6A 5CN7A 1Y8KA 2FRJX 1FSXB 5F2AA 2WY4A 1Y4VA 3WFTA 3UHYA 106MA 1A9WA 1XY0A 1M9PA 3BOMB 1Y4GB 1XZUB 1BUWB 2ZLUA 4KMWA 5ILMA 3BJ1B 1YE0A 1A4FA 3WCUB 4G51A 2HHBB 3D1KA 1RQ3B 3MJUA 1LFYB 1GJNA 3QJBA 2D60A 1C7DA 1Y7CB 3WCVB 3PT7B 4GZGA 2ZS1D 1MYHA 3GOUA 2V1IA 3UHUA 4YU3A 1CPWA 3GQPB 1DWTA 1HGCA 1BZ0B 2QLSB 1YENA 3E4NA 1BBBA 1ITHA 1V07A 2FALA 2V1GA 1HBSB 4MBAA 1Y45A 2EKTA 2HBEA 2GTLA 1BABB 3MBAA 3MKBA 1UVXA 3NG6A 109MA 1CH9A 1JDOA 1S0HB 2ZFOD 3GLNA 1V4WA 2MYBA 1DM1A 1YMAA 1Y0WA 1Y0WB 4BJAA 3U3EA 1VREA 1YEQA 1DWRA 2ZT2A 4NS2A 1MBAA 1O1MB 4TWVA 4PQBA 3WCWB 1VXDA 1HABB 1G9VA 4NI1B 1THBA 1LJWB 4MXKA 2HBDB 4NXCA 4O2GA 3UHVA 3ZJSA 2RI4A 1SDKA 1HBIA 1JF3A 1BBBB 1J3ZB 1LUEA 3E5IA 1A3NB 1CBLA 4B3WA 1MBIA 1NWNA 3K9ZA 4ZVBA 5KDQA 1HCOA 1YH9A 1X9FB 5B85A 1X9FC 5EETA 1Y5FB 1J7YA 3WTGA 1O1JA 2QMBB 1FAWA 1MNIA 3NMMA 2PEGA 1X9FA 2QU0A 1G0AB 3PIAA 1GCVB 5CNFA 1K1KA 1M6MA 1CH2A 1NEJA 5E29A 3QJDB 3VRFA 4HSWA 4XS0A 1DO7A 2D2MC 1A01A 2H35A 3D1AA 5SW7A 3A5AA 1MBOA 1GLIA 4F6GA 3AG0A 2D2MA 2VYWA 2YRSA 1A00A 1MBDA 1NQPA 2ZLVB 1S0HA 3MN0A 4MAXA 2W6VA 1QPWB 2GRZA 3WCWD 1B0BA 4HRTA 3LB2A 5C6EB 1RVWA 1FSLA 1BINA 3E5OA 2ZLUB 1MYFA 3KUNA 4F4OB 1BZ1A 3WCVC 2R1HB 3QQQA 1WMUA 4G51B 1Y0CB 3HC9A 2ZS1B 1J3FA 4NI1A 1Y8IA 2HBFA 1QXEA 2GLNA 1LFZA 103MA 5ILEA 1HGCB 1LFVA 3S1IA 3DHTA 1Y4BB 4O1TA 1MOAA 2ZT3A 2LHBA 3VRGA 1Y46A 4LPIA 1JZMA 1XXTA 2FRKX 1GCWB 3QJEB 3S65B 4ODCB 3HYUB 1C7BA 1C7BB 1HACA 1MLLA 1LFQB 1DO4A 3QMAA 1IWHA 1YIHA 2EF2A 1IRCA 1F5PA 4FH6A 2VEEA 1YDZA 3G4UA 1O1PB 2MGIA 5HU6A 1AJ9A 3GQRA 3GQRB 1A0ZA 4OODA 3WCPB 4ZVAA 2ZSXA 1V5HA 3OZVA 1LH3A 3ARJA 5EUIB 3WI8A 2V1HA 4N8TA 3BA2A 2LH7A 1MGNA 2QRWA 1X3KA 3ZH0A 1M6CA 5E6EB 4JYQA 2EB8A 1OUUB 4X0LB 1YE0B 1R1YA 4QAUA 2HBSB 3ZJQA 2OH8A 2IN4A 3VREB 3VREA 3WCTC 4PNJA 1MWDA 2MB5A 1A6MA 1CQ2A 3R5IA 3GQGB 3A2GA 2G10A 4KJTA 5EU2A 1HGAB 4XS0B 1Y8KB 1J7SB 1NZ5A 2G0SA 3QJCA 4MQIB 3K8BA 1XQ5B 3FS4A 2QFNA 4H07A 3MJUB 1RQ3A 1A0UB 1Y01B 1Y45B 3PIAB 2NX0A 1LA6A 1LA6B 1Y2ZA 2RI4B 2ZFOA 1GCWA 3QM6A 1I3EA 1MKOB 2GTLC 1YZIB 2Z6TA 1JPBA 4SDHA 5KDQB 3D17A 3OZWA 1V4UA 1A00B 1NZ4A 2MGBA 2BLHA 2QSSA 1MYGA 1G08A 1N9HA 1BVCA 3UHSA 1QXDB 1YOIA 5HBIA 2XKGA 1DXTB 2AUOA 1CP5A 3B75A 3TM9A 1XZ2A 2H8DB 1UX8A 2ZLTA 2HZ1A 3SDHA 3D4XB 4ESAB 4DWTA 2H8FA 2BWHA 2MYDA 1MNHA 4FC3B 3UHWA 107MA 2GNWA 2XYKA 1NAZA 2O5QX 1RQAA 3A0GA 5CN9A 4TWUA 3UH5A 5EYJA 1XYEA 1DXUB 1G0AA 1Y7GA 112MA 4MQIA 1G9VB 2MGKA 1MBCA 3EDBA 1Y7ZA 3A59B 1Y4FA 1Y4FB 2M6ZA 2M6ZB 3WCWC 3GKVB 4MQGB 1UIWB 1MYTA 1GBVB 3A5GA 4O35A 4UZVA 1JEBA 1SWMA 3QM8A 1YFFB 3IC0B 3CY5A 1DKEB 1Y35A 4N7OA 1YVQA 1GZXA 1Y09B 3V2ZA 3DUTB 2HHDB 1IRDA 1IRDB 2W6XA 1KR7A 3H57A 1A3OB 1VXBA 2GTLD 2R80B 1YGFA 2NRMA 3BCQB 4F69A 3AQ8A 2WTHA 1J3YA 1DXCA 4U8UD 4O4TA 1QXEB 1F5OA 1HBAA 1F65A 3UHRA 2ZS0A 5HU6B 3ORDA 3D4XA 1ABWB 3LR7A 2ZS0C 2D2MB 2BNLA 3FS4B 2CMMA 2GTLB 1ECAA 1QSHA 1LH7A 2MYEA 1UVYA 3UHGA 4PQCA 1ECDA 4N7OB 3SZKB 1V4XA 3O7NA
chains in the Genus database with same CATH superfamily
102MA 1DXVB 1M9PB 3UHTA 5JDOE 3ZJHA 4N7NA 1Q1FA 1HLMA 1CH4A 1URYA 3GOUB 3UHZA 1J41B 2KSCA 3LB1A 1Y7ZB 2GKNA 4N7PA 1QSIB 1SPEA 3PT7A 1HGBA 3UH6A 4TYXA 5JGGA 1HACB 3WHMA 2ZS1C 2QSSB 3GDJB 1O1LB 1VXHA 3HRWA 2W72A 2EKUA 3ZJMA 1JF4A 1YENB 3EOKB 5JGGB 5E83A 1NZ3A 1FN3A 1C7CA 4MQCB 4BS9A 2VMLA 1YOHA 1DO1A 2MGDA 3O89A 1B86A 1LFTA 1Y4RA 3R0GA 4MQJB 5CNEA 5E83B 1GH0A 1GH0B 2PGHB 3BJ2A 4FWXA 1TESA 1MWBA 1U7SA 1HCOB 2R4ZA 3ZJLA 3NL7B 3HYUA 4MBNA 1SI4A 1MZ0A 2HBGA 3QM5A 3PI1A 4H0MA 1J7SA 2WTGA 4ILZA 1RQAB 4M4AA 4MU5A 3NFEA 1F99B 1R1YB 3W4UA 1CQXA 1Y0DA 5E29B 2I88A 1YEQB 1RQ4A 2LH1A 1YHEA 1GBVA 2FRIX 1O1IA 3UBVA 1MLMA 1MODA 2SPLA 4XXKA 4F0TA 4F0TB 3BJ3B 5HY8B 1UFJA 1BZ0A 1O1IB 3AQ9A 1MLJA 4L1EA 6HBWA 1SPGB 1LH1A 1RH1A 5EE4C 2MGLA 2JLFA 5JDOD 3QM7A 4C0NA 2C7JA 1UFPA 1A3NA 1J52A 1WLAA 1QXDA 1QGWC 1Y4GA 3ASEA 3WCTB 5B13A 1MOCA 1O1KB 1VXCA 1CIKA 1B8DB 1J40A 1MLKA 1MTKA 1SGKA 2Z6NA 1IBEB 3R5IB 3OK5A 1H97A 5JDOC 4TMAB 1HV4A 2V1FA 5AZRA 1UIWA 2G3HA 5SW7B 4L2MA 1CIOA 3ED9A 3OO4A 111MA 3G53A 5CNBA 1COHA 1YMBA 3PT8B 1A9WE 1HSYA 1MLOA 5F0BA 5CN6A 1ASHA 3S1JA 1YCAA 1J7WA 1CO8A 4N7NB 1Y7GB 2R4YA 2Z8AA 1V75B 1YDZB 1IBEA 4ROLA 5CNGA 1FHJA 3BRPB 3EDAA 3S48C 1HDBA 4F0UA 1Y31B 2DN1B 4U8UA 3ZJNA 3OVUC 2OLPA 2BLIA 1QI8B 3P5QA 4Q70A 4MPMA 5EUIA 5MBAA 2OHBA 1XDTT 4YU4B 3UBCA 1CG8B 1O1NA 2G14A 4MQCA 4FC3A 4ROMA 1DDTA 2HBSA 1G09A 2MGGA 1O1JB 1NZ2A 1YGFB 4B02A 1YIHB 2UUNA 4PO5A 1IT3A 1VWTA 1YE2B 1MNOA 1YH9B 3LHBA 1S5YB 3ARLA 1LFQA 2HHBA 2D60B 1Y8HB 3MJPA 3MJPB 1K1KB 1CP0A 1FLPA 4WJGA 2B7HB 4DC8A 3W4UB 110MA 3AT5B 4KN3A 1O1LA 3HRWB 1PHNB 1A6KA 3NMLA 1BZ6A 1JP8A 4ETTA 1MOHA 1XY0B 1YIEB 2SPNA 1SPGA 2ZSSA 1BVDA 3O18A 2DHBA 1FSXA 1V9QA 2NSSA 5CMVA 1MLRA 4YU4A 1UVNA 5HLXA 1MCYA 2HHDA 5KERA 3K3UA 3M3AA 1T1NB 1I7YA 3ECZA 1MYIA 4F6JA 3GDJA 5C6EA 2VLZA 3EU1A 4XXIA 2QLSA 1RTEA 1RPSB 2BV8A 3FH9B 2ZLXB 1JZKA 2ZFBA 1YEVA 1DWSA 5B13G 2YSKA 5CN5A 3BJ3A 3FH9A 1LTWA 1XZ2B 3PELB 2D5ZB 2ZFBB 5D1VA 3WFUA 1YIEA 3GQPA 3SZKA 1YZIA 2Z6SA 1YHRA 1YHUD 2BLJM 5CNDA 2G12A 2W72B 2UULH 3VRGB 1Y22B 1AZIA 4HRTB 2UULB 1YVTB 4UURA 2V8AA 3H58A 2DXMB 2QMBA 1BUWA 3UHXA 2HHEA 2Z6NB 3WCPA 1W92A 1Y0TB 3G52A 3QJBB 2DC3A 3UGZA 2G0XA 1MDNA 1URVA 1XYEB 1NS9B 1UT0A 1MLSA 1WVPA 3HF4A 3NFEB 3OJ1A 1BIJA 3HHBA 2UULC 1QI8A 1PBXA 1L2KA 1HBHA 4FWZA 1LJWA 3UHIA 1SDLA 3QZZA 1B33B 2DN2A 4ZIZB 1Y31A 1IT2A 2ZLVA 5M3SA 5HY8A 4F6BA 1B8DA 2QSPA 2IG3A 2SPOA 1S5XB 1LFLB 1U7RA 1YEVB 3KMFA 2ZSZA 3HXNB 3UHHA 3WR1B 1CH1A 1A0UA 2G0ZA 2D6CA 3HEPA 3UHCA 1Y8WB 1HDBB 4F0UB 1O1OB 2DN1A 1HGAA 3DHRB 1HHTP 2QFKA 4GXEB 3G46A 4F68A 1N9FA 3UH7A 104MA 4N6SB 1XZ5A 1MBSA 4F6FA 1VRFA 1YHUC 1GBUB 1EBTA 3UHKA 4F6DA 1Z8UB 2YRSB 2EVKA 1EWAA 3ZJPA 1HDAB 1YEOB 1YEOA 1CMYB 3D1KB 3HEOA 2MBWA 4MQHB 1JY7B 1JY7A 3QZXA 3HF4B 1CMYA 4DC7A 3OO4B 3DHTB 1AJ9B 2HZ2A 2OH9A 1JP6A 1ABYA 4MQKA 1QSIA 1UX9A 4GY3A 1C7CB 3VNCA 1OFKA 3UHEA 4FH7A 2W31A 3DBJA 5D5RA 3LQDA 2MGEA 4HRRB 3ZOMA 1ON7B 5E6EA 1MLHA 1JWNA 1YMCA 3SDNA 3PI9A 1NY9A 1FDHA 5AQDM 2GRFA 2O5TX 5CN8A 1YHRB 4M4AB 1HGBB 1HLBA 3CIUA 108MA 1Y0TA 2EVPA 2AV0A 1ECNA 1FHJB 1AJHA 2XKHA 3GKVA 3GYSA 1JL6A 1G0BB 2V1JA 1MLQA 5ILRA 1D8UA 5AB8A 1HDSA 4Z8KB 3G4YA 3GYSB 4HBIA 2JLGA 2AUPA 2O5LX 1MLFA 3VHBA 3WCUD 2HBCB 4H2LB 1GDIA 2R4WA 1DXTA 3EOKA 3HHBB 5CN4A 3AT5A 1GDKA 1NPGA 3IC2A 1Y85B 1SDLB 1YFFA 4A8KA 5EOHA 1LIAA 2HCOB 1PBXB 1THBB 2W6WA 1GZXB 1Y09A 2PGHA 3QJEA 4G1VA 5IKSA 1J7YB 1BZPA 3E55A 1DUOA 1FAWB 1Y0AA 1CLSA 3S66B 1ECOA 1RQ4B 1EYXB 3D1AB 4DWUA 1HBRA 1KD2A 3QJDA 3VRFB 1OBMA 3ONZA 5FVBA 3PI8B 5EV5A 4A8SA 4HHBA 2B7HA 1XQ5A 2ZS0D 1JEBB 1EW6A 1Y4BA 3UHQA 6HBWB 1JP9A 2GKMA 1HBBA 3OO5B 1R1XB 1WACA 4MQGA 3O18B 1GDJA 2MGJA 1MOBA 4HSXA 4N6SA 1DXVA 2D5ZA 5KKKA 1YVTA 1Y4VB 2AURA 2FAMA 2VLYA 1V4XB 3M39A 2VHBA 4MQHA 5C6YA 2ZLXA 1NIHB 4AVEA 2MYCA 2ZLWB 1YOGA 1A3OA 2DN3B 2DN3A 1RVWB 1XZ7B 1LFYA 4IROA 4IROB 3AQ5A 4NZIA 1VXEA 1BJEA 2C0KA 1PMBA 2G11A 3GQGA 2X49A 3BRPA 1NEJB 3MVCA 1Y5KA 2ZS0B 2JL9A 3AQ7A 1XZVB 1GVHA 2BK9A 3P5QB 4A8FA 2H8FB 1LFZB 1YCBA 3WCVD 3RJ6A 1OR4A 1LHSA 1DLWA 3MKBB 4VHBA 1AJGA 1RTXA 1OUTA 1SI4B 1BABA 3WR1A 1ON7A 2ZSPA 1A4FB 3WCUA 3M38A 3KMFC 1UMOA 1G09B 3ZJJA 1Y8HA 101MA 3UGYA 1GCVA 3QJCB 1CO9A 4F6IA 1CG5B 1Y83A 3OGBA 5EYSA 3A59A 1MWCA 1HBBB 4NXAA 1G0BA 4WJG1 3LB3A 1CG8A 5JDOF 2LH5A 1XZVA 1GLIB 1Y85A 3ZJOA 1Y8WA 2MHBB 1KN1A 2VJTA 3ZJRA 1YG5A 1DLYA 1YHUA 1XXTB 4H0BA 4A8YA 1UVLA 1MBNA 3AT6A 1X9FD 3OZUA 1S5YA 3HXNA 1MNKA 1J41A 1NS6A 1A6GA 1Y7DA 1CPCB 1S5XA 2ZSRA 1LH6A 1Y5FA 1O1KA 1IDRA 2D2NB 1Y7CA 1YHEB 3EU1B 2AA1B 1Y2ZB 1HBRB 1KD2B 1SDKB 1A6NA 4HRRA 3UI0A 2W6VB 2AV3A 1HBGA 4XDIA 3G4WA 1NQPB 1J7WB 3DBJB 1V4UB 3ECXA 1S61A 3WTGB 4ROMB 2V1KA 3MYNA 4U8UC 1HHOA 1O1PA 1Y0CA 4M4BB 3BCQA 3BJ1A 1CH5A 1HHSA 3WCVA 2DKCA 1Y8IB 1EMYA 5MBNA 2C7LB 4A8WA 1CH7A 1MTIA 1BZRA 2HBEB 1HABA 3IC0A 1I3DA 1NS9A 1Y46B 3WCTD 4GY3B 2GL3A 2LH6A 1EBCA 2ZLTB 1Y4QB 1VHBA 1VXAA 2R50A 1CH3A 3B75B 3AT6B 2QSPB 4WCHD 1JZLA 3PI2A 1Y0DB 2DXMA 3A0GB 5JOMA 2MGHA 2SPMA 1N9IA 1SHRB 1SHRA 2O5SX 5AZQA 2ZLWA 1G08B 2VEBA 2XKIA 3AQ6A 4HHBB 1DUKA 3VAUA 1LH2A 3ARKA 1YGDB 4L7YA 1LFLA 3IA3B 2ZSYA 1YEUB 3LR9A 1BZZA 3G4RA 2VM0A 2V1EA 1HA7B 1H1XA 4LM6B 2ZFOC 3QM9A 3DHRA 1NPFA 1DTMA 1TOXA 1Y4PB 2R80A 3G4QA 1O16A 1X46A 3DUTA 2MHBA 2HCOA 3V57B 1NGKA 2JHOA 3A5BA 4ODCA 3IC2B 3TM3A 1MYZA 1DKEA 1VXFA 1Y35B 1EYXA 3BOMA 2VRYA 1HDAA 1XZUA 1K0YB 4NK1A 2QU0B 1MLUA 1S6AA 1HI8A 1Y0AB 1HI0P 2HHEB 3TLDA 4MXLA 2D2ND 2HBFB 1PHNA 3GKTA 1NS6B 2VJHA 1ABYB 4MQKB 1MYMA 3GUQA 1XF6C 2VLXA 2G0RA 2VYZA 2BMMA 1MLGA 1JW8A 1COHB 4RMPB 2OIFA 5CHRA 1OUUA 4X0LA 3GIOA 1YHUB 3V2VA 3PI9B 1ABSA 1GBUA 4O4ZA 2EB9A 3ODQA 3PI4A 2VYYA 4ETVA 4NI0B 1LHTA 4N7PB 5HLQA 4G1BA 3ECLA 4YU3B 2ZT4A 1YGDA 4L7YB 4NI0A 3UHNA 1VXGA 2ZS1A 4NK2A 5CNCA 1JL7A 3UH3A 1WMUB 1RPSA 2O5MX 1XZ7A 1BZ1B 4LMXB 3D7OA 4AVDA 2ZWJA 1HBSA 1BIJB 3QQRA 3MWNA 4H2LA 4UIQA 4N8TB 2DN2B 1CBMA 2MGCA 1YG5B 4U8UB 3WHMB 2D5XB 2ZSTA 2VJRA 3KUOA 1HDSB 1LFVB 3FEWX 1Y4QA 3GK9A 3RGKA 2DHBB 3CY5B 5HAVA 1XZ4B 4PO5B 1LFTB 1MNJA 3ZOLA 1Y5JA 3ZHWA 2UUMA 3D17B 3A9MA 2Z85A 1O1NB 1CLSB 5EQMA 3UHBA 3DR9A 2BW9M 4KMVA 1Y5JB 2O58X 3HENA 3S65A 105MA 1S56A 3V58A 3WFWA 2GNVA 1ALLB 1DXUA 7HBIA 1FDHG 1VWTB 3K8BB 5HLUA 3V58B 1KTPA 1NXFA 1OR6A 4ROLB 1O1MA 1ABWA 3WCWA 2HBCA 3LB4A 1XZ5B 2ZSNA 2D2NA 4L1EB 2ZFOB 1MYJA 2X4AA 1J3ZA 5CHQA 4B4YA 1XZ4A 2MYAA 4OF9A 4Q70B 3M3BA 1RSEA 2AA1A 1T1NA 3OO5A 1C40B 1C7DB 5KERB 1Y4PA 2R1HA 4IT8A 1NIHA 2HZ3A 2OHAA 2C7JB 3D7OB 1DXDA 1Y7DB 2RAOB 1DTIA 6HBIA 2NRLA 2C7KB 3UHDA 4C44A 1HBAB 2LH3A 3G4VA 3PELA 1HV4B 3NMMB 1FN3B 2RAOA 1HRMA 2ZSQA 1KFRA 1UVKA 1UC3A 2D2MD 1A01B 4PQ6A 4ESAA 3IXFA 1R1XA 2H8DA 3KVSA 2MGFA 3WFXA 5FVBM 3PI3A 1MKOA 3ODQB 3LQ9A 1Y22A 2H35B 1N9XA 3PT8A 2D2NC 4H0MB 1V75A 1OUTB 2ZT0A 4M4BA 2ZSOA 1XG0C 3NL7A 2G0VA 1XCHA 1HHOB 2W6YA 1BZZB 1QPWA 1YEUA 3S66A 1V4WB 1LH5A 1J40B 1CIIA 2FRFA 3RJNB 1CG5A 1Y83B 2V8AB 2NSRA 3L0FA 1B33A 2HBDA 2ZT1A 1HBHB 1Y5KB 2D5XA 1IOPA 1FCSA 3PI8A 2O5BX 3MYMA 2MGMA 1QSHB 1NWIA 4ERTA 5ILPA 1KN1B 2W72C 1F63A 4FWYA 3ZTAA 2GRHA 1C40A 4JACA 2E2YA 1YE2A 3LQDB 1MTJA 2PEGB 3MOUA 3BJ2B 2GDMA 5EE4D 2R4XA 1GDLA 4ERVA 1B86B 1Y4RB 4MQJA 3ZJIA 2O5OX 2BKMA 3CIUB 3WCTA 3NG6B 1MLNA 1IWHB 1O1OA 1OFJA 1K0YA 2WCRA 4ETUA 1J3YB 2LH2A 1A87A 4F4OA 1F99A 2AUQA 1HJTA 1KTPB 2MGAA 3ONZB 1S69A 5B84A 1DO3A 2VJTB 1A0ZB 3WCUC 1YVQB 1TU9A 1OJ6A 1Y8KA 5CN7A 2FRJX 1FSXB 5F2AA 2WY4A 1Y4VA 3WFTA 1HA7A 3UHYA 4ZIZA 106MA 1A9WA 2UULA 1XY0A 1M9PA 3BOMB 1Y4GB 1XZUB 1BUWB 2ZLUA 4KMWA 5ILMA 3BJ1B 1YE0A 1A4FA 3WCUB 4G51A 2HHBB 3D1KA 1RQ3B 3MJUA 1LFYB 3L0FB 1GJNA 3QJBA 2D60A 1C7DA 1Y7CB 3WCVB 3PT7B 4GZGA 2ZS1D 1HI1A 2UUMX 1MYHA 3GOUA 2V1IA 3PMCA 3UHUA 4YU3A 1CPWA 3GQPB 1DWTA 1HGCA 1BZ0B 2QLSB 1YENA 3E4NA 1BBBA 1ITHA 1V07A 2FALA 2V1GA 1HBSB 4MBAA 1Y45A 2EKTA 2HBEA 2GTLA 1BABB 3MBAA 3MKBA 1UVXA 3NG6A 109MA 1CH9A 1JDOA 1S0HB 2ZFOD 3GLNA 1V4WA 2MYBA 1DM1A 1YMAA 1Y0WA 1Y0WB 4BJAA 4Z8KA 3O2CB 3U3EA 1VREA 1YEQA 1DWRA 2ZT2A 1JBOA 4NS2A 1MBAA 1O1MB 4PQBA 4TWVA 3WCWB 1VXDA 2VMLB 1HABB 1G9VA 4NI1B 1THBA 1LJWB 1LIAB 4MXKA 2HBDB 4NXCA 4O2GA 3UHVA 3ZJSA 2RI4A 1SDKA 1HBIA 1JF3A 1BBBB 1J3ZB 1LUEA 3E5IA 1A3NB 1CBLA 4B3WA 1MBIA 1NWNA 3K9ZA 4ZVBA 5KDQA 1HCOA 1YH9A 1X9FB 5B85A 1X9FC 5EETA 2C7KA 1Y5FB 1J7YA 3WTGA 1O1JA 2QMBB 1FAWA 1MNIA 3NMMA 2PEGA 1X9FA 2QU0A 1G0AB 3PIAA 1GCVB 5CNFA 1F0LA 1K1KA 2UULD 1M6MA 1MDTA 1CH2A 1NEJA 5E29A 3QJDB 3VRFA 4HSWA 4XS0A 1DO7A 1JBOB 2D2MC 1A01A 2H35A 3D1AA 5SW7A 3A5AA 4ESUA 1MBOA 4AE0A 1GLIA 4F6GA 3AG0A 2D2MA 2VYWA 2YRSA 1A00A 1MBDA 1NQPA 2ZLVB 3NUHB 1S0HA 3MN0A 4MAXA 2W6VA 1QPWB 2GRZA 3WCWD 1B0BA 4HRTA 3LB2A 5C6EB 1RVWA 4HH0A 1FSLA 1BINA 1I7YB 3E5OA 2ZLUB 1MYFA 3KUNA 4F4OB 1BZ1A 3WCVC 2R1HB 3QQQA 1WMUA 4G51B 1Y0CB 3HC9A 2ZS1B 1J3FA 4NI1A 1Y8IA 4A8OA 3KVSB 2HBFA 1QXEA 2GLNA 1LFZA 103MA 5ILEA 1HGCB 1LFVA 3S1IA 3DHTA 1Y4BB 4O1TA 1MOAA 2ZT3A 2LHBA 3VRGA 1Y46A 4LPIA 1JZMA 1XXTA 2FRKX 1GCWB 3QJEB 4YJJB 4YJJA 3S65B 4ODCB 3HYUB 1C7BA 1C7BB 1HACA 1LFQB 1MLLA 1DO4A 3QMAA 1IWHA 1YIHA 2EF2A 2UUNB 1IRCA 1F5PA 4FH6A 2VEEA 1YDZA 3G4UA 1O1PB 2MGIA 4AE1A 5HU6A 3O2CA 1AJ9A 3GQRA 3GQRB 1A0ZA 4OODA 4HH1A 4ZVAA 3WCPB 2ZSXA 1V5HA 3OZVA 1LH3A 3ARJA 5EUIB 4GXEA 3WI8A 2V1HA 4N8TA 4LMSB 3BA2A 2LH7A 3V57A 1MGNA 2QRWA 2WCQA 2VJRB 1X3KA 3ZH0A 1M6CA 5E6EB 4JYQA 2EB8A 1OUUB 4X0LB 1YE0B 1R1YA 4QAUA 2HBSB 3ZJQA 1UVMA 2OH8A 2IN4A 3VREB 3VREA 3WCTC 4PNJA 1MWDA 2MB5A 1A6MA 1CQ2A 3R5IA 3GQGB 3A2GA 2G10A 4KJTA 5EU2A 1HGAB 4XS0B 1Y8KB 1J7SB 1NZ5A 2C7LA 2G0SA 3QJCA 4MQIB 3K8BA 1XQ5B 3FS4A 2QFNA 4H07A 3MJUB 1RQ3A 1A0UB 1Y01B 1Y45B 3PIAB 2VJHB 2NX0A 1LA6A 1LA6B 1Y2ZA 2RI4B 2ZFOA 1GCWA 3QM6A 1I3EA 1MKOB 2GTLC 1YZIB 2Z6TA 1JPBA 3RQRA 4SDHA 5KDQB 3D17A 3OZWA 1V4UA 1A00B 1NZ4A 2MGBA 2BLHA 2QSSA 1MYGA 1G08A 1N9HA 1BVCA 3UHSA 1QXDB 4A8MP 5AQDA 1YOIA 5HBIA 2XKGA 1DXTB 2AUOA 1CP5A 3B75A 3TM9A 1XZ2A 2H8DB 1UX8A 2ZLTA 2HZ1A 3SDHA 3D4XB 4ESAB 4DWTA 2H8FA 2BWHA 2MYDA 1MNHA 4FC3B 3UHWA 107MA 4BJUA 2GNWA 2XYKA 1NAZA 2O5QX 1RQAA 3A0GA 5CN9A 4TWUA 3UH5A 5EYJA 4A8QA 1XYEA 1ALLA 1DXUB 1G0AA 1Y7GA 112MA 4MQIA 1G9VB 2MGKA 3PMDA 1MBCA 3EDBA 1Y7ZA 3A59B 1Y4FA 1Y4FB 2M6ZA 2M6ZB 3WCWC 3GKVB 4MQGB 1UIWB 1MYTA 1GBVB 3A5GA 4O35A 4UZVA 1JEBA 1SWMA 3QM8A 1YFFB 3IC0B 3CY5A 1DKEB 1Y35A 1UVIA 4N7OA 1YVQA 1GZXA 1Y09B 3V2ZA 2DKDA 3DUTB 2HHDB 1IRDA 1IRDB 2W6XA 1KR7A 3H57A 1A3OB 2J96A 1VXBA 2GTLD 2R80B 1YGFA 2NRMA 2UUMB 3BCQB 4F69A 3AQ8A 2WTHA 1J3YA 1DXCA 4U8UD 4O4TA 1QXEB 1F5OA 1HBAA 1F65A 2BV8B 3UHRA 2ZS0A 5HU6B 1CPCA 3ORDA 2UUND 3D4XA 1ABWB 3LR7A 1UVJA 2ZS0C 2D2MB 2BNLA 1COLA 3FS4B 2CMMA 2GTLB 1ECAA 1QSHA 1LH7A 2MYEA 1UVYA 3UHGA 4RMPA 2DKAA 4PQCA 1ECDA 4N7OB 3SZKB 1V4XA 3O7NA
chains in the Genus database with same CATH topology
102MA 1DXVB 1M9PB 3UHTA 5JDOE 3ZJHA 4N7NA 1Q1FA 1HLMA 1CH4A 1URYA 3GOUB 3UHZA 1J41B 2KSCA 3LB1A 1Y7ZB 2GKNA 4N7PA 1QSIB 1SPEA 3PT7A 1HGBA 3UH6A 4TYXA 5JGGA 1HACB 3WHMA 2ZS1C 2QSSB 3GDJB 1O1LB 1VXHA 3HRWA 2W72A 2EKUA 3ZJMA 1JF4A 1YENB 3EOKB 5JGGB 5E83A 1NZ3A 1FN3A 1C7CA 4MQCB 1YOHA 1DO1A 2MGDA 3O89A 1B86A 1LFTA 1Y4RA 3R0GA 4MQJB 5CNEA 5E83B 2PGHB 3BJ2A 4FWXA 1TESA 1MWBA 1U7SA 1HCOB 2R4ZA 3ZJLA 3NL7B 3HYUA 4MBNA 1SI4A 1MZ0A 2HBGA 3QM5A 3PI1A 1J7SA 2WTGA 4ILZA 1RQAB 4M4AA 4MU5A 3NFEA 1R1YB 3W4UA 1CQXA 1Y0DA 5E29B 1YEQB 1RQ4A 2LH1A 1YHEA 1GBVA 2FRIX 1O1IA 3UBVA 1MLMA 1MODA 2SPLA 3BJ3B 5HY8B 1UFJA 1BZ0A 1O1IB 3AQ9A 1MLJA 6HBWA 1SPGB 1LH1A 5EE4C 2MGLA 5JDOD 3QM7A 4C0NA 1UFPA 1A3NA 1J52A 1WLAA 1QXDA 1Y4GA 3ASEA 3WCTB 1MOCA 1O1KB 1VXCA 1CIKA 1J40A 1MLKA 1MTKA 2Z6NA 1IBEB 3R5IB 3OK5A 1H97A 5JDOC 1HV4A 2V1FA 5AZRA 1UIWA 2G3HA 5SW7B 4L2MA 1CIOA 3ED9A 3OO4A 111MA 3G53A 5CNBA 1COHA 1YMBA 3PT8B 1A9WE 1HSYA 1MLOA 5F0BA 5CN6A 1ASHA 3S1JA 1YCAA 1J7WA 1CO8A 4N7NB 1Y7GB 2R4YA 2Z8AA 1V75B 1YDZB 1IBEA 4ROLA 5CNGA 1FHJA 3EDAA 3S48C 1HDBA 1Y31B 2DN1B 4U8UA 3ZJNA 3OVUC 2OLPA 2BLIA 1QI8B 3P5QA 4MPMA 5EUIA 5MBAA 2OHBA 4YU4B 3UBCA 1CG8B 1O1NA 2G14A 4MQCA 4FC3A 4ROMA 2HBSA 1G09A 2MGGA 1O1JB 1NZ2A 1YGFB 1YIHB 1IT3A 1VWTA 1YE2B 1MNOA 1YH9B 3LHBA 1S5YB 3ARLA 1LFQA 2HHBA 2D60B 1Y8HB 3MJPA 3MJPB 1K1KB 1CP0A 1FLPA 4WJGA 2B7HB 4DC8A 3W4UB 110MA 3AT5B 4KN3A 1O1LA 3HRWB 1A6KA 3NMLA 1BZ6A 1JP8A 1MOHA 1XY0B 1YIEB 2SPNA 1SPGA 2ZSSA 1BVDA 2DHBA 1FSXA 1V9QA 2NSSA 5CMVA 1MLRA 4YU4A 5HLXA 1MCYA 2HHDA 5KERA 3K3UA 3M3AA 1T1NB 3ECZA 1MYIA 4F6JA 3GDJA 5C6EA 2VLZA 3EU1A 2QLSA 1RTEA 1RPSB 3FH9B 2ZLXB 1JZKA 2ZFBA 1YEVA 1DWSA 5CN5A 3BJ3A 3FH9A 1LTWA 1XZ2B 3PELB 2D5ZB 2ZFBB 5D1VA 3WFUA 1YIEA 3GQPA 3SZKA 1YZIA 2Z6SA 1YHRA 1YHUD 2BLJM 5CNDA 2G12A 2W72B 3VRGB 1Y22B 1AZIA 4HRTB 1YVTB 4UURA 3H58A 2DXMB 2QMBA 1BUWA 3UHXA 2HHEA 2Z6NB 3WCPA 1W92A 1Y0TB 3G52A 3QJBB 2DC3A 3UGZA 2G0XA 1MDNA 1URVA 1XYEB 1NS9B 1UT0A 1MLSA 1WVPA 3HF4A 3NFEB 3OJ1A 1BIJA 3HHBA 1QI8A 1PBXA 1L2KA 1HBHA 4FWZA 1LJWA 3UHIA 1SDLA 3QZZA 2DN2A 1Y31A 1IT2A 2ZLVA 5M3SA 5HY8A 4F6BA 2QSPA 2IG3A 2SPOA 1S5XB 1LFLB 1U7RA 1YEVB 3KMFA 2ZSZA 3HXNB 3UHHA 3WR1B 1CH1A 1A0UA 2G0ZA 2D6CA 3HEPA 3UHCA 1Y8WB 1HDBB 1O1OB 2DN1A 1HGAA 3DHRB 2QFKA 3G46A 4F68A 1N9FA 3UH7A 104MA 1XZ5A 1MBSA 4F6FA 1VRFA 1YHUC 1GBUB 1EBTA 3UHKA 4F6DA 1Z8UB 2YRSB 2EVKA 1EWAA 3ZJPA 1HDAB 1YEOB 1YEOA 1CMYB 3D1KB 3HEOA 2MBWA 4MQHB 1JY7B 1JY7A 3QZXA 3HF4B 1CMYA 4DC7A 3OO4B 3DHTB 1AJ9B 2HZ2A 2OH9A 1JP6A 1ABYA 4MQKA 1QSIA 1UX9A 1C7CB 1OFKA 3UHEA 4FH7A 2W31A 5D5RA 3LQDA 2MGEA 4HRRB 3ZOMA 5E6EA 1MLHA 1JWNA 1YMCA 3SDNA 3PI9A 1FDHA 2GRFA 2O5TX 5CN8A 1YHRB 4M4AB 1HGBB 1HLBA 3CIUA 108MA 1Y0TA 2EVPA 2AV0A 1ECNA 1FHJB 1AJHA 2XKHA 3GKVA 3GYSA 1JL6A 1G0BB 2V1JA 1MLQA 5ILRA 1D8UA 5AB8A 1HDSA 3G4YA 3GYSB 4HBIA 2AUPA 2O5LX 1MLFA 3VHBA 3WCUD 2HBCB 4H2LB 1GDIA 2R4WA 1DXTA 3EOKA 3HHBB 5CN4A 3AT5A 1GDKA 1NPGA 3IC2A 1Y85B 1SDLB 1YFFA 5EOHA 2HCOB 1PBXB 1THBB 2W6WA 1GZXB 1Y09A 2PGHA 3QJEA 4G1VA 5IKSA 1J7YB 1BZPA 3E55A 1DUOA 1FAWB 1Y0AA 1CLSA 3S66B 1ECOA 1RQ4B 3D1AB 4DWUA 1HBRA 1KD2A 3QJDA 3VRFB 1OBMA 3ONZA 3PI8B 5EV5A 4HHBA 2B7HA 1XQ5A 2ZS0D 1JEBB 1EW6A 1Y4BA 3UHQA 6HBWB 1JP9A 2GKMA 1HBBA 3OO5B 1R1XB 4MQGA 1GDJA 2MGJA 1MOBA 4HSXA 1DXVA 2D5ZA 5KKKA 1YVTA 1Y4VB 2AURA 2FAMA 2VLYA 1V4XB 3M39A 2VHBA 4MQHA 5C6YA 2ZLXA 1NIHB 4AVEA 2MYCA 2ZLWB 1YOGA 1A3OA 2DN3B 2DN3A 1RVWB 1XZ7B 1LFYA 4IROA 4IROB 3AQ5A 4NZIA 1VXEA 1BJEA 2C0KA 1PMBA 2G11A 3GQGA 1NEJB 3MVCA 1Y5KA 2ZS0B 3AQ7A 1XZVB 1GVHA 2BK9A 3P5QB 2H8FB 1LFZB 1YCBA 3WCVD 3RJ6A 1OR4A 1LHSA 1DLWA 3MKBB 4VHBA 1AJGA 1RTXA 1OUTA 1SI4B 1BABA 3WR1A 2ZSPA 1A4FB 3WCUA 3M38A 3KMFC 1UMOA 1G09B 3ZJJA 1Y8HA 101MA 3UGYA 1GCVA 3QJCB 1CO9A 4F6IA 1CG5B 1Y83A 3OGBA 5EYSA 3A59A 1MWCA 1HBBB 4NXAA 1G0BA 4WJG1 3LB3A 1CG8A 5JDOF 2LH5A 1XZVA 1GLIB 1Y85A 3ZJOA 1Y8WA 2MHBB 3ZJRA 1YG5A 1DLYA 1YHUA 1XXTB 4H0BA 1MBNA 3AT6A 1X9FD 3OZUA 1S5YA 3HXNA 1MNKA 1J41A 1NS6A 1A6GA 1Y7DA 1S5XA 2ZSRA 1LH6A 1Y5FA 1O1KA 1IDRA 2D2NB 1Y7CA 1YHEB 3EU1B 2AA1B 1Y2ZB 1HBRB 1KD2B 1SDKB 1A6NA 4HRRA 3UI0A 2W6VB 2AV3A 1HBGA 4XDIA 3G4WA 1NQPB 1J7WB 1V4UB 3ECXA 1S61A 3WTGB 4ROMB 2V1KA 3MYNA 4U8UC 1HHOA 1O1PA 1Y0CA 4M4BB 3BCQA 3BJ1A 1CH5A 3WCVA 1Y8IB 1EMYA 5MBNA 1CH7A 1MTIA 1BZRA 2HBEB 1HABA 3IC0A 1I3DA 1NS9A 1Y46B 3WCTD 2GL3A 2LH6A 1EBCA 2ZLTB 1Y4QB 1VHBA 1VXAA 2R50A 1CH3A 3B75B 3AT6B 2QSPB 4WCHD 1JZLA 3PI2A 1Y0DB 2DXMA 3A0GB 5JOMA 2MGHA 2SPMA 1N9IA 1SHRB 1SHRA 2O5SX 5AZQA 2ZLWA 1G08B 2VEBA 2XKIA 3AQ6A 4HHBB 1DUKA 3VAUA 1LH2A 3ARKA 1YGDB 4L7YA 1LFLA 3IA3B 2ZSYA 1YEUB 3LR9A 1BZZA 3G4RA 2VM0A 2V1EA 1H1XA 2ZFOC 3QM9A 3DHRA 1NPFA 1DTMA 1Y4PB 2R80A 3G4QA 1O16A 1X46A 3DUTA 2MHBA 2HCOA 1NGKA 2JHOA 3A5BA 4ODCA 3IC2B 3TM3A 1MYZA 1DKEA 1VXFA 1Y35B 3BOMA 2VRYA 1HDAA 1XZUA 1K0YB 4NK1A 2QU0B 1MLUA 1S6AA 1Y0AB 2HHEB 3TLDA 4MXLA 2D2ND 2HBFB 3GKTA 1NS6B 1ABYB 4MQKB 1MYMA 2VLXA 2G0RA 2VYZA 2BMMA 1MLGA 1JW8A 1COHB 2OIFA 5CHRA 1OUUA 4X0LA 1YHUB 3V2VA 3PI9B 1ABSA 1GBUA 4O4ZA 2EB9A 3ODQA 3PI4A 2VYYA 4NI0B 1LHTA 4N7PB 5HLQA 4G1BA 3ECLA 4YU3B 2ZT4A 1YGDA 4L7YB 4NI0A 3UHNA 1VXGA 2ZS1A 4NK2A 5CNCA 1JL7A 3UH3A 1WMUB 1RPSA 2O5MX 1XZ7A 1BZ1B 3D7OA 4AVDA 2ZWJA 1HBSA 1BIJB 3QQRA 4H2LA 4UIQA 4N8TB 2DN2B 1CBMA 2MGCA 1YG5B 4U8UB 3WHMB 2D5XB 2ZSTA 3KUOA 1HDSB 1LFVB 1Y4QA 3GK9A 3RGKA 2DHBB 3CY5B 5HAVA 1XZ4B 1LFTB 1MNJA 3ZOLA 1Y5JA 3ZHWA 3D17B 3A9MA 2Z85A 1O1NB 1CLSB 5EQMA 3UHBA 3DR9A 2BW9M 4KMVA 1Y5JB 2O58X 3HENA 3S65A 105MA 1S56A 3WFWA 2GNVA 1DXUA 7HBIA 1FDHG 1VWTB 3K8BB 5HLUA 1NXFA 1OR6A 4ROLB 1O1MA 1ABWA 3WCWA 2HBCA 3LB4A 1XZ5B 2ZSNA 2D2NA 2ZFOB 1MYJA 1J3ZA 5CHQA 4B4YA 1XZ4A 2MYAA 4OF9A 3M3BA 1RSEA 2AA1A 1T1NA 3OO5A 1C40B 1C7DB 5KERB 1Y4PA 2R1HA 4IT8A 1NIHA 2HZ3A 2OHAA 3D7OB 1DXDA 1Y7DB 2RAOB 1DTIA 6HBIA 2NRLA 3UHDA 4C44A 1HBAB 2LH3A 3G4VA 3PELA 1HV4B 3NMMB 1FN3B 2RAOA 1HRMA 2ZSQA 1KFRA 1UC3A 2D2MD 1A01B 4PQ6A 4ESAA 3IXFA 1R1XA 2H8DA 2MGFA 3WFXA 3PI3A 1MKOA 3ODQB 1Y22A 2H35B 1N9XA 3PT8A 2D2NC 1V75A 1OUTB 2ZT0A 4M4BA 2ZSOA 3NL7A 2G0VA 1XCHA 1HHOB 2W6YA 1BZZB 1QPWA 1YEUA 3S66A 1V4WB 1LH5A 1J40B 2FRFA 3RJNB 1CG5A 1Y83B 2NSRA 2HBDA 2ZT1A 1HBHB 1Y5KB 2D5XA 1IOPA 1FCSA 3PI8A 2O5BX 3MYMA 2MGMA 1QSHB 1NWIA 5ILPA 2W72C 1F63A 4FWYA 2GRHA 1C40A 4JACA 2E2YA 1YE2A 3LQDB 1MTJA 2PEGB 3MOUA 3BJ2B 2GDMA 5EE4D 2R4XA 1GDLA 1B86B 1Y4RB 4MQJA 3ZJIA 2O5OX 2BKMA 3CIUB 3WCTA 3NG6B 1MLNA 1IWHB 1O1OA 1OFJA 1K0YA 1J3YB 2LH2A 4F4OA 2AUQA 1HJTA 2MGAA 3ONZB 1S69A 5B84A 1DO3A 1A0ZB 3WCUC 1YVQB 1TU9A 1OJ6A 5CN7A 1Y8KA 2FRJX 1FSXB 5F2AA 2WY4A 1Y4VA 3WFTA 3UHYA 106MA 1A9WA 1XY0A 1M9PA 3BOMB 1Y4GB 1XZUB 1BUWB 2ZLUA 4KMWA 5ILMA 3BJ1B 1YE0A 1A4FA 3WCUB 4G51A 2HHBB 3D1KA 1RQ3B 3MJUA 1LFYB 1GJNA 3QJBA 2D60A 1C7DA 1Y7CB 3WCVB 3PT7B 4GZGA 2ZS1D 1MYHA 3GOUA 2V1IA 3UHUA 4YU3A 1CPWA 3GQPB 1DWTA 1HGCA 1BZ0B 2QLSB 1YENA 3E4NA 1BBBA 1ITHA 1V07A 2FALA 2V1GA 1HBSB 4MBAA 1Y45A 2EKTA 2HBEA 2GTLA 1BABB 3MBAA 3MKBA 1UVXA 3NG6A 109MA 1CH9A 1JDOA 1S0HB 2ZFOD 3GLNA 1V4WA 2MYBA 1DM1A 1YMAA 1Y0WA 1Y0WB 4BJAA 3U3EA 1VREA 1YEQA 1DWRA 2ZT2A 4NS2A 1MBAA 1O1MB 4TWVA 4PQBA 3WCWB 1VXDA 1HABB 1G9VA 4NI1B 1THBA 1LJWB 4MXKA 2HBDB 4NXCA 4O2GA 3UHVA 3ZJSA 2RI4A 1SDKA 1HBIA 1JF3A 1BBBB 1J3ZB 1LUEA 3E5IA 1A3NB 1CBLA 4B3WA 1MBIA 1NWNA 3K9ZA 4ZVBA 5KDQA 1HCOA 1YH9A 1X9FB 5B85A 1X9FC 5EETA 1Y5FB 1J7YA 3WTGA 1O1JA 2QMBB 1FAWA 1MNIA 3NMMA 2PEGA 1X9FA 2QU0A 1G0AB 3PIAA 1GCVB 5CNFA 1K1KA 1M6MA 1CH2A 1NEJA 5E29A 3QJDB 3VRFA 4HSWA 4XS0A 1DO7A 2D2MC 1A01A 2H35A 3D1AA 5SW7A 3A5AA 1MBOA 1GLIA 4F6GA 3AG0A 2D2MA 2VYWA 2YRSA 1A00A 1MBDA 1NQPA 2ZLVB 1S0HA 3MN0A 4MAXA 2W6VA 1QPWB 2GRZA 3WCWD 1B0BA 4HRTA 3LB2A 5C6EB 1RVWA 1FSLA 1BINA 3E5OA 2ZLUB 1MYFA 3KUNA 4F4OB 1BZ1A 3WCVC 2R1HB 3QQQA 1WMUA 4G51B 1Y0CB 3HC9A 2ZS1B 1J3FA 4NI1A 1Y8IA 2HBFA 1QXEA 2GLNA 1LFZA 103MA 5ILEA 1HGCB 1LFVA 3S1IA 3DHTA 1Y4BB 4O1TA 1MOAA 2ZT3A 2LHBA 3VRGA 1Y46A 4LPIA 1JZMA 1XXTA 2FRKX 1GCWB 3QJEB 3S65B 4ODCB 3HYUB 1C7BA 1C7BB 1HACA 1MLLA 1LFQB 1DO4A 3QMAA 1IWHA 1YIHA 2EF2A 1IRCA 1F5PA 4FH6A 2VEEA 1YDZA 3G4UA 1O1PB 2MGIA 5HU6A 1AJ9A 3GQRA 3GQRB 1A0ZA 4OODA 3WCPB 4ZVAA 2ZSXA 1V5HA 3OZVA 1LH3A 3ARJA 5EUIB 3WI8A 2V1HA 4N8TA 3BA2A 2LH7A 1MGNA 2QRWA 1X3KA 3ZH0A 1M6CA 5E6EB 4JYQA 2EB8A 1OUUB 4X0LB 1YE0B 1R1YA 4QAUA 2HBSB 3ZJQA 2OH8A 2IN4A 3VREB 3VREA 3WCTC 4PNJA 1MWDA 2MB5A 1A6MA 1CQ2A 3R5IA 3GQGB 3A2GA 2G10A 4KJTA 5EU2A 1HGAB 4XS0B 1Y8KB 1J7SB 1NZ5A 2G0SA 3QJCA 4MQIB 3K8BA 1XQ5B 3FS4A 2QFNA 4H07A 3MJUB 1RQ3A 1A0UB 1Y01B 1Y45B 3PIAB 2NX0A 1LA6A 1LA6B 1Y2ZA 2RI4B 2ZFOA 1GCWA 3QM6A 1I3EA 1MKOB 2GTLC 1YZIB 2Z6TA 1JPBA 4SDHA 5KDQB 3D17A 3OZWA 1V4UA 1A00B 1NZ4A 2MGBA 2BLHA 2QSSA 1MYGA 1G08A 1N9HA 1BVCA 3UHSA 1QXDB 1YOIA 5HBIA 2XKGA 1DXTB 2AUOA 1CP5A 3B75A 3TM9A 1XZ2A 2H8DB 1UX8A 2ZLTA 2HZ1A 3SDHA 3D4XB 4ESAB 4DWTA 2H8FA 2BWHA 2MYDA 1MNHA 4FC3B 3UHWA 107MA 2GNWA 2XYKA 1NAZA 2O5QX 1RQAA 3A0GA 5CN9A 4TWUA 3UH5A 5EYJA 1XYEA 1DXUB 1G0AA 1Y7GA 112MA 4MQIA 1G9VB 2MGKA 1MBCA 3EDBA 1Y7ZA 3A59B 1Y4FA 1Y4FB 2M6ZA 2M6ZB 3WCWC 3GKVB 4MQGB 1UIWB 1MYTA 1GBVB 3A5GA 4O35A 4UZVA 1JEBA 1SWMA 3QM8A 1YFFB 3IC0B 3CY5A 1DKEB 1Y35A 4N7OA 1YVQA 1GZXA 1Y09B 3V2ZA 3DUTB 2HHDB 1IRDA 1IRDB 2W6XA 1KR7A 3H57A 1A3OB 1VXBA 2GTLD 2R80B 1YGFA 2NRMA 3BCQB 4F69A 3AQ8A 2WTHA 1J3YA 1DXCA 4U8UD 4O4TA 1QXEB 1F5OA 1HBAA 1F65A 3UHRA 2ZS0A 5HU6B 3ORDA 3D4XA 1ABWB 3LR7A 2ZS0C 2D2MB 2BNLA 3FS4B 2CMMA 2GTLB 1ECAA 1QSHA 1LH7A 2MYEA 1UVYA 3UHGA 4PQCA 1ECDA 4N7OB 3SZKB 1V4XA 3O7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 102M A;  1DXV B;  1M9P B;  3UHT A;  5JDO E;  3ZJH A;  4N7N A;  1Q1F A;  1HLM A;  1CH4 A;  1URY A;  3GOU B;  3UHZ A;  1J41 B;  2KSC A;  3LB1 A;  1Y7Z B;  2GKN A;  4N7P A;  1QSI B;  1SPE A;  3PT7 A;  1HGB A;  3UH6 A;  4TYX A;  5JGG A;  1HAC B;  3WHM A;  2ZS1 C;  2QSS B;  3GDJ B;  1O1L B;  1VXH A;  3HRW A;  2W72 A;  2EKU A;  3ZJM A;  1JF4 A;  1YEN B;  3EOK B;  5JGG B;  5E83 A;  1NZ3 A;  1FN3 A;  1C7C A;  4MQC B;  1YOH A;  1DO1 A;  2MGD A;  3O89 A;  1B86 A;  1LFT A;  1Y4R A;  3R0G A;  4MQJ B;  5CNE A;  5E83 B;  2PGH B;  3BJ2 A;  4FWX A;  1TES A;  1MWB A;  1U7S A;  1HCO B;  2R4Z A;  3ZJL A;  3NL7 B;  3HYU A;  4MBN A;  1SI4 A;  1MZ0 A;  2HBG A;  3QM5 A;  3PI1 A;  1J7S A;  2WTG A;  4ILZ A;  1RQA B;  4M4A A;  4MU5 A;  3NFE A;  1R1Y B;  3W4U A;  1CQX A;  1Y0D A;  5E29 B;  1YEQ B;  1RQ4 A;  2LH1 A;  1YHE A;  1GBV A;  2FRI X;  1O1I A;  3UBV A;  1MLM A;  1MOD A;  2SPL A;  3BJ3 B;  5HY8 B;  1UFJ A;  1BZ0 A;  1O1I B;  3AQ9 A;  1MLJ A;  6HBW A;  1SPG B;  1LH1 A;  5EE4 C;  2MGL A;  5JDO D;  3QM7 A;  4C0N A;  1UFP A;  1A3N A;  1J52 A;  1WLA A;  1QXD A;  1Y4G A;  3ASE A;  3WCT B;  1MOC A;  1O1K B;  1VXC A;  1CIK A;  1J40 A;  1MLK A;  1MTK A;  2Z6N A;  1IBE B;  3R5I B;  3OK5 A;  1H97 A;  5JDO C;  1HV4 A;  2V1F A;  5AZR A;  1UIW A;  2G3H A;  5SW7 B;  4L2M A;  1CIO A;  3ED9 A;  3OO4 A;  111M A;  3G53 A;  5CNB A;  1COH A;  1YMB A;  3PT8 B;  1A9W E;  1HSY A;  1MLO A;  5F0B A;  5CN6 A;  1ASH A;  3S1J A;  1YCA A;  1J7W A;  1CO8 A;  4N7N B;  1Y7G B;  2R4Y A;  2Z8A A;  1V75 B;  1YDZ B;  1IBE A;  4ROL A;  5CNG A;  1FHJ A;  3EDA A;  3S48 C;  1HDB A;  1Y31 B;  2DN1 B;  4U8U A;  3ZJN A;  3OVU C;  2OLP A;  2BLI A;  1QI8 B;  3P5Q A;  4MPM A;  5EUI A;  5MBA A;  2OHB A;  4YU4 B;  3UBC A;  1CG8 B;  1O1N A;  2G14 A;  4MQC A;  4FC3 A;  4ROM A;  2HBS A;  1G09 A;  2MGG A;  1O1J B;  1NZ2 A;  1YGF B;  1YIH B;  1IT3 A;  1VWT A;  1YE2 B;  1MNO A;  1YH9 B;  3LHB A;  1S5Y B;  3ARL A;  1LFQ A;  2HHB A;  2D60 B;  1Y8H B;  3MJP A;  3MJP B;  1K1K B;  1CP0 A;  1FLP A;  4WJG A;  2B7H B;  4DC8 A;  3W4U B;  110M A;  3AT5 B;  4KN3 A;  1O1L A;  3HRW B;  1A6K A;  3NML A;  1BZ6 A;  1JP8 A;  1MOH A;  1XY0 B;  1YIE B;  2SPN A;  1SPG A;  2ZSS A;  1BVD A;  2DHB A;  1FSX A;  1V9Q A;  2NSS A;  5CMV A;  1MLR A;  4YU4 A;  5HLX A;  1MCY A;  2HHD A;  5KER A;  3K3U A;  3M3A A;  1T1N B;  3ECZ A;  1MYI A;  4F6J A;  3GDJ A;  5C6E A;  2VLZ A;  3EU1 A;  2QLS A;  1RTE A;  1RPS B;  3FH9 B;  2ZLX B;  1JZK A;  2ZFB A;  1YEV A;  1DWS A;  5CN5 A;  3BJ3 A;  3FH9 A;  1LTW A;  1XZ2 B;  3PEL B;  2D5Z B;  2ZFB B;  5D1V A;  3WFU A;  1YIE A;  3GQP A;  3SZK A;  1YZI A;  2Z6S A;  1YHR A;  1YHU D;  2BLJ M;  5CND A;  2G12 A;  2W72 B;  3VRG B;  1Y22 B;  1AZI A;  4HRT B;  1YVT B;  4UUR A;  3H58 A;  2DXM B;  2QMB A;  1BUW A;  3UHX A;  2HHE A;  2Z6N B;  3WCP A;  1W92 A;  1Y0T B;  3G52 A;  3QJB B;  2DC3 A;  3UGZ A;  2G0X A;  1MDN A;  1URV A;  1XYE B;  1NS9 B;  1UT0 A;  1MLS A;  1WVP A;  3HF4 A;  3NFE B;  3OJ1 A;  1BIJ A;  3HHB A;  1QI8 A;  1PBX A;  1L2K A;  1HBH A;  4FWZ A;  1LJW A;  3UHI A;  1SDL A;  3QZZ A;  2DN2 A;  1Y31 A;  1IT2 A;  2ZLV A;  5M3S A;  5HY8 A;  4F6B A;  2QSP A;  2IG3 A;  2SPO A;  1S5X B;  1LFL B;  1U7R A;  1YEV B;  3KMF A;  2ZSZ A;  3HXN B;  3UHH A;  3WR1 B;  1CH1 A;  1A0U A;  2G0Z A;  2D6C A;  3HEP A;  3UHC A;  1Y8W B;  1HDB B;  1O1O B;  2DN1 A;  1HGA A;  3DHR B;  2QFK A;  3G46 A;  4F68 A;  1N9F A;  3UH7 A;  104M A;  1XZ5 A;  1MBS A;  4F6F A;  1VRF A;  1YHU C;  1GBU B;  1EBT A;  3UHK A;  4F6D A;  1Z8U B;  2YRS B;  2EVK A;  1EWA A;  3ZJP A;  1HDA B;  1YEO B;  1YEO A;  1CMY B;  3D1K B;  3HEO A;  2MBW A;  4MQH B;  1JY7 B;  1JY7 A;  3QZX A;  3HF4 B;  1CMY A;  4DC7 A;  3OO4 B;  3DHT B;  1AJ9 B;  2HZ2 A;  2OH9 A;  1JP6 A;  1ABY A;  4MQK A;  1QSI A;  1UX9 A;  1C7C B;  1OFK A;  3UHE A;  4FH7 A;  2W31 A;  5D5R A;  3LQD A;  2MGE A;  4HRR B;  3ZOM A;  5E6E A;  1MLH A;  1JWN A;  1YMC A;  3SDN A;  3PI9 A;  1FDH A;  2GRF A;  2O5T X;  5CN8 A;  1YHR B;  4M4A B;  1HGB B;  1HLB A;  3CIU A;  108M A;  1Y0T A;  2EVP A;  2AV0 A;  1ECN A;  1FHJ B;  1AJH A;  2XKH A;  3GKV A;  3GYS A;  1JL6 A;  1G0B B;  2V1J A;  1MLQ A;  5ILR A;  1D8U A;  5AB8 A;  1HDS A;  3G4Y A;  3GYS B;  4HBI A;  2AUP A;  2O5L X;  1MLF A;  3VHB A;  3WCU D;  2HBC B;  4H2L B;  1GDI A;  2R4W A;  1DXT A;  3EOK A;  3HHB B;  5CN4 A;  3AT5 A;  1GDK A;  1NPG A;  3IC2 A;  1Y85 B;  1SDL B;  1YFF A;  5EOH A;  2HCO B;  1PBX B;  1THB B;  2W6W A;  1GZX B;  1Y09 A;  2PGH A;  3QJE A;  4G1V A;  5IKS A;  1J7Y B;  1BZP A;  3E55 A;  1DUO A;  1FAW B;  1Y0A A;  1CLS A;  3S66 B;  1ECO A;  1RQ4 B;  3D1A B;  4DWU A;  1HBR A;  1KD2 A;  3QJD A;  3VRF B;  1OBM A;  3ONZ A;  3PI8 B;  5EV5 A;  4HHB A;  2B7H A;  1XQ5 A;  2ZS0 D;  1JEB B;  1EW6 A;  1Y4B A;  3UHQ A;  6HBW B;  1JP9 A;  2GKM A;  1HBB A;  3OO5 B;  1R1X B;  4MQG A;  1GDJ A;  2MGJ A;  1MOB A;  4HSX A;  1DXV A;  2D5Z A;  5KKK A;  1YVT A;  1Y4V B;  2AUR A;  2FAM A;  2VLY A;  1V4X B;  3M39 A;  2VHB A;  4MQH A;  5C6Y A;  2ZLX A;  1NIH B;  4AVE A;  2MYC A;  2ZLW B;  1YOG A;  1A3O A;  2DN3 B;  2DN3 A;  1RVW B;  1XZ7 B;  1LFY A;  4IRO A;  4IRO B;  3AQ5 A;  4NZI A;  1VXE A;  1BJE A;  2C0K A;  1PMB A;  2G11 A;  3GQG A;  1NEJ B;  3MVC A;  1Y5K A;  2ZS0 B;  3AQ7 A;  1XZV B;  1GVH A;  2BK9 A;  3P5Q B;  2H8F B;  1LFZ B;  1YCB A;  3WCV D;  3RJ6 A;  1OR4 A;  1LHS A;  1DLW A;  3MKB B;  4VHB A;  1AJG A;  1RTX A;  1OUT A;  1SI4 B;  1BAB A;  3WR1 A;  2ZSP A;  1A4F B;  3WCU A;  3M38 A;  3KMF C;  1UMO A;  1G09 B;  3ZJJ A;  1Y8H A;  101M A;  3UGY A;  1GCV A;  3QJC B;  1CO9 A;  4F6I A;  1CG5 B;  1Y83 A;  3OGB A;  5EYS A;  3A59 A;  1MWC A;  1HBB B;  4NXA A;  1G0B A;  4WJG 1;  3LB3 A;  1CG8 A;  5JDO F;  2LH5 A;  1XZV A;  1GLI B;  1Y85 A;  3ZJO A;  1Y8W A;  2MHB B;  3ZJR A;  1YG5 A;  1DLY A;  1YHU A;  1XXT B;  4H0B A;  1MBN A;  3AT6 A;  1X9F D;  3OZU A;  1S5Y A;  3HXN A;  1MNK A;  1J41 A;  1NS6 A;  1A6G A;  1Y7D A;  1S5X A;  2ZSR A;  1LH6 A;  1Y5F A;  1O1K A;  1IDR A;  2D2N B;  1Y7C A;  1YHE B;  3EU1 B;  2AA1 B;  1Y2Z B;  1HBR B;  1KD2 B;  1SDK B;  1A6N A;  4HRR A;  3UI0 A;  2W6V B;  2AV3 A;  1HBG A;  4XDI A;  3G4W A;  1NQP B;  1J7W B;  1V4U B;  3ECX A;  1S61 A;  3WTG B;  4ROM B;  2V1K A;  3MYN A;  4U8U C;  1HHO A;  1O1P A;  1Y0C A;  4M4B B;  3BCQ A;  3BJ1 A;  1CH5 A;  3WCV A;  1Y8I B;  1EMY A;  5MBN A;  1CH7 A;  1MTI A;  1BZR A;  2HBE B;  1HAB A;  3IC0 A;  1I3D A;  1NS9 A;  1Y46 B;  3WCT D;  2GL3 A;  2LH6 A;  1EBC A;  2ZLT B;  1Y4Q B;  1VHB A;  1VXA A;  2R50 A;  1CH3 A;  3B75 B;  3AT6 B;  2QSP B;  4WCH D;  1JZL A;  3PI2 A;  1Y0D B;  2DXM A;  3A0G B;  5JOM A;  2MGH A;  2SPM A;  1N9I A;  1SHR B;  1SHR A;  2O5S X;  5AZQ A;  2ZLW A;  1G08 B;  2VEB A;  2XKI A;  3AQ6 A;  4HHB B;  1DUK A;  3VAU A;  1LH2 A;  3ARK A;  1YGD B;  4L7Y A;  1LFL A;  3IA3 B;  2ZSY A;  1YEU B;  3LR9 A;  1BZZ A;  3G4R A;  2VM0 A;  2V1E A;  1H1X A;  2ZFO C;  3QM9 A;  3DHR A;  1NPF A;  1DTM A;  1Y4P B;  2R80 A;  3G4Q A;  1O16 A;  1X46 A;  3DUT A;  2MHB A;  2HCO A;  1NGK A;  2JHO A;  3A5B A;  4ODC A;  3IC2 B;  3TM3 A;  1MYZ A;  1DKE A;  1VXF A;  1Y35 B;  3BOM A;  2VRY A;  1HDA A;  1XZU A;  1K0Y B;  4NK1 A;  2QU0 B;  1MLU A;  1S6A A;  1Y0A B;  2HHE B;  3TLD A;  4MXL A;  2D2N D;  2HBF B;  3GKT A;  1NS6 B;  1ABY B;  4MQK B;  1MYM A;  2VLX A;  2G0R A;  2VYZ A;  2BMM A;  1MLG A;  1JW8 A;  1COH B;  2OIF A;  5CHR A;  1OUU A;  4X0L A;  1YHU B;  3V2V A;  3PI9 B;  1ABS A;  1GBU A;  4O4Z A;  2EB9 A;  3ODQ A;  3PI4 A;  2VYY A;  4NI0 B;  1LHT A;  4N7P B;  5HLQ A;  4G1B A;  3ECL A;  4YU3 B;  2ZT4 A;  1YGD A;  4L7Y B;  4NI0 A;  3UHN A;  1VXG A;  2ZS1 A;  4NK2 A;  5CNC A;  1JL7 A;  3UH3 A;  1WMU B;  1RPS A;  2O5M X;  1XZ7 A;  1BZ1 B;  3D7O A;  4AVD A;  2ZWJ A;  1HBS A;  1BIJ B;  3QQR A;  4H2L A;  4UIQ A;  4N8T B;  2DN2 B;  1CBM A;  2MGC A;  1YG5 B;  4U8U B;  3WHM B;  2D5X B;  2ZST A;  3KUO A;  1HDS B;  1LFV B;  1Y4Q A;  3GK9 A;  3RGK A;  2DHB B;  3CY5 B;  5HAV A;  1XZ4 B;  1LFT B;  1MNJ A;  3ZOL A;  1Y5J A;  3ZHW A;  3D17 B;  3A9M A;  2Z85 A;  1O1N B;  1CLS B;  5EQM A;  3UHB A;  3DR9 A;  2BW9 M;  4KMV A;  1Y5J B;  2O58 X;  3HEN A;  3S65 A;  105M A;  1S56 A;  3WFW A;  2GNV A;  1DXU A;  7HBI A;  1FDH G;  1VWT B;  3K8B B;  5HLU A;  1NXF A;  1OR6 A;  4ROL B;  1O1M A;  1ABW A;  3WCW A;  2HBC A;  3LB4 A;  1XZ5 B;  2ZSN A;  2D2N A;  2ZFO B;  1MYJ A;  1J3Z A;  5CHQ A;  4B4Y A;  1XZ4 A;  2MYA A;  4OF9 A;  3M3B A;  1RSE A;  2AA1 A;  1T1N A;  3OO5 A;  1C40 B;  1C7D B;  5KER B;  1Y4P A;  2R1H A;  4IT8 A;  1NIH A;  2HZ3 A;  2OHA A;  3D7O B;  1DXD A;  1Y7D B;  2RAO B;  1DTI A;  6HBI A;  2NRL A;  3UHD A;  4C44 A;  1HBA B;  2LH3 A;  3G4V A;  3PEL A;  1HV4 B;  3NMM B;  1FN3 B;  2RAO A;  1HRM A;  2ZSQ A;  1KFR A;  1UC3 A;  2D2M D;  1A01 B;  4PQ6 A;  4ESA A;  3IXF A;  1R1X A;  2H8D A;  2MGF A;  3WFX A;  3PI3 A;  1MKO A;  3ODQ B;  1Y22 A;  2H35 B;  1N9X A;  3PT8 A;  2D2N C;  1V75 A;  1OUT B;  2ZT0 A;  4M4B A;  2ZSO A;  3NL7 A;  2G0V A;  1XCH A;  1HHO B;  2W6Y A;  1BZZ B;  1QPW A;  1YEU A;  3S66 A;  1V4W B;  1LH5 A;  1J40 B;  2FRF A;  3RJN B;  1CG5 A;  1Y83 B;  2NSR A;  2HBD A;  2ZT1 A;  1HBH B;  1Y5K B;  2D5X A;  1IOP A;  1FCS A;  3PI8 A;  2O5B X;  3MYM A;  2MGM A;  1QSH B;  1NWI A;  5ILP A;  2W72 C;  1F63 A;  4FWY A;  2GRH A;  1C40 A;  4JAC A;  2E2Y A;  1YE2 A;  3LQD B;  1MTJ A;  2PEG B;  3MOU A;  3BJ2 B;  2GDM A;  5EE4 D;  2R4X A;  1GDL A;  1B86 B;  1Y4R B;  4MQJ A;  3ZJI A;  2O5O X;  2BKM A;  3CIU B;  3WCT A;  3NG6 B;  1MLN A;  1IWH B;  1O1O A;  1OFJ A;  1K0Y A;  1J3Y B;  2LH2 A;  4F4O A;  2AUQ A;  1HJT A;  2MGA A;  3ONZ B;  1S69 A;  5B84 A;  1DO3 A;  1A0Z B;  3WCU C;  1YVQ B;  1TU9 A;  1OJ6 A;  5CN7 A;  1Y8K A;  2FRJ X;  1FSX B;  5F2A A;  2WY4 A;  1Y4V A;  3WFT A;  3UHY A;  106M A;  1A9W A;  1XY0 A;  1M9P A;  3BOM B;  1Y4G B;  1XZU B;  1BUW B;  2ZLU A;  4KMW A;  5ILM A;  3BJ1 B;  1YE0 A;  1A4F A;  3WCU B;  4G51 A;  2HHB B;  3D1K A;  1RQ3 B;  3MJU A;  1LFY B;  1GJN A;  3QJB A;  2D60 A;  1C7D A;  1Y7C B;  3WCV B;  3PT7 B;  4GZG A;  2ZS1 D;  1MYH A;  3GOU A;  2V1I A;  3UHU A;  4YU3 A;  1CPW A;  3GQP B;  1DWT A;  1HGC A;  1BZ0 B;  2QLS B;  1YEN A;  3E4N A;  1BBB A;  1ITH A;  1V07 A;  2FAL A;  2V1G A;  1HBS B;  4MBA A;  1Y45 A;  2EKT A;  2HBE A;  2GTL A;  1BAB B;  3MBA A;  3MKB A;  1UVX A;  3NG6 A;  109M A;  1CH9 A;  1JDO A;  1S0H B;  2ZFO D;  3GLN A;  1V4W A;  2MYB A;  1DM1 A;  1YMA A;  1Y0W A;  1Y0W B;  4BJA A;  3U3E A;  1VRE A;  1YEQ A;  1DWR A;  2ZT2 A;  4NS2 A;  1MBA A;  1O1M B;  4TWV A;  4PQB A;  3WCW B;  1VXD A;  1HAB B;  1G9V A;  4NI1 B;  1THB A;  1LJW B;  4MXK A;  2HBD B;  4NXC A;  4O2G A;  3UHV A;  3ZJS A;  2RI4 A;  1SDK A;  1HBI A;  1JF3 A;  1BBB B;  1J3Z B;  1LUE A;  3E5I A;  1A3N B;  1CBL A;  4B3W A;  1MBI A;  1NWN A;  3K9Z A;  4ZVB A;  5KDQ A;  1HCO A;  1YH9 A;  1X9F B;  5B85 A;  1X9F C;  5EET A;  1Y5F B;  1J7Y A;  3WTG A;  1O1J A;  2QMB B;  1FAW A;  1MNI A;  3NMM A;  2PEG A;  1X9F A;  2QU0 A;  1G0A B;  3PIA A;  1GCV B;  5CNF A;  1K1K A;  1M6M A;  1CH2 A;  1NEJ A;  5E29 A;  3QJD B;  3VRF A;  4HSW A;  4XS0 A;  1DO7 A;  2D2M C;  1A01 A;  2H35 A;  3D1A A;  5SW7 A;  3A5A A;  1MBO A;  1GLI A;  4F6G A;  3AG0 A;  2D2M A;  2VYW A;  2YRS A;  1A00 A;  1MBD A;  1NQP A;  2ZLV B;  1S0H A;  3MN0 A;  4MAX A;  2W6V A;  1QPW B;  2GRZ A;  3WCW D;  1B0B A;  4HRT A;  3LB2 A;  5C6E B;  1RVW A;  1FSL A;  1BIN A;  3E5O A;  2ZLU B;  1MYF A;  3KUN A;  4F4O B;  1BZ1 A;  3WCV C;  2R1H B;  3QQQ A;  1WMU A;  4G51 B;  1Y0C B;  3HC9 A;  2ZS1 B;  1J3F A;  4NI1 A;  1Y8I A;  2HBF A;  1QXE A;  2GLN A;  1LFZ A;  103M A;  5ILE A;  1HGC B;  1LFV A;  3S1I A;  3DHT A;  1Y4B B;  4O1T A;  1MOA A;  2ZT3 A;  2LHB A;  3VRG A;  1Y46 A;  4LPI A;  1JZM A;  1XXT A;  2FRK X;  1GCW B;  3QJE B;  3S65 B;  4ODC B;  3HYU B;  1C7B A;  1C7B B;  1HAC A;  1MLL A;  1LFQ B;  1DO4 A;  3QMA A;  1IWH A;  1YIH A;  2EF2 A;  1IRC A;  1F5P A;  4FH6 A;  2VEE A;  1YDZ A;  3G4U A;  1O1P B;  2MGI A;  5HU6 A;  1AJ9 A;  3GQR A;  3GQR B;  1A0Z A;  4OOD A;  3WCP B;  4ZVA A;  2ZSX A;  1V5H A;  3OZV A;  1LH3 A;  3ARJ A;  5EUI B;  3WI8 A;  2V1H A;  4N8T A;  3BA2 A;  2LH7 A;  1MGN A;  2QRW A;  1X3K A;  3ZH0 A;  1M6C A;  5E6E B;  4JYQ A;  2EB8 A;  1OUU B;  4X0L B;  1YE0 B;  1R1Y A;  4QAU A;  2HBS B;  3ZJQ A;  2OH8 A;  2IN4 A;  3VRE B;  3VRE A;  3WCT C;  4PNJ A;  1MWD A;  2MB5 A;  1A6M A;  1CQ2 A;  3R5I A;  3GQG B;  3A2G A;  2G10 A;  4KJT A;  5EU2 A;  1HGA B;  4XS0 B;  1Y8K B;  1J7S B;  1NZ5 A;  2G0S A;  3QJC A;  4MQI B;  3K8B A;  1XQ5 B;  3FS4 A;  2QFN A;  4H07 A;  3MJU B;  1RQ3 A;  1A0U B;  1Y01 B;  1Y45 B;  3PIA B;  2NX0 A;  1LA6 A;  1LA6 B;  1Y2Z A;  2RI4 B;  2ZFO A;  1GCW A;  3QM6 A;  1I3E A;  1MKO B;  2GTL C;  1YZI B;  2Z6T A;  1JPB A;  4SDH A;  5KDQ B;  3D17 A;  3OZW A;  1V4U A;  1A00 B;  1NZ4 A;  2MGB A;  2BLH A;  2QSS A;  1MYG A;  1G08 A;  1N9H A;  1BVC A;  3UHS A;  1QXD B;  1YOI A;  5HBI A;  2XKG A;  1DXT B;  2AUO A;  1CP5 A;  3B75 A;  3TM9 A;  1XZ2 A;  2H8D B;  1UX8 A;  2ZLT A;  2HZ1 A;  3SDH A;  3D4X B;  4ESA B;  4DWT A;  2H8F A;  2BWH A;  2MYD A;  1MNH A;  4FC3 B;  3UHW A;  107M A;  2GNW A;  2XYK A;  1NAZ A;  2O5Q X;  1RQA A;  3A0G A;  5CN9 A;  4TWU A;  3UH5 A;  5EYJ A;  1XYE A;  1DXU B;  1G0A A;  1Y7G A;  112M A;  4MQI A;  1G9V B;  2MGK A;  1MBC A;  3EDB A;  1Y7Z A;  3A59 B;  1Y4F A;  1Y4F B;  2M6Z A;  2M6Z B;  3WCW C;  3GKV B;  4MQG B;  1UIW B;  1MYT A;  1GBV B;  3A5G A;  4O35 A;  4UZV A;  1JEB A;  1SWM A;  3QM8 A;  1YFF B;  3IC0 B;  3CY5 A;  1DKE B;  1Y35 A;  4N7O A;  1YVQ A;  1GZX A;  1Y09 B;  3V2Z A;  3DUT B;  2HHD B;  1IRD A;  1IRD B;  2W6X A;  1KR7 A;  3H57 A;  1A3O B;  1VXB A;  2GTL D;  2R80 B;  1YGF A;  2NRM A;  3BCQ B;  4F69 A;  3AQ8 A;  2WTH A;  1J3Y A;  1DXC A;  4U8U D;  4O4T A;  1QXE B;  1F5O A;  1HBA A;  1F65 A;  3UHR A;  2ZS0 A;  5HU6 B;  3ORD A;  3D4X A;  1ABW B;  3LR7 A;  2ZS0 C;  2D2M B;  2BNL A;  3FS4 B;  2CMM A;  2GTL B;  1ECA A;  1QSH A;  1LH7 A;  2MYE A;  1UVY A;  3UHG A;  4PQC A;  1ECD A;  4N7O B;  3SZK B;  1V4X A;  3O7N A; 
#chains in the Genus database with same CATH topology
 102M A;  1DXV B;  1M9P B;  3UHT A;  5JDO E;  3ZJH A;  4N7N A;  1Q1F A;  1HLM A;  1CH4 A;  1URY A;  3GOU B;  3UHZ A;  1J41 B;  2KSC A;  3LB1 A;  1Y7Z B;  2GKN A;  4N7P A;  1QSI B;  1SPE A;  3PT7 A;  1HGB A;  3UH6 A;  4TYX A;  5JGG A;  1HAC B;  3WHM A;  2ZS1 C;  2QSS B;  3GDJ B;  1O1L B;  1VXH A;  3HRW A;  2W72 A;  2EKU A;  3ZJM A;  1JF4 A;  1YEN B;  3EOK B;  5JGG B;  5E83 A;  1NZ3 A;  1FN3 A;  1C7C A;  4MQC B;  4BS9 A;  2VML A;  1YOH A;  1DO1 A;  2MGD A;  3O89 A;  1B86 A;  1LFT A;  1Y4R A;  3R0G A;  4MQJ B;  5CNE A;  5E83 B;  1GH0 A;  1GH0 B;  2PGH B;  3BJ2 A;  4FWX A;  1TES A;  1MWB A;  1U7S A;  1HCO B;  2R4Z A;  3ZJL A;  3NL7 B;  3HYU A;  4MBN A;  1SI4 A;  1MZ0 A;  2HBG A;  3QM5 A;  3PI1 A;  4H0M A;  1J7S A;  2WTG A;  4ILZ A;  1RQA B;  4M4A A;  4MU5 A;  3NFE A;  1F99 B;  1R1Y B;  3W4U A;  1CQX A;  1Y0D A;  5E29 B;  2I88 A;  1YEQ B;  1RQ4 A;  2LH1 A;  1YHE A;  1GBV A;  2FRI X;  1O1I A;  3UBV A;  1MLM A;  1MOD A;  2SPL A;  4XXK A;  4F0T A;  4F0T B;  3BJ3 B;  5HY8 B;  1UFJ A;  1BZ0 A;  1O1I B;  3AQ9 A;  1MLJ A;  4L1E A;  6HBW A;  1SPG B;  1LH1 A;  1RH1 A;  5EE4 C;  2MGL A;  2JLF A;  5JDO D;  3QM7 A;  4C0N A;  2C7J A;  1UFP A;  1A3N A;  1J52 A;  1WLA A;  1QXD A;  1QGW C;  1Y4G A;  3ASE A;  3WCT B;  5B13 A;  1MOC A;  1O1K B;  1VXC A;  1CIK A;  1B8D B;  1J40 A;  1MLK A;  1MTK A;  1SGK A;  2Z6N A;  1IBE B;  3R5I B;  3OK5 A;  1H97 A;  5JDO C;  4TMA B;  1HV4 A;  2V1F A;  5AZR A;  1UIW A;  2G3H A;  5SW7 B;  4L2M A;  1CIO A;  3ED9 A;  3OO4 A;  111M A;  3G53 A;  5CNB A;  1COH A;  1YMB A;  3PT8 B;  1A9W E;  1HSY A;  1MLO A;  5F0B A;  5CN6 A;  1ASH A;  3S1J A;  1YCA A;  1J7W A;  1CO8 A;  4N7N B;  1Y7G B;  2R4Y A;  2Z8A A;  1V75 B;  1YDZ B;  1IBE A;  4ROL A;  5CNG A;  1FHJ A;  3BRP B;  3EDA A;  3S48 C;  1HDB A;  4F0U A;  1Y31 B;  2DN1 B;  4U8U A;  3ZJN A;  3OVU C;  2OLP A;  2BLI A;  1QI8 B;  3P5Q A;  4Q70 A;  4MPM A;  5EUI A;  5MBA A;  2OHB A;  1XDT T;  4YU4 B;  3UBC A;  1CG8 B;  1O1N A;  2G14 A;  4MQC A;  4FC3 A;  4ROM A;  1DDT A;  2HBS A;  1G09 A;  2MGG A;  1O1J B;  1NZ2 A;  1YGF B;  4B02 A;  1YIH B;  2UUN A;  4PO5 A;  1IT3 A;  1VWT A;  1YE2 B;  1MNO A;  1YH9 B;  3LHB A;  1S5Y B;  3ARL A;  1LFQ A;  2HHB A;  2D60 B;  1Y8H B;  3MJP A;  3MJP B;  1K1K B;  1CP0 A;  1FLP A;  4WJG A;  2B7H B;  4DC8 A;  3W4U B;  110M A;  3AT5 B;  4KN3 A;  1O1L A;  3HRW B;  1PHN B;  1A6K A;  3NML A;  1BZ6 A;  1JP8 A;  4ETT A;  1MOH A;  1XY0 B;  1YIE B;  2SPN A;  1SPG A;  2ZSS A;  1BVD A;  3O18 A;  2DHB A;  1FSX A;  1V9Q A;  2NSS A;  5CMV A;  1MLR A;  4YU4 A;  1UVN A;  5HLX A;  1MCY A;  2HHD A;  5KER A;  3K3U A;  3M3A A;  1T1N B;  1I7Y A;  3ECZ A;  1MYI A;  4F6J A;  3GDJ A;  5C6E A;  2VLZ A;  3EU1 A;  4XXI A;  2QLS A;  1RTE A;  1RPS B;  2BV8 A;  3FH9 B;  2ZLX B;  1JZK A;  2ZFB A;  1YEV A;  1DWS A;  5B13 G;  2YSK A;  5CN5 A;  3BJ3 A;  3FH9 A;  1LTW A;  1XZ2 B;  3PEL B;  2D5Z B;  2ZFB B;  5D1V A;  3WFU A;  1YIE A;  3GQP A;  3SZK A;  1YZI A;  2Z6S A;  1YHR A;  1YHU D;  2BLJ M;  5CND A;  2G12 A;  2W72 B;  2UUL H;  3VRG B;  1Y22 B;  1AZI A;  4HRT B;  2UUL B;  1YVT B;  4UUR A;  2V8A A;  3H58 A;  2DXM B;  2QMB A;  1BUW A;  3UHX A;  2HHE A;  2Z6N B;  3WCP A;  1W92 A;  1Y0T B;  3G52 A;  3QJB B;  2DC3 A;  3UGZ A;  2G0X A;  1MDN A;  1URV A;  1XYE B;  1NS9 B;  1UT0 A;  1MLS A;  1WVP A;  3HF4 A;  3NFE B;  3OJ1 A;  1BIJ A;  3HHB A;  2UUL C;  1QI8 A;  1PBX A;  1L2K A;  1HBH A;  4FWZ A;  1LJW A;  3UHI A;  1SDL A;  3QZZ A;  1B33 B;  2DN2 A;  4ZIZ B;  1Y31 A;  1IT2 A;  2ZLV A;  5M3S A;  5HY8 A;  4F6B A;  1B8D A;  2QSP A;  2IG3 A;  2SPO A;  1S5X B;  1LFL B;  1U7R A;  1YEV B;  3KMF A;  2ZSZ A;  3HXN B;  3UHH A;  3WR1 B;  1CH1 A;  1A0U A;  2G0Z A;  2D6C A;  3HEP A;  3UHC A;  1Y8W B;  1HDB B;  4F0U B;  1O1O B;  2DN1 A;  1HGA A;  3DHR B;  1HHT P;  2QFK A;  4GXE B;  3G46 A;  4F68 A;  1N9F A;  3UH7 A;  104M A;  4N6S B;  1XZ5 A;  1MBS A;  4F6F A;  1VRF A;  1YHU C;  1GBU B;  1EBT A;  3UHK A;  4F6D A;  1Z8U B;  2YRS B;  2EVK A;  1EWA A;  3ZJP A;  1HDA B;  1YEO B;  1YEO A;  1CMY B;  3D1K B;  3HEO A;  2MBW A;  4MQH B;  1JY7 B;  1JY7 A;  3QZX A;  3HF4 B;  1CMY A;  4DC7 A;  3OO4 B;  3DHT B;  1AJ9 B;  2HZ2 A;  2OH9 A;  1JP6 A;  1ABY A;  4MQK A;  1QSI A;  1UX9 A;  4GY3 A;  1C7C B;  3VNC A;  1OFK A;  3UHE A;  4FH7 A;  2W31 A;  3DBJ A;  5D5R A;  3LQD A;  2MGE A;  4HRR B;  3ZOM A;  1ON7 B;  5E6E A;  1MLH A;  1JWN A;  1YMC A;  3SDN A;  3PI9 A;  1NY9 A;  1FDH A;  5AQD M;  2GRF A;  2O5T X;  5CN8 A;  1YHR B;  4M4A B;  1HGB B;  1HLB A;  3CIU A;  108M A;  1Y0T A;  2EVP A;  2AV0 A;  1ECN A;  1FHJ B;  1AJH A;  2XKH A;  3GKV A;  3GYS A;  1JL6 A;  1G0B B;  2V1J A;  1MLQ A;  5ILR A;  1D8U A;  5AB8 A;  1HDS A;  4Z8K B;  3G4Y A;  3GYS B;  4HBI A;  2JLG A;  2AUP A;  2O5L X;  1MLF A;  3VHB A;  3WCU D;  2HBC B;  4H2L B;  1GDI A;  2R4W A;  1DXT A;  3EOK A;  3HHB B;  5CN4 A;  3AT5 A;  1GDK A;  1NPG A;  3IC2 A;  1Y85 B;  1SDL B;  1YFF A;  4A8K A;  5EOH A;  1LIA A;  2HCO B;  1PBX B;  1THB B;  2W6W A;  1GZX B;  1Y09 A;  2PGH A;  3QJE A;  4G1V A;  5IKS A;  1J7Y B;  1BZP A;  3E55 A;  1DUO A;  1FAW B;  1Y0A A;  1CLS A;  3S66 B;  1ECO A;  1RQ4 B;  1EYX B;  3D1A B;  4DWU A;  1HBR A;  1KD2 A;  3QJD A;  3VRF B;  1OBM A;  3ONZ A;  5FVB A;  3PI8 B;  5EV5 A;  4A8S A;  4HHB A;  2B7H A;  1XQ5 A;  2ZS0 D;  1JEB B;  1EW6 A;  1Y4B A;  3UHQ A;  6HBW B;  1JP9 A;  2GKM A;  1HBB A;  3OO5 B;  1R1X B;  1WAC A;  4MQG A;  3O18 B;  1GDJ A;  2MGJ A;  1MOB A;  4HSX A;  4N6S A;  1DXV A;  2D5Z A;  5KKK A;  1YVT A;  1Y4V B;  2AUR A;  2FAM A;  2VLY A;  1V4X B;  3M39 A;  2VHB A;  4MQH A;  5C6Y A;  2ZLX A;  1NIH B;  4AVE A;  2MYC A;  2ZLW B;  1YOG A;  1A3O A;  2DN3 B;  2DN3 A;  1RVW B;  1XZ7 B;  1LFY A;  4IRO A;  4IRO B;  3AQ5 A;  4NZI A;  1VXE A;  1BJE A;  2C0K A;  1PMB A;  2G11 A;  3GQG A;  2X49 A;  3BRP A;  1NEJ B;  3MVC A;  1Y5K A;  2ZS0 B;  2JL9 A;  3AQ7 A;  1XZV B;  1GVH A;  2BK9 A;  3P5Q B;  4A8F A;  2H8F B;  1LFZ B;  1YCB A;  3WCV D;  3RJ6 A;  1OR4 A;  1LHS A;  1DLW A;  3MKB B;  4VHB A;  1AJG A;  1RTX A;  1OUT A;  1SI4 B;  1BAB A;  3WR1 A;  1ON7 A;  2ZSP A;  1A4F B;  3WCU A;  3M38 A;  3KMF C;  1UMO A;  1G09 B;  3ZJJ A;  1Y8H A;  101M A;  3UGY A;  1GCV A;  3QJC B;  1CO9 A;  4F6I A;  1CG5 B;  1Y83 A;  3OGB A;  5EYS A;  3A59 A;  1MWC A;  1HBB B;  4NXA A;  1G0B A;  4WJG 1;  3LB3 A;  1CG8 A;  5JDO F;  2LH5 A;  1XZV A;  1GLI B;  1Y85 A;  3ZJO A;  1Y8W A;  2MHB B;  1KN1 A;  2VJT A;  3ZJR A;  1YG5 A;  1DLY A;  1YHU A;  1XXT B;  4H0B A;  4A8Y A;  1UVL A;  1MBN A;  3AT6 A;  1X9F D;  3OZU A;  1S5Y A;  3HXN A;  1MNK A;  1J41 A;  1NS6 A;  1A6G A;  1Y7D A;  1CPC B;  1S5X A;  2ZSR A;  1LH6 A;  1Y5F A;  1O1K A;  1IDR A;  2D2N B;  1Y7C A;  1YHE B;  3EU1 B;  2AA1 B;  1Y2Z B;  1HBR B;  1KD2 B;  1SDK B;  1A6N A;  4HRR A;  3UI0 A;  2W6V B;  2AV3 A;  1HBG A;  4XDI A;  3G4W A;  1NQP B;  1J7W B;  3DBJ B;  1V4U B;  3ECX A;  1S61 A;  3WTG B;  4ROM B;  2V1K A;  3MYN A;  4U8U C;  1HHO A;  1O1P A;  1Y0C A;  4M4B B;  3BCQ A;  3BJ1 A;  1CH5 A;  1HHS A;  3WCV A;  2DKC A;  1Y8I B;  1EMY A;  5MBN A;  2C7L B;  4A8W A;  1CH7 A;  1MTI A;  1BZR A;  2HBE B;  1HAB A;  3IC0 A;  1I3D A;  1NS9 A;  1Y46 B;  3WCT D;  4GY3 B;  2GL3 A;  2LH6 A;  1EBC A;  2ZLT B;  1Y4Q B;  1VHB A;  1VXA A;  2R50 A;  1CH3 A;  3B75 B;  3AT6 B;  2QSP B;  4WCH D;  1JZL A;  3PI2 A;  1Y0D B;  2DXM A;  3A0G B;  5JOM A;  2MGH A;  2SPM A;  1N9I A;  1SHR B;  1SHR A;  2O5S X;  5AZQ A;  2ZLW A;  1G08 B;  2VEB A;  2XKI A;  3AQ6 A;  4HHB B;  1DUK A;  3VAU A;  1LH2 A;  3ARK A;  1YGD B;  4L7Y A;  1LFL A;  3IA3 B;  2ZSY A;  1YEU B;  3LR9 A;  1BZZ A;  3G4R A;  2VM0 A;  2V1E A;  1HA7 B;  1H1X A;  4LM6 B;  2ZFO C;  3QM9 A;  3DHR A;  1NPF A;  1DTM A;  1TOX A;  1Y4P B;  2R80 A;  3G4Q A;  1O16 A;  1X46 A;  3DUT A;  2MHB A;  2HCO A;  3V57 B;  1NGK A;  2JHO A;  3A5B A;  4ODC A;  3IC2 B;  3TM3 A;  1MYZ A;  1DKE A;  1VXF A;  1Y35 B;  1EYX A;  3BOM A;  2VRY A;  1HDA A;  1XZU A;  1K0Y B;  4NK1 A;  2QU0 B;  1MLU A;  1S6A A;  1HI8 A;  1Y0A B;  1HI0 P;  2HHE B;  3TLD A;  4MXL A;  2D2N D;  2HBF B;  1PHN A;  3GKT A;  1NS6 B;  2VJH A;  1ABY B;  4MQK B;  1MYM A;  3GUQ A;  1XF6 C;  2VLX A;  2G0R A;  2VYZ A;  2BMM A;  1MLG A;  1JW8 A;  1COH B;  4RMP B;  2OIF A;  5CHR A;  1OUU A;  4X0L A;  3GIO A;  1YHU B;  3V2V A;  3PI9 B;  1ABS A;  1GBU A;  4O4Z A;  2EB9 A;  3ODQ A;  3PI4 A;  2VYY A;  4ETV A;  4NI0 B;  1LHT A;  4N7P B;  5HLQ A;  4G1B A;  3ECL A;  4YU3 B;  2ZT4 A;  1YGD A;  4L7Y B;  4NI0 A;  3UHN A;  1VXG A;  2ZS1 A;  4NK2 A;  5CNC A;  1JL7 A;  3UH3 A;  1WMU B;  1RPS A;  2O5M X;  1XZ7 A;  1BZ1 B;  4LMX B;  3D7O A;  4AVD A;  2ZWJ A;  1HBS A;  1BIJ B;  3QQR A;  3MWN A;  4H2L A;  4UIQ A;  4N8T B;  2DN2 B;  1CBM A;  2MGC A;  1YG5 B;  4U8U B;  3WHM B;  2D5X B;  2ZST A;  2VJR A;  3KUO A;  1HDS B;  1LFV B;  3FEW X;  1Y4Q A;  3GK9 A;  3RGK A;  2DHB B;  3CY5 B;  5HAV A;  1XZ4 B;  4PO5 B;  1LFT B;  1MNJ A;  3ZOL A;  1Y5J A;  3ZHW A;  2UUM A;  3D17 B;  3A9M A;  2Z85 A;  1O1N B;  1CLS B;  5EQM A;  3UHB A;  3DR9 A;  2BW9 M;  4KMV A;  1Y5J B;  2O58 X;  3HEN A;  3S65 A;  105M A;  1S56 A;  3V58 A;  3WFW A;  2GNV A;  1ALL B;  1DXU A;  7HBI A;  1FDH G;  1VWT B;  3K8B B;  5HLU A;  3V58 B;  1KTP A;  1NXF A;  1OR6 A;  4ROL B;  1O1M A;  1ABW A;  3WCW A;  2HBC A;  3LB4 A;  1XZ5 B;  2ZSN A;  2D2N A;  4L1E B;  2ZFO B;  1MYJ A;  2X4A A;  1J3Z A;  5CHQ A;  4B4Y A;  1XZ4 A;  2MYA A;  4OF9 A;  4Q70 B;  3M3B A;  1RSE A;  2AA1 A;  1T1N A;  3OO5 A;  1C40 B;  1C7D B;  5KER B;  1Y4P A;  2R1H A;  4IT8 A;  1NIH A;  2HZ3 A;  2OHA A;  2C7J B;  3D7O B;  1DXD A;  1Y7D B;  2RAO B;  1DTI A;  6HBI A;  2NRL A;  2C7K B;  3UHD A;  4C44 A;  1HBA B;  2LH3 A;  3G4V A;  3PEL A;  1HV4 B;  3NMM B;  1FN3 B;  2RAO A;  1HRM A;  2ZSQ A;  1KFR A;  1UVK A;  1UC3 A;  2D2M D;  1A01 B;  4PQ6 A;  4ESA A;  3IXF A;  1R1X A;  2H8D A;  3KVS A;  2MGF A;  3WFX A;  5FVB M;  3PI3 A;  1MKO A;  3ODQ B;  3LQ9 A;  1Y22 A;  2H35 B;  1N9X A;  3PT8 A;  2D2N C;  4H0M B;  1V75 A;  1OUT B;  2ZT0 A;  4M4B A;  2ZSO A;  1XG0 C;  3NL7 A;  2G0V A;  1XCH A;  1HHO B;  2W6Y A;  1BZZ B;  1QPW A;  1YEU A;  3S66 A;  1V4W B;  1LH5 A;  1J40 B;  1CII A;  2FRF A;  3RJN B;  1CG5 A;  1Y83 B;  2V8A B;  2NSR A;  3L0F A;  1B33 A;  2HBD A;  2ZT1 A;  1HBH B;  1Y5K B;  2D5X A;  1IOP A;  1FCS A;  3PI8 A;  2O5B X;  3MYM A;  2MGM A;  1QSH B;  1NWI A;  4ERT A;  5ILP A;  1KN1 B;  2W72 C;  1F63 A;  4FWY A;  3ZTA A;  2GRH A;  1C40 A;  4JAC A;  2E2Y A;  1YE2 A;  3LQD B;  1MTJ A;  2PEG B;  3MOU A;  3BJ2 B;  2GDM A;  5EE4 D;  2R4X A;  1GDL A;  4ERV A;  1B86 B;  1Y4R B;  4MQJ A;  3ZJI A;  2O5O X;  2BKM A;  3CIU B;  3WCT A;  3NG6 B;  1MLN A;  1IWH B;  1O1O A;  1OFJ A;  1K0Y A;  2WCR A;  4ETU A;  1J3Y B;  2LH2 A;  1A87 A;  4F4O A;  1F99 A;  2AUQ A;  1HJT A;  1KTP B;  2MGA A;  3ONZ B;  1S69 A;  5B84 A;  1DO3 A;  2VJT B;  1A0Z B;  3WCU C;  1YVQ B;  1TU9 A;  1OJ6 A;  1Y8K A;  5CN7 A;  2FRJ X;  1FSX B;  5F2A A;  2WY4 A;  1Y4V A;  3WFT A;  1HA7 A;  3UHY A;  4ZIZ A;  106M A;  1A9W A;  2UUL A;  1XY0 A;  1M9P A;  3BOM B;  1Y4G B;  1XZU B;  1BUW B;  2ZLU A;  4KMW A;  5ILM A;  3BJ1 B;  1YE0 A;  1A4F A;  3WCU B;  4G51 A;  2HHB B;  3D1K A;  1RQ3 B;  3MJU A;  1LFY B;  3L0F B;  1GJN A;  3QJB A;  2D60 A;  1C7D A;  1Y7C B;  3WCV B;  3PT7 B;  4GZG A;  2ZS1 D;  1HI1 A;  2UUM X;  1MYH A;  3GOU A;  2V1I A;  3PMC A;  3UHU A;  4YU3 A;  1CPW A;  3GQP B;  1DWT A;  1HGC A;  1BZ0 B;  2QLS B;  1YEN A;  3E4N A;  1BBB A;  1ITH A;  1V07 A;  2FAL A;  2V1G A;  1HBS B;  4MBA A;  1Y45 A;  2EKT A;  2HBE A;  2GTL A;  1BAB B;  3MBA A;  3MKB A;  1UVX A;  3NG6 A;  109M A;  1CH9 A;  1JDO A;  1S0H B;  2ZFO D;  3GLN A;  1V4W A;  2MYB A;  1DM1 A;  1YMA A;  1Y0W A;  1Y0W B;  4BJA A;  4Z8K A;  3O2C B;  3U3E A;  1VRE A;  1YEQ A;  1DWR A;  2ZT2 A;  1JBO A;  4NS2 A;  1MBA A;  1O1M B;  4PQB A;  4TWV A;  3WCW B;  1VXD A;  2VML B;  1HAB B;  1G9V A;  4NI1 B;  1THB A;  1LJW B;  1LIA B;  4MXK A;  2HBD B;  4NXC A;  4O2G A;  3UHV A;  3ZJS A;  2RI4 A;  1SDK A;  1HBI A;  1JF3 A;  1BBB B;  1J3Z B;  1LUE A;  3E5I A;  1A3N B;  1CBL A;  4B3W A;  1MBI A;  1NWN A;  3K9Z A;  4ZVB A;  5KDQ A;  1HCO A;  1YH9 A;  1X9F B;  5B85 A;  1X9F C;  5EET A;  2C7K A;  1Y5F B;  1J7Y A;  3WTG A;  1O1J A;  2QMB B;  1FAW A;  1MNI A;  3NMM A;  2PEG A;  1X9F A;  2QU0 A;  1G0A B;  3PIA A;  1GCV B;  5CNF A;  1F0L A;  1K1K A;  2UUL D;  1M6M A;  1MDT A;  1CH2 A;  1NEJ A;  5E29 A;  3QJD B;  3VRF A;  4HSW A;  4XS0 A;  1DO7 A;  1JBO B;  2D2M C;  1A01 A;  2H35 A;  3D1A A;  5SW7 A;  3A5A A;  4ESU A;  1MBO A;  4AE0 A;  1GLI A;  4F6G A;  3AG0 A;  2D2M A;  2VYW A;  2YRS A;  1A00 A;  1MBD A;  1NQP A;  2ZLV B;  3NUH B;  1S0H A;  3MN0 A;  4MAX A;  2W6V A;  1QPW B;  2GRZ A;  3WCW D;  1B0B A;  4HRT A;  3LB2 A;  5C6E B;  1RVW A;  4HH0 A;  1FSL A;  1BIN A;  1I7Y B;  3E5O A;  2ZLU B;  1MYF A;  3KUN A;  4F4O B;  1BZ1 A;  3WCV C;  2R1H B;  3QQQ A;  1WMU A;  4G51 B;  1Y0C B;  3HC9 A;  2ZS1 B;  1J3F A;  4NI1 A;  1Y8I A;  4A8O A;  3KVS B;  2HBF A;  1QXE A;  2GLN A;  1LFZ A;  103M A;  5ILE A;  1HGC B;  1LFV A;  3S1I A;  3DHT A;  1Y4B B;  4O1T A;  1MOA A;  2ZT3 A;  2LHB A;  3VRG A;  1Y46 A;  4LPI A;  1JZM A;  1XXT A;  2FRK X;  1GCW B;  3QJE B;  4YJJ B;  4YJJ A;  3S65 B;  4ODC B;  3HYU B;  1C7B A;  1C7B B;  1HAC A;  1LFQ B;  1MLL A;  1DO4 A;  3QMA A;  1IWH A;  1YIH A;  2EF2 A;  2UUN B;  1IRC A;  1F5P A;  4FH6 A;  2VEE A;  1YDZ A;  3G4U A;  1O1P B;  2MGI A;  4AE1 A;  5HU6 A;  3O2C A;  1AJ9 A;  3GQR A;  3GQR B;  1A0Z A;  4OOD A;  4HH1 A;  4ZVA A;  3WCP B;  2ZSX A;  1V5H A;  3OZV A;  1LH3 A;  3ARJ A;  5EUI B;  4GXE A;  3WI8 A;  2V1H A;  4N8T A;  4LMS B;  3BA2 A;  2LH7 A;  3V57 A;  1MGN A;  2QRW A;  2WCQ A;  2VJR B;  1X3K A;  3ZH0 A;  1M6C A;  5E6E B;  4JYQ A;  2EB8 A;  1OUU B;  4X0L B;  1YE0 B;  1R1Y A;  4QAU A;  2HBS B;  3ZJQ A;  1UVM A;  2OH8 A;  2IN4 A;  3VRE B;  3VRE A;  3WCT C;  4PNJ A;  1MWD A;  2MB5 A;  1A6M A;  1CQ2 A;  3R5I A;  3GQG B;  3A2G A;  2G10 A;  4KJT A;  5EU2 A;  1HGA B;  4XS0 B;  1Y8K B;  1J7S B;  1NZ5 A;  2C7L A;  2G0S A;  3QJC A;  4MQI B;  3K8B A;  1XQ5 B;  3FS4 A;  2QFN A;  4H07 A;  3MJU B;  1RQ3 A;  1A0U B;  1Y01 B;  1Y45 B;  3PIA B;  2VJH B;  2NX0 A;  1LA6 A;  1LA6 B;  1Y2Z A;  2RI4 B;  2ZFO A;  1GCW A;  3QM6 A;  1I3E A;  1MKO B;  2GTL C;  1YZI B;  2Z6T A;  1JPB A;  3RQR A;  4SDH A;  5KDQ B;  3D17 A;  3OZW A;  1V4U A;  1A00 B;  1NZ4 A;  2MGB A;  2BLH A;  2QSS A;  1MYG A;  1G08 A;  1N9H A;  1BVC A;  3UHS A;  1QXD B;  4A8M P;  5AQD A;  1YOI A;  5HBI A;  2XKG A;  1DXT B;  2AUO A;  1CP5 A;  3B75 A;  3TM9 A;  1XZ2 A;  2H8D B;  1UX8 A;  2ZLT A;  2HZ1 A;  3SDH A;  3D4X B;  4ESA B;  4DWT A;  2H8F A;  2BWH A;  2MYD A;  1MNH A;  4FC3 B;  3UHW A;  107M A;  4BJU A;  2GNW A;  2XYK A;  1NAZ A;  2O5Q X;  1RQA A;  3A0G A;  5CN9 A;  4TWU A;  3UH5 A;  5EYJ A;  4A8Q A;  1XYE A;  1ALL A;  1DXU B;  1G0A A;  1Y7G A;  112M A;  4MQI A;  1G9V B;  2MGK A;  3PMD A;  1MBC A;  3EDB A;  1Y7Z A;  3A59 B;  1Y4F A;  1Y4F B;  2M6Z A;  2M6Z B;  3WCW C;  3GKV B;  4MQG B;  1UIW B;  1MYT A;  1GBV B;  3A5G A;  4O35 A;  4UZV A;  1JEB A;  1SWM A;  3QM8 A;  1YFF B;  3IC0 B;  3CY5 A;  1DKE B;  1Y35 A;  1UVI A;  4N7O A;  1YVQ A;  1GZX A;  1Y09 B;  3V2Z A;  2DKD A;  3DUT B;  2HHD B;  1IRD A;  1IRD B;  2W6X A;  1KR7 A;  3H57 A;  1A3O B;  2J96 A;  1VXB A;  2GTL D;  2R80 B;  1YGF A;  2NRM A;  2UUM B;  3BCQ B;  4F69 A;  3AQ8 A;  2WTH A;  1J3Y A;  1DXC A;  4U8U D;  4O4T A;  1QXE B;  1F5O A;  1HBA A;  1F65 A;  2BV8 B;  3UHR A;  2ZS0 A;  5HU6 B;  1CPC A;  3ORD A;  2UUN D;  3D4X A;  1ABW B;  3LR7 A;  1UVJ A;  2ZS0 C;  2D2M B;  2BNL A;  1COL A;  3FS4 B;  2CMM A;  2GTL B;  1ECA A;  1QSH A;  1LH7 A;  2MYE A;  1UVY A;  3UHG A;  4RMP A;  2DKA A;  4PQC A;  1ECD A;  4N7O B;  3SZK B;  1V4X A;  3O7N A; 
#chains in the Genus database with same CATH homology
 102M A;  1DXV B;  1M9P B;  3UHT A;  5JDO E;  3ZJH A;  4N7N A;  1Q1F A;  1HLM A;  1CH4 A;  1URY A;  3GOU B;  3UHZ A;  1J41 B;  2KSC A;  3LB1 A;  1Y7Z B;  2GKN A;  4N7P A;  1QSI B;  1SPE A;  3PT7 A;  1HGB A;  3UH6 A;  4TYX A;  5JGG A;  1HAC B;  3WHM A;  2ZS1 C;  2QSS B;  3GDJ B;  1O1L B;  1VXH A;  3HRW A;  2W72 A;  2EKU A;  3ZJM A;  1JF4 A;  1YEN B;  3EOK B;  5JGG B;  5E83 A;  1NZ3 A;  1FN3 A;  1C7C A;  4MQC B;  1YOH A;  1DO1 A;  2MGD A;  3O89 A;  1B86 A;  1LFT A;  1Y4R A;  3R0G A;  4MQJ B;  5CNE A;  5E83 B;  2PGH B;  3BJ2 A;  4FWX A;  1TES A;  1MWB A;  1U7S A;  1HCO B;  2R4Z A;  3ZJL A;  3NL7 B;  3HYU A;  4MBN A;  1SI4 A;  1MZ0 A;  2HBG A;  3QM5 A;  3PI1 A;  1J7S A;  2WTG A;  4ILZ A;  1RQA B;  4M4A A;  4MU5 A;  3NFE A;  1R1Y B;  3W4U A;  1CQX A;  1Y0D A;  5E29 B;  1YEQ B;  1RQ4 A;  2LH1 A;  1YHE A;  1GBV A;  2FRI X;  1O1I A;  3UBV A;  1MLM A;  1MOD A;  2SPL A;  3BJ3 B;  5HY8 B;  1UFJ A;  1BZ0 A;  1O1I B;  3AQ9 A;  1MLJ A;  6HBW A;  1SPG B;  1LH1 A;  5EE4 C;  2MGL A;  5JDO D;  3QM7 A;  4C0N A;  1UFP A;  1A3N A;  1J52 A;  1WLA A;  1QXD A;  1Y4G A;  3ASE A;  3WCT B;  1MOC A;  1O1K B;  1VXC A;  1CIK A;  1J40 A;  1MLK A;  1MTK A;  2Z6N A;  1IBE B;  3R5I B;  3OK5 A;  1H97 A;  5JDO C;  1HV4 A;  2V1F A;  5AZR A;  1UIW A;  2G3H A;  5SW7 B;  4L2M A;  1CIO A;  3ED9 A;  3OO4 A;  111M A;  3G53 A;  5CNB A;  1COH A;  1YMB A;  3PT8 B;  1A9W E;  1HSY A;  1MLO A;  5F0B A;  5CN6 A;  1ASH A;  3S1J A;  1YCA A;  1J7W A;  1CO8 A;  4N7N B;  1Y7G B;  2R4Y A;  2Z8A A;  1V75 B;  1YDZ B;  1IBE A;  4ROL A;  5CNG A;  1FHJ A;  3EDA A;  3S48 C;  1HDB A;  1Y31 B;  2DN1 B;  4U8U A;  3ZJN A;  3OVU C;  2OLP A;  2BLI A;  1QI8 B;  3P5Q A;  4MPM A;  5EUI A;  5MBA A;  2OHB A;  4YU4 B;  3UBC A;  1CG8 B;  1O1N A;  2G14 A;  4MQC A;  4FC3 A;  4ROM A;  2HBS A;  1G09 A;  2MGG A;  1O1J B;  1NZ2 A;  1YGF B;  1YIH B;  1IT3 A;  1VWT A;  1YE2 B;  1MNO A;  1YH9 B;  3LHB A;  1S5Y B;  3ARL A;  1LFQ A;  2HHB A;  2D60 B;  1Y8H B;  3MJP A;  3MJP B;  1K1K B;  1CP0 A;  1FLP A;  4WJG A;  2B7H B;  4DC8 A;  3W4U B;  110M A;  3AT5 B;  4KN3 A;  1O1L A;  3HRW B;  1A6K A;  3NML A;  1BZ6 A;  1JP8 A;  1MOH A;  1XY0 B;  1YIE B;  2SPN A;  1SPG A;  2ZSS A;  1BVD A;  2DHB A;  1FSX A;  1V9Q A;  2NSS A;  5CMV A;  1MLR A;  4YU4 A;  5HLX A;  1MCY A;  2HHD A;  5KER A;  3K3U A;  3M3A A;  1T1N B;  3ECZ A;  1MYI A;  4F6J A;  3GDJ A;  5C6E A;  2VLZ A;  3EU1 A;  2QLS A;  1RTE A;  1RPS B;  3FH9 B;  2ZLX B;  1JZK A;  2ZFB A;  1YEV A;  1DWS A;  5CN5 A;  3BJ3 A;  3FH9 A;  1LTW A;  1XZ2 B;  3PEL B;  2D5Z B;  2ZFB B;  5D1V A;  3WFU A;  1YIE A;  3GQP A;  3SZK A;  1YZI A;  2Z6S A;  1YHR A;  1YHU D;  2BLJ M;  5CND A;  2G12 A;  2W72 B;  3VRG B;  1Y22 B;  1AZI A;  4HRT B;  1YVT B;  4UUR A;  3H58 A;  2DXM B;  2QMB A;  1BUW A;  3UHX A;  2HHE A;  2Z6N B;  3WCP A;  1W92 A;  1Y0T B;  3G52 A;  3QJB B;  2DC3 A;  3UGZ A;  2G0X A;  1MDN A;  1URV A;  1XYE B;  1NS9 B;  1UT0 A;  1MLS A;  1WVP A;  3HF4 A;  3NFE B;  3OJ1 A;  1BIJ A;  3HHB A;  1QI8 A;  1PBX A;  1L2K A;  1HBH A;  4FWZ A;  1LJW A;  3UHI A;  1SDL A;  3QZZ A;  2DN2 A;  1Y31 A;  1IT2 A;  2ZLV A;  5M3S A;  5HY8 A;  4F6B A;  2QSP A;  2IG3 A;  2SPO A;  1S5X B;  1LFL B;  1U7R A;  1YEV B;  3KMF A;  2ZSZ A;  3HXN B;  3UHH A;  3WR1 B;  1CH1 A;  1A0U A;  2G0Z A;  2D6C A;  3HEP A;  3UHC A;  1Y8W B;  1HDB B;  1O1O B;  2DN1 A;  1HGA A;  3DHR B;  2QFK A;  3G46 A;  4F68 A;  1N9F A;  3UH7 A;  104M A;  1XZ5 A;  1MBS A;  4F6F A;  1VRF A;  1YHU C;  1GBU B;  1EBT A;  3UHK A;  4F6D A;  1Z8U B;  2YRS B;  2EVK A;  1EWA A;  3ZJP A;  1HDA B;  1YEO B;  1YEO A;  1CMY B;  3D1K B;  3HEO A;  2MBW A;  4MQH B;  1JY7 B;  1JY7 A;  3QZX A;  3HF4 B;  1CMY A;  4DC7 A;  3OO4 B;  3DHT B;  1AJ9 B;  2HZ2 A;  2OH9 A;  1JP6 A;  1ABY A;  4MQK A;  1QSI A;  1UX9 A;  1C7C B;  1OFK A;  3UHE A;  4FH7 A;  2W31 A;  5D5R A;  3LQD A;  2MGE A;  4HRR B;  3ZOM A;  5E6E A;  1MLH A;  1JWN A;  1YMC A;  3SDN A;  3PI9 A;  1FDH A;  2GRF A;  2O5T X;  5CN8 A;  1YHR B;  4M4A B;  1HGB B;  1HLB A;  3CIU A;  108M A;  1Y0T A;  2EVP A;  2AV0 A;  1ECN A;  1FHJ B;  1AJH A;  2XKH A;  3GKV A;  3GYS A;  1JL6 A;  1G0B B;  2V1J A;  1MLQ A;  5ILR A;  1D8U A;  5AB8 A;  1HDS A;  3G4Y A;  3GYS B;  4HBI A;  2AUP A;  2O5L X;  1MLF A;  3VHB A;  3WCU D;  2HBC B;  4H2L B;  1GDI A;  2R4W A;  1DXT A;  3EOK A;  3HHB B;  5CN4 A;  3AT5 A;  1GDK A;  1NPG A;  3IC2 A;  1Y85 B;  1SDL B;  1YFF A;  5EOH A;  2HCO B;  1PBX B;  1THB B;  2W6W A;  1GZX B;  1Y09 A;  2PGH A;  3QJE A;  4G1V A;  5IKS A;  1J7Y B;  1BZP A;  3E55 A;  1DUO A;  1FAW B;  1Y0A A;  1CLS A;  3S66 B;  1ECO A;  1RQ4 B;  3D1A B;  4DWU A;  1HBR A;  1KD2 A;  3QJD A;  3VRF B;  1OBM A;  3ONZ A;  3PI8 B;  5EV5 A;  4HHB A;  2B7H A;  1XQ5 A;  2ZS0 D;  1JEB B;  1EW6 A;  1Y4B A;  3UHQ A;  6HBW B;  1JP9 A;  2GKM A;  1HBB A;  3OO5 B;  1R1X B;  4MQG A;  1GDJ A;  2MGJ A;  1MOB A;  4HSX A;  1DXV A;  2D5Z A;  5KKK A;  1YVT A;  1Y4V B;  2AUR A;  2FAM A;  2VLY A;  1V4X B;  3M39 A;  2VHB A;  4MQH A;  5C6Y A;  2ZLX A;  1NIH B;  4AVE A;  2MYC A;  2ZLW B;  1YOG A;  1A3O A;  2DN3 B;  2DN3 A;  1RVW B;  1XZ7 B;  1LFY A;  4IRO A;  4IRO B;  3AQ5 A;  4NZI A;  1VXE A;  1BJE A;  2C0K A;  1PMB A;  2G11 A;  3GQG A;  1NEJ B;  3MVC A;  1Y5K A;  2ZS0 B;  3AQ7 A;  1XZV B;  1GVH A;  2BK9 A;  3P5Q B;  2H8F B;  1LFZ B;  1YCB A;  3WCV D;  3RJ6 A;  1OR4 A;  1LHS A;  1DLW A;  3MKB B;  4VHB A;  1AJG A;  1RTX A;  1OUT A;  1SI4 B;  1BAB A;  3WR1 A;  2ZSP A;  1A4F B;  3WCU A;  3M38 A;  3KMF C;  1UMO A;  1G09 B;  3ZJJ A;  1Y8H A;  101M A;  3UGY A;  1GCV A;  3QJC B;  1CO9 A;  4F6I A;  1CG5 B;  1Y83 A;  3OGB A;  5EYS A;  3A59 A;  1MWC A;  1HBB B;  4NXA A;  1G0B A;  4WJG 1;  3LB3 A;  1CG8 A;  5JDO F;  2LH5 A;  1XZV A;  1GLI B;  1Y85 A;  3ZJO A;  1Y8W A;  2MHB B;  3ZJR A;  1YG5 A;  1DLY A;  1YHU A;  1XXT B;  4H0B A;  1MBN A;  3AT6 A;  1X9F D;  3OZU A;  1S5Y A;  3HXN A;  1MNK A;  1J41 A;  1NS6 A;  1A6G A;  1Y7D A;  1S5X A;  2ZSR A;  1LH6 A;  1Y5F A;  1O1K A;  1IDR A;  2D2N B;  1Y7C A;  1YHE B;  3EU1 B;  2AA1 B;  1Y2Z B;  1HBR B;  1KD2 B;  1SDK B;  1A6N A;  4HRR A;  3UI0 A;  2W6V B;  2AV3 A;  1HBG A;  4XDI A;  3G4W A;  1NQP B;  1J7W B;  1V4U B;  3ECX A;  1S61 A;  3WTG B;  4ROM B;  2V1K A;  3MYN A;  4U8U C;  1HHO A;  1O1P A;  1Y0C A;  4M4B B;  3BCQ A;  3BJ1 A;  1CH5 A;  3WCV A;  1Y8I B;  1EMY A;  5MBN A;  1CH7 A;  1MTI A;  1BZR A;  2HBE B;  1HAB A;  3IC0 A;  1I3D A;  1NS9 A;  1Y46 B;  3WCT D;  2GL3 A;  2LH6 A;  1EBC A;  2ZLT B;  1Y4Q B;  1VHB A;  1VXA A;  2R50 A;  1CH3 A;  3B75 B;  3AT6 B;  2QSP B;  4WCH D;  1JZL A;  3PI2 A;  1Y0D B;  2DXM A;  3A0G B;  5JOM A;  2MGH A;  2SPM A;  1N9I A;  1SHR B;  1SHR A;  2O5S X;  5AZQ A;  2ZLW A;  1G08 B;  2VEB A;  2XKI A;  3AQ6 A;  4HHB B;  1DUK A;  3VAU A;  1LH2 A;  3ARK A;  1YGD B;  4L7Y A;  1LFL A;  3IA3 B;  2ZSY A;  1YEU B;  3LR9 A;  1BZZ A;  3G4R A;  2VM0 A;  2V1E A;  1H1X A;  2ZFO C;  3QM9 A;  3DHR A;  1NPF A;  1DTM A;  1Y4P B;  2R80 A;  3G4Q A;  1O16 A;  1X46 A;  3DUT A;  2MHB A;  2HCO A;  1NGK A;  2JHO A;  3A5B A;  4ODC A;  3IC2 B;  3TM3 A;  1MYZ A;  1DKE A;  1VXF A;  1Y35 B;  3BOM A;  2VRY A;  1HDA A;  1XZU A;  1K0Y B;  4NK1 A;  2QU0 B;  1MLU A;  1S6A A;  1Y0A B;  2HHE B;  3TLD A;  4MXL A;  2D2N D;  2HBF B;  3GKT A;  1NS6 B;  1ABY B;  4MQK B;  1MYM A;  2VLX A;  2G0R A;  2VYZ A;  2BMM A;  1MLG A;  1JW8 A;  1COH B;  2OIF A;  5CHR A;  1OUU A;  4X0L A;  1YHU B;  3V2V A;  3PI9 B;  1ABS A;  1GBU A;  4O4Z A;  2EB9 A;  3ODQ A;  3PI4 A;  2VYY A;  4NI0 B;  1LHT A;  4N7P B;  5HLQ A;  4G1B A;  3ECL A;  4YU3 B;  2ZT4 A;  1YGD A;  4L7Y B;  4NI0 A;  3UHN A;  1VXG A;  2ZS1 A;  4NK2 A;  5CNC A;  1JL7 A;  3UH3 A;  1WMU B;  1RPS A;  2O5M X;  1XZ7 A;  1BZ1 B;  3D7O A;  4AVD A;  2ZWJ A;  1HBS A;  1BIJ B;  3QQR A;  4H2L A;  4UIQ A;  4N8T B;  2DN2 B;  1CBM A;  2MGC A;  1YG5 B;  4U8U B;  3WHM B;  2D5X B;  2ZST A;  3KUO A;  1HDS B;  1LFV B;  1Y4Q A;  3GK9 A;  3RGK A;  2DHB B;  3CY5 B;  5HAV A;  1XZ4 B;  1LFT B;  1MNJ A;  3ZOL A;  1Y5J A;  3ZHW A;  3D17 B;  3A9M A;  2Z85 A;  1O1N B;  1CLS B;  5EQM A;  3UHB A;  3DR9 A;  2BW9 M;  4KMV A;  1Y5J B;  2O58 X;  3HEN A;  3S65 A;  105M A;  1S56 A;  3WFW A;  2GNV A;  1DXU A;  7HBI A;  1FDH G;  1VWT B;  3K8B B;  5HLU A;  1NXF A;  1OR6 A;  4ROL B;  1O1M A;  1ABW A;  3WCW A;  2HBC A;  3LB4 A;  1XZ5 B;  2ZSN A;  2D2N A;  2ZFO B;  1MYJ A;  1J3Z A;  5CHQ A;  4B4Y A;  1XZ4 A;  2MYA A;  4OF9 A;  3M3B A;  1RSE A;  2AA1 A;  1T1N A;  3OO5 A;  1C40 B;  1C7D B;  5KER B;  1Y4P A;  2R1H A;  4IT8 A;  1NIH A;  2HZ3 A;  2OHA A;  3D7O B;  1DXD A;  1Y7D B;  2RAO B;  1DTI A;  6HBI A;  2NRL A;  3UHD A;  4C44 A;  1HBA B;  2LH3 A;  3G4V A;  3PEL A;  1HV4 B;  3NMM B;  1FN3 B;  2RAO A;  1HRM A;  2ZSQ A;  1KFR A;  1UC3 A;  2D2M D;  1A01 B;  4PQ6 A;  4ESA A;  3IXF A;  1R1X A;  2H8D A;  2MGF A;  3WFX A;  3PI3 A;  1MKO A;  3ODQ B;  1Y22 A;  2H35 B;  1N9X A;  3PT8 A;  2D2N C;  1V75 A;  1OUT B;  2ZT0 A;  4M4B A;  2ZSO A;  3NL7 A;  2G0V A;  1XCH A;  1HHO B;  2W6Y A;  1BZZ B;  1QPW A;  1YEU A;  3S66 A;  1V4W B;  1LH5 A;  1J40 B;  2FRF A;  3RJN B;  1CG5 A;  1Y83 B;  2NSR A;  2HBD A;  2ZT1 A;  1HBH B;  1Y5K B;  2D5X A;  1IOP A;  1FCS A;  3PI8 A;  2O5B X;  3MYM A;  2MGM A;  1QSH B;  1NWI A;  5ILP A;  2W72 C;  1F63 A;  4FWY A;  2GRH A;  1C40 A;  4JAC A;  2E2Y A;  1YE2 A;  3LQD B;  1MTJ A;  2PEG B;  3MOU A;  3BJ2 B;  2GDM A;  5EE4 D;  2R4X A;  1GDL A;  1B86 B;  1Y4R B;  4MQJ A;  3ZJI A;  2O5O X;  2BKM A;  3CIU B;  3WCT A;  3NG6 B;  1MLN A;  1IWH B;  1O1O A;  1OFJ A;  1K0Y A;  1J3Y B;  2LH2 A;  4F4O A;  2AUQ A;  1HJT A;  2MGA A;  3ONZ B;  1S69 A;  5B84 A;  1DO3 A;  1A0Z B;  3WCU C;  1YVQ B;  1TU9 A;  1OJ6 A;  5CN7 A;  1Y8K A;  2FRJ X;  1FSX B;  5F2A A;  2WY4 A;  1Y4V A;  3WFT A;  3UHY A;  106M A;  1A9W A;  1XY0 A;  1M9P A;  3BOM B;  1Y4G B;  1XZU B;  1BUW B;  2ZLU A;  4KMW A;  5ILM A;  3BJ1 B;  1YE0 A;  1A4F A;  3WCU B;  4G51 A;  2HHB B;  3D1K A;  1RQ3 B;  3MJU A;  1LFY B;  1GJN A;  3QJB A;  2D60 A;  1C7D A;  1Y7C B;  3WCV B;  3PT7 B;  4GZG A;  2ZS1 D;  1MYH A;  3GOU A;  2V1I A;  3UHU A;  4YU3 A;  1CPW A;  3GQP B;  1DWT A;  1HGC A;  1BZ0 B;  2QLS B;  1YEN A;  3E4N A;  1BBB A;  1ITH A;  1V07 A;  2FAL A;  2V1G A;  1HBS B;  4MBA A;  1Y45 A;  2EKT A;  2HBE A;  2GTL A;  1BAB B;  3MBA A;  3MKB A;  1UVX A;  3NG6 A;  109M A;  1CH9 A;  1JDO A;  1S0H B;  2ZFO D;  3GLN A;  1V4W A;  2MYB A;  1DM1 A;  1YMA A;  1Y0W A;  1Y0W B;  4BJA A;  3U3E A;  1VRE A;  1YEQ A;  1DWR A;  2ZT2 A;  4NS2 A;  1MBA A;  1O1M B;  4TWV A;  4PQB A;  3WCW B;  1VXD A;  1HAB B;  1G9V A;  4NI1 B;  1THB A;  1LJW B;  4MXK A;  2HBD B;  4NXC A;  4O2G A;  3UHV A;  3ZJS A;  2RI4 A;  1SDK A;  1HBI A;  1JF3 A;  1BBB B;  1J3Z B;  1LUE A;  3E5I A;  1A3N B;  1CBL A;  4B3W A;  1MBI A;  1NWN A;  3K9Z A;  4ZVB A;  5KDQ A;  1HCO A;  1YH9 A;  1X9F B;  5B85 A;  1X9F C;  5EET A;  1Y5F B;  1J7Y A;  3WTG A;  1O1J A;  2QMB B;  1FAW A;  1MNI A;  3NMM A;  2PEG A;  1X9F A;  2QU0 A;  1G0A B;  3PIA A;  1GCV B;  5CNF A;  1K1K A;  1M6M A;  1CH2 A;  1NEJ A;  5E29 A;  3QJD B;  3VRF A;  4HSW A;  4XS0 A;  1DO7 A;  2D2M C;  1A01 A;  2H35 A;  3D1A A;  5SW7 A;  3A5A A;  1MBO A;  1GLI A;  4F6G A;  3AG0 A;  2D2M A;  2VYW A;  2YRS A;  1A00 A;  1MBD A;  1NQP A;  2ZLV B;  1S0H A;  3MN0 A;  4MAX A;  2W6V A;  1QPW B;  2GRZ A;  3WCW D;  1B0B A;  4HRT A;  3LB2 A;  5C6E B;  1RVW A;  1FSL A;  1BIN A;  3E5O A;  2ZLU B;  1MYF A;  3KUN A;  4F4O B;  1BZ1 A;  3WCV C;  2R1H B;  3QQQ A;  1WMU A;  4G51 B;  1Y0C B;  3HC9 A;  2ZS1 B;  1J3F A;  4NI1 A;  1Y8I A;  2HBF A;  1QXE A;  2GLN A;  1LFZ A;  103M A;  5ILE A;  1HGC B;  1LFV A;  3S1I A;  3DHT A;  1Y4B B;  4O1T A;  1MOA A;  2ZT3 A;  2LHB A;  3VRG A;  1Y46 A;  4LPI A;  1JZM A;  1XXT A;  2FRK X;  1GCW B;  3QJE B;  3S65 B;  4ODC B;  3HYU B;  1C7B A;  1C7B B;  1HAC A;  1MLL A;  1LFQ B;  1DO4 A;  3QMA A;  1IWH A;  1YIH A;  2EF2 A;  1IRC A;  1F5P A;  4FH6 A;  2VEE A;  1YDZ A;  3G4U A;  1O1P B;  2MGI A;  5HU6 A;  1AJ9 A;  3GQR A;  3GQR B;  1A0Z A;  4OOD A;  3WCP B;  4ZVA A;  2ZSX A;  1V5H A;  3OZV A;  1LH3 A;  3ARJ A;  5EUI B;  3WI8 A;  2V1H A;  4N8T A;  3BA2 A;  2LH7 A;  1MGN A;  2QRW A;  1X3K A;  3ZH0 A;  1M6C A;  5E6E B;  4JYQ A;  2EB8 A;  1OUU B;  4X0L B;  1YE0 B;  1R1Y A;  4QAU A;  2HBS B;  3ZJQ A;  2OH8 A;  2IN4 A;  3VRE B;  3VRE A;  3WCT C;  4PNJ A;  1MWD A;  2MB5 A;  1A6M A;  1CQ2 A;  3R5I A;  3GQG B;  3A2G A;  2G10 A;  4KJT A;  5EU2 A;  1HGA B;  4XS0 B;  1Y8K B;  1J7S B;  1NZ5 A;  2G0S A;  3QJC A;  4MQI B;  3K8B A;  1XQ5 B;  3FS4 A;  2QFN A;  4H07 A;  3MJU B;  1RQ3 A;  1A0U B;  1Y01 B;  1Y45 B;  3PIA B;  2NX0 A;  1LA6 A;  1LA6 B;  1Y2Z A;  2RI4 B;  2ZFO A;  1GCW A;  3QM6 A;  1I3E A;  1MKO B;  2GTL C;  1YZI B;  2Z6T A;  1JPB A;  4SDH A;  5KDQ B;  3D17 A;  3OZW A;  1V4U A;  1A00 B;  1NZ4 A;  2MGB A;  2BLH A;  2QSS A;  1MYG A;  1G08 A;  1N9H A;  1BVC A;  3UHS A;  1QXD B;  1YOI A;  5HBI A;  2XKG A;  1DXT B;  2AUO A;  1CP5 A;  3B75 A;  3TM9 A;  1XZ2 A;  2H8D B;  1UX8 A;  2ZLT A;  2HZ1 A;  3SDH A;  3D4X B;  4ESA B;  4DWT A;  2H8F A;  2BWH A;  2MYD A;  1MNH A;  4FC3 B;  3UHW A;  107M A;  2GNW A;  2XYK A;  1NAZ A;  2O5Q X;  1RQA A;  3A0G A;  5CN9 A;  4TWU A;  3UH5 A;  5EYJ A;  1XYE A;  1DXU B;  1G0A A;  1Y7G A;  112M A;  4MQI A;  1G9V B;  2MGK A;  1MBC A;  3EDB A;  1Y7Z A;  3A59 B;  1Y4F A;  1Y4F B;  2M6Z A;  2M6Z B;  3WCW C;  3GKV B;  4MQG B;  1UIW B;  1MYT A;  1GBV B;  3A5G A;  4O35 A;  4UZV A;  1JEB A;  1SWM A;  3QM8 A;  1YFF B;  3IC0 B;  3CY5 A;  1DKE B;  1Y35 A;  4N7O A;  1YVQ A;  1GZX A;  1Y09 B;  3V2Z A;  3DUT B;  2HHD B;  1IRD A;  1IRD B;  2W6X A;  1KR7 A;  3H57 A;  1A3O B;  1VXB A;  2GTL D;  2R80 B;  1YGF A;  2NRM A;  3BCQ B;  4F69 A;  3AQ8 A;  2WTH A;  1J3Y A;  1DXC A;  4U8U D;  4O4T A;  1QXE B;  1F5O A;  1HBA A;  1F65 A;  3UHR A;  2ZS0 A;  5HU6 B;  3ORD A;  3D4X A;  1ABW B;  3LR7 A;  2ZS0 C;  2D2M B;  2BNL A;  3FS4 B;  2CMM A;  2GTL B;  1ECA A;  1QSH A;  1LH7 A;  2MYE A;  1UVY A;  3UHG A;  4PQC A;  1ECD A;  4N7O B;  3SZK B;  1V4X A;  3O7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...