1HBXG

Ternary complex of sap-1 and srf with specific sre dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
155
structure length
112
Chain Sequence
DSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMSRNDYIHSGLYSSFTLNSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The B-Box Dominates Sap-1/Srf Interactions in the Structure of the Ternary Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords SERUM RESPONSE FACTOR
total genus 20
structure length 112
sequence length 155
chains with identical sequence H
ec nomenclature
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hbxG00
4HV6A 2ZCWA 3K2ZA 4I98B 2PLYA 2MA3A 1D5VA 3RPQA 2HR3A 1JE8A 1P4XA 4A12A 2UWMA 3I59B 1XSXA 3H92A 2RN7A 1R1UA 1MJAA 4IRHA 1K79A 1XB4A 1YFHA 4RB2C 5L3DA 5BPIA 1K78B 2DLLA 2VOOA 1KYZA 4KNYA 3HHHA 4KICA 1G3SA 5L3BA 2HQNA 3RYPA 3GO5A 3ZQ7A 2EWNA 2DW4A 1O3RA 1KQ9A 1JGSA 1IXRC 2Q2EA 4MNUA 2XASA 4IRIA 1SAXA 2PI0A 4CYDA 1B4AA 3REOA 4S04A 5HVQC 2QLZA 2HEOA 1I1SA 5HDGA 2VBYA 5E20A 4RGXA 1CF7A 2A61A 5D5XB 3E6DA 2TDXA 1QBJA 3FMSA 3L2CA 2LF8A 1XN7A 3OOPA 6PAXA 1G3TA 2Y48A 1DDNA 2DU9A 3Q9SA 3KP5A 2M5WA 2YX4A 3IC7A 1OPCA 2CWEA 1LB2A 2K4JA 1QPMA 5J8CA 2V1XA 3ISPA 3QP6A 5E17F 4BQAA 5L3CA 3LA3A 2PFBA 1XCVA 1IAWA 3WTWC 3W6KB 2E1NA 4LMYA 4KA4A 1MGTA 3DV8A 4ZYEA 3BJOA 4KIBA 5CLSA 2VBWA 4MEXF 4XLNF 3FWEA 4LK1F 1J59A 2JZYA 5D4RA 4WWCA 1H0MA 4P9FA 4I09A 1Y0UA 4UHTA 1B6AA 3DP7A 2EK5A 2WTEA 1FT9A 2NNNA 5DYMA 3WE3A 1BJAA 3IKVA 4YFKF 3QRFF 4GYIA 2EA4A 1J7KA 1R7JA 4PZJA 1G3WA 4HDUA 1ONVA 4EJWA 3KP2A 4A5MA 4H0EA 3QPHA 3J81K 3R4KA 5LEKA 5K5QA 1TW3A 2OBPA 3FMQA 1ZYRF 1R23A 1FSHA 2DK5A 1IN8A 2M8EA 2F2EA 5J6XA 1FBQA 2P7CB 5LBQA 2EV0A 1KQ8A 3KCCA 3VODA 4U7BA 3WTUC 1LDKB 4G8XA 4I01A 5HLGA 3KP3A 2QBYA 2DI3A 5LGUA 4RB3C 1XSVA 1AWCA 5HLIA 2XVCA 4EM2A 2E7XA 1IN4A 2RVCA 2XRNA 5TRDA 1OKRA 5EEGA 2VE9A 3WODF 3MAJA 3ZPLA 3I53A 3TOBA 5HDKA 1XGSA 3VB2A 4A5NA 1RUNA 2GIVA 2H6BA 2MH2A 3ROUA 3TOAA 3WE2A 2FMYA 5CVRA 2FNPA 1H9TA 2F5EA 4OOIA 4L0YB 1REPC 3GW2A 1B1BA 3DF8A 1Z1DA 1FLIA 3T1BA 1IRGA 1XDSA 3T5XA 2RGVA 1LEAA 4KT5C 5DEQA 3IKTA 1IW7F 3F6OA 4AIKA 3K0LA 1JHHA 4L9TA 2XV4S 2CW0F 3HRUA 1Q1HA 5HS9A 4ZYGA 2RC4A 1YTYA 3LA7A 2CGPA 4JK1X 5J8FA 2GWRA 4PCQA 3P7NA 2AS5F 4ESBA 2HZTA 3HSFA 1D3YA 4MTDA 4HX4A 3W6JB 3I64A 1GVJA 2UZKA 2VOPA 3J80Z 1UB9A 1SD4A 4R1HA 3HSEA 3MZYA 4UV9A 1B59A 2BEOA 1FZPB 3GUDA 5JR3A 1BIBA 2PBIA 4D0PA 2IVMA 3ZN0A 3HSRA 2KIMA 5LEJA 4LLNA 3LSTA 1IXSB 2DQRA 4YFNF 3F22A 4GGGA 5JI6A 3V8LA 3F8NA 4G9YA 2IW5A 1W7PD 5IT9Z 5ERIA 1W7PA 1ZN2A 4IF4A 2R3SA 3CTAA 1LNWA 1S29A 1R5HA 2V9VA 4U0YA 1K6OA 2V6CA 1V3FA 2QQ9A 3GYHX 2EJRA 3CUQB 3E6MA 4L0ZB 4G7HF 4G6DA 3E6CC 3WU1B 1U3EM 3DPTA 1OYWA 1XSDA 4OIQF 2K7LA 2ESNA 2DQLA 3V7SA 2FBKA 2JTVA 4A0XA 1D8KA 4AIJA 4EJUA 3F6VA 4ENNA 1YW7A 2XAJA 5ED4A 1YG2A 2G9WA 4G7ZF 1ZREA 3JW4A 2YSRA 3B73A 1YW8A 5FD6A 1P6RA 3K9TA 3E3VA 4KDPA 2IRFG 1F1ZA 1D8JA 4S05A 2P5KA 2E1CA 4WCGA 4F7ZA 1HSJA 3PQKA 3WGHA 3NRVA 5L3FA 3J7AO 2M87A 3V8KA 1ZRCA 4Q48A 1SMYF 2ZXJA 2ACJA 2HFHA 3QPTA 3ECHA 3R0JA 3QU3A 4RB1A 1G3YA 2RDPA 3LAJA 3DKWA 5ILUA 4KMFA 3MWMA 3SXYA 2ZJ2A 4KYWA 1TLHB 3TDUC 1MDMA 2DK8A 3L00A 1U5TA 3WTVC 2PEXA 3M8FA 3E6BA 2EB7A 2EFPA 2OQRA 3QU6A 3R6SA 2K27A 2HDCA 4LB5A 2ZBKA 3RKWA 1J2XA 2FNAA 1K7AA 3EQLF 2DAOA 3BOQA 2BV6A 2DO7A 2IT0A 1KGSA 2W85A 4HA8A 1WWXA 3FM3A 3BPXA 1QGPA 4XSZF 2IP2A 1FX7A 1GXQA 2XAFA 3GFJA 1FYKA 1FP2A 1MKMA 4XSXF 1BM9A 2EA2A 2L02A 2FF4A 3I4PA 3V7RA 3WTTC 2JRTA 1PP8F 3WTZA 3KEOA 4NB5A 1MDMB 2PG4A 3DFGA 3ELKA 3TO6A 2KJCA 3ZN1A 1SFXA 4XLPF 1P4AA 5F1RA 4AIHA 5ILVA 1XMAA 2VE8A 4ZZDA 5FFZA 4M9XA 1I1GA 1G4DA 2H94A 4EMSA 2KIUA 3HIFA 5D6FA 1UHMA 3RTRA 1FY7A 1DP7P 1ZRDA 1ZGAA 3V8JA 1RZ4A 2ELHA 1WI9A 3BJ6A 3F8FA 2W25A 3K1PA 3ULQB 1ZLKA 2FE3A 2QWWA 4FHTA 3DQVC 2XAGA 3ABUA 1R36A 2LF7A 1XGOA 2ETHA 3WG9A 1WRJA 4WXDA 4EM0B 3QAHA 3ZMZA 1O3TA 1T6SA 2DBBA 1UHWA 1I27A 2OZ6A 4CZZA 1H9GA 2PQ8A 4WX9A 2ZMEA 2Z33A 1FBUA 1ZARA 3TQNA 2JSCA 1LDDA 5H6RA 1U5TB 5ICEA 3HOTA 4PGGA 1OMIA 1U2WA 3T0YA 4M72A 4P55A 5JFRA 5E1XA 3SHFA 3ZMVA 3M9AA 5FGMA 3TKYA 3E97A 1WKMA 1ZHFA 5F64A 1Z91A 1U78A 1V4RA 2Z5UA 5DCMB 3HRTA 1O3QA 5H20A 2NYXA 3QOPA 2M30A 3FX3A 3KETA 1BI0A 2K02A 2FSWA 2IJLA 5E1WA 2HS5A 2CFXA 2VODA 1O7LA 3GX4X 2Y75A 2KKOA 4EJTA 1MJBA 4M6XA 4K2EA 3HTUA 4R8HA 3AAFA 3EDPA 1UFMA 3JAMZ 3WGGA 4AD9A 1S8NA 3FXQA 5CYVA 3F23A 1ZGJA 1HW1A 3HUGA 1OR7A 1J0RA 3I0TA 5FB2A 3RIRA 1QO0D 2RV8A 2OD5A 2O6GE 4OINF 3BJAA 2O0YA 4HLYA 2K4BA 5FO5A 1XGNA 4MHGA 2D1VA 4QLCU 4RGRA 2O03A 2FXAA 4I0BA 2XUBA 2OA4A 2H6CA 2MLGA 4IRGA 1IZ1A 1FYMA 2H09A 4O6JA 4IHTA 1RNLA 4LD5A 3JAMK 1SD6A 2P6TA 4KUMA 3CJNA 1HKTA 3M1EA 3NEUA 2L3DA 2UXXA 3U2RA 5CVUA 5BQTA 3COAC 3E5QA 4EGZA 1ZLJA 4UXNA 1HW2A 4Q4ZF 4OIPF 2QQBA 4A6DA 4BAYA 4Y15A 4B8XA 2D2WA 3I71A 3CUQA 3HTSB 3RKXA 2EFOA 2VBXA 1LQ1A 3TGNA 1HXDA 1XCBA 2FMLA 3IRQA 4GCVA 3KP7A 1W7PB 1L3LA 2FBIA 2PMHA 3KP6A 3T8TA 4L5JA 5LRRA 1PDNC 1P92A 1STZA 1TNSA 2GA1A 1J9IA 5KVRA 4HOBA 4JBAA 2HGCA 3Q9VA 4EM1A 5F6FA 2J5PA 3PFIA 1W4MA 3GZ6A 3BZ6A 4AVPA 4LJZF 2IA0A 4UVAA 3KP4A 1ZG5A 2ZNYA 4PDKA 1F5TA 4P5OA 2MBFA 2L01A 4O5VA 2EV5A 4WXCA 3C7JA 4KN4X 2EFNA 3WGIA 1EH7A 1QZYA 2IA2A 4B09A 4NHJA 3GFMA 4A2UA 1R5GA 2D45A 3G73A 5FD5A 3QP5A 4CGZA 4LLGF 2IA1A 3MEXA 3GXOA 3RI4A 1LJ9A 4BXUA 4BH9A 1I6XA 5D5UB 4LB6B 4LG0B 4HF2A 5E18F 4HAMA 1F9NA 5IT3A 2ESHA 1BI3A 5AIQA 1SD7A 1FC3A 3FXRA 1ZH5A 2D1HA 3LWFA 2QBYB 2ADUA 2F5CA 3JSOA 3F21A 3GZ5A 2ISYA 2QQAA 4XRFA 1TQIA 2J5OA 4LFUA 4M9SA 1QNTA 1P2FA 2GZWA 1RUOA 2FQ3A 1P4WA 5D6EA 3ZP5A 1BC8C 2BE5F 2FOKA 2HKXA 5JHUA 1BOAA 3ZMSA 3N4MA 4UVBA 5JVTA 1B9MA 4KMUX 5CVJA 1EH6A 4I02A 2XKOA 3SFZA 2QM3A 1ZRFA 5CVVA 4PGHA 2UXNA 5E1ZB 3U9GA 1S7AA 1DUXC 4HF1A 1S6LA 1BI1A 2Y0MA 1G6NA 2BGCA 3CLOA 1U6GA 2MC3A 2RKHA 3N97A 4RAYA 1XDUA 2A68F 2W24A 4DNCA 2HKOA 3U1DA 2NAZA 3S2WA 4U0WA 1I5ZA 1OYIA 2JT1A 3TO9A 1USTA 4CO8A 4MEYF 2XKPA 1A04A 2KRFA 2M1BA 5FFXA 1MD0A 1ZG3A 2P5VA 4DQ2A 3J81Z 2Z9OA 3R61A 1YQAA 5K5OA 3T8RA 2A07F 3EUHA 4UNOA 5A2QZ 4GO1A 1EH8A 1LDJA 3H3ZA 3LAPA 1L0OC 4IJAA 3LFKA 2OQGA 3RDIA 1SMTA 4A0YA 1BC7C 1SD5A 2CQKA 3FZVA 4EQQA 4G94A 1PUEE 4N9IA 4FX0A 4M9ZA 3WU0A 3TDZC 3E5XA 1KYWA 3JTGA 1AOYA 4ZZLA 2Z3YA 2VC0A 4HLXA 1MJ9A 3HOSA 5L3EA 2Q8KA 5HLHA 1KU3A 3K1MA 3ZMDA 5FLXZ 3K1NA 3MZHA 3CUOA 4U0VA 4L9NA 3GF2A 4LK0F 1O57A 2G7UA 4WK8F 1CF7B 4QWQA 2CG4A 1B9NA 1E17A 4EV0A 4OMYA 3RYRA 3VFZA 5HS8A 1HQCA 5D8KB 2EFWA 3DXJF 3FM5A 3HHGA 3IWFA 1BI2A 2W57A 1T0FA 4Y13A 2FRHA 1SFUA 1CGPA 5IT9K 3HYIA 1FPQA 4I0AA 4G6QA 4LLLA 5AONA 4RGSA 3H3UA 1ON2A 3GFIA 1BIAA 1C0WA 1TTYA 2GA2A 3P9CA 5L3GA 1IXCA 2MD5A 2OAZA 3BROA 2G7HA 1T2KA 3BY6A 1O3SA 2ZMEB 3FMRA 2HQRA 2QUFA 5BMZA 5LGTA 5E8GA 1R1TA 4I7HA 3V4GA 3BP8A 1UCRA 1KA8A 3HRSA 1IRFA 1DPRA 4M71A 1FOKA 1NHAA 1TW2A 4HV5A 5BS6A 4L9VA 2HTJA 2QYOA 1KU2A 4KIGA 1K78A 3ERED 5KK1A 4N0BA 4OMZA 3R60A 4CHUA 4KIFA 3M8EA 2HWVA 3EYIA 5HDNA 3P9KA 1YLFA 4LG0A 4O3MA 1IN7A 4BHPA 3IRRA 1LVAA 2R7DA 1TBXA 1JXSA 1IF1A 5CVIA 4P9UA 1QZZA 1IUYA 3O3KA 3G3ZA 2GQQA 4YIFA 2IPQX 2YU3A 4R79A 1ZAOA 1E2XA 3F72A 4MQ9F 1YYVA 5TJJA 4OU0A 1Z6TA 2GXGA 1ODDA 3D0SA 3E5UA 1HKSA 1EV7A 2KJBA 2P5LC 4UVCA 4M6YA 4IHSA 4ETSA 4N9HA 4MGRA 3Q5FA 2LNBA 2X4HA 4HX7A 5ILSA 2HYGD 4IPAA 3JTHA 5LRSA 2P6SA 2F5FA 2V79A 1GXPA 2H27A 2DT5A 2YPRA 3CDHA 5D4SA 2NS0A 4LGWA 3ZMUA 2AXLA 4ASNA 2VC1A 1FYLA 3ML6A 4U88A 2A69F 3EYYA 5DCMA 4EJVA 2DTRA 4EGYA 1Z7UA 3C3WA 3O2PE 2XHKA 1USSA 2CSOA 1ULYA 4HQMA 4Q5SF 2V1DA 4ZYDA 2EV6A 5D8LB 4L5IA 1IN6A 3K69A 4OIOF 1S3JA 4NQWA 3ABTA 3I54A 2QENA 2YR2A 2HTSA 2PJPA 3CO7C 2RNJA 2COMA 4MQVA 4U7DA 2B0LA 2WC2A 3PQJA 5DD8A 1O7FA 2C6YA 3RJPA 5LLQA 3NQOA 1IN5A 4GXOA 2VT3A 2P7VB 1Z05A 4WF2A 4HX8A 4EVIA 3BWGA 5DCFA 1BBYA 2NNYA 1F4KA 3FHZA 3TO7A 5EEHA 1YO5C 5DDGA 1MZBA 1R00A 1R1VA 2O61A 2HOEA 2O8XA 2O3FA 3F8BA 3I5UA 3KLNA 2PN6A 4A6EA 4ON0A 4WXHA 5ICCA 2R7FA 4EJOA 2V1UA 3FF5A 2XAQA 3GVAA 4IXAA 2F5DA 4Z2YA 2JPCA 3CUQC 3SQNA 4CICA 1YS7A 4TV7A 2FBHA 1J5YA 3GFLA 3RPUA 5DV5A 3SZPA 5H6QA 2WWYA 1YIOA 3F3XA 3J80K 2ZNZA 5LHHA 3P9IA 2STWA 3B02A 2YX7A 4HW0A 2VBZA 2A6HF 1RIOH 3KFWX 4CXFA 2DPDA 4CDGA 3MQ0A 2LSOA 2Z99A 2DPUA 4JQFA 1TNTA 5ICFA 1TQMA 2L54A 1TQPA 2VXZA 3KZYA 3VOEA 3MCZA 1HW5A 4RGUA 1FSEA 3O6BB 3LQRA 1FWZA 3LQQA 4RAZA 2PMUA 1WSUA 5D5WB 3DEUA 3VEPA 2L4MA 3ECOA 4HZFA 5DUIA 2DFIA 3L7WA 1SFEA 5DD4A 4BNCA 1XD7A 3F8CA 1U8RA 3L9FA 2ISZA 2P4WA 1HKQA 2STTA 3M7GA 2XIGA 4ESFA 4HQEA 2EFQA 2VN2A 3DPLC 4YIIA 3IWZA 2CO5A 3I58A 3JSPA 5K1YA 3L09A 1T39A 2M45A 2L4AA 4I2OA 3GLXA 1R22A 4MTEA 3EETA 2VONA 2BBYA 3LA2A 5LHGA 4G7OF 2LKPA 4RS8A 3I59A 4XBFA 3WTSC 3GWZA 1JHFA 1KU7A 5DUKA 2MLKA 2K86A 4FT8A 2NRAC 2XROA 3F8MA 1ZG1A 1KQ0A 2VT2A 2FA5A 1HBXG 1PP7U 3HRMA 2QVOA 4L18B 3KEQA 4KFCA 2FU4A 2XAHA 1BN5A 4AWXB 4KN7X 1XMKA 2WV0A 3SZTA 1ON1A 1Z6RA 4ZYHA 2OZUA 4ESJA 4A0ZA 2ZO4A 5LGNA 1X3UA 1S7OA 3BPVA 5LHIA 2P8TA 1FBSA 1VTNC 4BHBA 4ENMA 1T38A 2GXBA 4HYEA 4BHCA 2FEZA 3KE2A 1QQIA 3D5LA 4FX4A 3IHUA 2RQPA 1FP1D 5D5VB 4M74A 5E8IA 4Q47A 1W5TA 4YG2F 2A3SA 5A2QK 5BOXA 5AIPA 2X0LA 5ICGA 5FLXK 2E7WA 2KIFA 2A6EF 3ZMTA 5BPDA 5HS7A 1HSTA 4YFXF 3C1DA 4M73A 3CO6C 2MH9A 2OU2A 1LEBA 3V7CA 4UUVA 4UV8A 4RB0A 4HF0A 4HDVA 1KU9A 4ENKA 1DPUA 1T98A 4Y17A 3GEZA 1GHCA 1W5SA 2HYFA 1R58A 5K5RA 4IVNA 3OV8A 2ZKZA 2LDUA 1J75A 2Q0OA 2GAUA 4OIRF 2XGXA 4BYYA 2BYVE 4P96A 3RKYA 1Z9CA 4ZH4F 3WTYC 3R0AA 1YS6A 1U5TC 4HBLA 3KZZA 1OYYA 3KLOA 3BDDA 3C18A 3IL2A 4ENJA 1FNNA 3MFKA 1WQ2A 4E70A 2JPBA 3FXUA 4L9JA 2QZ8A 1RI7A 5HOOA 4GYGA 1YW9A 1XGMA 2W84A 2CYYA 3WTXC 2ZFWA 5CJ9A 2A5YB
chains in the Genus database with same CATH superfamily
3JRBA 4HV6A 1ZGWA 3OY9A 2ZCWA 4HNTA 3K2ZA 4I98B 1T8IA 2PLYA 2NS7A 2MA3A 1ZR4A 3KYDB 1D5VA 3QYFA 3RPQA 2HR3A 3AKZA 4PSWA 1JE8A 1P4XA 4A12A 2UWMA 3OS0A 3I59B 2JA5J 3H0DA 3PIPF 4MIMA 1K61A 2BVLA 1XSXA 1PUFA 1OCPA 3H92A 4PSXA 2RN7A 2YU9J 2E19A 1R1UA 4DYCA 1ENHA 1MJAA 4IRHA 1K79A 5M5YJ 2Y0SN 3L2UA 1XB4A 2XF6A 4CYCA 1YFHA 4RB2C 3QWLA 1ETVA 3HGGA 5L3DA 4FE4A 4DYRA 5BPIA 2DLLA 1K78B 2VOOA 4S0HB 1KYZA 4KNYA 2QKMB 2BVMA 3FXLA 3HZJA 3HHHA 4KICA 1G3SA 5L3BA 1XG1A 4H4KC 2HQNA 3RYPA 3GO5A 2OUMA 2DMUA 3DEEA 1YRNB 5F0CA 2EZHA 2EWNA 1BJZA 1POGA 3ZQ7A 2DW4A 5EYRA 1E3HA 1O3RA 3E1SA 1KQ9A 5GTHC 1JGSA 1IXRC 2Q2EA 4MNUA 2XASA 4X1EA 4IRIA 1SAXA 3GMEA 4M6VA 1FOYA 2PI0A 3ZQHA 4BEHB 3S8PA 5H2FC 4BXXJ 4CYDA 4ZDLA 1B4AA 1FIPA 1O3SA 3REOA 4S04A 5HVQC 2QLZA 4Z6YA 2HEOA 3CESA 4GFBA 4L5EA 1VQ5I 1I1SA 1MBFA 5HDGA 2VBYA 5E20A 1EA3A 4RGXA 2WY7Q 1CF7A 2A61A 5D5XB 3A2KA 3E6DA 1Z7LA 2TDXA 1QBJA 3FMSA 3PO2J 3L2CA 1BW5A 2LF8A 1XN7A 2WAEA 3OOPA 6PAXA 4XONA 1G3TA 2Y48A 1YE9A 1DDNA 2E5NA 2R7VA 2DU9A 2R5YB 2E2IJ 3Q9SA 1ITYA 1SVLA 2HOSA 4RAGA 3KP5A 3IAS2 2M5WA 3S93A 3FXKA 2YX4A 3A02A 3IC7A 1OPCA 4BJTA 2CWEA 1LB2A 1D1CA 2AO9A 1IV6A 2K4JA 1QPMA 3AG4H 5J8CA 2V1XA 1G8XA 2PJRA 3ISPA 3TMOA 3QP6A 5E17F 4BQAA 5L3CA 3LA3A 2PFBA 2IBDA 2GIZA 4KISA 1MW7A 2NXNB 3JR9A 1XCVA 2BY1A 1N25A 1IAWA 2MGQA 4V2GA 3EUKL 4UB6C 3WTWC 2H1LA 3W6KB 4CCOA 2E1NA 4LMYA 3CCEI 4KA4A 4LITA 3LSIA 3W6VA 2ZC2A 2KDOA 3SZGA 2CU7A 1MGTA 2DA4A 3PNYA 3DV8A 4ZYEA 3BJOA 5CPRB 4FQGA 2IGKA 4KIBA 5CLSA 2VBWA 5GAEJ 3HM5A 4MEXF 4XLNF 4BL0B 3FWEA 4LK1F 2VKDA 1J59A 2X51A 2JZYA 5D4RA 3S1NJ 4I99C 2Y9YA 4A3BJ 2COBA 3I56I 4WWCA 2PX9A 1H89C 2CW8A 3I55I 4CA0A 1H0MA 4P9FA 2F4IA 4I09A 1Y0UA 4UHTA 1B6AA 4F91B 1LUJB 2HDWA 2BHYA 3HBLA 1A31A 1XMXA 3DP7A 2EK5A 2WTEA 2VQHA 2F6CA 3HXLA 1FT9A 3CC7I 3GLLA 3TW6A 3JRCA 2NNNA 5DYMA 3BR3A 3WE3A 2E36A 3CCUI 1BJAA 3IKVA 3HOUJ 4YFKF 3QRFF 3H35A 4GYIA 2VB6A 4W97A 2EA4A 3LSJA 4EEFG 1J7KA 1R7JA 4PZJA 4BDYA 2R7SA 1G3WA 1W0TA 3CZ6A 3FISA 5FJ8J 1FMVA 1WJBA 4HDUA 3BQZA 4DGWB 1ONVA 1SFKA 4EJWA 3KP2A 4A5MA 2X48A 4H0EA 2X6OA 3QPLA 3QPHA 1A5JA 1G59A 1T0FC 3J81K 3R4KA 5LEKA 5IYCJ 3QYBA 5K5QA 1TW3A 2V9KA 4CSWA 2OBPA 3FMQA 5B5EC 4E7ZA 1HLVA 2VPLA 1ZYRF 2M7AA 3N05A 1R23A 2K3PA 1FSHA 2DK5A 3UNGC 1Y6IA 1IN8A 2M8EA 2RNGA 3MN2A 4B48A 3PO3J 1Z67A 2F2EA 2CW7A 2R5ZA 5J6XA 1FBQA 2P7CB 2VLAA 2P81A 2ZSHB 3H36A 4AU7A 4D9JA 3PNVA 3OSGA 5LBQA 2EV0A 3C2HA 3M8JA 4C3HJ 3HC7A 3JRIA 1KQ8A 2VQGA 2PMZA 3KCCA 3VODA 4U7BA 2VIXA 2ZXHA 3WTUC 1LDKB 4XLAA 4G8XA 4I01A 5HLGA 3RZOJ 3KP3A 2CUFA 2QBYA 2DI3A 5LGUA 4RB3C 1XSVA 3I9V2 1AWCA 1R4MB 5DS9A 5HLIA 2XVCA 1OISA 3U21A 4EM2A 4XN3A 2E7XA 3KEYA 1IN4A 2RVCA 2XRNA 5TRDA 1OKRA 5EEGA 2KIQA 2VE9A 3WODF 3MAJA 3ZPLA 4PFOA 4FISA 3I53A 3TOBA 3BG3A 1XGSA 3VB2A 5HDKA 4A5NA 3VYTB 3IH3A 1RUNA 3CMEI 2GIVA 2H6BA 5FLMJ 2BXYA 2MH2A 2O5RA 2Q2EB 3ROUA 3TOAA 3WE2A 2B7EA 2FMYA 5CVRA 5EJCA 1VNDA 2OCCH 5CKTA 2LKXA 2FNPA 1H9TA 1VQ8I 2F5EA 4OOIA 3DCFA 3WU2C 2FUG2 3RQ4A 4L0YB 1REPC 3GW2A 3OYNA 2M4GA 1B1BA 3FIWA 3DF8A 1Z1DA 1FLIA 2XF7A 1I39A 3T1BA 1MH3A 3FKJA 3CJQB 1IRGA 1XDSA 3BQYA 3T5XA 2RGVA 4IKFA 1LEAA 3FXMA 1Y8RB 4KT5C 2ID3A 5IOZA 5M5WJ 1IG7A 5DEQA 2OTJI 3IKTA 1IW7F 1E3OC 5J47A 2Y69H 1JKQC 3F6OA 4AIKA 3K0LA 3K4MA 2ZJPF 1JHHA 4XICA 4L9TA 4BUPA 2XV4S 2CW0F 3HRUA 3KIOA 2IEKA 3UKGA 1Q1HA 5HS9A 4ZYGA 2RC4A 1YTYA 1DGRM 1Y1WJ 3CMYA 3LA7A 4HPQA 3OYBA 2CGPA 3HEFA 1FEXA 2VPRA 1NK2P 4JK1X 1PVEA 5J8FA 2GWRA 3CC4I 4PCQA 3P7NA 2EIJH 4CCKA 1MBGA 2AS5F 3A4CA 4ESBA 2HZTA 1MNEA 3HSFA 1D3YA 4MTDA 4HX4A 2DT7B 1LFUP 3W6JB 3I64A 1GVJA 4MFDA 1IV8A 1D0ZA 3MZ8A 2E60A 2CJJA 2QQ8A 2X1CA 4N4OB 2UZKA 2BY3A 2VOPA 3QOEA 3KYCB 1SVMA 3J80Z 1V5FA 1UB9A 4RBOA 1SD4A 4M3BA 4R1HA 3HSEA 3DKYA 3MZYA 2EZIA 3CCLI 4UV9A 3CF5F 1B59A 2BEOA 1FZPB 3GUDA 5JR3A 1BIBA 2PBIA 4D0PA 2L9VA 5C4JJ 2IVMA 3ZN0A 3LSKA 1FJLA 3HSRA 2M4KA 4BE0A 4BGDA 4A3MJ 2KIMA 2KZGA 5LEJA 4LLNA 3LSTA 1IXSB 3Q0UA 2DQRA 4YFNF 3F22A 4E7IA 4GGGA 5JI6A 4DOZA 4RLQA 3V8LA 4BQQA 3F8NA 2ZMEC 2IW5A 4G9YA 4DBRA 1GT0C 1W7PD 2QA4I 1SFOJ 1DQUA 2V26A 3GTPJ 3ERMA 3TEDA 2KFDA 5IT9Z 5ERIA 2E1OA 2H8WA 4J01A 3DU5A 3BTIA 3OR2C 1W7PA 1ZN2A 4IF4A 3F0CA 2R3SA 3CTAA 1LNWA 2GLOA 3L2VA 5GPAA 1S29A 3FBNB 1LKXA 1SANA 1R5HA 2V9VA 2EQRA 4U0YA 4XKBA 3CMAI 1K6OA 2V6CA 1ETOA 3JCUC 1V3FA 3IP4B 5JVGF 4V2FA 2QQ9A 4FE7A 3GYHX 2EJRA 4Y33A 5E79C 3CUQB 3E6MA 4L0ZB 4UUTA 4G7HF 4G6DA 3E6CC 4HSTA 3DBHB 2LMDA 3CP8A 2ZB9A 3WU1B 2KRCA 1U3EM 3S2DJ 1N75A 2QF7A 3H9GA 1V55H 3DPTA 3BTJA 1OYWA 1X1DA 4OAYA 2ELKA 3SDGA 1XSDA 2XPVA 4OIQF 3FDYA 3CP2A 2ZSIB 3S16J 3FKIJ 2Z1DA 5KAFC 2K7LA 2ESNA 3HKZA 2DQLA 2RREA 3OMYA 4Y3OA 3V7SA 2FBKA 2JTVA 4A0XA 5IP7J 1D8KA 1PJRA 2GOMA 4ZC3A 5EG0A 2DYRH 4AIJA 4EJUA 3DTEA 1ETYA 3F6VA 1MSEC 4ENNA 1YW7A 2JA8J 2ME6A 2XAJA 5F08A 5ED4A 1YG2A 2IS6A 2G9WA 4G7ZF 1LFPA 1JKPC 1U0JA 1OCRH 1ZREA 4U87A 3JW4A 2BW3B 2YSRA 3B73A 1YW8A 4FETA 5FD6A 1P6RA 1OQYA 4BE2A 4A3EJ 2JA7J 3K9TA 5FRNA 3E3VA 5F27A 3J7ZI 2ECBA 4KDPA 1H88C 2JJ7A 2IRFG 3W3CA 2K5CA 1F1ZA 1OCCH 1D8JA 1J09A 4S05A 2P5KA 2E1CA 1WFXA 4WCGA 1GV2A 1IRZA 4F7ZA 1LPQA 3UR3C 1HSJA 3PQKA 3WGHA 1ZKGA 2DFEA 3PM1A 4M3FA 3NRVA 5IP6A 5L3FA 3HUGB 3J7AO 2M87A 3V8KA 1ZRCA 3H5AA 5E3NA 2R7ZJ 4Q48A 1SMYF 3KPHA 2ZXJA 3FXOA 3OWTA 1WJEA 2MD0A 2KL4A 1VQ9I 2ACJA 2HFHA 3QPTA 3ECHA 2RQQA 3R0JA 3QU3A 4RB1A 1G3YA 5M3FJ 2YS9A 2RDPA 1P7JA 1K4SA 5HLTA 3DKWA 5ILUA 3LAJA 4BS9A 4KMFA 2W00A 1LE8A 3MWMA 4DIQA 3H1CA 3SXYA 4IOAF 3BTLA 2ZJ2A 4KYWA 1G2HA 1TWGJ 1TLHB 3TDUC 1MDMA 2CV0A 2DK8A 3L00A 1U5TA 2W1OA 1OCZH 1RC9A 3WTVC 2PEXA 2HU9A 3E6BA 3M8FA 4B44A 2EB7A 2EFPA 2OQRA 3QU6A 3R6SA 2HDDA 2FJ1A 2K27A 2L5QA 2HDCA 4LB5A 2ZBKA 3RKWA 1J2XA 2FNAA 1WJFA 3JRGA 3EQLF 1K7AA 4V19K 1I6HJ 2DAOA 3BOQA 1IJWC 2XSDC 2BV6A 2DO7A 2IT0A 1T08B 2A05A 1KGSA 2W85A 4HA8A 1WWXA 3FM3A 2JRMA 4PJJA 3G2BA 1RETA 2OTLI 2QEXI 3K4KA 2XSJC 1MH4A 1WPKA 3BPXA 1MBJA 1QGPA 3FBIB 4XSZF 5GPCA 3OYFA 2IP2A 1FX7A 1R4NB 2W48A 3OYCA 1ORKA 1GXQA 2OF7A 2QSFX 2XAFA 3ZR8X 3HOYJ 1X1AA 1S72I 3GFJA 1FYKA 1FP2A 3BCBA 1MKMA 4XSXF 1BM9A 2EA2A 2L02A 2KMUA 2FF4A 3MD2A 3RKQA 3I4PA 2BOLA 2DDBA 3OL3A 3V7RA 5HNFA 3WTTC 5J4VA 1VZ0A 5IPAA 2JRTA 1PP8F 4CYCB 3WTZA 4A3GJ 2DYSH 4LIUA 3KEOA 4NB5A 3GTMJ 3CQZJ 1MDMB 5LD2C 3DBLB 2PG4A 3ELKA 3DFGA 3TO6A 1TWFJ 2KJCA 2IXSA 1JI8A 3ZN1A 1SFXA 4XLPF 1P4AA 5F1RA 3OL4A 1X19A 4AIHA 4A3FJ 2DA1A 3J7YJ 5ILVA 4Y7NJ 4AC0A 2R5ZB 5FROA 1XMAA 1FOWA 3TP3A 3IH4A 2VE8A 4ZZDA 5FFZA 2K9NA 4M9XA 1I1GA 1G4DA 2H94A 4EMSA 2KIUA 3HIFA 5D6FA 1UHMA 3RTRA 1FY7A 4OAZA 1DP7P 1ZRDA 1ZGAA 3BR2A 3V8JA 1RZ4A 2ELHA 4JP0A 1WI9A 3BJ6A 3F8FA 2W25A 3LSGA 3K1PA 4PFPA 1AHDP 2HVRA 3ULQB 1ZLKA 2FE3A 2QWWA 4FHTA 3HB9A 2XGDA 3DQVC 2XAGA 3ABUA 1W36D 1R36A 2LF7A 3ONQA 1WJCA 1XGOA 2ETHA 3WG9A 1WRJA 4WXDA 4EM0B 3PFYA 3SJMA 2XGEA 1X58A 2M3AA 3QAHA 3ZMZA 1MBHA 1ERDA 1O3TA 4E7JA 4ANJA 1T6SA 3BR5A 1MMNA 2K85A 2DBBA 1UHWA 2LOOA 2XRLA 2IGNA 1VQKI 1I27A 2OZ6A 4C3JJ 4CZZA 2HVQA 1H9GA 2DA5A 2PQ8A 4WX9A 2RAEA 2AXTC 2ZMEA 2Z33A 1FBUA 2KPMA 1ZARA 3M07A 3TQNA 3PJRA 2JSCA 1LDDA 3G1MA 5H6RA 1U5TB 1BOBA 3OYEA 5IYBJ 5ICEA 3HOTA 2ZFUA 4PGGA 4HNVA 3DU6A 1OMIA 1U2WA 1ACIA 4D7MA 1ZQ3P 3T0YA 4M72A 4RDUA 4XRMA 3OYGA 4P55A 5JFRA 5E1XA 2L2OA 3SHFA 3ZMVA 2LVSA 3M9AA 3CCVI 2HYJA 3K4LA 4LIVA 5FGMA 2DCEA 4A3LJ 2W7NA 2NVUB 1D1BA 3TKYA 3OIOA 2NVXJ 3E97A 1WKMA 1ZHFA 5F64A 1Z91A 1U78A 1V4RA 3K4NA 3EUAA 3M1CA 3MKWB 2R92J 2Z5UA 4PK4A 3PUFA 5DCMB 2L7FP 2I10A 3HRTA 1O3QA 3VWBA 5FLVA 1VQLI 5H20A 4CCLA 4KJZA 2AQFA 2NYXA 3QOPA 4ABZA 2M30A 3FX3A 3KETA 1U9NA 1BI0A 2K02A 1M1EB 2FSWA 2IJLA 5E1WA 1VQOI 2HS5A 1SEUA 1XTAA 1UMQA 4XQFA 4YEJA 2CFXA 3K2AA 2VODA 4ITVA 1O7LA 3GX4X 2DJIA 4JYKA 2Y75A 1NH3A 2LY9A 4E7HA 4XN0A 2KKOA 4EJTA 1MJBA 4M6XA 4K2EA 3V42A 3HTUA 1VQ6I 1ETQA 3A0BC 4R8HA 3AAFA 5F04A 3OIQA 5JHFA 4CUGA 3EDPA 1UFMA 2R7QA 3JAMZ 4DYQA 3A01B 1APLC 2O7OA 1IGNA 3WGGA 1JT0A 4AD9A 3CCRI 1S8NA 3ZRGA 3FXQA 1OR7C 5EG0B 2R7RA 1BA5A 5CYVA 3S32A 2QSHX 4MFEA 3F23A 4A93J 1ZGJA 3I4NJ 2WY8Q 1HW1A 3HUGA 3K70D 4C2TA 2MW8A 2H8RA 1X1BA 1OR7A 1ZK8A 1FMWA 4W1UA 4XRSG 5EGOB 1J0RA 3K6GA 3I0TA 5FB2A 1SAUA 3RIRA 4BU2A 3HOZJ 2ICWG 1YX3A 4EATA 3OYKA 1QO0D 2RV8A 2OD5A 3OYAA 2O6GE 4OINF 3DTKA 3BJAA 4XMYA 2O0YA 4HLYA 3CDIA 2K4BA 5FO5A 1XGNA 4MHGA 2D1VA 1R71A 5JLWA 1MNMC 4QLCU 2ZXWH 4RGRA 2O03A 2FXAA 1YITI 4I0BA 2XUBA 3SYTA 2OA4A 2H6CA 2M2EA 2MABA 2MLGA 2P0WA 4YIRX 2W82A 4AVZA 1HOMA 2F4MB 1IZ1A 4IRGA 1FYMA 2OJED 2H09A 4O6JA 4IHTA 1RNLA 4LD5A 2VJ5A 3JAMK 1SD6A 2P6TA 4KUMA 3ZOBA 2OC6A 1MMSA 1A6QA 2DA6A 1MMGA 3L2QA 2CQXA 3CJNA 1HKTA 1ETWA 3M1EA 3NEUA 2TRTA 1MIJA 3IH2A 2L3DA 2UXXA 3U2RA 5CVUA 5BQTA 3LFUA 1LE8B 3K70C 3COAC 1WZ2A 3E5QA 2K40A 4ZTFA 4EGZA 1ZLJA 4UXNA 1HW2A 1A6IA 2DOEA 2LRDA 4Q4ZF 4LOCA 4DJAA 4OIPF 2QQBA 4A6DA 3BLYA 4BAYA 1MNDA 1VQPI 4Y15A 1TL8A 2ID6A 2X1EA 2DMTA 2JVHA 2NOJB 3TW7A 4B8XA 2D2WA 3I71A 1AKHA 3OS1A 5KNLA 5J40A 3CUQA 3BZKA 5GTIC 3HTSB 3RKXA 2LD5A 2EFOA 3DEWA 3LL7A 2O8KA 3GZNB 4HSRA 2EILH 2VBXA 3BG7A 1LQ1A 2JVGA 3TGNA 1HXDA 1NG7A 1XCBA 3FXJA 2FMLA 2CUZA 1WJAA 4GCVA 3IRQA 4C2MJ 3GTQJ 4YRVA 1K83J 3KP7A 1W7PB 3HL2A 2FBIA 3KP6A 2PMHA 4L5JA 3T8TA 1VQMI 1L3LA 2G0EA 5LRRA 1U8BA 1PDNC 1P92A 1VQNI 4B4CA 2F5VA 1STZA 1TNSA 2GA1A 3BC8A 2VJJA 4IX7A 1J9IA 2CQ7A 5KVRA 3LSHA 2CFOA 1B8IB 3AL0B 2EPFA 4HOBA 4JBAA 4IL6C 2HGCA 2DXIA 1KONA 3Q9VA 4BE1A 2CQQA 1IRXA 2FQ4A 2LREA 4EM1A 5F6FA 2J5PA 1JJ6C 3PFIA 1TC3C 3S17J 2QCOA 1NK3P 1W4MA 3GZ6A 3ESWB 3BZ6A 4AVPA 4LJZF 2IA0A 1QZEA 4UVAA 3OS2A 3KP4A 1ZG5A 2ZNYA 4PDKA 3OIPA 1F5TA 4MO7A 4P5OA 2MBFA 3C2GA 2L01A 4O5VA 2XPWA 2EV5A 4WXCA 3C7JA 4KN4X 2EFNA 1DGWY 5IY5H 3WGIA 4JOMA 1EH7A 1QZYA 1IDZA 2L9SA 2IA2A 4B09A 4B1RA 4NHJA 5B3SH 2L9RA 3GFMA 2VKHA 4A2UA 2HQ5A 3HOWJ 1R5GA 1TWAJ 3DPUA 2CUJA 3ZQFA 2DMPA 2E35A 3G73A 2D45A 3O8GA 5FKMA 5FD5A 3QP5A 3ABMH 4CGZA 1Q1VA 5E3OA 2KP6A 3DWLE 4LLGF 2IA1A 3OYIA 1MBKA 2KT0A 3MEXA 1D0XA 3RPUD 1UAAA 1IC8A 3GXOA 3PNTA 3RI4A 1LJ9A 1TWCJ 2ME0A 4BXUA 4BH9A 2ZXIA 3QPSA 2GBYA 1I6XA 2VQLA 5D5UB 4LB6B 3RCOA 4LG0B 4ZDPA 3HGYA 4HF2A 5E18F 1MMDA 4HAMA 2X9DA 1F9NA 1QVUA 2WADA 4D1QA 4A3CJ 2PMZN 5IT3A 2DT6A 1WH7A 3BR6A 4RAFA 2M34A 2ESHA 1BI3A 2VXDA 2EZKA 5AIQA 2HOAA 1SD7A 1FC3A 3FXRA 1ZH5A 2D1HA 3LWFA 2QBYB 4F52A 2ADUA 2F5CA 3JSOA 3F21A 4UUSA 2WA0A 3BT9A 3GZ5A 2ISYA 2QQAA 4XRFA 1ETXA 5FRMA 4PJLA 2LY2A 1TQIA 3D5SC 2J5OA 3W2VA 4LFUA 2MG4A 4M9SA 1QNTA 1P2FA 2GZWA 5GAHJ 1RUOA 2FQ3A 2R4GA 1P4WA 2Y2ZA 2EIKH 5D6EA 3NAUA 1E0EA 3ZP5A 1BC8C 2XF5A 4IHXA 1DP3A 2BE5F 2FOKA 2HKXA 5JHUA 1BOAA 2V6EA 4IHWA 3ZMSA 5LFAA 4UVBA 3N4MA 1QHGA 1B9MA 5JVTA 4KMUX 1JTYA 5CVJA 4F92B 1EH6A 3AG3H 1FOXA 3AL0C 3H9JA 4XKVA 4I02A 2XKOA 3SFZA 3LSMA 1R6RA 4B43A 2QM3A 2CV1A 2VASA 2PJRB 2DJNA 3HOXJ 1ZRFA 4F93B 5CVVA 3ZQQA 4PGHA 2UXNA 1YJWI 4UB8C 5E1ZB 3U9GA 4PJ0C 1S7AA 4DW6A 3IUOA 1AKHB 1DUXC 2V4JC 4HF1A 1S6LA 1BI1A 2Y0MA 1G6NA 4XR6A 2K3FA 2Y9ZA 3CCJI 2BGCA 1BR1A 3CLOA 1HF0A 4I76A 1U6GA 2MC3A 2RKHA 3PSIA 3N97A 1S9HA 4RAYA 1XDUA 2A68F 2MSYA 2W24A 1VI0A 2Y30A 1P7IA 1GVDA 1ZELA 2HKOA 2JUCA 2M0CA 4DNCA 2DTZA 3JRHA 3BG5A 3U1DA 2HPMA 1JUMA 2NAZA 3P5JA 3S2WA 4U0WA 3O8HA 2K9LA 3D1NI 1SVOA 1TP4A 1I5ZA 1OYIA 2JT1A 3TO9A 1YI2I 4XRSA 2FOWA 4QPQA 5DM6F 1TWHJ 1USTA 4CO8A 4MEYF 2XKPA 1WGXA 2GOXB 1A04A 2BZTA 1B72A 2KRFA 2M1BA 5FFXA 1MD0A 1ZG3A 2P5VA 2JK3A 4DQ2A 3J81Z 3G71I 2F48A 2Z9OA 2Y31A 3R61A 1YQAA 5K5OA 3HJEA 3T8RA 4JX6A 3S15J 3CJTB 3EUHA 2A07F 3PL8A 2E2JJ 1K6YA 4OWRB 1YHQI 4UNOA 5A2QZ 4GO1A 2HPIA 1EH8A 1T95A 3WHBA 3J7AY 1LDJA 1ETKA 3H3ZA 3GTGJ 2EZLA 3LAPA 1L0OC 2NVQJ 2IGOA 2X6WA 4IJAA 4RMNA 4J19A 1UHSA 3MKZA 1R5ID 3H3VK 3CC2I 4XKWA 3LFKA 2OQGA 2EINH 3RDIA 2L9NA 1SMTA 4A0YA 3H5NA 1BC7C 2HOTA 5C44J 1SD5A 2CQKA 3FZVA 5J1UA 2WB1A 3VYSB 4EQQA 1GLNA 3CD6I 4G94A 5C3EJ 4NQWB 4LG3A 1PUEE 4N9IA 4FX0A 4M9ZA 3C2BA 3I3LA 4GDFA 1VQ7I 3TDZC 2LLKA 3WU0A 3E5XA 3WG7H 1KYWA 3S3NA 3HG9A 9ANTA 3JTGA 1AOYA 4ZZLA 3PUBA 3ZQCA 2Z3YA 1ZTRA 2QSGX 2VC0A 2E34A 4HLXA 1MJ9A 4JX4A 3HOSA 4CCMA 3FK6A 2O9LA 3E7LA 5L3EA 2IS2A 2Q8KA 4X0GA 5HLHA 1KU3A 3K1MA 5FKNA 3ZMDA 5FLXZ 3K1NA 4XNFA 3VDXA 4GRIA 3CUOA 4F3QA 4U0VA 3MZHA 4L9NA 4XIDA 3L2WA 3GF2A 5IYDJ 1X2NA 4LK0F 1Z21A 2KLOA 1HDPA 2HZDA 3S14J 1O57A 2BXZA 2G7UA 3ZQLA 4WK8F 2E5ZA 3S3MA 1JKOC 1CF7B 3G1OA 2XAUA 1TT0A 2XPUA 4QWQA 2CG4A 1B9NA 2K9QA 1E17A 4EV0A 4OMYA 2B63J 1F43A 3HDDA 3RYRA 1BR2A 2HQAA 3VFZA 1D1AA 1LFBA 1HDDC 5HS8A 1HQCA 2M0MA 3HPHA 4IHYA 5D8KB 2EFWA 1RR7A 1T56A 3DXJF 3FM5A 5FKOA 2R7UA 3HHGA 3IWFA 3G1LA 1BI2A 2W57A 1T0FA 2DN0A 4Y13A 1RPWA 3L2RA 4BBSJ 4BDZA 2FRHA 1SFUA 1BL0A 1CGPA 2KDZA 5IT9K 1X1CA 3HYIA 1FPQA 4I0AA 4G6QA 4LLLA 5AONA 4RGSA 5DM7F 3H3UA 2LTPA 1ON2A 4BY7J 3GFIA 1N77A 1BIAA 2R7TA 3NWSA 4Y4RA 1C0WA 1TTYA 2GA2A 5K7FA 3P9CA 4NBQA 1EKEA 5L3GA 3JREA 3S1QJ 1IXCA 2MD5A 2OAZA 3BROA 2DA7A 2G7HA 1T2KA 3BY6A 1NG6A 2F4OB 1I3QJ 3DBRB 2OV7A 2ZMEB 4HG2A 2DDAA 1KZHA 3FMRA 2HQRA 2QUFA 4KT6A 5BMZA 5LGTA 2XB0X 3AG1H 2X85A 5E8GA 3MKLA 4DZPA 2BY2A 3JRDA 1R1TA 4I7HA 3V4GA 3BP8A 1UCRA 1KA8A 3HRSA 1FIAA 1IRFA 1DPRA 4QTRA 4M71A 1JGGA 5DTDA 3JRAA 4HNUA 1QU3A 3W2WA 1FOKA 1NHAA 1TW2A 4NC8A 4HV5A 5BS6A 1UELB 5J3LA 3H0GJ 5GADJ 4L9VA 2HTJA 3DLLF 4AYBA 2WV1A 4QSHA 3BTCA 1VFCA 1V5GA 2EH3A 3K10A 5F1JA 2QYOA 1KU2A 4KIGA 1B72B 1QPIA 4AM3A 2QGUA 2Y0SA 1K78A 3MVPA 3ERED 5KK1A 4E7LA 4N0BA 2R0QC 4OMZA 3CCYA 3HOVJ 2V9PA 3R60A 4CHUA 4KIFA 3M8EA 2HWVA 2VL8A 3W2AA 3EYIA 5HDNA 4BJ5C 3K4CA 4BQNA 4Y52J 4JX5A 3P9KA 1V54H 3CCMI 5GAGJ 1YLFA 1OLTA 4LG0A 2E71A 1U9OA 3DTIA 1IN7A 2WAQN 4BHPA 3IRRA 4O3MA 4B3XA 4QIWN 3QQAA 1LVAA 2WBMA 3A0HC 3L1PA 2R7DA 1TBXA 4NUBA 2X6YA 1JXSA 5EF6A 1IF1A 5J1YA 5CVIA 4P9UA 1QZZA 1IUYA 3O3KA 4IEJA 3H9QA 3G3ZA 2GQQA 2IAIA 4YIFA 2IPQX 2YU3A 1OFCX 4R79A 1ZAOA 1E2XA 5J4YA 2CRGA 5B66C 3F72A 2AHQA 4MQ9F 4YELA 4CCNA 2IS4A 1YYVA 5TJJA 1F36A 5HNHA 3GTLJ 4OU0A 1BR4A 1Z6TA 2GXGA 4RM3A 1ODDA 4MLOA 3D0SA 5EGOA 2XGCA 1NTCA 1TT5B 3X2QH 1JUSA 2LP0A 3E5UA 1HKSA 2WAQA 3A03A 2B9SA 4BKXA 5FKKA 3B6AA 1EV7A 1S7EA 2KJBA 1JT6A 4UVCA 4M6YA 3ZQIA 2P5LC 1W0UA 2UUZA 4ZDOA 4IHSA 2LBFB 4ETSA 4N9HA 4MGRA 3G4SI 3Q5FA 5KHDA 3RQIA 3A01A 1OJLA 2LNBA 2FX0A 5EZHA 2X4HA 4HX7A 5ILSA 2HYGD 1X3WB 3ABLH 2E1MB 2YUSA 2L0KA 1Y8QB 4IPAA 1Z77A 5FKLA 2ZJRF 1B8IA 1VF9A 3JTHA 3A1YA 3SEQA 1HC8A 2H1KA 3OYMA 5LRSA 1GDTA 2P6SA 2F5FA 2V79A 5EZGA 1GXPA 2H27A 4PUSA 2DT5A 2YPRA 3CDHA 4AYBN 5D4SA 2DA3A 2NS0A 4LGWA 3ZMUA 2AXLA 2VI6A 4ASNA 4IO9F 1S5LC 2VC1A 4XOPA 4UY8I 1FYLA 1A36A 2HXIA 3ML6A 3OYJA 4BJ6C 2DOFA 3CMMA 4U88A 1BW6A 2A69F 5F0HA 5KAIC 1WHUA 3EYYA 5DCMA 1R49A 2CMPA 3Q0WA 1XS9A 4EJVA 2DTRA 2CS3A 4EGYA 5B1BH 3VSLA 4CZCA 1Z7UA 3C3WA 3O2PE 2XHKA 1USSA 3RZDJ 2CSOA 3HPGA 1ULYA 4BBRJ 3FK7A 4HQMA 5KCMA 4Q5SF 4ZJZA 1RKTA 4IOCF 2V1DA 2MFZA 4ZYDA 5C4XJ 2EV6A 5D8LB 2R93J 4L5IA 3U1KA 4NNJA 1IN6A 3K69A 5CQEA 4OIOF 2NVTJ 3S2HJ 2VQCA 5M3MJ 2BW3A 4XL9A 1OCOH 5IP9J 1S3JA 4NQWA 3ABTA 5GP9A 3I54A 3GTJJ 2QENA 2YR2A 2HTSA 1WJDA 2PJPA 2RNJA 3CO7C 2JMWA 2COMA 2HVSA 1A35A 1GV5A 4ZTJA 4AIDA 4MQVA 4U7DA 2B0LA 4XKCA 2WC2A 3PQJA 5DD8A 1O7FA 3OYHA 2X6XA 3K4JA 4A3IJ 2C6YA 3RJPA 5LLQA 3NQOA 1IN5A 4GXOA 2VT3A 2P7VB 1Z05A 2M7BA 5M5XJ 4WF2A 3FHNA 4HX8A 4EVIA 1P9QC 1IO2A 3BWGA 2FD5A 1EF4A 5DCFA 2K9MA 1BBYA 1XX5A 1QA6A 2NNYA 4BQOA 3OYLA 1F4KA 2LC2A 3FHZA 3TO7A 5EEHA 1YO5C 2UV1A 4HRIA 3BCAA 2BHZA 3BZCA 1MZBA 5DDGA 3CCQI 1R00A 1R1VA 2R7XA 2O61A 2HOEA 1I50J 2O8XA 2N8GA 2OPTA 2O3FA 3BR1A 3F8BA 3I5UA 2L7ZA 3KLNA 2PN6A 2MYSA 2LR8A 2IGMA 4A6EA 4ON0A 2LG4A 3K4BA 1W36C 4F55A 4WXHA 4CH7A 1V5EA 5ICCA 2OCEA 2R7FA 5JLXA 4PJMA 4EJOA 4D5CA 2V1UA 3FF5A 2XAQA 3GVAA 4IXAA 2F5DA 2JN6A 4Z2YA 2JPCA 3K7AJ 4FTHA 3CUQC 3SQNA 4CICA 2GM4A 2CH0A 1YS7A 4TV7A 2FBHA 4C30A 2BY0A 3DLAA 1J5YA 3GFLA 3TBIA 3CLQA 3RPUA 5DV5A 3SZPA 3KX2A 1H8AC 4A3DJ 5H6QA 4ZYAA 5K7ZA 2WWYA 1YIOA 1JKRC 3F3XA 1AA7A 3J80K 1ZR2A 3AG2H 2ZNZA 5LHHA 3VYUB 4FCYA 4BACA 3P9IA 1YIJI 4HEA2 1IDYA 2STWA 3B02A 2YX7A 3B6CA 1UZCA 4DBQA 4HW0A 5EEAA 5TGTA 1YRNA 3LSRA 1QRYA 3ZQGA 2VBZA 2A6HF 1RIOH 4D5FA 2HXOA 2DFHA 3KFWX 2V7FA 4CXFA 4C2UA 2DPDA 4CDGA 3MQ0A 1FTZA 2M9HA 2L7MP 2LSOA 2Z99A 2DPUA 4JQFA 1TNTA 2AQEA 3M3YJ 5ICFA 1TQMA 2A5WA 2L54A 1UJ8A 1R9TJ 1PUFB 3SDBA 1GUUA 1TQPA 2VXZA 3KZYA 3VOEA 1HA8A 1XC5A 3PIOF 4XORA 3LOCA 3GBGA 3MCZA 1HW5A 4RA2A 4RGUA 3RSNA 4I6ZA 1FSEA 3O6BB 4C9YA 2JQ7A 3LQRA 1FWZA 3LQQA 4G6TB 4RAZA 5J1RA 4E4HA 2PMUA 1WSUA 5D5WB 3LSPA 5F0FA 3MMYB 3DEUA 3OR1C 3VEPA 2CUEA 3HKZN 2L4MA 3ECOA 3G6EI 4HZFA 1CQTA 3KZIC 4DZJA 5DUIA 1WVRA 2DFIA 3E0JB 3L7WA 1SFEA 5DD4A 4BNCA 1XD7A 3AFHA 3F8CA 1Z3YA 1RKWA 1U8RA 3L9FA 2LYCA 4BEHA 2ISZA 2P4WA 1HKQA 2STTA 1RESA 3M7GA 2XIGA 2DMNA 4ESFA 3TP0A 4HQEA 2XC7A 3WHCA 2EFQA 2VN2A 4XLHA 3S1MJ 2V1NA 3DPLC 1WI3A 4J00A 3IAM2 2Z2SB 3ZGKA 4D7NA 1D5YA 4YIIA 3IWZA 3NARA 2CO5A 3I58A 3JSPA 5K1YA 3L09A 1T39A 1N78A 2M45A 2L4AA 4UUSB 5K7HA 3GLXA 1R22A 4I2OA 4MTEA 1JUPA 3SFIA 1Y56A 2HNHA 3EETA 2DFFA 5IOYA 2VONA 2LK2A 2BBYA 2JWTA 2M8GX 3LA2A 5LHGA 2EBIA 3GTOJ 2LKPA 4G7OF 4RS8A 4X6AJ 4N4NB 1FTTA 3I59A 2XB5A 2CQNA 4XBFA 3WTSC 1Z3XA 3GWZA 1QHHD 1UG0A 1JHFA 1KU7A 5DUKA 2MLKA 4XK4A 2K86A 2JUGA 4FT8A 2LFBA 1X3ZB 2LY1A 2NRAC 2XROA 1X4PA 3F8MA 1ZG1A 1O4XA 1KQ0A 2VT2A 3CJRB 3QYEA 2FA5A 3OYDA 1HBXG 1PP7U 2NOGA 4B47A 3HRMA 2QVOA 4L18B 3KEQA 4KFCA 3VPRA 2FU4A 3I4MJ 4XLEA 2XAHA 1BN5A 4II2A 4AWXB 1YJNI 2W4SA 4KN7X 1XMKA 4G12A 1X4OA 2LKSA 2WV0A 5E3LA 1Y1VJ 2E2HJ 2GXAA 5E3MA 4NDLA 3SZTA 1ON1A 1DU0A 1Z6RA 2NS8A 4ZYHA 2OZUA 4ESJA 4A0ZA 3H5RA 2ELJA 2ZO4A 2L7KA 4NC7A 5LGNA 4A3JJ 1LVKA 1X3UA 1Y39A 1AU7A 1MSFC 3CCSI 1S7OA 3BPVA 4C3IJ 4BXFA 5LHIA 2P8TA 2LH9A 2VKVA 4CCJA 1FBSA 4RM2A 1VTNC 2KHMA 4BHBA 4IZZA 4ENMA 1T38A 2GXBA 4E7KA 4HYEA 4BHCA 4KITB 3S3OA 2FEZA 3S1RJ 4BY1J 3OOUA 1WCMJ 1QQIA 2KRHA 3D5LA 3KE2A 3VYRB 3PSFA 4FX4A 4A3KJ 4E6KG 3IHUA 2R7OA 2RQPA 1FP1D 5HODA 2JA6J 5D5VB 3ASNH 3SEZA 4M74A 5E8IA 4Q47A 1W5TA 1WJ5A 4YG2F 1IUFA 2A3SA 2Z16A 5A2QK 1MMAA 4XM3A 2HI3A 5BOXA 5AIPA 2X0LA 3Q0VA 5ICGA 2VJ4A 1JTXA 3QODA 4AUXA 2ZJQF 5FLXK 1T33A 2E7WA 4E7SA 1RR8C 1WH5A 4M3DA 1UG2A 2KIFA 1X2MA 2A6EF 3ZMTA 1VQ4I 2ECCA 1OCTC 5BPDA 2DMQA 2KQRA 2DOAA 5HS7A 5B1AH 1D0YA 4B3AA 4M3GA 3ZCOA 4RLFA 1HSTA 4YFXF 1YOVB 2JSPA 3C1DA 4M73A 1EJ9A 2XDVA 4XOTA 1K4TA 1TZLA 3ZXSA 3CO6C 2EIMH 1YX5A 2MH9A 2OU2A 2KISA 1LEBA 3EUHC 2WB1N 2DA2A 3V7CA 4UUVA 4UV8A 2D5VA 2VKEA 1E3PA 2A6TA 2K9SA 4RB0A 2R5YA 2E1MC 2QKLB 4PJNA 4HF0A 2NVYJ 3OSFA 4HDVA 3M4OJ 1KU9A 4ENKA 3BG9A 1DPUA 1T98A 4Y17A 1W5CC 3GEZA 1GHCA 1W5SA 1RRJA 2HYFA 4IHVA 1R58A 3NWTA 3TL4X 5K5RA 3EPZA 3JRFA 4IVNA 3DKXA 3D5RC 3OV8A 2ZKZA 5TISC 2LDUA 1J75A 1SC7A 1HCRA 1MBEA 2Q0OA 1YJ9I 2GAUA 4P1WA 4OIRF 2I8DA 2XGXA 4BYYA 3Q3SA 3BR0A 2BYVE 4A69C 3ABKH 4P96A 3RKYA 5CQGA 3GTKJ 1Z9CA 2VUMJ 4ZH4F 3WTYC 1QVTA 3CDLA 3R0AA 1YS6A 1JJ8C 1U5TC 4HBLA 3VSKA 3KZZA 4FASD 1OYYA 3ASOH 3KLOA 3BDDA 4XLFA 5BNGA 3C18A 3IL2A 4ENJA 2MC4A 1FNNA 3MFKA 1DU6A 2LBFA 3IV5A 1WQ2A 5EDNA 4E70A 2X1DA 2JPBA 1X1PA 3LNQA 4II3A 3FXUA 4L9JA 2R7WA 2QZ8A 3F9KA 1RI7A 3MKYB 3CF2A 3GCMA 4M3EA 1W1WE 2VJIA 5HOOA 2DODA 2TCTA 2KZVA 4GYGA 4XLCA 2CV2A 1YW9A 2Q1ZB 1I3AA 1XGMA 3BG6A 2W84A 4QPOA 2CYYA 2I5UA 4IQJA 1XPXA 3WTXC 1Z0XA 2ZFWA 2IS1A 3KYLA 4IQ4A 1Y0NA 5CJ9A 3LMMA 2WAFA 1PYVA 2A5YB 2JA2A 4NC6A
chains in the Genus database with same CATH topology
4HV6A 2ZCWA 3K2ZA 4I98B 2PLYA 2MA3A 1D5VA 3RPQA 2HR3A 1JE8A 1P4XA 4A12A 2UWMA 3I59B 1XSXA 3H92A 2RN7A 1R1UA 1MJAA 4IRHA 1K79A 1XB4A 1YFHA 4RB2C 5L3DA 5BPIA 1K78B 2DLLA 2VOOA 1KYZA 4KNYA 3HHHA 4KICA 1G3SA 5L3BA 2HQNA 3RYPA 3GO5A 3ZQ7A 2EWNA 2DW4A 1O3RA 1KQ9A 1JGSA 1IXRC 2Q2EA 4MNUA 2XASA 4IRIA 1SAXA 2PI0A 4CYDA 1B4AA 3REOA 4S04A 5HVQC 2QLZA 2HEOA 1I1SA 5HDGA 2VBYA 5E20A 4RGXA 1CF7A 2A61A 5D5XB 3E6DA 2TDXA 1QBJA 3FMSA 3L2CA 2LF8A 1XN7A 3OOPA 6PAXA 1G3TA 2Y48A 1DDNA 2DU9A 3Q9SA 3KP5A 2M5WA 2YX4A 3IC7A 1OPCA 2CWEA 1LB2A 2K4JA 1QPMA 5J8CA 2V1XA 3ISPA 3QP6A 5E17F 4BQAA 5L3CA 3LA3A 2PFBA 1XCVA 1IAWA 3WTWC 3W6KB 2E1NA 4LMYA 4KA4A 1MGTA 3DV8A 4ZYEA 3BJOA 4KIBA 5CLSA 2VBWA 4MEXF 4XLNF 3FWEA 4LK1F 1J59A 2JZYA 5D4RA 4WWCA 1H0MA 4P9FA 4I09A 1Y0UA 4UHTA 1B6AA 3DP7A 2EK5A 2WTEA 1FT9A 2NNNA 5DYMA 3WE3A 1BJAA 3IKVA 4YFKF 3QRFF 4GYIA 2EA4A 1J7KA 1R7JA 4PZJA 1G3WA 4HDUA 1ONVA 4EJWA 3KP2A 4A5MA 4H0EA 3QPHA 3J81K 3R4KA 5LEKA 5K5QA 1TW3A 2OBPA 3FMQA 1ZYRF 1R23A 1FSHA 2DK5A 1IN8A 2M8EA 2F2EA 5J6XA 1FBQA 2P7CB 5LBQA 2EV0A 1KQ8A 3KCCA 3VODA 4U7BA 3WTUC 1LDKB 4G8XA 4I01A 5HLGA 3KP3A 2QBYA 2DI3A 5LGUA 4RB3C 1XSVA 1AWCA 5HLIA 2XVCA 4EM2A 2E7XA 1IN4A 2RVCA 2XRNA 5TRDA 1OKRA 5EEGA 2VE9A 3WODF 3MAJA 3ZPLA 3I53A 3TOBA 5HDKA 1XGSA 3VB2A 4A5NA 1RUNA 2GIVA 2H6BA 2MH2A 3ROUA 3TOAA 3WE2A 2FMYA 5CVRA 2FNPA 1H9TA 2F5EA 4OOIA 4L0YB 1REPC 3GW2A 1B1BA 3DF8A 1Z1DA 1FLIA 3T1BA 1IRGA 1XDSA 3T5XA 2RGVA 1LEAA 4KT5C 5DEQA 3IKTA 1IW7F 3F6OA 4AIKA 3K0LA 1JHHA 4L9TA 2XV4S 2CW0F 3HRUA 1Q1HA 5HS9A 4ZYGA 2RC4A 1YTYA 3LA7A 2CGPA 4JK1X 5J8FA 2GWRA 4PCQA 3P7NA 2AS5F 4ESBA 2HZTA 3HSFA 1D3YA 4MTDA 4HX4A 3W6JB 3I64A 1GVJA 2UZKA 2VOPA 3J80Z 1UB9A 1SD4A 4R1HA 3HSEA 3MZYA 4UV9A 1B59A 2BEOA 1FZPB 3GUDA 5JR3A 1BIBA 2PBIA 4D0PA 2IVMA 3ZN0A 3HSRA 2KIMA 5LEJA 4LLNA 3LSTA 1IXSB 2DQRA 4YFNF 3F22A 4GGGA 5JI6A 3V8LA 3F8NA 4G9YA 2IW5A 1W7PD 5IT9Z 5ERIA 1W7PA 1ZN2A 4IF4A 2R3SA 3CTAA 1LNWA 1S29A 1R5HA 2V9VA 4U0YA 1K6OA 2V6CA 1V3FA 2QQ9A 3GYHX 2EJRA 3CUQB 3E6MA 4L0ZB 4G7HF 4G6DA 3E6CC 3WU1B 1U3EM 3DPTA 1OYWA 1XSDA 4OIQF 2K7LA 2ESNA 2DQLA 3V7SA 2FBKA 2JTVA 4A0XA 1D8KA 4AIJA 4EJUA 3F6VA 4ENNA 1YW7A 2XAJA 5ED4A 1YG2A 2G9WA 4G7ZF 1ZREA 3JW4A 2YSRA 3B73A 1YW8A 5FD6A 1P6RA 3K9TA 3E3VA 4KDPA 2IRFG 1F1ZA 1D8JA 4S05A 2P5KA 2E1CA 4WCGA 4F7ZA 1HSJA 3PQKA 3WGHA 3NRVA 5L3FA 3J7AO 2M87A 3V8KA 1ZRCA 4Q48A 1SMYF 2ZXJA 2ACJA 2HFHA 3QPTA 3ECHA 3R0JA 3QU3A 4RB1A 1G3YA 2RDPA 3LAJA 3DKWA 5ILUA 4KMFA 3MWMA 3SXYA 2ZJ2A 4KYWA 1TLHB 3TDUC 1MDMA 2DK8A 3L00A 1U5TA 3WTVC 2PEXA 3M8FA 3E6BA 2EB7A 2EFPA 2OQRA 3QU6A 3R6SA 2K27A 2HDCA 4LB5A 2ZBKA 3RKWA 1J2XA 2FNAA 1K7AA 3EQLF 2DAOA 3BOQA 2BV6A 2DO7A 2IT0A 1KGSA 2W85A 4HA8A 1WWXA 3FM3A 3BPXA 1QGPA 4XSZF 2IP2A 1FX7A 1GXQA 2XAFA 3GFJA 1FYKA 1FP2A 1MKMA 4XSXF 1BM9A 2EA2A 2L02A 2FF4A 3I4PA 3V7RA 3WTTC 2JRTA 1PP8F 3WTZA 3KEOA 4NB5A 1MDMB 2PG4A 3DFGA 3ELKA 3TO6A 2KJCA 3ZN1A 1SFXA 4XLPF 1P4AA 5F1RA 4AIHA 5ILVA 1XMAA 2VE8A 4ZZDA 5FFZA 4M9XA 1I1GA 1G4DA 2H94A 4EMSA 2KIUA 3HIFA 5D6FA 1UHMA 3RTRA 1FY7A 1DP7P 1ZRDA 1ZGAA 3V8JA 1RZ4A 2ELHA 1WI9A 3BJ6A 3F8FA 2W25A 3K1PA 3ULQB 1ZLKA 2FE3A 2QWWA 4FHTA 3DQVC 2XAGA 3ABUA 1R36A 2LF7A 1XGOA 2ETHA 3WG9A 1WRJA 4WXDA 4EM0B 3QAHA 3ZMZA 1O3TA 1T6SA 2DBBA 1UHWA 1I27A 2OZ6A 4CZZA 1H9GA 2PQ8A 4WX9A 2ZMEA 2Z33A 1FBUA 1ZARA 3TQNA 2JSCA 1LDDA 5H6RA 1U5TB 5ICEA 3HOTA 4PGGA 1OMIA 1U2WA 3T0YA 4M72A 4P55A 5JFRA 5E1XA 3SHFA 3ZMVA 3M9AA 5FGMA 3TKYA 3E97A 1WKMA 1ZHFA 5F64A 1Z91A 1U78A 1V4RA 2Z5UA 5DCMB 3HRTA 1O3QA 5H20A 2NYXA 3QOPA 2M30A 3FX3A 3KETA 1BI0A 2K02A 2FSWA 2IJLA 5E1WA 2HS5A 2CFXA 2VODA 1O7LA 3GX4X 2Y75A 2KKOA 4EJTA 1MJBA 4M6XA 4K2EA 3HTUA 4R8HA 3AAFA 3EDPA 1UFMA 3JAMZ 3WGGA 4AD9A 1S8NA 3FXQA 5CYVA 3F23A 1ZGJA 1HW1A 3HUGA 1OR7A 1J0RA 3I0TA 5FB2A 3RIRA 1QO0D 2RV8A 2OD5A 2O6GE 4OINF 3BJAA 2O0YA 4HLYA 2K4BA 5FO5A 1XGNA 4MHGA 2D1VA 4QLCU 4RGRA 2O03A 2FXAA 4I0BA 2XUBA 2OA4A 2H6CA 2MLGA 4IRGA 1IZ1A 1FYMA 2H09A 4O6JA 4IHTA 1RNLA 4LD5A 3JAMK 1SD6A 2P6TA 4KUMA 3CJNA 1HKTA 3M1EA 3NEUA 2L3DA 2UXXA 3U2RA 5CVUA 5BQTA 3COAC 3E5QA 4EGZA 1ZLJA 4UXNA 1HW2A 4Q4ZF 4OIPF 2QQBA 4A6DA 4BAYA 4Y15A 4B8XA 2D2WA 3I71A 3CUQA 3HTSB 3RKXA 2EFOA 2VBXA 1LQ1A 3TGNA 1HXDA 1XCBA 2FMLA 3IRQA 4GCVA 3KP7A 1W7PB 1L3LA 2FBIA 2PMHA 3KP6A 3T8TA 4L5JA 5LRRA 1PDNC 1P92A 1STZA 1TNSA 2GA1A 1J9IA 5KVRA 4HOBA 4JBAA 2HGCA 3Q9VA 4EM1A 5F6FA 2J5PA 3PFIA 1W4MA 3GZ6A 3BZ6A 4AVPA 4LJZF 2IA0A 4UVAA 3KP4A 1ZG5A 2ZNYA 4PDKA 1F5TA 4P5OA 2MBFA 2L01A 4O5VA 2EV5A 4WXCA 3C7JA 4KN4X 2EFNA 3WGIA 1EH7A 1QZYA 2IA2A 4B09A 4NHJA 3GFMA 4A2UA 1R5GA 2D45A 3G73A 5FD5A 3QP5A 4CGZA 4LLGF 2IA1A 3MEXA 3GXOA 3RI4A 1LJ9A 4BXUA 4BH9A 1I6XA 5D5UB 4LB6B 4LG0B 4HF2A 5E18F 4HAMA 1F9NA 5IT3A 2ESHA 1BI3A 5AIQA 1SD7A 1FC3A 3FXRA 1ZH5A 2D1HA 3LWFA 2QBYB 2ADUA 2F5CA 3JSOA 3F21A 3GZ5A 2ISYA 2QQAA 4XRFA 1TQIA 2J5OA 4LFUA 4M9SA 1QNTA 1P2FA 2GZWA 1RUOA 2FQ3A 1P4WA 5D6EA 3ZP5A 1BC8C 2BE5F 2FOKA 2HKXA 5JHUA 1BOAA 3ZMSA 3N4MA 4UVBA 5JVTA 1B9MA 4KMUX 5CVJA 1EH6A 4I02A 2XKOA 3SFZA 2QM3A 1ZRFA 5CVVA 4PGHA 2UXNA 5E1ZB 3U9GA 1S7AA 1DUXC 4HF1A 1S6LA 1BI1A 2Y0MA 1G6NA 2BGCA 3CLOA 1U6GA 2MC3A 2RKHA 3N97A 4RAYA 1XDUA 2A68F 2W24A 4DNCA 2HKOA 3U1DA 2NAZA 3S2WA 4U0WA 1I5ZA 1OYIA 2JT1A 3TO9A 1USTA 4CO8A 4MEYF 2XKPA 1A04A 2KRFA 2M1BA 5FFXA 1MD0A 1ZG3A 2P5VA 4DQ2A 3J81Z 2Z9OA 3R61A 1YQAA 5K5OA 3T8RA 2A07F 3EUHA 4UNOA 5A2QZ 4GO1A 1EH8A 1LDJA 3H3ZA 3LAPA 1L0OC 4IJAA 3LFKA 2OQGA 3RDIA 1SMTA 4A0YA 1BC7C 1SD5A 2CQKA 3FZVA 4EQQA 4G94A 1PUEE 4N9IA 4FX0A 4M9ZA 3WU0A 3TDZC 3E5XA 1KYWA 3JTGA 1AOYA 4ZZLA 2Z3YA 2VC0A 4HLXA 1MJ9A 3HOSA 5L3EA 2Q8KA 5HLHA 1KU3A 3K1MA 3ZMDA 5FLXZ 3K1NA 3MZHA 3CUOA 4U0VA 4L9NA 3GF2A 4LK0F 1O57A 2G7UA 4WK8F 1CF7B 4QWQA 2CG4A 1B9NA 1E17A 4EV0A 4OMYA 3RYRA 3VFZA 5HS8A 1HQCA 5D8KB 2EFWA 3DXJF 3FM5A 3HHGA 3IWFA 1BI2A 2W57A 1T0FA 4Y13A 2FRHA 1SFUA 1CGPA 5IT9K 3HYIA 1FPQA 4I0AA 4G6QA 4LLLA 5AONA 4RGSA 3H3UA 1ON2A 3GFIA 1BIAA 1C0WA 1TTYA 2GA2A 3P9CA 5L3GA 1IXCA 2MD5A 2OAZA 3BROA 2G7HA 1T2KA 3BY6A 1O3SA 2ZMEB 3FMRA 2HQRA 2QUFA 5BMZA 5LGTA 5E8GA 1R1TA 4I7HA 3V4GA 3BP8A 1UCRA 1KA8A 3HRSA 1IRFA 1DPRA 4M71A 1FOKA 1NHAA 1TW2A 4HV5A 5BS6A 4L9VA 2HTJA 2QYOA 1KU2A 4KIGA 1K78A 3ERED 5KK1A 4N0BA 4OMZA 3R60A 4CHUA 4KIFA 3M8EA 2HWVA 3EYIA 5HDNA 3P9KA 1YLFA 4LG0A 4O3MA 1IN7A 4BHPA 3IRRA 1LVAA 2R7DA 1TBXA 1JXSA 1IF1A 5CVIA 4P9UA 1QZZA 1IUYA 3O3KA 3G3ZA 2GQQA 4YIFA 2IPQX 2YU3A 4R79A 1ZAOA 1E2XA 3F72A 4MQ9F 1YYVA 5TJJA 4OU0A 1Z6TA 2GXGA 1ODDA 3D0SA 3E5UA 1HKSA 1EV7A 2KJBA 2P5LC 4UVCA 4M6YA 4IHSA 4ETSA 4N9HA 4MGRA 3Q5FA 2LNBA 2X4HA 4HX7A 5ILSA 2HYGD 4IPAA 3JTHA 5LRSA 2P6SA 2F5FA 2V79A 1GXPA 2H27A 2DT5A 2YPRA 3CDHA 5D4SA 2NS0A 4LGWA 3ZMUA 2AXLA 4ASNA 2VC1A 1FYLA 3ML6A 4U88A 2A69F 3EYYA 5DCMA 4EJVA 2DTRA 4EGYA 1Z7UA 3C3WA 3O2PE 2XHKA 1USSA 2CSOA 1ULYA 4HQMA 4Q5SF 2V1DA 4ZYDA 2EV6A 5D8LB 4L5IA 1IN6A 3K69A 4OIOF 1S3JA 4NQWA 3ABTA 3I54A 2QENA 2YR2A 2HTSA 2PJPA 3CO7C 2RNJA 2COMA 4MQVA 4U7DA 2B0LA 2WC2A 3PQJA 5DD8A 1O7FA 2C6YA 3RJPA 5LLQA 3NQOA 1IN5A 4GXOA 2VT3A 2P7VB 1Z05A 4WF2A 4HX8A 4EVIA 3BWGA 5DCFA 1BBYA 2NNYA 1F4KA 3FHZA 3TO7A 5EEHA 1YO5C 5DDGA 1MZBA 1R00A 1R1VA 2O61A 2HOEA 2O8XA 2O3FA 3F8BA 3I5UA 3KLNA 2PN6A 4A6EA 4ON0A 4WXHA 5ICCA 2R7FA 4EJOA 2V1UA 3FF5A 2XAQA 3GVAA 4IXAA 2F5DA 4Z2YA 2JPCA 3CUQC 3SQNA 4CICA 1YS7A 4TV7A 2FBHA 1J5YA 3GFLA 3RPUA 5DV5A 3SZPA 5H6QA 2WWYA 1YIOA 3F3XA 3J80K 2ZNZA 5LHHA 3P9IA 2STWA 3B02A 2YX7A 4HW0A 2VBZA 2A6HF 1RIOH 3KFWX 4CXFA 2DPDA 4CDGA 3MQ0A 2LSOA 2Z99A 2DPUA 4JQFA 1TNTA 5ICFA 1TQMA 2L54A 1TQPA 2VXZA 3KZYA 3VOEA 3MCZA 1HW5A 4RGUA 1FSEA 3O6BB 3LQRA 1FWZA 3LQQA 4RAZA 2PMUA 1WSUA 5D5WB 3DEUA 3VEPA 2L4MA 3ECOA 4HZFA 5DUIA 2DFIA 3L7WA 1SFEA 5DD4A 4BNCA 1XD7A 3F8CA 1U8RA 3L9FA 2ISZA 2P4WA 1HKQA 2STTA 3M7GA 2XIGA 4ESFA 4HQEA 2EFQA 2VN2A 3DPLC 4YIIA 3IWZA 2CO5A 3I58A 3JSPA 5K1YA 3L09A 1T39A 2M45A 2L4AA 4I2OA 3GLXA 1R22A 4MTEA 3EETA 2VONA 2BBYA 3LA2A 5LHGA 4G7OF 2LKPA 4RS8A 3I59A 4XBFA 3WTSC 3GWZA 1JHFA 1KU7A 5DUKA 2MLKA 2K86A 4FT8A 2NRAC 2XROA 3F8MA 1ZG1A 1KQ0A 2VT2A 2FA5A 1HBXG 1PP7U 3HRMA 2QVOA 4L18B 3KEQA 4KFCA 2FU4A 2XAHA 1BN5A 4AWXB 4KN7X 1XMKA 2WV0A 3SZTA 1ON1A 1Z6RA 4ZYHA 2OZUA 4ESJA 4A0ZA 2ZO4A 5LGNA 1X3UA 1S7OA 3BPVA 5LHIA 2P8TA 1FBSA 1VTNC 4BHBA 4ENMA 1T38A 2GXBA 4HYEA 4BHCA 2FEZA 3KE2A 1QQIA 3D5LA 4FX4A 3IHUA 2RQPA 1FP1D 5D5VB 4M74A 5E8IA 4Q47A 1W5TA 4YG2F 2A3SA 5A2QK 5BOXA 5AIPA 2X0LA 5ICGA 5FLXK 2E7WA 2KIFA 2A6EF 3ZMTA 5BPDA 5HS7A 1HSTA 4YFXF 3C1DA 4M73A 3CO6C 2MH9A 2OU2A 1LEBA 3V7CA 4UUVA 4UV8A 4RB0A 4HF0A 4HDVA 1KU9A 4ENKA 1DPUA 1T98A 4Y17A 3GEZA 1GHCA 1W5SA 2HYFA 1R58A 5K5RA 4IVNA 3OV8A 2ZKZA 2LDUA 1J75A 2Q0OA 2GAUA 4OIRF 2XGXA 4BYYA 2BYVE 4P96A 3RKYA 1Z9CA 4ZH4F 3WTYC 3R0AA 1YS6A 1U5TC 4HBLA 3KZZA 1OYYA 3KLOA 3BDDA 3C18A 3IL2A 4ENJA 1FNNA 3MFKA 1WQ2A 4E70A 2JPBA 3FXUA 4L9JA 2QZ8A 1RI7A 5HOOA 4GYGA 1YW9A 1XGMA 2W84A 2CYYA 3WTXC 2ZFWA 5CJ9A 2A5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HV6 A;  2ZCW A;  3K2Z A;  4I98 B;  2PLY A;  2MA3 A;  1D5V A;  3RPQ A;  2HR3 A;  1JE8 A;  1P4X A;  4A12 A;  2UWM A;  3I59 B;  1XSX A;  3H92 A;  2RN7 A;  1R1U A;  1MJA A;  4IRH A;  1K79 A;  1XB4 A;  1YFH A;  4RB2 C;  5L3D A;  5BPI A;  1K78 B;  2DLL A;  2VOO A;  1KYZ A;  4KNY A;  3HHH A;  4KIC A;  1G3S A;  5L3B A;  2HQN A;  3RYP A;  3GO5 A;  3ZQ7 A;  2EWN A;  2DW4 A;  1O3R A;  1KQ9 A;  1JGS A;  1IXR C;  2Q2E A;  4MNU A;  2XAS A;  4IRI A;  1SAX A;  2PI0 A;  4CYD A;  1B4A A;  3REO A;  4S04 A;  5HVQ C;  2QLZ A;  2HEO A;  1I1S A;  5HDG A;  2VBY A;  5E20 A;  4RGX A;  1CF7 A;  2A61 A;  5D5X B;  3E6D A;  2TDX A;  1QBJ A;  3FMS A;  3L2C A;  2LF8 A;  1XN7 A;  3OOP A;  6PAX A;  1G3T A;  2Y48 A;  1DDN A;  2DU9 A;  3Q9S A;  3KP5 A;  2M5W A;  2YX4 A;  3IC7 A;  1OPC A;  2CWE A;  1LB2 A;  2K4J A;  1QPM A;  5J8C A;  2V1X A;  3ISP A;  3QP6 A;  5E17 F;  4BQA A;  5L3C A;  3LA3 A;  2PFB A;  1XCV A;  1IAW A;  3WTW C;  3W6K B;  2E1N A;  4LMY A;  4KA4 A;  1MGT A;  3DV8 A;  4ZYE A;  3BJO A;  4KIB A;  5CLS A;  2VBW A;  4MEX F;  4XLN F;  3FWE A;  4LK1 F;  1J59 A;  2JZY A;  5D4R A;  4WWC A;  1H0M A;  4P9F A;  4I09 A;  1Y0U A;  4UHT A;  1B6A A;  3DP7 A;  2EK5 A;  2WTE A;  1FT9 A;  2NNN A;  5DYM A;  3WE3 A;  1BJA A;  3IKV A;  4YFK F;  3QRF F;  4GYI A;  2EA4 A;  1J7K A;  1R7J A;  4PZJ A;  1G3W A;  4HDU A;  1ONV A;  4EJW A;  3KP2 A;  4A5M A;  4H0E A;  3QPH A;  3J81 K;  3R4K A;  5LEK A;  5K5Q A;  1TW3 A;  2OBP A;  3FMQ A;  1ZYR F;  1R23 A;  1FSH A;  2DK5 A;  1IN8 A;  2M8E A;  2F2E A;  5J6X A;  1FBQ A;  2P7C B;  5LBQ A;  2EV0 A;  1KQ8 A;  3KCC A;  3VOD A;  4U7B A;  3WTU C;  1LDK B;  4G8X A;  4I01 A;  5HLG A;  3KP3 A;  2QBY A;  2DI3 A;  5LGU A;  4RB3 C;  1XSV A;  1AWC A;  5HLI A;  2XVC A;  4EM2 A;  2E7X A;  1IN4 A;  2RVC A;  2XRN A;  5TRD A;  1OKR A;  5EEG A;  2VE9 A;  3WOD F;  3MAJ A;  3ZPL A;  3I53 A;  3TOB A;  5HDK A;  1XGS A;  3VB2 A;  4A5N A;  1RUN A;  2GIV A;  2H6B A;  2MH2 A;  3ROU A;  3TOA A;  3WE2 A;  2FMY A;  5CVR A;  2FNP A;  1H9T A;  2F5E A;  4OOI A;  4L0Y B;  1REP C;  3GW2 A;  1B1B A;  3DF8 A;  1Z1D A;  1FLI A;  3T1B A;  1IRG A;  1XDS A;  3T5X A;  2RGV A;  1LEA A;  4KT5 C;  5DEQ A;  3IKT A;  1IW7 F;  3F6O A;  4AIK A;  3K0L A;  1JHH A;  4L9T A;  2XV4 S;  2CW0 F;  3HRU A;  1Q1H A;  5HS9 A;  4ZYG A;  2RC4 A;  1YTY A;  3LA7 A;  2CGP A;  4JK1 X;  5J8F A;  2GWR A;  4PCQ A;  3P7N A;  2AS5 F;  4ESB A;  2HZT A;  3HSF A;  1D3Y A;  4MTD A;  4HX4 A;  3W6J B;  3I64 A;  1GVJ A;  2UZK A;  2VOP A;  3J80 Z;  1UB9 A;  1SD4 A;  4R1H A;  3HSE A;  3MZY A;  4UV9 A;  1B59 A;  2BEO A;  1FZP B;  3GUD A;  5JR3 A;  1BIB A;  2PBI A;  4D0P A;  2IVM A;  3ZN0 A;  3HSR A;  2KIM A;  5LEJ A;  4LLN A;  3LST A;  1IXS B;  2DQR A;  4YFN F;  3F22 A;  4GGG A;  5JI6 A;  3V8L A;  3F8N A;  4G9Y A;  2IW5 A;  1W7P D;  5IT9 Z;  5ERI A;  1W7P A;  1ZN2 A;  4IF4 A;  2R3S A;  3CTA A;  1LNW A;  1S29 A;  1R5H A;  2V9V A;  4U0Y A;  1K6O A;  2V6C A;  1V3F A;  2QQ9 A;  3GYH X;  2EJR A;  3CUQ B;  3E6M A;  4L0Z B;  4G7H F;  4G6D A;  3E6C C;  3WU1 B;  1U3E M;  3DPT A;  1OYW A;  1XSD A;  4OIQ F;  2K7L A;  2ESN A;  2DQL A;  3V7S A;  2FBK A;  2JTV A;  4A0X A;  1D8K A;  4AIJ A;  4EJU A;  3F6V A;  4ENN A;  1YW7 A;  2XAJ A;  5ED4 A;  1YG2 A;  2G9W A;  4G7Z F;  1ZRE A;  3JW4 A;  2YSR A;  3B73 A;  1YW8 A;  5FD6 A;  1P6R A;  3K9T A;  3E3V A;  4KDP A;  2IRF G;  1F1Z A;  1D8J A;  4S05 A;  2P5K A;  2E1C A;  4WCG A;  4F7Z A;  1HSJ A;  3PQK A;  3WGH A;  3NRV A;  5L3F A;  3J7A O;  2M87 A;  3V8K A;  1ZRC A;  4Q48 A;  1SMY F;  2ZXJ A;  2ACJ A;  2HFH A;  3QPT A;  3ECH A;  3R0J A;  3QU3 A;  4RB1 A;  1G3Y A;  2RDP A;  3LAJ A;  3DKW A;  5ILU A;  4KMF A;  3MWM A;  3SXY A;  2ZJ2 A;  4KYW A;  1TLH B;  3TDU C;  1MDM A;  2DK8 A;  3L00 A;  1U5T A;  3WTV C;  2PEX A;  3M8F A;  3E6B A;  2EB7 A;  2EFP A;  2OQR A;  3QU6 A;  3R6S A;  2K27 A;  2HDC A;  4LB5 A;  2ZBK A;  3RKW A;  1J2X A;  2FNA A;  1K7A A;  3EQL F;  2DAO A;  3BOQ A;  2BV6 A;  2DO7 A;  2IT0 A;  1KGS A;  2W85 A;  4HA8 A;  1WWX A;  3FM3 A;  3BPX A;  1QGP A;  4XSZ F;  2IP2 A;  1FX7 A;  1GXQ A;  2XAF A;  3GFJ A;  1FYK A;  1FP2 A;  1MKM A;  4XSX F;  1BM9 A;  2EA2 A;  2L02 A;  2FF4 A;  3I4P A;  3V7R A;  3WTT C;  2JRT A;  1PP8 F;  3WTZ A;  3KEO A;  4NB5 A;  1MDM B;  2PG4 A;  3DFG A;  3ELK A;  3TO6 A;  2KJC A;  3ZN1 A;  1SFX A;  4XLP F;  1P4A A;  5F1R A;  4AIH A;  5ILV A;  1XMA A;  2VE8 A;  4ZZD A;  5FFZ A;  4M9X A;  1I1G A;  1G4D A;  2H94 A;  4EMS A;  2KIU A;  3HIF A;  5D6F A;  1UHM A;  3RTR A;  1FY7 A;  1DP7 P;  1ZRD A;  1ZGA A;  3V8J A;  1RZ4 A;  2ELH A;  1WI9 A;  3BJ6 A;  3F8F A;  2W25 A;  3K1P A;  3ULQ B;  1ZLK A;  2FE3 A;  2QWW A;  4FHT A;  3DQV C;  2XAG A;  3ABU A;  1R36 A;  2LF7 A;  1XGO A;  2ETH A;  3WG9 A;  1WRJ A;  4WXD A;  4EM0 B;  3QAH A;  3ZMZ A;  1O3T A;  1T6S A;  2DBB A;  1UHW A;  1I27 A;  2OZ6 A;  4CZZ A;  1H9G A;  2PQ8 A;  4WX9 A;  2ZME A;  2Z33 A;  1FBU A;  1ZAR A;  3TQN A;  2JSC A;  1LDD A;  5H6R A;  1U5T B;  5ICE A;  3HOT A;  4PGG A;  1OMI A;  1U2W A;  3T0Y A;  4M72 A;  4P55 A;  5JFR A;  5E1X A;  3SHF A;  3ZMV A;  3M9A A;  5FGM A;  3TKY A;  3E97 A;  1WKM A;  1ZHF A;  5F64 A;  1Z91 A;  1U78 A;  1V4R A;  2Z5U A;  5DCM B;  3HRT A;  1O3Q A;  5H20 A;  2NYX A;  3QOP A;  2M30 A;  3FX3 A;  3KET A;  1BI0 A;  2K02 A;  2FSW A;  2IJL A;  5E1W A;  2HS5 A;  2CFX A;  2VOD A;  1O7L A;  3GX4 X;  2Y75 A;  2KKO A;  4EJT A;  1MJB A;  4M6X A;  4K2E A;  3HTU A;  4R8H A;  3AAF A;  3EDP A;  1UFM A;  3JAM Z;  3WGG A;  4AD9 A;  1S8N A;  3FXQ A;  5CYV A;  3F23 A;  1ZGJ A;  1HW1 A;  3HUG A;  1OR7 A;  1J0R A;  3I0T A;  5FB2 A;  3RIR A;  1QO0 D;  2RV8 A;  2OD5 A;  2O6G E;  4OIN F;  3BJA A;  2O0Y A;  4HLY A;  2K4B A;  5FO5 A;  1XGN A;  4MHG A;  2D1V A;  4QLC U;  4RGR A;  2O03 A;  2FXA A;  4I0B A;  2XUB A;  2OA4 A;  2H6C A;  2MLG A;  4IRG A;  1IZ1 A;  1FYM A;  2H09 A;  4O6J A;  4IHT A;  1RNL A;  4LD5 A;  3JAM K;  1SD6 A;  2P6T A;  4KUM A;  3CJN A;  1HKT A;  3M1E A;  3NEU A;  2L3D A;  2UXX A;  3U2R A;  5CVU A;  5BQT A;  3COA C;  3E5Q A;  4EGZ A;  1ZLJ A;  4UXN A;  1HW2 A;  4Q4Z F;  4OIP F;  2QQB A;  4A6D A;  4BAY A;  4Y15 A;  4B8X A;  2D2W A;  3I71 A;  3CUQ A;  3HTS B;  3RKX A;  2EFO A;  2VBX A;  1LQ1 A;  3TGN A;  1HXD A;  1XCB A;  2FML A;  3IRQ A;  4GCV A;  3KP7 A;  1W7P B;  1L3L A;  2FBI A;  2PMH A;  3KP6 A;  3T8T A;  4L5J A;  5LRR A;  1PDN C;  1P92 A;  1STZ A;  1TNS A;  2GA1 A;  1J9I A;  5KVR A;  4HOB A;  4JBA A;  2HGC A;  3Q9V A;  4EM1 A;  5F6F A;  2J5P A;  3PFI A;  1W4M A;  3GZ6 A;  3BZ6 A;  4AVP A;  4LJZ F;  2IA0 A;  4UVA A;  3KP4 A;  1ZG5 A;  2ZNY A;  4PDK A;  1F5T A;  4P5O A;  2MBF A;  2L01 A;  4O5V A;  2EV5 A;  4WXC A;  3C7J A;  4KN4 X;  2EFN A;  3WGI A;  1EH7 A;  1QZY A;  2IA2 A;  4B09 A;  4NHJ A;  3GFM A;  4A2U A;  1R5G A;  2D45 A;  3G73 A;  5FD5 A;  3QP5 A;  4CGZ A;  4LLG F;  2IA1 A;  3MEX A;  3GXO A;  3RI4 A;  1LJ9 A;  4BXU A;  4BH9 A;  1I6X A;  5D5U B;  4LB6 B;  4LG0 B;  4HF2 A;  5E18 F;  4HAM A;  1F9N A;  5IT3 A;  2ESH A;  1BI3 A;  5AIQ A;  1SD7 A;  1FC3 A;  3FXR A;  1ZH5 A;  2D1H A;  3LWF A;  2QBY B;  2ADU A;  2F5C A;  3JSO A;  3F21 A;  3GZ5 A;  2ISY A;  2QQA A;  4XRF A;  1TQI A;  2J5O A;  4LFU A;  4M9S A;  1QNT A;  1P2F A;  2GZW A;  1RUO A;  2FQ3 A;  1P4W A;  5D6E A;  3ZP5 A;  1BC8 C;  2BE5 F;  2FOK A;  2HKX A;  5JHU A;  1BOA A;  3ZMS A;  3N4M A;  4UVB A;  5JVT A;  1B9M A;  4KMU X;  5CVJ A;  1EH6 A;  4I02 A;  2XKO A;  3SFZ A;  2QM3 A;  1ZRF A;  5CVV A;  4PGH A;  2UXN A;  5E1Z B;  3U9G A;  1S7A A;  1DUX C;  4HF1 A;  1S6L A;  1BI1 A;  2Y0M A;  1G6N A;  2BGC A;  3CLO A;  1U6G A;  2MC3 A;  2RKH A;  3N97 A;  4RAY A;  1XDU A;  2A68 F;  2W24 A;  4DNC A;  2HKO A;  3U1D A;  2NAZ A;  3S2W A;  4U0W A;  1I5Z A;  1OYI A;  2JT1 A;  3TO9 A;  1UST A;  4CO8 A;  4MEY F;  2XKP A;  1A04 A;  2KRF A;  2M1B A;  5FFX A;  1MD0 A;  1ZG3 A;  2P5V A;  4DQ2 A;  3J81 Z;  2Z9O A;  3R61 A;  1YQA A;  5K5O A;  3T8R A;  2A07 F;  3EUH A;  4UNO A;  5A2Q Z;  4GO1 A;  1EH8 A;  1LDJ A;  3H3Z A;  3LAP A;  1L0O C;  4IJA A;  3LFK A;  2OQG A;  3RDI A;  1SMT A;  4A0Y A;  1BC7 C;  1SD5 A;  2CQK A;  3FZV A;  4EQQ A;  4G94 A;  1PUE E;  4N9I A;  4FX0 A;  4M9Z A;  3WU0 A;  3TDZ C;  3E5X A;  1KYW A;  3JTG A;  1AOY A;  4ZZL A;  2Z3Y A;  2VC0 A;  4HLX A;  1MJ9 A;  3HOS A;  5L3E A;  2Q8K A;  5HLH A;  1KU3 A;  3K1M A;  3ZMD A;  5FLX Z;  3K1N A;  3MZH A;  3CUO A;  4U0V A;  4L9N A;  3GF2 A;  4LK0 F;  1O57 A;  2G7U A;  4WK8 F;  1CF7 B;  4QWQ A;  2CG4 A;  1B9N A;  1E17 A;  4EV0 A;  4OMY A;  3RYR A;  3VFZ A;  5HS8 A;  1HQC A;  5D8K B;  2EFW A;  3DXJ F;  3FM5 A;  3HHG A;  3IWF A;  1BI2 A;  2W57 A;  1T0F A;  4Y13 A;  2FRH A;  1SFU A;  1CGP A;  5IT9 K;  3HYI A;  1FPQ A;  4I0A A;  4G6Q A;  4LLL A;  5AON A;  4RGS A;  3H3U A;  1ON2 A;  3GFI A;  1BIA A;  1C0W A;  1TTY A;  2GA2 A;  3P9C A;  5L3G A;  1IXC A;  2MD5 A;  2OAZ A;  3BRO A;  2G7H A;  1T2K A;  3BY6 A;  1O3S A;  2ZME B;  3FMR A;  2HQR A;  2QUF A;  5BMZ A;  5LGT A;  5E8G A;  1R1T A;  4I7H A;  3V4G A;  3BP8 A;  1UCR A;  1KA8 A;  3HRS A;  1IRF A;  1DPR A;  4M71 A;  1FOK A;  1NHA A;  1TW2 A;  4HV5 A;  5BS6 A;  4L9V A;  2HTJ A;  2QYO A;  1KU2 A;  4KIG A;  1K78 A;  3ERE D;  5KK1 A;  4N0B A;  4OMZ A;  3R60 A;  4CHU A;  4KIF A;  3M8E A;  2HWV A;  3EYI A;  5HDN A;  3P9K A;  1YLF A;  4LG0 A;  4O3M A;  1IN7 A;  4BHP A;  3IRR A;  1LVA A;  2R7D A;  1TBX A;  1JXS A;  1IF1 A;  5CVI A;  4P9U A;  1QZZ A;  1IUY A;  3O3K A;  3G3Z A;  2GQQ A;  4YIF A;  2IPQ X;  2YU3 A;  4R79 A;  1ZAO A;  1E2X A;  3F72 A;  4MQ9 F;  1YYV A;  5TJJ A;  4OU0 A;  1Z6T A;  2GXG A;  1ODD A;  3D0S A;  3E5U A;  1HKS A;  1EV7 A;  2KJB A;  2P5L C;  4UVC A;  4M6Y A;  4IHS A;  4ETS A;  4N9H A;  4MGR A;  3Q5F A;  2LNB A;  2X4H A;  4HX7 A;  5ILS A;  2HYG D;  4IPA A;  3JTH A;  5LRS A;  2P6S A;  2F5F A;  2V79 A;  1GXP A;  2H27 A;  2DT5 A;  2YPR A;  3CDH A;  5D4S A;  2NS0 A;  4LGW A;  3ZMU A;  2AXL A;  4ASN A;  2VC1 A;  1FYL A;  3ML6 A;  4U88 A;  2A69 F;  3EYY A;  5DCM A;  4EJV A;  2DTR A;  4EGY A;  1Z7U A;  3C3W A;  3O2P E;  2XHK A;  1USS A;  2CSO A;  1ULY A;  4HQM A;  4Q5S F;  2V1D A;  4ZYD A;  2EV6 A;  5D8L B;  4L5I A;  1IN6 A;  3K69 A;  4OIO F;  1S3J A;  4NQW A;  3ABT A;  3I54 A;  2QEN A;  2YR2 A;  2HTS A;  2PJP A;  3CO7 C;  2RNJ A;  2COM A;  4MQV A;  4U7D A;  2B0L A;  2WC2 A;  3PQJ A;  5DD8 A;  1O7F A;  2C6Y A;  3RJP A;  5LLQ A;  3NQO A;  1IN5 A;  4GXO A;  2VT3 A;  2P7V B;  1Z05 A;  4WF2 A;  4HX8 A;  4EVI A;  3BWG A;  5DCF A;  1BBY A;  2NNY A;  1F4K A;  3FHZ A;  3TO7 A;  5EEH A;  1YO5 C;  5DDG A;  1MZB A;  1R00 A;  1R1V A;  2O61 A;  2HOE A;  2O8X A;  2O3F A;  3F8B A;  3I5U A;  3KLN A;  2PN6 A;  4A6E A;  4ON0 A;  4WXH A;  5ICC A;  2R7F A;  4EJO A;  2V1U A;  3FF5 A;  2XAQ A;  3GVA A;  4IXA A;  2F5D A;  4Z2Y A;  2JPC A;  3CUQ C;  3SQN A;  4CIC A;  1YS7 A;  4TV7 A;  2FBH A;  1J5Y A;  3GFL A;  3RPU A;  5DV5 A;  3SZP A;  5H6Q A;  2WWY A;  1YIO A;  3F3X A;  3J80 K;  2ZNZ A;  5LHH A;  3P9I A;  2STW A;  3B02 A;  2YX7 A;  4HW0 A;  2VBZ A;  2A6H F;  1RIO H;  3KFW X;  4CXF A;  2DPD A;  4CDG A;  3MQ0 A;  2LSO A;  2Z99 A;  2DPU A;  4JQF A;  1TNT A;  5ICF A;  1TQM A;  2L54 A;  1TQP A;  2VXZ A;  3KZY A;  3VOE A;  3MCZ A;  1HW5 A;  4RGU A;  1FSE A;  3O6B B;  3LQR A;  1FWZ A;  3LQQ A;  4RAZ A;  2PMU A;  1WSU A;  5D5W B;  3DEU A;  3VEP A;  2L4M A;  3ECO A;  4HZF A;  5DUI A;  2DFI A;  3L7W A;  1SFE A;  5DD4 A;  4BNC A;  1XD7 A;  3F8C A;  1U8R A;  3L9F A;  2ISZ A;  2P4W A;  1HKQ A;  2STT A;  3M7G A;  2XIG A;  4ESF A;  4HQE A;  2EFQ A;  2VN2 A;  3DPL C;  4YII A;  3IWZ A;  2CO5 A;  3I58 A;  3JSP A;  5K1Y A;  3L09 A;  1T39 A;  2M45 A;  2L4A A;  4I2O A;  3GLX A;  1R22 A;  4MTE A;  3EET A;  2VON A;  2BBY A;  3LA2 A;  5LHG A;  4G7O F;  2LKP A;  4RS8 A;  3I59 A;  4XBF A;  3WTS C;  3GWZ A;  1JHF A;  1KU7 A;  5DUK A;  2MLK A;  2K86 A;  4FT8 A;  2NRA C;  2XRO A;  3F8M A;  1ZG1 A;  1KQ0 A;  2VT2 A;  2FA5 A;  1HBX G;  1PP7 U;  3HRM A;  2QVO A;  4L18 B;  3KEQ A;  4KFC A;  2FU4 A;  2XAH A;  1BN5 A;  4AWX B;  4KN7 X;  1XMK A;  2WV0 A;  3SZT A;  1ON1 A;  1Z6R A;  4ZYH A;  2OZU A;  4ESJ A;  4A0Z A;  2ZO4 A;  5LGN A;  1X3U A;  1S7O A;  3BPV A;  5LHI A;  2P8T A;  1FBS A;  1VTN C;  4BHB A;  4ENM A;  1T38 A;  2GXB A;  4HYE A;  4BHC A;  2FEZ A;  3KE2 A;  1QQI A;  3D5L A;  4FX4 A;  3IHU A;  2RQP A;  1FP1 D;  5D5V B;  4M74 A;  5E8I A;  4Q47 A;  1W5T A;  4YG2 F;  2A3S A;  5A2Q K;  5BOX A;  5AIP A;  2X0L A;  5ICG A;  5FLX K;  2E7W A;  2KIF A;  2A6E F;  3ZMT A;  5BPD A;  5HS7 A;  1HST A;  4YFX F;  3C1D A;  4M73 A;  3CO6 C;  2MH9 A;  2OU2 A;  1LEB A;  3V7C A;  4UUV A;  4UV8 A;  4RB0 A;  4HF0 A;  4HDV A;  1KU9 A;  4ENK A;  1DPU A;  1T98 A;  4Y17 A;  3GEZ A;  1GHC A;  1W5S A;  2HYF A;  1R58 A;  5K5R A;  4IVN A;  3OV8 A;  2ZKZ A;  2LDU A;  1J75 A;  2Q0O A;  2GAU A;  4OIR F;  2XGX A;  4BYY A;  2BYV E;  4P96 A;  3RKY A;  1Z9C A;  4ZH4 F;  3WTY C;  3R0A A;  1YS6 A;  1U5T C;  4HBL A;  3KZZ A;  1OYY A;  3KLO A;  3BDD A;  3C18 A;  3IL2 A;  4ENJ A;  1FNN A;  3MFK A;  1WQ2 A;  4E70 A;  2JPB A;  3FXU A;  4L9J A;  2QZ8 A;  1RI7 A;  5HOO A;  4GYG A;  1YW9 A;  1XGM A;  2W84 A;  2CYY A;  3WTX C;  2ZFW A;  5CJ9 A;  2A5Y B; 
#chains in the Genus database with same CATH topology
 3JRB A;  4HV6 A;  1ZGW A;  3OY9 A;  2ZCW A;  4HNT A;  3K2Z A;  4I98 B;  1T8I A;  2PLY A;  2NS7 A;  2MA3 A;  1ZR4 A;  3KYD B;  1D5V A;  3QYF A;  3RPQ A;  2HR3 A;  3AKZ A;  4PSW A;  1JE8 A;  1P4X A;  4A12 A;  2UWM A;  3OS0 A;  3I59 B;  2JA5 J;  3H0D A;  3PIP F;  4MIM A;  1K61 A;  2BVL A;  1XSX A;  1PUF A;  1OCP A;  3H92 A;  4PSX A;  2RN7 A;  2YU9 J;  2E19 A;  1R1U A;  4DYC A;  1ENH A;  1MJA A;  4IRH A;  1K79 A;  5M5Y J;  2Y0S N;  3L2U A;  1XB4 A;  2XF6 A;  4CYC A;  1YFH A;  4RB2 C;  3QWL A;  1ETV A;  3HGG A;  5L3D A;  4FE4 A;  4DYR A;  5BPI A;  2DLL A;  1K78 B;  2VOO A;  4S0H B;  1KYZ A;  4KNY A;  2QKM B;  2BVM A;  3FXL A;  3HZJ A;  3HHH A;  4KIC A;  1G3S A;  5L3B A;  1XG1 A;  4H4K C;  2HQN A;  3RYP A;  3GO5 A;  2OUM A;  2DMU A;  3DEE A;  1YRN B;  5F0C A;  2EZH A;  2EWN A;  1BJZ A;  1POG A;  3ZQ7 A;  2DW4 A;  5EYR A;  1E3H A;  1O3R A;  3E1S A;  1KQ9 A;  5GTH C;  1JGS A;  1IXR C;  2Q2E A;  4MNU A;  2XAS A;  4X1E A;  4IRI A;  1SAX A;  3GME A;  4M6V A;  1FOY A;  2PI0 A;  3ZQH A;  4BEH B;  3S8P A;  5H2F C;  4BXX J;  4CYD A;  4ZDL A;  1B4A A;  1FIP A;  1O3S A;  3REO A;  4S04 A;  5HVQ C;  2QLZ A;  4Z6Y A;  2HEO A;  3CES A;  4GFB A;  4L5E A;  1VQ5 I;  1I1S A;  1MBF A;  5HDG A;  2VBY A;  5E20 A;  1EA3 A;  4RGX A;  2WY7 Q;  1CF7 A;  2A61 A;  5D5X B;  3A2K A;  3E6D A;  1Z7L A;  2TDX A;  1QBJ A;  3FMS A;  3PO2 J;  3L2C A;  1BW5 A;  2LF8 A;  1XN7 A;  2WAE A;  3OOP A;  6PAX A;  4XON A;  1G3T A;  2Y48 A;  1YE9 A;  1DDN A;  2E5N A;  2R7V A;  2DU9 A;  2R5Y B;  2E2I J;  3Q9S A;  1ITY A;  1SVL A;  2HOS A;  4RAG A;  3KP5 A;  3IAS 2;  2M5W A;  3S93 A;  3FXK A;  2YX4 A;  3A02 A;  3IC7 A;  1OPC A;  4BJT A;  2CWE A;  1LB2 A;  1D1C A;  2AO9 A;  1IV6 A;  2K4J A;  1QPM A;  3AG4 H;  5J8C A;  2V1X A;  1G8X A;  2PJR A;  3ISP A;  3TMO A;  3QP6 A;  5E17 F;  4BQA A;  5L3C A;  3LA3 A;  2PFB A;  2IBD A;  2GIZ A;  4KIS A;  1MW7 A;  2NXN B;  3JR9 A;  1XCV A;  2BY1 A;  1N25 A;  1IAW A;  2MGQ A;  4V2G A;  3EUK L;  4UB6 C;  3WTW C;  2H1L A;  3W6K B;  4CCO A;  2E1N A;  4LMY A;  3CCE I;  4KA4 A;  4LIT A;  3LSI A;  3W6V A;  2ZC2 A;  2KDO A;  3SZG A;  2CU7 A;  1MGT A;  2DA4 A;  3PNY A;  3DV8 A;  4ZYE A;  3BJO A;  5CPR B;  4FQG A;  2IGK A;  4KIB A;  5CLS A;  2VBW A;  5GAE J;  3HM5 A;  4MEX F;  4XLN F;  4BL0 B;  3FWE A;  4LK1 F;  2VKD A;  1J59 A;  2X51 A;  2JZY A;  5D4R A;  3S1N J;  4I99 C;  2Y9Y A;  4A3B J;  2COB A;  3I56 I;  4WWC A;  2PX9 A;  1H89 C;  2CW8 A;  3I55 I;  4CA0 A;  1H0M A;  4P9F A;  2F4I A;  4I09 A;  1Y0U A;  4UHT A;  1B6A A;  4F91 B;  1LUJ B;  2HDW A;  2BHY A;  3HBL A;  1A31 A;  1XMX A;  3DP7 A;  2EK5 A;  2WTE A;  2VQH A;  2F6C A;  3HXL A;  1FT9 A;  3CC7 I;  3GLL A;  3TW6 A;  3JRC A;  2NNN A;  5DYM A;  3BR3 A;  3WE3 A;  2E36 A;  3CCU I;  1BJA A;  3IKV A;  3HOU J;  4YFK F;  3QRF F;  3H35 A;  4GYI A;  2VB6 A;  4W97 A;  2EA4 A;  3LSJ A;  4EEF G;  1J7K A;  1R7J A;  4PZJ A;  4BDY A;  2R7S A;  1G3W A;  1W0T A;  3CZ6 A;  3FIS A;  5FJ8 J;  1FMV A;  1WJB A;  4HDU A;  3BQZ A;  4DGW B;  1ONV A;  1SFK A;  4EJW A;  3KP2 A;  4A5M A;  2X48 A;  4H0E A;  2X6O A;  3QPL A;  3QPH A;  1A5J A;  1G59 A;  1T0F C;  3J81 K;  3R4K A;  5LEK A;  5IYC J;  3QYB A;  5K5Q A;  1TW3 A;  2V9K A;  4CSW A;  2OBP A;  3FMQ A;  5B5E C;  4E7Z A;  1HLV A;  2VPL A;  1ZYR F;  2M7A A;  3N05 A;  1R23 A;  2K3P A;  1FSH A;  2DK5 A;  3UNG C;  1Y6I A;  1IN8 A;  2M8E A;  2RNG A;  3MN2 A;  4B48 A;  3PO3 J;  1Z67 A;  2F2E A;  2CW7 A;  2R5Z A;  5J6X A;  1FBQ A;  2P7C B;  2VLA A;  2P81 A;  2ZSH B;  3H36 A;  4AU7 A;  4D9J A;  3PNV A;  3OSG A;  5LBQ A;  2EV0 A;  3C2H A;  3M8J A;  4C3H J;  3HC7 A;  3JRI A;  1KQ8 A;  2VQG A;  2PMZ A;  3KCC A;  3VOD A;  4U7B A;  2VIX A;  2ZXH A;  3WTU C;  1LDK B;  4XLA A;  4G8X A;  4I01 A;  5HLG A;  3RZO J;  3KP3 A;  2CUF A;  2QBY A;  2DI3 A;  5LGU A;  4RB3 C;  1XSV A;  3I9V 2;  1AWC A;  1R4M B;  5DS9 A;  5HLI A;  2XVC A;  1OIS A;  3U21 A;  4EM2 A;  4XN3 A;  2E7X A;  3KEY A;  1IN4 A;  2RVC A;  2XRN A;  5TRD A;  1OKR A;  5EEG A;  2KIQ A;  2VE9 A;  3WOD F;  3MAJ A;  3ZPL A;  4PFO A;  4FIS A;  3I53 A;  3TOB A;  3BG3 A;  1XGS A;  3VB2 A;  5HDK A;  4A5N A;  3VYT B;  3IH3 A;  1RUN A;  3CME I;  2GIV A;  2H6B A;  5FLM J;  2BXY A;  2MH2 A;  2O5R A;  2Q2E B;  3ROU A;  3TOA A;  3WE2 A;  2B7E A;  2FMY A;  5CVR A;  5EJC A;  1VND A;  2OCC H;  5CKT A;  2LKX A;  2FNP A;  1H9T A;  1VQ8 I;  2F5E A;  4OOI A;  3DCF A;  3WU2 C;  2FUG 2;  3RQ4 A;  4L0Y B;  1REP C;  3GW2 A;  3OYN A;  2M4G A;  1B1B A;  3FIW A;  3DF8 A;  1Z1D A;  1FLI A;  2XF7 A;  1I39 A;  3T1B A;  1MH3 A;  3FKJ A;  3CJQ B;  1IRG A;  1XDS A;  3BQY A;  3T5X A;  2RGV A;  4IKF A;  1LEA A;  3FXM A;  1Y8R B;  4KT5 C;  2ID3 A;  5IOZ A;  5M5W J;  1IG7 A;  5DEQ A;  2OTJ I;  3IKT A;  1IW7 F;  1E3O C;  5J47 A;  2Y69 H;  1JKQ C;  3F6O A;  4AIK A;  3K0L A;  3K4M A;  2ZJP F;  1JHH A;  4XIC A;  4L9T A;  4BUP A;  2XV4 S;  2CW0 F;  3HRU A;  3KIO A;  2IEK A;  3UKG A;  1Q1H A;  5HS9 A;  4ZYG A;  2RC4 A;  1YTY A;  1DGR M;  1Y1W J;  3CMY A;  3LA7 A;  4HPQ A;  3OYB A;  2CGP A;  3HEF A;  1FEX A;  2VPR A;  1NK2 P;  4JK1 X;  1PVE A;  5J8F A;  2GWR A;  3CC4 I;  4PCQ A;  3P7N A;  2EIJ H;  4CCK A;  1MBG A;  2AS5 F;  3A4C A;  4ESB A;  2HZT A;  1MNE A;  3HSF A;  1D3Y A;  4MTD A;  4HX4 A;  2DT7 B;  1LFU P;  3W6J B;  3I64 A;  1GVJ A;  4MFD A;  1IV8 A;  1D0Z A;  3MZ8 A;  2E60 A;  2CJJ A;  2QQ8 A;  2X1C A;  4N4O B;  2UZK A;  2BY3 A;  2VOP A;  3QOE A;  3KYC B;  1SVM A;  3J80 Z;  1V5F A;  1UB9 A;  4RBO A;  1SD4 A;  4M3B A;  4R1H A;  3HSE A;  3DKY A;  3MZY A;  2EZI A;  3CCL I;  4UV9 A;  3CF5 F;  1B59 A;  2BEO A;  1FZP B;  3GUD A;  5JR3 A;  1BIB A;  2PBI A;  4D0P A;  2L9V A;  5C4J J;  2IVM A;  3ZN0 A;  3LSK A;  1FJL A;  3HSR A;  2M4K A;  4BE0 A;  4BGD A;  4A3M J;  2KIM A;  2KZG A;  5LEJ A;  4LLN A;  3LST A;  1IXS B;  3Q0U A;  2DQR A;  4YFN F;  3F22 A;  4E7I A;  4GGG A;  5JI6 A;  4DOZ A;  4RLQ A;  3V8L A;  4BQQ A;  3F8N A;  2ZME C;  2IW5 A;  4G9Y A;  4DBR A;  1GT0 C;  1W7P D;  2QA4 I;  1SFO J;  1DQU A;  2V26 A;  3GTP J;  3ERM A;  3TED A;  2KFD A;  5IT9 Z;  5ERI A;  2E1O A;  2H8W A;  4J01 A;  3DU5 A;  3BTI A;  3OR2 C;  1W7P A;  1ZN2 A;  4IF4 A;  3F0C A;  2R3S A;  3CTA A;  1LNW A;  2GLO A;  3L2V A;  5GPA A;  1S29 A;  3FBN B;  1LKX A;  1SAN A;  1R5H A;  2V9V A;  2EQR A;  4U0Y A;  4XKB A;  3CMA I;  1K6O A;  2V6C A;  1ETO A;  3JCU C;  1V3F A;  3IP4 B;  5JVG F;  4V2F A;  2QQ9 A;  4FE7 A;  3GYH X;  2EJR A;  4Y33 A;  5E79 C;  3CUQ B;  3E6M A;  4L0Z B;  4UUT A;  4G7H F;  4G6D A;  3E6C C;  4HST A;  3DBH B;  2LMD A;  3CP8 A;  2ZB9 A;  3WU1 B;  2KRC A;  1U3E M;  3S2D J;  1N75 A;  2QF7 A;  3H9G A;  1V55 H;  3DPT A;  3BTJ A;  1OYW A;  1X1D A;  4OAY A;  2ELK A;  3SDG A;  1XSD A;  2XPV A;  4OIQ F;  3FDY A;  3CP2 A;  2ZSI B;  3S16 J;  3FKI J;  2Z1D A;  5KAF C;  2K7L A;  2ESN A;  3HKZ A;  2DQL A;  2RRE A;  3OMY A;  4Y3O A;  3V7S A;  2FBK A;  2JTV A;  4A0X A;  5IP7 J;  1D8K A;  1PJR A;  2GOM A;  4ZC3 A;  5EG0 A;  2DYR H;  4AIJ A;  4EJU A;  3DTE A;  1ETY A;  3F6V A;  1MSE C;  4ENN A;  1YW7 A;  2JA8 J;  2ME6 A;  2XAJ A;  5F08 A;  5ED4 A;  1YG2 A;  2IS6 A;  2G9W A;  4G7Z F;  1LFP A;  1JKP C;  1U0J A;  1OCR H;  1ZRE A;  4U87 A;  3JW4 A;  2BW3 B;  2YSR A;  3B73 A;  1YW8 A;  4FET A;  5FD6 A;  1P6R A;  1OQY A;  4BE2 A;  4A3E J;  2JA7 J;  3K9T A;  5FRN A;  3E3V A;  5F27 A;  3J7Z I;  2ECB A;  4KDP A;  1H88 C;  2JJ7 A;  2IRF G;  3W3C A;  2K5C A;  1F1Z A;  1OCC H;  1D8J A;  1J09 A;  4S05 A;  2P5K A;  2E1C A;  1WFX A;  4WCG A;  1GV2 A;  1IRZ A;  4F7Z A;  1LPQ A;  3UR3 C;  1HSJ A;  3PQK A;  3WGH A;  1ZKG A;  2DFE A;  3PM1 A;  4M3F A;  3NRV A;  5IP6 A;  5L3F A;  3HUG B;  3J7A O;  2M87 A;  3V8K A;  1ZRC A;  3H5A A;  5E3N A;  2R7Z J;  4Q48 A;  1SMY F;  3KPH A;  2ZXJ A;  3FXO A;  3OWT A;  1WJE A;  2MD0 A;  2KL4 A;  1VQ9 I;  2ACJ A;  2HFH A;  3QPT A;  3ECH A;  2RQQ A;  3R0J A;  3QU3 A;  4RB1 A;  1G3Y A;  5M3F J;  2YS9 A;  2RDP A;  1P7J A;  1K4S A;  5HLT A;  3DKW A;  5ILU A;  3LAJ A;  4BS9 A;  4KMF A;  2W00 A;  1LE8 A;  3MWM A;  4DIQ A;  3H1C A;  3SXY A;  4IOA F;  3BTL A;  2ZJ2 A;  4KYW A;  1G2H A;  1TWG J;  1TLH B;  3TDU C;  1MDM A;  2CV0 A;  2DK8 A;  3L00 A;  1U5T A;  2W1O A;  1OCZ H;  1RC9 A;  3WTV C;  2PEX A;  2HU9 A;  3E6B A;  3M8F A;  4B44 A;  2EB7 A;  2EFP A;  2OQR A;  3QU6 A;  3R6S A;  2HDD A;  2FJ1 A;  2K27 A;  2L5Q A;  2HDC A;  4LB5 A;  2ZBK A;  3RKW A;  1J2X A;  2FNA A;  1WJF A;  3JRG A;  3EQL F;  1K7A A;  4V19 K;  1I6H J;  2DAO A;  3BOQ A;  1IJW C;  2XSD C;  2BV6 A;  2DO7 A;  2IT0 A;  1T08 B;  2A05 A;  1KGS A;  2W85 A;  4HA8 A;  1WWX A;  3FM3 A;  2JRM A;  4PJJ A;  3G2B A;  1RET A;  2OTL I;  2QEX I;  3K4K A;  2XSJ C;  1MH4 A;  1WPK A;  3BPX A;  1MBJ A;  1QGP A;  3FBI B;  4XSZ F;  5GPC A;  3OYF A;  2IP2 A;  1FX7 A;  1R4N B;  2W48 A;  3OYC A;  1ORK A;  1GXQ A;  2OF7 A;  2QSF X;  2XAF A;  3ZR8 X;  3HOY J;  1X1A A;  1S72 I;  3GFJ A;  1FYK A;  1FP2 A;  3BCB A;  1MKM A;  4XSX F;  1BM9 A;  2EA2 A;  2L02 A;  2KMU A;  2FF4 A;  3MD2 A;  3RKQ A;  3I4P A;  2BOL A;  2DDB A;  3OL3 A;  3V7R A;  5HNF A;  3WTT C;  5J4V A;  1VZ0 A;  5IPA A;  2JRT A;  1PP8 F;  4CYC B;  3WTZ A;  4A3G J;  2DYS H;  4LIU A;  3KEO A;  4NB5 A;  3GTM J;  3CQZ J;  1MDM B;  5LD2 C;  3DBL B;  2PG4 A;  3ELK A;  3DFG A;  3TO6 A;  1TWF J;  2KJC A;  2IXS A;  1JI8 A;  3ZN1 A;  1SFX A;  4XLP F;  1P4A A;  5F1R A;  3OL4 A;  1X19 A;  4AIH A;  4A3F J;  2DA1 A;  3J7Y J;  5ILV A;  4Y7N J;  4AC0 A;  2R5Z B;  5FRO A;  1XMA A;  1FOW A;  3TP3 A;  3IH4 A;  2VE8 A;  4ZZD A;  5FFZ A;  2K9N A;  4M9X A;  1I1G A;  1G4D A;  2H94 A;  4EMS A;  2KIU A;  3HIF A;  5D6F A;  1UHM A;  3RTR A;  1FY7 A;  4OAZ A;  1DP7 P;  1ZRD A;  1ZGA A;  3BR2 A;  3V8J A;  1RZ4 A;  2ELH A;  4JP0 A;  1WI9 A;  3BJ6 A;  3F8F A;  2W25 A;  3LSG A;  3K1P A;  4PFP A;  1AHD P;  2HVR A;  3ULQ B;  1ZLK A;  2FE3 A;  2QWW A;  4FHT A;  3HB9 A;  2XGD A;  3DQV C;  2XAG A;  3ABU A;  1W36 D;  1R36 A;  2LF7 A;  3ONQ A;  1WJC A;  1XGO A;  2ETH A;  3WG9 A;  1WRJ A;  4WXD A;  4EM0 B;  3PFY A;  3SJM A;  2XGE A;  1X58 A;  2M3A A;  3QAH A;  3ZMZ A;  1MBH A;  1ERD A;  1O3T A;  4E7J A;  4ANJ A;  1T6S A;  3BR5 A;  1MMN A;  2K85 A;  2DBB A;  1UHW A;  2LOO A;  2XRL A;  2IGN A;  1VQK I;  1I27 A;  2OZ6 A;  4C3J J;  4CZZ A;  2HVQ A;  1H9G A;  2DA5 A;  2PQ8 A;  4WX9 A;  2RAE A;  2AXT C;  2ZME A;  2Z33 A;  1FBU A;  2KPM A;  1ZAR A;  3M07 A;  3TQN A;  3PJR A;  2JSC A;  1LDD A;  3G1M A;  5H6R A;  1U5T B;  1BOB A;  3OYE A;  5IYB J;  5ICE A;  3HOT A;  2ZFU A;  4PGG A;  4HNV A;  3DU6 A;  1OMI A;  1U2W A;  1ACI A;  4D7M A;  1ZQ3 P;  3T0Y A;  4M72 A;  4RDU A;  4XRM A;  3OYG A;  4P55 A;  5JFR A;  5E1X A;  2L2O A;  3SHF A;  3ZMV A;  2LVS A;  3M9A A;  3CCV I;  2HYJ A;  3K4L A;  4LIV A;  5FGM A;  2DCE A;  4A3L J;  2W7N A;  2NVU B;  1D1B A;  3TKY A;  3OIO A;  2NVX J;  3E97 A;  1WKM A;  1ZHF A;  5F64 A;  1Z91 A;  1U78 A;  1V4R A;  3K4N A;  3EUA A;  3M1C A;  3MKW B;  2R92 J;  2Z5U A;  4PK4 A;  3PUF A;  5DCM B;  2L7F P;  2I10 A;  3HRT A;  1O3Q A;  3VWB A;  5FLV A;  1VQL I;  5H20 A;  4CCL A;  4KJZ A;  2AQF A;  2NYX A;  3QOP A;  4ABZ A;  2M30 A;  3FX3 A;  3KET A;  1U9N A;  1BI0 A;  2K02 A;  1M1E B;  2FSW A;  2IJL A;  5E1W A;  1VQO I;  2HS5 A;  1SEU A;  1XTA A;  1UMQ A;  4XQF A;  4YEJ A;  2CFX A;  3K2A A;  2VOD A;  4ITV A;  1O7L A;  3GX4 X;  2DJI A;  4JYK A;  2Y75 A;  1NH3 A;  2LY9 A;  4E7H A;  4XN0 A;  2KKO A;  4EJT A;  1MJB A;  4M6X A;  4K2E A;  3V42 A;  3HTU A;  1VQ6 I;  1ETQ A;  3A0B C;  4R8H A;  3AAF A;  5F04 A;  3OIQ A;  5JHF A;  4CUG A;  3EDP A;  1UFM A;  2R7Q A;  3JAM Z;  4DYQ A;  3A01 B;  1APL C;  2O7O A;  1IGN A;  3WGG A;  1JT0 A;  4AD9 A;  3CCR I;  1S8N A;  3ZRG A;  3FXQ A;  1OR7 C;  5EG0 B;  2R7R A;  1BA5 A;  5CYV A;  3S32 A;  2QSH X;  4MFE A;  3F23 A;  4A93 J;  1ZGJ A;  3I4N J;  2WY8 Q;  1HW1 A;  3HUG A;  3K70 D;  4C2T A;  2MW8 A;  2H8R A;  1X1B A;  1OR7 A;  1ZK8 A;  1FMW A;  4W1U A;  4XRS G;  5EGO B;  1J0R A;  3K6G A;  3I0T A;  5FB2 A;  1SAU A;  3RIR A;  4BU2 A;  3HOZ J;  2ICW G;  1YX3 A;  4EAT A;  3OYK A;  1QO0 D;  2RV8 A;  2OD5 A;  3OYA A;  2O6G E;  4OIN F;  3DTK A;  3BJA A;  4XMY A;  2O0Y A;  4HLY A;  3CDI A;  2K4B A;  5FO5 A;  1XGN A;  4MHG A;  2D1V A;  1R71 A;  5JLW A;  1MNM C;  4QLC U;  2ZXW H;  4RGR A;  2O03 A;  2FXA A;  1YIT I;  4I0B A;  2XUB A;  3SYT A;  2OA4 A;  2H6C A;  2M2E A;  2MAB A;  2MLG A;  2P0W A;  4YIR X;  2W82 A;  4AVZ A;  1HOM A;  2F4M B;  1IZ1 A;  4IRG A;  1FYM A;  2OJE D;  2H09 A;  4O6J A;  4IHT A;  1RNL A;  4LD5 A;  2VJ5 A;  3JAM K;  1SD6 A;  2P6T A;  4KUM A;  3ZOB A;  2OC6 A;  1MMS A;  1A6Q A;  2DA6 A;  1MMG A;  3L2Q A;  2CQX A;  3CJN A;  1HKT A;  1ETW A;  3M1E A;  3NEU A;  2TRT A;  1MIJ A;  3IH2 A;  2L3D A;  2UXX A;  3U2R A;  5CVU A;  5BQT A;  3LFU A;  1LE8 B;  3K70 C;  3COA C;  1WZ2 A;  3E5Q A;  2K40 A;  4ZTF A;  4EGZ A;  1ZLJ A;  4UXN A;  1HW2 A;  1A6I A;  2DOE A;  2LRD A;  4Q4Z F;  4LOC A;  4DJA A;  4OIP F;  2QQB A;  4A6D A;  3BLY A;  4BAY A;  1MND A;  1VQP I;  4Y15 A;  1TL8 A;  2ID6 A;  2X1E A;  2DMT A;  2JVH A;  2NOJ B;  3TW7 A;  4B8X A;  2D2W A;  3I71 A;  1AKH A;  3OS1 A;  5KNL A;  5J40 A;  3CUQ A;  3BZK A;  5GTI C;  3HTS B;  3RKX A;  2LD5 A;  2EFO A;  3DEW A;  3LL7 A;  2O8K A;  3GZN B;  4HSR A;  2EIL H;  2VBX A;  3BG7 A;  1LQ1 A;  2JVG A;  3TGN A;  1HXD A;  1NG7 A;  1XCB A;  3FXJ A;  2FML A;  2CUZ A;  1WJA A;  4GCV A;  3IRQ A;  4C2M J;  3GTQ J;  4YRV A;  1K83 J;  3KP7 A;  1W7P B;  3HL2 A;  2FBI A;  3KP6 A;  2PMH A;  4L5J A;  3T8T A;  1VQM I;  1L3L A;  2G0E A;  5LRR A;  1U8B A;  1PDN C;  1P92 A;  1VQN I;  4B4C A;  2F5V A;  1STZ A;  1TNS A;  2GA1 A;  3BC8 A;  2VJJ A;  4IX7 A;  1J9I A;  2CQ7 A;  5KVR A;  3LSH A;  2CFO A;  1B8I B;  3AL0 B;  2EPF A;  4HOB A;  4JBA A;  4IL6 C;  2HGC A;  2DXI A;  1KON A;  3Q9V A;  4BE1 A;  2CQQ A;  1IRX A;  2FQ4 A;  2LRE A;  4EM1 A;  5F6F A;  2J5P A;  1JJ6 C;  3PFI A;  1TC3 C;  3S17 J;  2QCO A;  1NK3 P;  1W4M A;  3GZ6 A;  3ESW B;  3BZ6 A;  4AVP A;  4LJZ F;  2IA0 A;  1QZE A;  4UVA A;  3OS2 A;  3KP4 A;  1ZG5 A;  2ZNY A;  4PDK A;  3OIP A;  1F5T A;  4MO7 A;  4P5O A;  2MBF A;  3C2G A;  2L01 A;  4O5V A;  2XPW A;  2EV5 A;  4WXC A;  3C7J A;  4KN4 X;  2EFN A;  1DGW Y;  5IY5 H;  3WGI A;  4JOM A;  1EH7 A;  1QZY A;  1IDZ A;  2L9S A;  2IA2 A;  4B09 A;  4B1R A;  4NHJ A;  5B3S H;  2L9R A;  3GFM A;  2VKH A;  4A2U A;  2HQ5 A;  3HOW J;  1R5G A;  1TWA J;  3DPU A;  2CUJ A;  3ZQF A;  2DMP A;  2E35 A;  3G73 A;  2D45 A;  3O8G A;  5FKM A;  5FD5 A;  3QP5 A;  3ABM H;  4CGZ A;  1Q1V A;  5E3O A;  2KP6 A;  3DWL E;  4LLG F;  2IA1 A;  3OYI A;  1MBK A;  2KT0 A;  3MEX A;  1D0X A;  3RPU D;  1UAA A;  1IC8 A;  3GXO A;  3PNT A;  3RI4 A;  1LJ9 A;  1TWC J;  2ME0 A;  4BXU A;  4BH9 A;  2ZXI A;  3QPS A;  2GBY A;  1I6X A;  2VQL A;  5D5U B;  4LB6 B;  3RCO A;  4LG0 B;  4ZDP A;  3HGY A;  4HF2 A;  5E18 F;  1MMD A;  4HAM A;  2X9D A;  1F9N A;  1QVU A;  2WAD A;  4D1Q A;  4A3C J;  2PMZ N;  5IT3 A;  2DT6 A;  1WH7 A;  3BR6 A;  4RAF A;  2M34 A;  2ESH A;  1BI3 A;  2VXD A;  2EZK A;  5AIQ A;  2HOA A;  1SD7 A;  1FC3 A;  3FXR A;  1ZH5 A;  2D1H A;  3LWF A;  2QBY B;  4F52 A;  2ADU A;  2F5C A;  3JSO A;  3F21 A;  4UUS A;  2WA0 A;  3BT9 A;  3GZ5 A;  2ISY A;  2QQA A;  4XRF A;  1ETX A;  5FRM A;  4PJL A;  2LY2 A;  1TQI A;  3D5S C;  2J5O A;  3W2V A;  4LFU A;  2MG4 A;  4M9S A;  1QNT A;  1P2F A;  2GZW A;  5GAH J;  1RUO A;  2FQ3 A;  2R4G A;  1P4W A;  2Y2Z A;  2EIK H;  5D6E A;  3NAU A;  1E0E A;  3ZP5 A;  1BC8 C;  2XF5 A;  4IHX A;  1DP3 A;  2BE5 F;  2FOK A;  2HKX A;  5JHU A;  1BOA A;  2V6E A;  4IHW A;  3ZMS A;  5LFA A;  4UVB A;  3N4M A;  1QHG A;  1B9M A;  5JVT A;  4KMU X;  1JTY A;  5CVJ A;  4F92 B;  1EH6 A;  3AG3 H;  1FOX A;  3AL0 C;  3H9J A;  4XKV A;  4I02 A;  2XKO A;  3SFZ A;  3LSM A;  1R6R A;  4B43 A;  2QM3 A;  2CV1 A;  2VAS A;  2PJR B;  2DJN A;  3HOX J;  1ZRF A;  4F93 B;  5CVV A;  3ZQQ A;  4PGH A;  2UXN A;  1YJW I;  4UB8 C;  5E1Z B;  3U9G A;  4PJ0 C;  1S7A A;  4DW6 A;  3IUO A;  1AKH B;  1DUX C;  2V4J C;  4HF1 A;  1S6L A;  1BI1 A;  2Y0M A;  1G6N A;  4XR6 A;  2K3F A;  2Y9Z A;  3CCJ I;  2BGC A;  1BR1 A;  3CLO A;  1HF0 A;  4I76 A;  1U6G A;  2MC3 A;  2RKH A;  3PSI A;  3N97 A;  1S9H A;  4RAY A;  1XDU A;  2A68 F;  2MSY A;  2W24 A;  1VI0 A;  2Y30 A;  1P7I A;  1GVD A;  1ZEL A;  2HKO A;  2JUC A;  2M0C A;  4DNC A;  2DTZ A;  3JRH A;  3BG5 A;  3U1D A;  2HPM A;  1JUM A;  2NAZ A;  3P5J A;  3S2W A;  4U0W A;  3O8H A;  2K9L A;  3D1N I;  1SVO A;  1TP4 A;  1I5Z A;  1OYI A;  2JT1 A;  3TO9 A;  1YI2 I;  4XRS A;  2FOW A;  4QPQ A;  5DM6 F;  1TWH J;  1UST A;  4CO8 A;  4MEY F;  2XKP A;  1WGX A;  2GOX B;  1A04 A;  2BZT A;  1B72 A;  2KRF A;  2M1B A;  5FFX A;  1MD0 A;  1ZG3 A;  2P5V A;  2JK3 A;  4DQ2 A;  3J81 Z;  3G71 I;  2F48 A;  2Z9O A;  2Y31 A;  3R61 A;  1YQA A;  5K5O A;  3HJE A;  3T8R A;  4JX6 A;  3S15 J;  3CJT B;  3EUH A;  2A07 F;  3PL8 A;  2E2J J;  1K6Y A;  4OWR B;  1YHQ I;  4UNO A;  5A2Q Z;  4GO1 A;  2HPI A;  1EH8 A;  1T95 A;  3WHB A;  3J7A Y;  1LDJ A;  1ETK A;  3H3Z A;  3GTG J;  2EZL A;  3LAP A;  1L0O C;  2NVQ J;  2IGO A;  2X6W A;  4IJA A;  4RMN A;  4J19 A;  1UHS A;  3MKZ A;  1R5I D;  3H3V K;  3CC2 I;  4XKW A;  3LFK A;  2OQG A;  2EIN H;  3RDI A;  2L9N A;  1SMT A;  4A0Y A;  3H5N A;  1BC7 C;  2HOT A;  5C44 J;  1SD5 A;  2CQK A;  3FZV A;  5J1U A;  2WB1 A;  3VYS B;  4EQQ A;  1GLN A;  3CD6 I;  4G94 A;  5C3E J;  4NQW B;  4LG3 A;  1PUE E;  4N9I A;  4FX0 A;  4M9Z A;  3C2B A;  3I3L A;  4GDF A;  1VQ7 I;  3TDZ C;  2LLK A;  3WU0 A;  3E5X A;  3WG7 H;  1KYW A;  3S3N A;  3HG9 A;  9ANT A;  3JTG A;  1AOY A;  4ZZL A;  3PUB A;  3ZQC A;  2Z3Y A;  1ZTR A;  2QSG X;  2VC0 A;  2E34 A;  4HLX A;  1MJ9 A;  4JX4 A;  3HOS A;  4CCM A;  3FK6 A;  2O9L A;  3E7L A;  5L3E A;  2IS2 A;  2Q8K A;  4X0G A;  5HLH A;  1KU3 A;  3K1M A;  5FKN A;  3ZMD A;  5FLX Z;  3K1N A;  4XNF A;  3VDX A;  4GRI A;  3CUO A;  4F3Q A;  4U0V A;  3MZH A;  4L9N A;  4XID A;  3L2W A;  3GF2 A;  5IYD J;  1X2N A;  4LK0 F;  1Z21 A;  2KLO A;  1HDP A;  2HZD A;  3S14 J;  1O57 A;  2BXZ A;  2G7U A;  3ZQL A;  4WK8 F;  2E5Z A;  3S3M A;  1JKO C;  1CF7 B;  3G1O A;  2XAU A;  1TT0 A;  2XPU A;  4QWQ A;  2CG4 A;  1B9N A;  2K9Q A;  1E17 A;  4EV0 A;  4OMY A;  2B63 J;  1F43 A;  3HDD A;  3RYR A;  1BR2 A;  2HQA A;  3VFZ A;  1D1A A;  1LFB A;  1HDD C;  5HS8 A;  1HQC A;  2M0M A;  3HPH A;  4IHY A;  5D8K B;  2EFW A;  1RR7 A;  1T56 A;  3DXJ F;  3FM5 A;  5FKO A;  2R7U A;  3HHG A;  3IWF A;  3G1L A;  1BI2 A;  2W57 A;  1T0F A;  2DN0 A;  4Y13 A;  1RPW A;  3L2R A;  4BBS J;  4BDZ A;  2FRH A;  1SFU A;  1BL0 A;  1CGP A;  2KDZ A;  5IT9 K;  1X1C A;  3HYI A;  1FPQ A;  4I0A A;  4G6Q A;  4LLL A;  5AON A;  4RGS A;  5DM7 F;  3H3U A;  2LTP A;  1ON2 A;  4BY7 J;  3GFI A;  1N77 A;  1BIA A;  2R7T A;  3NWS A;  4Y4R A;  1C0W A;  1TTY A;  2GA2 A;  5K7F A;  3P9C A;  4NBQ A;  1EKE A;  5L3G A;  3JRE A;  3S1Q J;  1IXC A;  2MD5 A;  2OAZ A;  3BRO A;  2DA7 A;  2G7H A;  1T2K A;  3BY6 A;  1NG6 A;  2F4O B;  1I3Q J;  3DBR B;  2OV7 A;  2ZME B;  4HG2 A;  2DDA A;  1KZH A;  3FMR A;  2HQR A;  2QUF A;  4KT6 A;  5BMZ A;  5LGT A;  2XB0 X;  3AG1 H;  2X85 A;  5E8G A;  3MKL A;  4DZP A;  2BY2 A;  3JRD A;  1R1T A;  4I7H A;  3V4G A;  3BP8 A;  1UCR A;  1KA8 A;  3HRS A;  1FIA A;  1IRF A;  1DPR A;  4QTR A;  4M71 A;  1JGG A;  5DTD A;  3JRA A;  4HNU A;  1QU3 A;  3W2W A;  1FOK A;  1NHA A;  1TW2 A;  4NC8 A;  4HV5 A;  5BS6 A;  1UEL B;  5J3L A;  3H0G J;  5GAD J;  4L9V A;  2HTJ A;  3DLL F;  4AYB A;  2WV1 A;  4QSH A;  3BTC A;  1VFC A;  1V5G A;  2EH3 A;  3K10 A;  5F1J A;  2QYO A;  1KU2 A;  4KIG A;  1B72 B;  1QPI A;  4AM3 A;  2QGU A;  2Y0S A;  1K78 A;  3MVP A;  3ERE D;  5KK1 A;  4E7L A;  4N0B A;  2R0Q C;  4OMZ A;  3CCY A;  3HOV J;  2V9P A;  3R60 A;  4CHU A;  4KIF A;  3M8E A;  2HWV A;  2VL8 A;  3W2A A;  3EYI A;  5HDN A;  4BJ5 C;  3K4C A;  4BQN A;  4Y52 J;  4JX5 A;  3P9K A;  1V54 H;  3CCM I;  5GAG J;  1YLF A;  1OLT A;  4LG0 A;  2E71 A;  1U9O A;  3DTI A;  1IN7 A;  2WAQ N;  4BHP A;  3IRR A;  4O3M A;  4B3X A;  4QIW N;  3QQA A;  1LVA A;  2WBM A;  3A0H C;  3L1P A;  2R7D A;  1TBX A;  4NUB A;  2X6Y A;  1JXS A;  5EF6 A;  1IF1 A;  5J1Y A;  5CVI A;  4P9U A;  1QZZ A;  1IUY A;  3O3K A;  4IEJ A;  3H9Q A;  3G3Z A;  2GQQ A;  2IAI A;  4YIF A;  2IPQ X;  2YU3 A;  1OFC X;  4R79 A;  1ZAO A;  1E2X A;  5J4Y A;  2CRG A;  5B66 C;  3F72 A;  2AHQ A;  4MQ9 F;  4YEL A;  4CCN A;  2IS4 A;  1YYV A;  5TJJ A;  1F36 A;  5HNH A;  3GTL J;  4OU0 A;  1BR4 A;  1Z6T A;  2GXG A;  4RM3 A;  1ODD A;  4MLO A;  3D0S A;  5EGO A;  2XGC A;  1NTC A;  1TT5 B;  3X2Q H;  1JUS A;  2LP0 A;  3E5U A;  1HKS A;  2WAQ A;  3A03 A;  2B9S A;  4BKX A;  5FKK A;  3B6A A;  1EV7 A;  1S7E A;  2KJB A;  1JT6 A;  4UVC A;  4M6Y A;  3ZQI A;  2P5L C;  1W0U A;  2UUZ A;  4ZDO A;  4IHS A;  2LBF B;  4ETS A;  4N9H A;  4MGR A;  3G4S I;  3Q5F A;  5KHD A;  3RQI A;  3A01 A;  1OJL A;  2LNB A;  2FX0 A;  5EZH A;  2X4H A;  4HX7 A;  5ILS A;  2HYG D;  1X3W B;  3ABL H;  2E1M B;  2YUS A;  2L0K A;  1Y8Q B;  4IPA A;  1Z77 A;  5FKL A;  2ZJR F;  1B8I A;  1VF9 A;  3JTH A;  3A1Y A;  3SEQ A;  1HC8 A;  2H1K A;  3OYM A;  5LRS A;  1GDT A;  2P6S A;  2F5F A;  2V79 A;  5EZG A;  1GXP A;  2H27 A;  4PUS A;  2DT5 A;  2YPR A;  3CDH A;  4AYB N;  5D4S A;  2DA3 A;  2NS0 A;  4LGW A;  3ZMU A;  2AXL A;  2VI6 A;  4ASN A;  4IO9 F;  1S5L C;  2VC1 A;  4XOP A;  4UY8 I;  1FYL A;  1A36 A;  2HXI A;  3ML6 A;  3OYJ A;  4BJ6 C;  2DOF A;  3CMM A;  4U88 A;  1BW6 A;  2A69 F;  5F0H A;  5KAI C;  1WHU A;  3EYY A;  5DCM A;  1R49 A;  2CMP A;  3Q0W A;  1XS9 A;  4EJV A;  2DTR A;  2CS3 A;  4EGY A;  5B1B H;  3VSL A;  4CZC A;  1Z7U A;  3C3W A;  3O2P E;  2XHK A;  1USS A;  3RZD J;  2CSO A;  3HPG A;  1ULY A;  4BBR J;  3FK7 A;  4HQM A;  5KCM A;  4Q5S F;  4ZJZ A;  1RKT A;  4IOC F;  2V1D A;  2MFZ A;  4ZYD A;  5C4X J;  2EV6 A;  5D8L B;  2R93 J;  4L5I A;  3U1K A;  4NNJ A;  1IN6 A;  3K69 A;  5CQE A;  4OIO F;  2NVT J;  3S2H J;  2VQC A;  5M3M J;  2BW3 A;  4XL9 A;  1OCO H;  5IP9 J;  1S3J A;  4NQW A;  3ABT A;  5GP9 A;  3I54 A;  3GTJ J;  2QEN A;  2YR2 A;  2HTS A;  1WJD A;  2PJP A;  2RNJ A;  3CO7 C;  2JMW A;  2COM A;  2HVS A;  1A35 A;  1GV5 A;  4ZTJ A;  4AID A;  4MQV A;  4U7D A;  2B0L A;  4XKC A;  2WC2 A;  3PQJ A;  5DD8 A;  1O7F A;  3OYH A;  2X6X A;  3K4J A;  4A3I J;  2C6Y A;  3RJP A;  5LLQ A;  3NQO A;  1IN5 A;  4GXO A;  2VT3 A;  2P7V B;  1Z05 A;  2M7B A;  5M5X J;  4WF2 A;  3FHN A;  4HX8 A;  4EVI A;  1P9Q C;  1IO2 A;  3BWG A;  2FD5 A;  1EF4 A;  5DCF A;  2K9M A;  1BBY A;  1XX5 A;  1QA6 A;  2NNY A;  4BQO A;  3OYL A;  1F4K A;  2LC2 A;  3FHZ A;  3TO7 A;  5EEH A;  1YO5 C;  2UV1 A;  4HRI A;  3BCA A;  2BHZ A;  3BZC A;  1MZB A;  5DDG A;  3CCQ I;  1R00 A;  1R1V A;  2R7X A;  2O61 A;  2HOE A;  1I50 J;  2O8X A;  2N8G A;  2OPT A;  2O3F A;  3BR1 A;  3F8B A;  3I5U A;  2L7Z A;  3KLN A;  2PN6 A;  2MYS A;  2LR8 A;  2IGM A;  4A6E A;  4ON0 A;  2LG4 A;  3K4B A;  1W36 C;  4F55 A;  4WXH A;  4CH7 A;  1V5E A;  5ICC A;  2OCE A;  2R7F A;  5JLX A;  4PJM A;  4EJO A;  4D5C A;  2V1U A;  3FF5 A;  2XAQ A;  3GVA A;  4IXA A;  2F5D A;  2JN6 A;  4Z2Y A;  2JPC A;  3K7A J;  4FTH A;  3CUQ C;  3SQN A;  4CIC A;  2GM4 A;  2CH0 A;  1YS7 A;  4TV7 A;  2FBH A;  4C30 A;  2BY0 A;  3DLA A;  1J5Y A;  3GFL A;  3TBI A;  3CLQ A;  3RPU A;  5DV5 A;  3SZP A;  3KX2 A;  1H8A C;  4A3D J;  5H6Q A;  4ZYA A;  5K7Z A;  2WWY A;  1YIO A;  1JKR C;  3F3X A;  1AA7 A;  3J80 K;  1ZR2 A;  3AG2 H;  2ZNZ A;  5LHH A;  3VYU B;  4FCY A;  4BAC A;  3P9I A;  1YIJ I;  4HEA 2;  1IDY A;  2STW A;  3B02 A;  2YX7 A;  3B6C A;  1UZC A;  4DBQ A;  4HW0 A;  5EEA A;  5TGT A;  1YRN A;  3LSR A;  1QRY A;  3ZQG A;  2VBZ A;  2A6H F;  1RIO H;  4D5F A;  2HXO A;  2DFH A;  3KFW X;  2V7F A;  4CXF A;  4C2U A;  2DPD A;  4CDG A;  3MQ0 A;  1FTZ A;  2M9H A;  2L7M P;  2LSO A;  2Z99 A;  2DPU A;  4JQF A;  1TNT A;  2AQE A;  3M3Y J;  5ICF A;  1TQM A;  2A5W A;  2L54 A;  1UJ8 A;  1R9T J;  1PUF B;  3SDB A;  1GUU A;  1TQP A;  2VXZ A;  3KZY A;  3VOE A;  1HA8 A;  1XC5 A;  3PIO F;  4XOR A;  3LOC A;  3GBG A;  3MCZ A;  1HW5 A;  4RA2 A;  4RGU A;  3RSN A;  4I6Z A;  1FSE A;  3O6B B;  4C9Y A;  2JQ7 A;  3LQR A;  1FWZ A;  3LQQ A;  4G6T B;  4RAZ A;  5J1R A;  4E4H A;  2PMU A;  1WSU A;  5D5W B;  3LSP A;  5F0F A;  3MMY B;  3DEU A;  3OR1 C;  3VEP A;  2CUE A;  3HKZ N;  2L4M A;  3ECO A;  3G6E I;  4HZF A;  1CQT A;  3KZI C;  4DZJ A;  5DUI A;  1WVR A;  2DFI A;  3E0J B;  3L7W A;  1SFE A;  5DD4 A;  4BNC A;  1XD7 A;  3AFH A;  3F8C A;  1Z3Y A;  1RKW A;  1U8R A;  3L9F A;  2LYC A;  4BEH A;  2ISZ A;  2P4W A;  1HKQ A;  2STT A;  1RES A;  3M7G A;  2XIG A;  2DMN A;  4ESF A;  3TP0 A;  4HQE A;  2XC7 A;  3WHC A;  2EFQ A;  2VN2 A;  4XLH A;  3S1M J;  2V1N A;  3DPL C;  1WI3 A;  4J00 A;  3IAM 2;  2Z2S B;  3ZGK A;  4D7N A;  1D5Y A;  4YII A;  3IWZ A;  3NAR A;  2CO5 A;  3I58 A;  3JSP A;  5K1Y A;  3L09 A;  1T39 A;  1N78 A;  2M45 A;  2L4A A;  4UUS B;  5K7H A;  3GLX A;  1R22 A;  4I2O A;  4MTE A;  1JUP A;  3SFI A;  1Y56 A;  2HNH A;  3EET A;  2DFF A;  5IOY A;  2VON A;  2LK2 A;  2BBY A;  2JWT A;  2M8G X;  3LA2 A;  5LHG A;  2EBI A;  3GTO J;  2LKP A;  4G7O F;  4RS8 A;  4X6A J;  4N4N B;  1FTT A;  3I59 A;  2XB5 A;  2CQN A;  4XBF A;  3WTS C;  1Z3X A;  3GWZ A;  1QHH D;  1UG0 A;  1JHF A;  1KU7 A;  5DUK A;  2MLK A;  4XK4 A;  2K86 A;  2JUG A;  4FT8 A;  2LFB A;  1X3Z B;  2LY1 A;  2NRA C;  2XRO A;  1X4P A;  3F8M A;  1ZG1 A;  1O4X A;  1KQ0 A;  2VT2 A;  3CJR B;  3QYE A;  2FA5 A;  3OYD A;  1HBX G;  1PP7 U;  2NOG A;  4B47 A;  3HRM A;  2QVO A;  4L18 B;  3KEQ A;  4KFC A;  3VPR A;  2FU4 A;  3I4M J;  4XLE A;  2XAH A;  1BN5 A;  4II2 A;  4AWX B;  1YJN I;  2W4S A;  4KN7 X;  1XMK A;  4G12 A;  1X4O A;  2LKS A;  2WV0 A;  5E3L A;  1Y1V J;  2E2H J;  2GXA A;  5E3M A;  4NDL A;  3SZT A;  1ON1 A;  1DU0 A;  1Z6R A;  2NS8 A;  4ZYH A;  2OZU A;  4ESJ A;  4A0Z A;  3H5R A;  2ELJ A;  2ZO4 A;  2L7K A;  4NC7 A;  5LGN A;  4A3J J;  1LVK A;  1X3U A;  1Y39 A;  1AU7 A;  1MSF C;  3CCS I;  1S7O A;  3BPV A;  4C3I J;  4BXF A;  5LHI A;  2P8T A;  2LH9 A;  2VKV A;  4CCJ A;  1FBS A;  4RM2 A;  1VTN C;  2KHM A;  4BHB A;  4IZZ A;  4ENM A;  1T38 A;  2GXB A;  4E7K A;  4HYE A;  4BHC A;  4KIT B;  3S3O A;  2FEZ A;  3S1R J;  4BY1 J;  3OOU A;  1WCM J;  1QQI A;  2KRH A;  3D5L A;  3KE2 A;  3VYR B;  3PSF A;  4FX4 A;  4A3K J;  4E6K G;  3IHU A;  2R7O A;  2RQP A;  1FP1 D;  5HOD A;  2JA6 J;  5D5V B;  3ASN H;  3SEZ A;  4M74 A;  5E8I A;  4Q47 A;  1W5T A;  1WJ5 A;  4YG2 F;  1IUF A;  2A3S A;  2Z16 A;  5A2Q K;  1MMA A;  4XM3 A;  2HI3 A;  5BOX A;  5AIP A;  2X0L A;  3Q0V A;  5ICG A;  2VJ4 A;  1JTX A;  3QOD A;  4AUX A;  2ZJQ F;  5FLX K;  1T33 A;  2E7W A;  4E7S A;  1RR8 C;  1WH5 A;  4M3D A;  1UG2 A;  2KIF A;  1X2M A;  2A6E F;  3ZMT A;  1VQ4 I;  2ECC A;  1OCT C;  5BPD A;  2DMQ A;  2KQR A;  2DOA A;  5HS7 A;  5B1A H;  1D0Y A;  4B3A A;  4M3G A;  3ZCO A;  4RLF A;  1HST A;  4YFX F;  1YOV B;  2JSP A;  3C1D A;  4M73 A;  1EJ9 A;  2XDV A;  4XOT A;  1K4T A;  1TZL A;  3ZXS A;  3CO6 C;  2EIM H;  1YX5 A;  2MH9 A;  2OU2 A;  2KIS A;  1LEB A;  3EUH C;  2WB1 N;  2DA2 A;  3V7C A;  4UUV A;  4UV8 A;  2D5V A;  2VKE A;  1E3P A;  2A6T A;  2K9S A;  4RB0 A;  2R5Y A;  2E1M C;  2QKL B;  4PJN A;  4HF0 A;  2NVY J;  3OSF A;  4HDV A;  3M4O J;  1KU9 A;  4ENK A;  3BG9 A;  1DPU A;  1T98 A;  4Y17 A;  1W5C C;  3GEZ A;  1GHC A;  1W5S A;  1RRJ A;  2HYF A;  4IHV A;  1R58 A;  3NWT A;  3TL4 X;  5K5R A;  3EPZ A;  3JRF A;  4IVN A;  3DKX A;  3D5R C;  3OV8 A;  2ZKZ A;  5TIS C;  2LDU A;  1J75 A;  1SC7 A;  1HCR A;  1MBE A;  2Q0O A;  1YJ9 I;  2GAU A;  4P1W A;  4OIR F;  2I8D A;  2XGX A;  4BYY A;  3Q3S A;  3BR0 A;  2BYV E;  4A69 C;  3ABK H;  4P96 A;  3RKY A;  5CQG A;  3GTK J;  1Z9C A;  2VUM J;  4ZH4 F;  3WTY C;  1QVT A;  3CDL A;  3R0A A;  1YS6 A;  1JJ8 C;  1U5T C;  4HBL A;  3VSK A;  3KZZ A;  4FAS D;  1OYY A;  3ASO H;  3KLO A;  3BDD A;  4XLF A;  5BNG A;  3C18 A;  3IL2 A;  4ENJ A;  2MC4 A;  1FNN A;  3MFK A;  1DU6 A;  2LBF A;  3IV5 A;  1WQ2 A;  5EDN A;  4E70 A;  2X1D A;  2JPB A;  1X1P A;  3LNQ A;  4II3 A;  3FXU A;  4L9J A;  2R7W A;  2QZ8 A;  3F9K A;  1RI7 A;  3MKY B;  3CF2 A;  3GCM A;  4M3E A;  1W1W E;  2VJI A;  5HOO A;  2DOD A;  2TCT A;  2KZV A;  4GYG A;  4XLC A;  2CV2 A;  1YW9 A;  2Q1Z B;  1I3A A;  1XGM A;  3BG6 A;  2W84 A;  4QPO A;  2CYY A;  2I5U A;  4IQJ A;  1XPX A;  3WTX C;  1Z0X A;  2ZFW A;  2IS1 A;  3KYL A;  4IQ4 A;  1Y0N A;  5CJ9 A;  3LMM A;  2WAF A;  1PYV A;  2A5Y B;  2JA2 A;  4NC6 A; 
#chains in the Genus database with same CATH homology
 4HV6 A;  2ZCW A;  3K2Z A;  4I98 B;  2PLY A;  2MA3 A;  1D5V A;  3RPQ A;  2HR3 A;  1JE8 A;  1P4X A;  4A12 A;  2UWM A;  3I59 B;  1XSX A;  3H92 A;  2RN7 A;  1R1U A;  1MJA A;  4IRH A;  1K79 A;  1XB4 A;  1YFH A;  4RB2 C;  5L3D A;  5BPI A;  1K78 B;  2DLL A;  2VOO A;  1KYZ A;  4KNY A;  3HHH A;  4KIC A;  1G3S A;  5L3B A;  2HQN A;  3RYP A;  3GO5 A;  3ZQ7 A;  2EWN A;  2DW4 A;  1O3R A;  1KQ9 A;  1JGS A;  1IXR C;  2Q2E A;  4MNU A;  2XAS A;  4IRI A;  1SAX A;  2PI0 A;  4CYD A;  1B4A A;  3REO A;  4S04 A;  5HVQ C;  2QLZ A;  2HEO A;  1I1S A;  5HDG A;  2VBY A;  5E20 A;  4RGX A;  1CF7 A;  2A61 A;  5D5X B;  3E6D A;  2TDX A;  1QBJ A;  3FMS A;  3L2C A;  2LF8 A;  1XN7 A;  3OOP A;  6PAX A;  1G3T A;  2Y48 A;  1DDN A;  2DU9 A;  3Q9S A;  3KP5 A;  2M5W A;  2YX4 A;  3IC7 A;  1OPC A;  2CWE A;  1LB2 A;  2K4J A;  1QPM A;  5J8C A;  2V1X A;  3ISP A;  3QP6 A;  5E17 F;  4BQA A;  5L3C A;  3LA3 A;  2PFB A;  1XCV A;  1IAW A;  3WTW C;  3W6K B;  2E1N A;  4LMY A;  4KA4 A;  1MGT A;  3DV8 A;  4ZYE A;  3BJO A;  4KIB A;  5CLS A;  2VBW A;  4MEX F;  4XLN F;  3FWE A;  4LK1 F;  1J59 A;  2JZY A;  5D4R A;  4WWC A;  1H0M A;  4P9F A;  4I09 A;  1Y0U A;  4UHT A;  1B6A A;  3DP7 A;  2EK5 A;  2WTE A;  1FT9 A;  2NNN A;  5DYM A;  3WE3 A;  1BJA A;  3IKV A;  4YFK F;  3QRF F;  4GYI A;  2EA4 A;  1J7K A;  1R7J A;  4PZJ A;  1G3W A;  4HDU A;  1ONV A;  4EJW A;  3KP2 A;  4A5M A;  4H0E A;  3QPH A;  3J81 K;  3R4K A;  5LEK A;  5K5Q A;  1TW3 A;  2OBP A;  3FMQ A;  1ZYR F;  1R23 A;  1FSH A;  2DK5 A;  1IN8 A;  2M8E A;  2F2E A;  5J6X A;  1FBQ A;  2P7C B;  5LBQ A;  2EV0 A;  1KQ8 A;  3KCC A;  3VOD A;  4U7B A;  3WTU C;  1LDK B;  4G8X A;  4I01 A;  5HLG A;  3KP3 A;  2QBY A;  2DI3 A;  5LGU A;  4RB3 C;  1XSV A;  1AWC A;  5HLI A;  2XVC A;  4EM2 A;  2E7X A;  1IN4 A;  2RVC A;  2XRN A;  5TRD A;  1OKR A;  5EEG A;  2VE9 A;  3WOD F;  3MAJ A;  3ZPL A;  3I53 A;  3TOB A;  5HDK A;  1XGS A;  3VB2 A;  4A5N A;  1RUN A;  2GIV A;  2H6B A;  2MH2 A;  3ROU A;  3TOA A;  3WE2 A;  2FMY A;  5CVR A;  2FNP A;  1H9T A;  2F5E A;  4OOI A;  4L0Y B;  1REP C;  3GW2 A;  1B1B A;  3DF8 A;  1Z1D A;  1FLI A;  3T1B A;  1IRG A;  1XDS A;  3T5X A;  2RGV A;  1LEA A;  4KT5 C;  5DEQ A;  3IKT A;  1IW7 F;  3F6O A;  4AIK A;  3K0L A;  1JHH A;  4L9T A;  2XV4 S;  2CW0 F;  3HRU A;  1Q1H A;  5HS9 A;  4ZYG A;  2RC4 A;  1YTY A;  3LA7 A;  2CGP A;  4JK1 X;  5J8F A;  2GWR A;  4PCQ A;  3P7N A;  2AS5 F;  4ESB A;  2HZT A;  3HSF A;  1D3Y A;  4MTD A;  4HX4 A;  3W6J B;  3I64 A;  1GVJ A;  2UZK A;  2VOP A;  3J80 Z;  1UB9 A;  1SD4 A;  4R1H A;  3HSE A;  3MZY A;  4UV9 A;  1B59 A;  2BEO A;  1FZP B;  3GUD A;  5JR3 A;  1BIB A;  2PBI A;  4D0P A;  2IVM A;  3ZN0 A;  3HSR A;  2KIM A;  5LEJ A;  4LLN A;  3LST A;  1IXS B;  2DQR A;  4YFN F;  3F22 A;  4GGG A;  5JI6 A;  3V8L A;  3F8N A;  4G9Y A;  2IW5 A;  1W7P D;  5IT9 Z;  5ERI A;  1W7P A;  1ZN2 A;  4IF4 A;  2R3S A;  3CTA A;  1LNW A;  1S29 A;  1R5H A;  2V9V A;  4U0Y A;  1K6O A;  2V6C A;  1V3F A;  2QQ9 A;  3GYH X;  2EJR A;  3CUQ B;  3E6M A;  4L0Z B;  4G7H F;  4G6D A;  3E6C C;  3WU1 B;  1U3E M;  3DPT A;  1OYW A;  1XSD A;  4OIQ F;  2K7L A;  2ESN A;  2DQL A;  3V7S A;  2FBK A;  2JTV A;  4A0X A;  1D8K A;  4AIJ A;  4EJU A;  3F6V A;  4ENN A;  1YW7 A;  2XAJ A;  5ED4 A;  1YG2 A;  2G9W A;  4G7Z F;  1ZRE A;  3JW4 A;  2YSR A;  3B73 A;  1YW8 A;  5FD6 A;  1P6R A;  3K9T A;  3E3V A;  4KDP A;  2IRF G;  1F1Z A;  1D8J A;  4S05 A;  2P5K A;  2E1C A;  4WCG A;  4F7Z A;  1HSJ A;  3PQK A;  3WGH A;  3NRV A;  5L3F A;  3J7A O;  2M87 A;  3V8K A;  1ZRC A;  4Q48 A;  1SMY F;  2ZXJ A;  2ACJ A;  2HFH A;  3QPT A;  3ECH A;  3R0J A;  3QU3 A;  4RB1 A;  1G3Y A;  2RDP A;  3LAJ A;  3DKW A;  5ILU A;  4KMF A;  3MWM A;  3SXY A;  2ZJ2 A;  4KYW A;  1TLH B;  3TDU C;  1MDM A;  2DK8 A;  3L00 A;  1U5T A;  3WTV C;  2PEX A;  3M8F A;  3E6B A;  2EB7 A;  2EFP A;  2OQR A;  3QU6 A;  3R6S A;  2K27 A;  2HDC A;  4LB5 A;  2ZBK A;  3RKW A;  1J2X A;  2FNA A;  1K7A A;  3EQL F;  2DAO A;  3BOQ A;  2BV6 A;  2DO7 A;  2IT0 A;  1KGS A;  2W85 A;  4HA8 A;  1WWX A;  3FM3 A;  3BPX A;  1QGP A;  4XSZ F;  2IP2 A;  1FX7 A;  1GXQ A;  2XAF A;  3GFJ A;  1FYK A;  1FP2 A;  1MKM A;  4XSX F;  1BM9 A;  2EA2 A;  2L02 A;  2FF4 A;  3I4P A;  3V7R A;  3WTT C;  2JRT A;  1PP8 F;  3WTZ A;  3KEO A;  4NB5 A;  1MDM B;  2PG4 A;  3DFG A;  3ELK A;  3TO6 A;  2KJC A;  3ZN1 A;  1SFX A;  4XLP F;  1P4A A;  5F1R A;  4AIH A;  5ILV A;  1XMA A;  2VE8 A;  4ZZD A;  5FFZ A;  4M9X A;  1I1G A;  1G4D A;  2H94 A;  4EMS A;  2KIU A;  3HIF A;  5D6F A;  1UHM A;  3RTR A;  1FY7 A;  1DP7 P;  1ZRD A;  1ZGA A;  3V8J A;  1RZ4 A;  2ELH A;  1WI9 A;  3BJ6 A;  3F8F A;  2W25 A;  3K1P A;  3ULQ B;  1ZLK A;  2FE3 A;  2QWW A;  4FHT A;  3DQV C;  2XAG A;  3ABU A;  1R36 A;  2LF7 A;  1XGO A;  2ETH A;  3WG9 A;  1WRJ A;  4WXD A;  4EM0 B;  3QAH A;  3ZMZ A;  1O3T A;  1T6S A;  2DBB A;  1UHW A;  1I27 A;  2OZ6 A;  4CZZ A;  1H9G A;  2PQ8 A;  4WX9 A;  2ZME A;  2Z33 A;  1FBU A;  1ZAR A;  3TQN A;  2JSC A;  1LDD A;  5H6R A;  1U5T B;  5ICE A;  3HOT A;  4PGG A;  1OMI A;  1U2W A;  3T0Y A;  4M72 A;  4P55 A;  5JFR A;  5E1X A;  3SHF A;  3ZMV A;  3M9A A;  5FGM A;  3TKY A;  3E97 A;  1WKM A;  1ZHF A;  5F64 A;  1Z91 A;  1U78 A;  1V4R A;  2Z5U A;  5DCM B;  3HRT A;  1O3Q A;  5H20 A;  2NYX A;  3QOP A;  2M30 A;  3FX3 A;  3KET A;  1BI0 A;  2K02 A;  2FSW A;  2IJL A;  5E1W A;  2HS5 A;  2CFX A;  2VOD A;  1O7L A;  3GX4 X;  2Y75 A;  2KKO A;  4EJT A;  1MJB A;  4M6X A;  4K2E A;  3HTU A;  4R8H A;  3AAF A;  3EDP A;  1UFM A;  3JAM Z;  3WGG A;  4AD9 A;  1S8N A;  3FXQ A;  5CYV A;  3F23 A;  1ZGJ A;  1HW1 A;  3HUG A;  1OR7 A;  1J0R A;  3I0T A;  5FB2 A;  3RIR A;  1QO0 D;  2RV8 A;  2OD5 A;  2O6G E;  4OIN F;  3BJA A;  2O0Y A;  4HLY A;  2K4B A;  5FO5 A;  1XGN A;  4MHG A;  2D1V A;  4QLC U;  4RGR A;  2O03 A;  2FXA A;  4I0B A;  2XUB A;  2OA4 A;  2H6C A;  2MLG A;  4IRG A;  1IZ1 A;  1FYM A;  2H09 A;  4O6J A;  4IHT A;  1RNL A;  4LD5 A;  3JAM K;  1SD6 A;  2P6T A;  4KUM A;  3CJN A;  1HKT A;  3M1E A;  3NEU A;  2L3D A;  2UXX A;  3U2R A;  5CVU A;  5BQT A;  3COA C;  3E5Q A;  4EGZ A;  1ZLJ A;  4UXN A;  1HW2 A;  4Q4Z F;  4OIP F;  2QQB A;  4A6D A;  4BAY A;  4Y15 A;  4B8X A;  2D2W A;  3I71 A;  3CUQ A;  3HTS B;  3RKX A;  2EFO A;  2VBX A;  1LQ1 A;  3TGN A;  1HXD A;  1XCB A;  2FML A;  3IRQ A;  4GCV A;  3KP7 A;  1W7P B;  1L3L A;  2FBI A;  2PMH A;  3KP6 A;  3T8T A;  4L5J A;  5LRR A;  1PDN C;  1P92 A;  1STZ A;  1TNS A;  2GA1 A;  1J9I A;  5KVR A;  4HOB A;  4JBA A;  2HGC A;  3Q9V A;  4EM1 A;  5F6F A;  2J5P A;  3PFI A;  1W4M A;  3GZ6 A;  3BZ6 A;  4AVP A;  4LJZ F;  2IA0 A;  4UVA A;  3KP4 A;  1ZG5 A;  2ZNY A;  4PDK A;  1F5T A;  4P5O A;  2MBF A;  2L01 A;  4O5V A;  2EV5 A;  4WXC A;  3C7J A;  4KN4 X;  2EFN A;  3WGI A;  1EH7 A;  1QZY A;  2IA2 A;  4B09 A;  4NHJ A;  3GFM A;  4A2U A;  1R5G A;  2D45 A;  3G73 A;  5FD5 A;  3QP5 A;  4CGZ A;  4LLG F;  2IA1 A;  3MEX A;  3GXO A;  3RI4 A;  1LJ9 A;  4BXU A;  4BH9 A;  1I6X A;  5D5U B;  4LB6 B;  4LG0 B;  4HF2 A;  5E18 F;  4HAM A;  1F9N A;  5IT3 A;  2ESH A;  1BI3 A;  5AIQ A;  1SD7 A;  1FC3 A;  3FXR A;  1ZH5 A;  2D1H A;  3LWF A;  2QBY B;  2ADU A;  2F5C A;  3JSO A;  3F21 A;  3GZ5 A;  2ISY A;  2QQA A;  4XRF A;  1TQI A;  2J5O A;  4LFU A;  4M9S A;  1QNT A;  1P2F A;  2GZW A;  1RUO A;  2FQ3 A;  1P4W A;  5D6E A;  3ZP5 A;  1BC8 C;  2BE5 F;  2FOK A;  2HKX A;  5JHU A;  1BOA A;  3ZMS A;  3N4M A;  4UVB A;  5JVT A;  1B9M A;  4KMU X;  5CVJ A;  1EH6 A;  4I02 A;  2XKO A;  3SFZ A;  2QM3 A;  1ZRF A;  5CVV A;  4PGH A;  2UXN A;  5E1Z B;  3U9G A;  1S7A A;  1DUX C;  4HF1 A;  1S6L A;  1BI1 A;  2Y0M A;  1G6N A;  2BGC A;  3CLO A;  1U6G A;  2MC3 A;  2RKH A;  3N97 A;  4RAY A;  1XDU A;  2A68 F;  2W24 A;  4DNC A;  2HKO A;  3U1D A;  2NAZ A;  3S2W A;  4U0W A;  1I5Z A;  1OYI A;  2JT1 A;  3TO9 A;  1UST A;  4CO8 A;  4MEY F;  2XKP A;  1A04 A;  2KRF A;  2M1B A;  5FFX A;  1MD0 A;  1ZG3 A;  2P5V A;  4DQ2 A;  3J81 Z;  2Z9O A;  3R61 A;  1YQA A;  5K5O A;  3T8R A;  2A07 F;  3EUH A;  4UNO A;  5A2Q Z;  4GO1 A;  1EH8 A;  1LDJ A;  3H3Z A;  3LAP A;  1L0O C;  4IJA A;  3LFK A;  2OQG A;  3RDI A;  1SMT A;  4A0Y A;  1BC7 C;  1SD5 A;  2CQK A;  3FZV A;  4EQQ A;  4G94 A;  1PUE E;  4N9I A;  4FX0 A;  4M9Z A;  3WU0 A;  3TDZ C;  3E5X A;  1KYW A;  3JTG A;  1AOY A;  4ZZL A;  2Z3Y A;  2VC0 A;  4HLX A;  1MJ9 A;  3HOS A;  5L3E A;  2Q8K A;  5HLH A;  1KU3 A;  3K1M A;  3ZMD A;  5FLX Z;  3K1N A;  3MZH A;  3CUO A;  4U0V A;  4L9N A;  3GF2 A;  4LK0 F;  1O57 A;  2G7U A;  4WK8 F;  1CF7 B;  4QWQ A;  2CG4 A;  1B9N A;  1E17 A;  4EV0 A;  4OMY A;  3RYR A;  3VFZ A;  5HS8 A;  1HQC A;  5D8K B;  2EFW A;  3DXJ F;  3FM5 A;  3HHG A;  3IWF A;  1BI2 A;  2W57 A;  1T0F A;  4Y13 A;  2FRH A;  1SFU A;  1CGP A;  5IT9 K;  3HYI A;  1FPQ A;  4I0A A;  4G6Q A;  4LLL A;  5AON A;  4RGS A;  3H3U A;  1ON2 A;  3GFI A;  1BIA A;  1C0W A;  1TTY A;  2GA2 A;  3P9C A;  5L3G A;  1IXC A;  2MD5 A;  2OAZ A;  3BRO A;  2G7H A;  1T2K A;  3BY6 A;  1O3S A;  2ZME B;  3FMR A;  2HQR A;  2QUF A;  5BMZ A;  5LGT A;  5E8G A;  1R1T A;  4I7H A;  3V4G A;  3BP8 A;  1UCR A;  1KA8 A;  3HRS A;  1IRF A;  1DPR A;  4M71 A;  1FOK A;  1NHA A;  1TW2 A;  4HV5 A;  5BS6 A;  4L9V A;  2HTJ A;  2QYO A;  1KU2 A;  4KIG A;  1K78 A;  3ERE D;  5KK1 A;  4N0B A;  4OMZ A;  3R60 A;  4CHU A;  4KIF A;  3M8E A;  2HWV A;  3EYI A;  5HDN A;  3P9K A;  1YLF A;  4LG0 A;  4O3M A;  1IN7 A;  4BHP A;  3IRR A;  1LVA A;  2R7D A;  1TBX A;  1JXS A;  1IF1 A;  5CVI A;  4P9U A;  1QZZ A;  1IUY A;  3O3K A;  3G3Z A;  2GQQ A;  4YIF A;  2IPQ X;  2YU3 A;  4R79 A;  1ZAO A;  1E2X A;  3F72 A;  4MQ9 F;  1YYV A;  5TJJ A;  4OU0 A;  1Z6T A;  2GXG A;  1ODD A;  3D0S A;  3E5U A;  1HKS A;  1EV7 A;  2KJB A;  2P5L C;  4UVC A;  4M6Y A;  4IHS A;  4ETS A;  4N9H A;  4MGR A;  3Q5F A;  2LNB A;  2X4H A;  4HX7 A;  5ILS A;  2HYG D;  4IPA A;  3JTH A;  5LRS A;  2P6S A;  2F5F A;  2V79 A;  1GXP A;  2H27 A;  2DT5 A;  2YPR A;  3CDH A;  5D4S A;  2NS0 A;  4LGW A;  3ZMU A;  2AXL A;  4ASN A;  2VC1 A;  1FYL A;  3ML6 A;  4U88 A;  2A69 F;  3EYY A;  5DCM A;  4EJV A;  2DTR A;  4EGY A;  1Z7U A;  3C3W A;  3O2P E;  2XHK A;  1USS A;  2CSO A;  1ULY A;  4HQM A;  4Q5S F;  2V1D A;  4ZYD A;  2EV6 A;  5D8L B;  4L5I A;  1IN6 A;  3K69 A;  4OIO F;  1S3J A;  4NQW A;  3ABT A;  3I54 A;  2QEN A;  2YR2 A;  2HTS A;  2PJP A;  3CO7 C;  2RNJ A;  2COM A;  4MQV A;  4U7D A;  2B0L A;  2WC2 A;  3PQJ A;  5DD8 A;  1O7F A;  2C6Y A;  3RJP A;  5LLQ A;  3NQO A;  1IN5 A;  4GXO A;  2VT3 A;  2P7V B;  1Z05 A;  4WF2 A;  4HX8 A;  4EVI A;  3BWG A;  5DCF A;  1BBY A;  2NNY A;  1F4K A;  3FHZ A;  3TO7 A;  5EEH A;  1YO5 C;  5DDG A;  1MZB A;  1R00 A;  1R1V A;  2O61 A;  2HOE A;  2O8X A;  2O3F A;  3F8B A;  3I5U A;  3KLN A;  2PN6 A;  4A6E A;  4ON0 A;  4WXH A;  5ICC A;  2R7F A;  4EJO A;  2V1U A;  3FF5 A;  2XAQ A;  3GVA A;  4IXA A;  2F5D A;  4Z2Y A;  2JPC A;  3CUQ C;  3SQN A;  4CIC A;  1YS7 A;  4TV7 A;  2FBH A;  1J5Y A;  3GFL A;  3RPU A;  5DV5 A;  3SZP A;  5H6Q A;  2WWY A;  1YIO A;  3F3X A;  3J80 K;  2ZNZ A;  5LHH A;  3P9I A;  2STW A;  3B02 A;  2YX7 A;  4HW0 A;  2VBZ A;  2A6H F;  1RIO H;  3KFW X;  4CXF A;  2DPD A;  4CDG A;  3MQ0 A;  2LSO A;  2Z99 A;  2DPU A;  4JQF A;  1TNT A;  5ICF A;  1TQM A;  2L54 A;  1TQP A;  2VXZ A;  3KZY A;  3VOE A;  3MCZ A;  1HW5 A;  4RGU A;  1FSE A;  3O6B B;  3LQR A;  1FWZ A;  3LQQ A;  4RAZ A;  2PMU A;  1WSU A;  5D5W B;  3DEU A;  3VEP A;  2L4M A;  3ECO A;  4HZF A;  5DUI A;  2DFI A;  3L7W A;  1SFE A;  5DD4 A;  4BNC A;  1XD7 A;  3F8C A;  1U8R A;  3L9F A;  2ISZ A;  2P4W A;  1HKQ A;  2STT A;  3M7G A;  2XIG A;  4ESF A;  4HQE A;  2EFQ A;  2VN2 A;  3DPL C;  4YII A;  3IWZ A;  2CO5 A;  3I58 A;  3JSP A;  5K1Y A;  3L09 A;  1T39 A;  2M45 A;  2L4A A;  4I2O A;  3GLX A;  1R22 A;  4MTE A;  3EET A;  2VON A;  2BBY A;  3LA2 A;  5LHG A;  4G7O F;  2LKP A;  4RS8 A;  3I59 A;  4XBF A;  3WTS C;  3GWZ A;  1JHF A;  1KU7 A;  5DUK A;  2MLK A;  2K86 A;  4FT8 A;  2NRA C;  2XRO A;  3F8M A;  1ZG1 A;  1KQ0 A;  2VT2 A;  2FA5 A;  1HBX G;  1PP7 U;  3HRM A;  2QVO A;  4L18 B;  3KEQ A;  4KFC A;  2FU4 A;  2XAH A;  1BN5 A;  4AWX B;  4KN7 X;  1XMK A;  2WV0 A;  3SZT A;  1ON1 A;  1Z6R A;  4ZYH A;  2OZU A;  4ESJ A;  4A0Z A;  2ZO4 A;  5LGN A;  1X3U A;  1S7O A;  3BPV A;  5LHI A;  2P8T A;  1FBS A;  1VTN C;  4BHB A;  4ENM A;  1T38 A;  2GXB A;  4HYE A;  4BHC A;  2FEZ A;  3KE2 A;  1QQI A;  3D5L A;  4FX4 A;  3IHU A;  2RQP A;  1FP1 D;  5D5V B;  4M74 A;  5E8I A;  4Q47 A;  1W5T A;  4YG2 F;  2A3S A;  5A2Q K;  5BOX A;  5AIP A;  2X0L A;  5ICG A;  5FLX K;  2E7W A;  2KIF A;  2A6E F;  3ZMT A;  5BPD A;  5HS7 A;  1HST A;  4YFX F;  3C1D A;  4M73 A;  3CO6 C;  2MH9 A;  2OU2 A;  1LEB A;  3V7C A;  4UUV A;  4UV8 A;  4RB0 A;  4HF0 A;  4HDV A;  1KU9 A;  4ENK A;  1DPU A;  1T98 A;  4Y17 A;  3GEZ A;  1GHC A;  1W5S A;  2HYF A;  1R58 A;  5K5R A;  4IVN A;  3OV8 A;  2ZKZ A;  2LDU A;  1J75 A;  2Q0O A;  2GAU A;  4OIR F;  2XGX A;  4BYY A;  2BYV E;  4P96 A;  3RKY A;  1Z9C A;  4ZH4 F;  3WTY C;  3R0A A;  1YS6 A;  1U5T C;  4HBL A;  3KZZ A;  1OYY A;  3KLO A;  3BDD A;  3C18 A;  3IL2 A;  4ENJ A;  1FNN A;  3MFK A;  1WQ2 A;  4E70 A;  2JPB A;  3FXU A;  4L9J A;  2QZ8 A;  1RI7 A;  5HOO A;  4GYG A;  1YW9 A;  1XGM A;  2W84 A;  2CYY A;  3WTX C;  2ZFW A;  5CJ9 A;  2A5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...