1HBXG

Ternary complex of sap-1 and srf with specific sre dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
155
structure length
112
Chain Sequence
DSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMSRNDYIHSGLYSSFTLNSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERUM RESPONSE FACTOR
publication title The B-Box Dominates Sap-1/Srf Interactions in the Structure of the Ternary Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 20
structure length 112
sequence length 155
chains with identical sequence H
ec nomenclature
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1hbxG00
3ABUA 1KU7A 2W57A 4FT8A 4HV5A 3I58A 1UHWA 2PN6A 4ESFA 4G9YA 4L18B 3BPXA 3LQQA 3O2PE 2XVCA 3HUGA 3C1DA 3ZMDA 1GXPA 1LNWA 2H6BA 5FFZA 3FM3A 1IXRC 2HWVA 2F5FA 3HSEA 4IRIA 3I5UA 2CSOA 2O0YA 4I02A 3W6JB 2MA3A 3K1NA 3IRQA 3CO7C 4XRFA 3ZMSA 2M5WA 3U1DA 2E7XA 3HYIA 3I71A 2HTJA 2NRAC 2FMYA 1H0MA 3IHUA 5F1RA 2GIVA 2KIUA 3J81K 4AD9A 3B73A 3GZ6A 1USSA 3HRUA 4EJUA 4ZYGA 2M1BA 1BC7C 3P7NA 3WODF 4I7HA 1EH6A 1R1UA 2GZWA 2L4AA 2QM3A 1OYWA 2DAOA 1ZGJA 4AWXB 3KCCA 2PMHA 4LGWA 4Q5SF 2BE5F 3R60A 2IRFG 3BY6A 1HSJA 1SAXA 3F8MA 1TTYA 2HQRA 1HBXG 4P9UA 2STTA 2DT5A 3GXOA 5HOOA 1LB2A 2QVOA 3JAMZ 3ELKA 1XGSA 2A3SA 5JHUA 1E2XA 2RV8A 3L9FA 1R5HA 1WWXA 2A61A 1YW8A 5L3BA 2EB7A 1O3QA 1MDMB 4AIJA 1T98A 1GHCA 4DNCA 2QQ9A 2EV5A 5LGNA 1OPCA 4HDUA 2W84A 2XAFA 1STZA 3FWEA 1EV7A 4RAZA 3J80K 5H6RA 2XHKA 4HLYA 2X4HA 1QPMA 1XDSA 5F64A 4ZYHA 3P9IA 1I1SA 2UXXA 1BOAA 1QBJA 4L9TA 2ZO4A 3T5XA 3RKWA 2P6TA 1ZG5A 4M72A 2EV6A 2EFNA 1RNLA 3HTSB 5FGMA 2R7DA 2PFBA 1L0OC 2GA1A 2NNNA 4UVCA 2ZFWA 3ZMTA 3DQVC 1MKMA 3RKXA 3S2WA 2D45A 1B4AA 2H6CA 2EA2A 4BHBA 4KMFA 2PJPA 4U0YA 2WV0A 2L3DA 4MHGA 4XBFA 2Z9OA 1ZLKA 5K5OA 3T0YA 5E1XA 1Z9CA 3QU6A 4MQVA 4GCVA 5DUKA 2L4MA 3M1EA 2XGXA 3DEUA 1BIAA 5CLSA 1WQ2A 3K9TA 3TO6A 1FYLA 4RB1A 3RYRA 4A0XA 5D8LB 2YR2A 2FA5A 3WTYC 2DBBA 2AXLA 1LDJA 2IVMA 3GVAA 4N9IA 1PP8F 3WG9A 1GXQA 1PP7U 3D5LA 1LEAA 1BBYA 2DLLA 4ETSA 1KYZA 4GXOA 2LKPA 4RGSA 1I1GA 1FY7A 1IZ1A 1FSEA 4WCGA 2VE8A 2W85A 1BI1A 2PBIA 2O3FA 4LLGF 5DCFA 2IP2A 2XASA 1JXSA 4G94A 4ENKA 3ZN1A 3LAJA 3DFGA 4LG0A 2EFOA 1QQIA 2G7UA 3WTWC 4LLLA 1B59A 3F23A 3QP6A 3RDIA 3L2CA 5HS8A 3I54A 1HXDA 2LF7A 4NQWA 1CF7B 5HVQC 4WX9A 2YSRA 3CUOA 1UB9A 1ZRCA 1G3TA 4P5OA 3GYHX 1R23A 2ZCWA 3OV8A 2P5LC 2EFPA 4AIKA 4FHTA 4HA8A 2ZXJA 2O6GE 1HKQA 4Y13A 4PDKA 3FMSA 4A0ZA 2OQGA 4LMYA 2DPDA 1TQPA 1SMTA 1FYMA 4HQEA 4JBAA 2QBYB 4G7HF 1XSDA 4CHUA 3PFIA 4LD5A 3MEXA 3F8CA 1XSXA 5K5QA 2PLYA 5DYMA 2FMLA 1L3LA 3GF2A 2BBYA 5IT9Z 4K2EA 1UFMA 3ZPLA 4L9JA 3KP5A 4HF1A 5FFXA 3E6DA 1HKSA 4Y15A 3GZ5A 4G6DA 2JSCA 1BIBA 1J7KA 2HKXA 2V1XA 1FPQA 2LSOA 1TNSA 1BI0A 1T39A 4I09A 3F3XA 1S3JA 3DXJF 1FBSA 4ENJA 4NHJA 4WK8F 3P9CA 1J75A 4OIQF 4L0ZB 1G6NA 1D8KA 1G4DA 1K7AA 2P7CB 3E5QA 1CGPA 3CTAA 2FXAA 3ABTA 4DQ2A 4M9XA 3CDHA 3F8FA 1Q1HA 5LRSA 3FMRA 2P5KA 1C0WA 2ZMEB 3L00A 3PQJA 1UCRA 3SQNA 2NAZA 4Z2YA 5CVVA 3Q9VA 2Y75A 1KU2A 3FXRA 5JR3A 1QO0D 1G3WA 1ZH5A 4L0YB 2D2WA 4Q48A 3F22A 1SD6A 1OYYA 3ZMZA 2VT3A 1MD0A 3F8BA 3MZHA 4IPAA 1P2FA 3VODA 3EUHA 1KU9A 3WU0A 3WTZA 1R00A 2HQNA 5BPDA 3TOAA 3C18A 3LAPA 3AAFA 2HR3A 2OBPA 1Z7UA 2FF4A 1W5TA 3BROA 3DPLC 3KLNA 1W5SA 4R8HA 2JZYA 3EYYA 2HTSA 4OU0A 2IA1A 1BI3A 3IRRA 5FLXK 3LFKA 1I27A 1HW5A 4LB6B 1P6RA 3I4PA 3E6BA 3KEQA 5DV5A 1LQ1A 4EM0B 1WKMA 3R0AA 4P96A 3RPQA 2WWYA 5K1YA 4FX4A 2V1UA 1K78A 1YFHA 2IT0A 2PEXA 1ZRFA 2XAGA 5LBQA 5HS9A 5AIQA 2LF8A 2Z99A 3W6KB 1OYIA 4I01A 2RN7A 3FF5A 4MEXF 3QU3A 4EGYA 4KIBA 1IW7F 2FBHA 1O3SA 3WE3A 2RDPA 1XGNA 2OZUA 1JHHA 1U2WA 3T8RA 2H94A 2XIGA 1FP1D 3E5UA 1S7AA 1HQCA 2M45A 2YU3A 5CVJA 4JK1X 4Q4ZF 1Y0UA 2RGVA 1BM9A 5LGUA 3HRSA 1FNNA 4ZYEA 2A6EF 2BEOA 5EEHA 2E1NA 2R3SA 5DDGA 5J6XA 3HOSA 2YX4A 1FSHA 5DD8A 3SZPA 2Q2EA 2PQ8A 5H20A 4LK1F 2O8XA 1F4KA 2STWA 3O3KA 2FRHA 3TDZC 4HX7A 1MGTA 1R7JA 1W4MA 2UWMA 1YYVA 2CYYA 5TJJA 4IHSA 2CWEA 4ZZDA 5L3CA 3I0TA 3HSRA 2FBIA 2XKPA 1JHFA 1KQ9A 2QQBA 4QLCU 2ZBKA 1KYWA 1OKRA 4A12A 1IXCA 1LDDA 1YTYA 2VXZA 1ON2A 3V8KA 3K1PA 5D6EA 3PQKA 5JFRA 4ZH4F 1F9NA 1J5YA 3VOEA 3GWZA 1QNTA 5CVRA 2IW5A 2KIMA 1O57A 2K27A 4H0EA 2IA0A 3GW2A 4EV0A 2DO7A 4KN7X 5E8IA 1YG2A 2MD5A 1W7PA 1R1TA 2A69F 4G7OF 4ENMA 2NYXA 4EJVA 5LEJA 4CYDA 3ROUA 4G8XA 4ESBA 4IVNA 3P9KA 4HX4A 3EETA 3CUQA 4UVAA 1LEBA 1IN6A 1LVAA 1U3EM 3EYIA 4IRGA 5CVIA 2TDXA 4I98B 4RGXA 3TOBA 4NB5A 4RS8A 3DV8A 1KQ0A 2OAZA 3I59B 2FSWA 3GLXA 3MFKA 1AWCA 1MJ9A 3V4GA 2P6SA 3N4MA 2ADUA 3CUQC 5HLIA 1J9IA 1LDKB 4YFKF 5LHIA 1XB4A 3LA2A 1B1BA 2ESNA 2L02A 2PI0A 5ICCA 2GXBA 5ILSA 2ELHA 4KYWA 1G3YA 1ONVA 1YO5C 3KP6A 5J8FA 4KT5C 2ZKZA 2EWNA 2OZ6A 3LA3A 2UXNA 3TQNA 2O61A 2FU4A 3WTSC 4AVPA 4EGZA 4UVBA 2Q8KA 3GUDA 4OIRF 3KE2A 5AIPA 3O6BB 3M8EA 3C3WA 1TNTA 3BJOA 3SXYA 1XD7A 5HDKA 1SMYF 3H92A 1DUXC 1U6GA 5CJ9A 1XMAA 1KA8A 1YS7A 5LHGA 2VBXA 3BDDA 4KIFA 2MLKA 4OMYA 3GX4X 4MEYF 1QZYA 3WGIA 5E18F 1RZ4A 4G6QA 3WTXC 2J5PA 2H27A 1T0FA 3MQ0A 2KIFA 2L54A 1F1ZA 1S6LA 3WGGA 2H09A 3EQLF 4HLXA 5ILVA 2FBKA 3E97A 1FT9A 2FNAA 1I6XA 3BZ6A 1O7FA 2L01A 4TV7A 3E5XA 3RPUA 3R4KA 5JVTA 1JE8A 5ED4A 5A2QZ 2EFWA 4CICA 3Q9SA 1TW3A 3G3ZA 5DCMB 4M73A 1DPRA 4ASNA 3M9AA 5FB2A 5IT3A 1J59A 4ENNA 1MDMA 2G9WA 4HW0A 2BGCA 1IF1A 1GVJA 5D5WB 1XCVA 2MH9A 4WWCA 3JAMK 4G7ZF 4BH9A 4KMUX 4ESJA 2F2EA 1EH8A 1ZREA 1OR7A 3SFZA 2D1VA 3TGNA 2XAHA 3Q5FA 2VBYA 3FZVA 4IXAA 4R79A 3RKYA 4CO8A 4HX8A 2XAJA 2XROA 4KIGA 4F7ZA 3WU1B 2E7WA 1U5TB 3IWZA 1ZAOA 4YFNF 2JRTA 2QUFA 5K5RA 3KETA 1XSVA 4M71A 3G73A 2JTVA 2DPUA 3CLOA 1U78A 1FBUA 1OMIA 2VN2A 3IWFA 4KDPA 2CG4A 1ZRDA 2XKOA 2ZNYA 4KNYA 5D5VB 4HDVA 4A2UA 3V7CA 3FHZA 1B9NA 3RJPA 3RIRA 2GAUA 2V79A 5HS7A 1B6AA 2F5EA 3NQOA 5LGTA 2DK8A 2CO5A 2OU2A 4A0YA 2M8EA 4UUVA 3KZYA 4D0PA 2ESHA 2XV4S 1WRJA 2Q0OA 3M7GA 1DDNA 4UHTA 1DP7P 1FC3A 3RYPA 3J81Z 4WXHA 4CDGA 2FOKA 1ZN2A 2K4BA 1D8JA 2HYFA 3ML6A 3FM5A 2EV0A 1PUEE 5D8KB 1FZPB 1S8NA 4P55A 3JTGA 4R1HA 2BYVE 1ZLJA 3TDUC 3IL2A 4CXFA 3K1MA 4L5JA 5E1ZB 3SHFA 2P4WA 2VC1A 2XAQA 2HOEA 3F6VA 4MGRA 1LJ9A 2YX7A 3H3ZA 1S29A 2JT1A 5DEQA 3U2RA 3GFIA 3F21A 2QLZA 2P7VB 4WXCA 1SD7A 1XMKA 3V7RA 1CF7A 2KJBA 3M8FA 2K4JA 4OIOF 1IRFA 2XUBA 2K7LA 3WGHA 4KA4A 1ULYA 1VTNC 4U7DA 2D1HA 3REOA 1W7PD 3L09A 5H6QA 1RUOA 1NHAA 3CJNA 2OQRA 1FYKA 3ULQB 2QBYA 1R1VA 4RB2C 1J2XA 3FXQA 3BWGA 2EJRA 3J80Z 3RI4A 3ECHA 4IF4A 4HYEA 1XN7A 1XCBA 1K79A 3HIFA 1A04A 3LQRA 4HBLA 2Y0MA 5E20A 1SFXA 3KLOA 4M9ZA 3R61A 4XSXF 4BHPA 4CZZA 4M6YA 1JGSA 2XRNA 2J5OA 3FMQA 3GEZA 1D5VA 5IT9K 2GQQA 4WXDA 1TBXA 4OMZA 2EFQA 1T2KA 3T8TA 1R5GA 1G3SA 3WTUC 4XLPF 1YQAA 1SD4A 1P4XA 1HSTA 1ON1A 3KZZA 4OINF 3C7JA 5E8GA 2P5VA 5DD4A 1ZG1A 2F5DA 2FNPA 4OIPF 2FEZA 3R0JA 5ERIA 3QRFF 4OOIA 1SFEA 2OD5A 5BS6A 2ZMEA 1XGOA 3KEOA 4HV6A 4YG2F 4IJAA 3I53A 2A68F 4P9FA 2DQRA 3F72A 2DU9A 5FD5A 5LRRA 4I0BA 4MQ9F 3E6MA 4L9NA 4GO1A 4U0VA 1YW7A 1I5ZA 2NNYA 2K86A 4A5NA 1P4WA 3K69A 2VBZA 1FWZA 5HDGA 3LSTA 4EQQA 5E1WA 2DI3A 2KJCA 4WF2A 4XLNF 2V9VA 1MJAA 1REPC 3VB2A 1YW9A 2HZTA 1RUNA 1ZYRF 3RTRA 3ZMVA 1HKTA 2M87A 1SFUA 2IA2A 4RAYA 4A5MA 4PZJA 4BNCA 4O6JA 3COAC 4LG0B 3B02A 1ZG3A 2RNJA 3HHHA 2G7HA 4YFXF 4LLNA 1YS6A 2V1DA 4KUMA 1BI2A 2QZ8A 1RIOH 4EMSA 1ZHFA 3FXUA 1P92A 3J7AO 3BPVA 3QOPA 1ZARA 3D0SA 3E3VA 2ZNZA 3QPTA 4Y17A 4I2OA 2HKOA 5L3GA 4I0AA 4Q47A 1TLHB 3T1BA 4O5VA 2HDCA 4L5IA 2JPCA 3ZQ7A 3MCZA 1Z05A 1IN4A 2VOOA 2DFIA 3QAHA 2FE3A 4EJOA 1P4AA 1BC8C 3ZP5A 3V8LA 4B8XA 2HYGD 1UHMA 4KFCA 2COMA 5CYVA 1ODDA 5EEGA 1O3TA 1FP2A 3GFLA 4KN4X 4HAMA 3V8JA 1TQIA 6PAXA 2O03A 3F6OA 4GYGA 2X0LA 3ERED 4LJZF 4EM1A 2MBFA 1T38A 2IPQX 5JI6A 4YIFA 3N97A 2WC2A 5LHHA 1O7LA 2AS5F 2QENA 4HF0A 5LLQA 2Y48A 1TQMA 4RGUA 2A6HF 3NRVA 5L3EA 3L7WA 2DK5A 5HLGA 2KKOA 4RB0A 2HEOA 1R58A 5BMZA 5F6FA 1D3YA 2BV6A 4IRHA 4N0BA 5D4SA 2ISYA 4N9HA 4O3MA 5HLHA 5D5UB 1Z1DA 2EK5A 4GGGA 1FX7A 3KFWX 4UXNA 1KU3A 1J0RA 1TW2A 4LFUA 5ICGA 4UNOA 3HRTA 5ICFA 2QQAA 5BQTA 1DPUA 1KGSA 3DKWA 1AOYA 2CFXA 4HQMA 1V3FA 3K0LA 5L3FA 1RI7A 2GA2A 3F8NA 2ACJA 5FLXZ 3GFMA 1WSUA 4LK0F 1KQ8A 1WI9A 2NS0A 3BP8A 2Z3YA 1MZBA 4CGZA 2GWRA 3MZYA 3IKTA 4PCQA 2CW0F 3HHGA 3JSPA 1IN5A 2LNBA 3I59A 3WE2A 4ZZLA 2M30A 2UZKA 3DP7A 5AONA 2B0LA 1FBQA 5D4RA 3MAJA 2IJLA 1Z6RA 4ON0A 4HF2A 5D6FA 4JQFA 4BAYA 5HDNA 1B9MA 2QWWA 2RQPA 5FD6A 5DUIA 3HRMA 4BHCA 1K78B 4B09A 1XDUA 4UV9A 4EJWA 3FX3A 4MNUA 2V6CA 3GFJA 4PGHA 3U9GA 3ISPA 1IXSB 2ETHA 2R7FA 2K02A 3TO7A 3DPTA 2VBWA 1IN8A 3JTHA 3TO9A 4PGGA 1H9TA 1EH7A 1E17A 5CVUA 1Z91A 5J8CA 5BPIA 3OOPA 3I64A 3CO6C 1H9GA 3KP2A 4M6XA 4QWQA 4U0WA 1IRGA 3BJ6A 2KRFA 1PDNC 5KK1A 2HFHA 1R36A 1ZGAA 5FO5A 1QZZA 2Z33A 1X3UA 2DTRA 3HOTA 4GYIA 1QGPA 1T6SA 2YPRA 2DQLA 1K6OA 4EM2A 4L9VA 4ZYDA 2W24A 2FQ3A 2VODA 1F5TA 4E70A 2QYOA 2CGPA 2JPBA 1SD5A 1FOKA 3ZN0A 3K2ZA 4EJTA 2OA4A 1S7OA 1YLFA 2VC0A 2ISZA 5TRDA 3KP4A 3EDPA 3NEUA 2VOPA 1HW2A 2A07F 2LDUA 2RC4A 3LWFA 3IC7A 2CQKA 5L3DA 5DCMA 4XSZF 3H3UA 3KP7A 2VT2A 4AIHA 4IHTA 4HOBA 1BN5A 4M74A 3MWMA 2DW4A 4U7BA 3JW4A 2ZJ2A 1R22A 5A2QK 3R6SA 2PMUA 4KICA 1IAWA 2HGCA 4RB3C 3GO5A 2GXGA 4FX0A 3TKYA 2A5YB 3IKVA 4A6DA 1W7PB 2VE9A 1V4RA 3QP5A 3V7SA 2WTEA 4BXUA 2MC3A 3DF8A 3LA7A 4U88A 4BQAA 1XGMA 4MTEA 1IUYA 3VEPA 3WTTC 3BJAA 1U5TA 2PG4A 3E6CC 3CUQB 2RVCA 3HTUA 5LEKA 1FLIA 4HZFA 4BYYA 3SZTA 2C6YA 2MLGA 2VONA 3KP3A 2E1CA 2HS5A 3HSFA 3QPHA 4S04A 1YIOA 1HW1A 4MTDA 4LB5A 1MJBA 1Z6TA 3ECOA 3WTVC 1USTA 3BOQA 2EA4A 5ILUA 5ICEA 5D5XB 2MH2A 2W25A 3ZMUA 4YIIA 5E17F 1O3RA 2Z5UA 4S05A 1U8RA 5KVRA 4M9SA 1U5TC 3JSOA 5BOXA 4UV8A 2P8TA 4EVIA 1BJAA 2RKHA 4A6EA 1IN7A 4RGRA 3VFZA 2F5CA
chains in the Genus database with same CATH superfamily
2B9SA 3ABUA 1ETWA 2K9SA 4QIWN 1KU7A 2W57A 4FT8A 2QF7A 4HV5A 3VWBA 2RREA 3I58A 1WJFA 2HNHA 1UHWA 1A35A 3W3CA 2LR8A 2PN6A 4ESFA 4G9YA 5IPAA 5C4JJ 3BPXA 3LQQA 4L18B 3O2PE 1JUPA 2XVCA 4BBSJ 3HUGA 3C1DA 3BZCA 1FTZA 4ZYAA 4F3QA 3ZMDA 1GXPA 1JKQC 1LNWA 2H6BA 5FFZA 2LOOA 4XNFA 2OCEA 3H9JA 1D5YA 4M3BA 3FM3A 1IXRC 2HWVA 2F5FA 3HSEA 1ETOA 1ZK8A 1NH3A 4IRIA 2DMUA 5GAEJ 3DCFA 1XS9A 1GV5A 3I5UA 5FKLA 2CSOA 2O0YA 3JRHA 3HDDA 1Y1WJ 5E79C 4I02A 3W6JB 2MA3A 3K1NA 3IRQA 3CO7C 2RNGA 1X1PA 3BC8A 4XRFA 3ZMSA 2XSDC 2M5WA 2WA0A 3H9QA 4XRMA 3U1DA 2E7XA 3HYIA 3I71A 4HEA2 2HTJA 2LRDA 2R7TA 2NRAC 2FMYA 1OLTA 1H0MA 3IHUA 4HSRA 5F1RA 3H5NA 4XK4A 1ZQ3P 2GIVA 2KIUA 3J81K 4AD9A 1K6YA 3B73A 3KYLA 3GZ6A 2Y0SN 2DMQA 1USSA 3IUOA 3TW7A 3HRUA 4EJUA 1JTYA 4ZYGA 4A3BJ 3AG3H 2M1BA 3H1CA 1RR8C 3PIPF 1BC7C 4RLQA 3P7NA 1TWGJ 3SZGA 3WODF 2M4KA 4XRSG 4I7HA 2X9DA 2PMZN 1EH6A 2Q1ZB 1R1UA 3RCOA 2GZWA 2XF7A 2L4AA 4LIVA 2QM3A 1OYWA 3L2UA 2DAOA 1ZGJA 2XPWA 2R7XA 4AWXB 4S0HB 2M7BA 3KCCA 2PMHA 3AG4H 3QPSA 4LGWA 5FROA 1Y39A 4Q5SF 2BE5F 3ESWB 1VQ7I 2V1NA 4LITA 3R60A 3ZQIA 2JWTA 1E3PA 2IRFG 1ZTRA 2VIXA 3DKXA 4FTHA 1B72A 2CRGA 3BY6A 2DA4A 1HSJA 1SAXA 3FKJA 2KL4A 2UV1A 4F55A 1W36D 1HDDC 3F8MA 3GTOJ 4UUSB 1TTYA 2DOFA 2HQRA 2DFHA 2M0MA 5E3OA 4P9UA 1HBXG 3JRDA 4BXXJ 2STTA 3GBGA 2DT5A 4XIDA 3GXOA 3W2WA 2X1DA 5HOOA 3V42A 1LB2A 3BCBA 4E6KG 2QVOA 4DZPA 4MLOA 1ORKA 3JAMZ 4XMYA 2JK3A 2DJNA 3ELKA 2R93J 1XGSA 2A3SA 1RESA 5JHUA 1E2XA 2RV8A 3L9FA 4Y52J 1R5HA 1WWXA 2FX0A 2A61A 1YW8A 5L3BA 4BEHA 3QOEA 4IEJA 2EB7A 2KFDA 1O3QA 1GUUA 1TWAJ 1MDMB 4AIJA 1T98A 1GHCA 4DNCA 3DLLF 2QQ9A 2EV5A 5LGNA 1R9TJ 4ITVA 4AM3A 1OPCA 4HDUA 4V2FA 1MMAA 3FXKA 2W84A 3I56I 3QQAA 2NVXJ 2XAFA 1MMGA 1STZA 2VQHA 3FWEA 1JKPC 3FK7A 1EV7A 4RAZA 1ETQA 2VASA 2HDWA 5GADJ 3J80K 3H0DA 1LFUP 3G2BA 3M07A 2M2EA 1SFKA 2H1KA 1T95A 5H6RA 3A0BC 3ABMH 4FCYA 2XHKA 2Y0SA 4HLYA 2X4HA 1QPMA 1XDSA 5F64A 2XPUA 4ZYHA 3DTKA 3P9IA 1I1SA 2OCCH 2UXXA 2R5YA 1TC3C 1BOAA 2CS3A 1R5ID 1QHHD 1QBJA 4L9TA 1IJWC 3U1KA 3BTCA 2O7OA 1N75A 3LL7A 1WJAA 2ZO4A 2M34A 4G12A 5GAHJ 3T5XA 1JT6A 3RKWA 2P6TA 3S1NJ 5FJ8J 1ZG5A 4M72A 5KNLA 2OUMA 2EV6A 2EFNA 4E7ZA 1RNLA 3A03A 1H88C 4YEJA 5FGMA 3HTSB 2R4GA 2R7DA 2PFBA 1L0OC 2GA1A 2NNNA 2QSGX 4PJNA 1JJ8C 4UVCA 2GOMA 4DBQA 5M3MJ 2ZFWA 1HC8A 2L9VA 4JX6A 4PJMA 3ZMTA 2R0QC 3DQVC 1MKMA 3RKXA 3S2WA 2D45A 1B4AA 2H6CA 2EA2A 4BHBA 4KMFA 1ETKA 2PJPA 4U0YA 2WV0A 2DA5A 2L3DA 4MHGA 4XBFA 2Z9OA 2DFEA 1ZLKA 5K5OA 3T0YA 2DDBA 2HXIA 5E1XA 1Z9CA 1RPWA 3QU6A 3MKLA 4MQVA 2EZKA 4GCVA 5DUKA 2L4MA 3IP4B 5J1YA 3M1EA 2N8GA 2XGXA 3IH4A 3E7LA 5KAFC 3DEUA 1BIAA 5CLSA 1WQ2A 3TP0A 4FISA 4BU2A 1OQYA 3K9TA 3O8HA 3TO6A 1FYLA 4RB1A 3AKZA 3HC7A 1GV2A 3RYRA 4XLEA 4A0XA 1MMSA 3QYBA 2MYSA 5D8LB 2YR2A 2FA5A 2Y9YA 3JRBA 2W4SA 2W00A 3WTYC 5EGOB 2DBBA 1ETVA 1MNDA 1JT0A 2AXLA 1LDJA 2IVMA 2H8WA 2V4JC 3GVAA 3PUBA 4N9IA 1PP8F 3WG9A 1W5CC 3CF2A 1GXQA 1PP7U 3D5LA 3U21A 1LEAA 3KYCB 4BL0B 1BBYA 4HNVA 1HLVA 1APLC 2DLLA 2KT0A 4ETSA 3I4NJ 1KYZA 4GXOA 2LKPA 5F0CA 3W2AA 4RGSA 3HOUJ 3OYCA 1I1GA 1FY7A 1IZ1A 2YUSA 1FSEA 4WCGA 1R71A 2VE8A 2W85A 4C30A 1BI1A 2PBIA 1ZGWA 2O3FA 4LLGF 5DCFA 4B47A 2IP2A 2XASA 1JXSA 4G94A 2V7FA 2ZXWH 1Z3YA 4ENKA 3ZN1A 2XAUA 3LAJA 3DFGA 2VL8A 2AHQA 4LG0A 2L7ZA 2EFOA 5F08A 5EDNA 3K4JA 1QQIA 2G7UA 1WI3A 2X6OA 3CMMA 3PNYA 2E35A 4BQOA 1I3AA 2K9LA 3WTWC 4PJJA 4LLLA 1B59A 4B48A 3F23A 3QP6A 3RDIA 1ETYA 3VDXA 4V19K 1X4OA 3L2CA 5HS8A 3I54A 5F04A 1HXDA 5FRNA 2LF7A 5M5WJ 1VI0A 4NQWA 1CF7B 4CA0A 5HVQC 4WX9A 2YSRA 3B6AA 2COBA 3CUOA 1Y56A 1UB9A 1ZRCA 1G3TA 4P5OA 2CJJA 3SDGA 3BR5A 2UUZA 1RR7A 3OYFA 1FTTA 3GYHX 1R23A 2ZCWA 3OV8A 2P5LC 2QKLB 1J09A 2IS1A 2EFPA 4AIKA 4FHTA 4HA8A 2OTLI 2ZXJA 3S15J 2O6GE 4GFBA 1HKQA 4Y13A 3CZ6A 4PDKA 3CCUI 3FMSA 4A0ZA 2OQGA 4LMYA 3DPUA 2DPDA 1TQPA 1MBKA 2EBIA 1SMTA 5FKMA 1LVKA 2K5CA 4AU7A 1BW5A 5GP9A 3FXLA 1FYMA 5B1AH 4HQEA 4JBAA 3ASOH 3LSIA 2QBYB 4G7HF 1XSDA 4CHUA 3PFIA 4LD5A 3MEXA 1YRNA 3F8CA 1N77A 1XSXA 3N05A 1PVEA 5K5QA 1IUFA 2M7AA 3G1OA 2PLYA 5DYMA 2FMLA 1L3LA 3GF2A 2BBYA 5IT9Z 4K2EA 1OFCX 2CFOA 2DJIA 4CCJA 1UFMA 3ZPLA 5FLMJ 4L9JA 3E1SA 3KP5A 3TBIA 4BJ5C 3PL8A 3GMEA 4HF1A 1VQLI 3KX2A 5FFXA 2KLOA 3E6DA 1TWHJ 1HKSA 2MFZA 4Y15A 3GZ5A 3M1CA 4G6DA 4E4HA 4IKFA 2JSCA 1BL0A 1BIBA 1R4MB 3HG9A 2VKEA 1J7KA 4YRVA 3SEQA 2AQEA 4IQJA 5E3MA 3BCAA 2XPVA 2HKXA 2V1XA 1FPQA 2LSOA 1TNSA 1BI0A 2MC4A 3DKYA 1T39A 1WFXA 2IGNA 4NDLA 4I09A 3F3XA 4PSWA 2LH9A 1S3JA 2DT6A 3DXJF 2QSHX 3BG9A 3B6CA 5DTDA 3BQZA 1FBSA 5IYBJ 4XORA 4ENJA 4NHJA 2LBFB 1WHUA 4WK8F 3OYIA 2M3AA 4NC6A 2E60A 3P9CA 3JR9A 1J75A 4OIQF 5EZGA 4L0ZB 4BDYA 3MKYB 3CDLA 1G6NA 1D8KA 3F0CA 1G4DA 4DBRA 1T33A 1K7AA 4V2GA 2P7CB 3S1QJ 1ZKGA 3E5QA 1U9NA 4AUXA 1CGPA 1F36A 4B4CA 2DA3A 3FXJA 3CTAA 3TEDA 3FK6A 2FXAA 3PNTA 1FOYA 2CH0A 3ABTA 4DQ2A 1V5FA 2Y30A 4M9XA 2KISA 2BW3A 3ZGKA 1H89C 3CDHA 3F8FA 4A93J 3PO3J 1Q1HA 5LRSA 3FMRA 2P5KA 1C0WA 2ZMEB 3L00A 3PQJA 1UCRA 2EIKH 3VYSB 3SQNA 2NAZA 1YJNI 3BG3A 3WG7H 3HXLA 4Z2YA 3S17J 5CVVA 3Q9VA 2Y75A 3M8JA 1BR4A 1KU2A 1G8XA 3FXRA 5JR3A 1QO0D 1G3WA 1ZH5A 4X0GA 1X19A 4L0YB 2ZFUA 2D2WA 3DEWA 4AYBN 4Q48A 3F22A 1SD6A 5IOYA 4A3MJ 1ETXA 1OYYA 3ZMZA 2VT3A 1MD0A 3GTJJ 3F8BA 3MZHA 4IPAA 1P2FA 1SVMA 3VODA 4BUPA 4Y3OA 3HM5A 2CU7A 3EUHA 1KU9A 3WU0A 3WTZA 3OY9A 1R00A 2HQNA 3L2QA 5BPDA 1DGWY 3TOAA 3BG7A 3C18A 3LAPA 3AAFA 1Y1VJ 2HR3A 2JMWA 2OBPA 4NC7A 1Z7UA 2XGDA 3LSRA 1LPQA 2PJRB 2FF4A 1NTCA 1W5TA 3BROA 2KIQA 3DPLC 2GXAA 3KLNA 2ZSHB 1Y8QB 1W5SA 4PFPA 1U8BA 4R8HA 1JGGA 2JZYA 3EYYA 4CSWA 2FD5A 4M3EA 3K6GA 1YJWI 2HTSA 4OU0A 5J4VA 5HLTA 3LMMA 2IA1A 1BI3A 2BXYA 1WZ2A 2OC6A 1V55H 3IRRA 5FLXK 5F0FA 3S2DJ 1QVTA 3LFKA 1DQUA 3WU2C 1I27A 1HW5A 4LB6B 1S5LC 3DTIA 1P6RA 2F4IA 3E6BA 3I4PA 3IV5A 2NS8A 3MN2A 5GAGJ 3KEQA 5DV5A 3EUHC 2BHZA 2BXZA 1LQ1A 4EM0B 1WKMA 3R0AA 4P96A 3RPQA 5H2FC 2WWYA 5K1YA 2K9NA 1D1CA 4F93B 3CCLI 1LE8B 4FX4A 2V1UA 5JLWA 5IY5H 1K78A 2CV1A 1YFHA 3FIWA 2IT0A 1B8IB 1A5JA 2PEXA 3X2QH 1ZRFA 2CV0A 4XKVA 2XAGA 5J1UA 5LBQA 5HS9A 5AIQA 3CCQI 2DMTA 2DTZA 2LF8A 4QTRA 2ZJRF 2VUMJ 2Z99A 3A0HC 3W6KB 2O5RA 3CCVI 1OYIA 4I01A 2W48A 2RN7A 2VJ4A 3OYAA 3FF5A 3H0GJ 3MVPA 1OCCH 4MEXF 3QU3A 4EGYA 3GTMJ 1ZR2A 1X3ZB 4CCNA 1Y6IA 1DU6A 3PNVA 4KIBA 2EIJH 3CDIA 4P1WA 2LC2A 1JUSA 1IW7F 2FBHA 4AYBA 5JHFA 1O3SA 2L7KA 3PSIA 2L7FP 4XLAA 2DCEA 3WE3A 2RDPA 1XGNA 4C3HJ 2P81A 2OZUA 1JHHA 4LIUA 5F1JA 5TGTA 1U2WA 2XSJC 2H94A 2XIGA 3T8RA 1FP1D 1A36A 1GDTA 1W0TA 3D5SC 3E5UA 2GM4A 1S7AA 4RBOA 1HQCA 3HZJA 4ABZA 2M45A 2YU3A 5CVJA 1MH3A 4JK1X 2R7QA 1Y0UA 2RGVA 4Q4ZF 4XM3A 1BM9A 4RMNA 3LSPA 3CC7I 4BXFA 3OOUA 5LGUA 3HRSA 1FNNA 4IOAF 5CKTA 4ZYEA 2A6EF 1T08B 2BEOA 1XC5A 5EEHA 1TWCJ 1OCZH 2E1NA 1K4TA 2R3SA 3HEFA 2X1EA 3OYBA 2JJ7A 1MBFA 5DDGA 2RQQA 1IRXA 2BZTA 2YX4A 5J6XA 3HOSA 2DODA 5DD8A 3BG5A 3SZPA 1FSHA 4DZJA 5J3LA 2Q2EA 2PQ8A 5H20A 3BR2A 1JJ6C 2NVUB 2IEKA 1XX5A 2XC7A 1ERDA 4LK1F 2O8XA 2AXTC 1F4KA 2STWA 3O3KA 2JVHA 2FRHA 3TDZC 5M5XJ 2R92J 4HX7A 1MGTA 1R7JA 3HKZN 1W4MA 2UWMA 1YYVA 2CYYA 5TJJA 2JRMA 4II3A 2CWEA 1MNMC 4IHSA 4ZZDA 3AL0C 2ID3A 5L3CA 3I0TA 3AFHA 5IYCJ 3K70D 1RC9A 3HSRA 1MH4A 2FBIA 2XKPA 2CW8A 1JHFA 1KQ9A 2QQBA 4QLCU 3IH2A 2ZBKA 1KYWA 1OKRA 4A12A 4KJZA 2ME6A 1IXCA 2X6WA 2IAIA 5M3FJ 1LDDA 3DLAA 3LSGA 4XR6A 1YTYA 2VXZA 1ON2A 3V8KA 3K1PA 3OIOA 2R7SA 4KISA 2LK2A 1OCTC 5D6EA 4FETA 4E7JA 3JRCA 3PQKA 4I99C 5EYRA 1Y8RB 2QSFX 5JFRA 4ZH4F 1F9NA 5EG0B 1AKHA 2L7MP 1J5YA 3VOEA 3GWZA 5FRMA 1QNTA 2DFFA 5CVRA 3OIQA 2IW5A 5EZHA 5FKKA 2KIMA 2NS7A 3OYHA 1O57A 2K27A 4H0EA 3MZ8A 4DYQA 3HL2A 4M3FA 2JA5J 2IA0A 1FOXA 2HQAA 3GW2A 4EV0A 2DO7A 3OYEA 4A3JJ 4KN7X 5E8IA 1YG2A 5C4XJ 2MD5A 1VQPI 4Y33A 2BVMA 1S7EA 1W7PA 3QPLA 1UELB 4XICA 1R1TA 2A69F 4G7OF 3S8PA 2JA7J 4ENMA 1R4NB 2DT7B 3RPUD 2NYXA 4EJVA 5LEJA 2JA2A 4CYDA 4E7KA 4XKCA 3ROUA 4AIDA 4G8XA 4ESBA 3H5RA 2DOEA 3JRGA 4IVNA 3P9KA 2HXOA 4HX4A 4UUTA 2HOSA 3EETA 3CUQA 5KHDA 4D7NA 2K9MA 3ABLH 1VZ0A 2JUCA 1OCOH 4NUBA 4PSXA 4UVAA 2LYCA 1HOMA 1LEBA 1QHGA 1IN6A 1LVAA 1U3EM 3OYKA 1HA8A 3EYIA 4IRGA 2ID6A 4B1RA 1SFOJ 5CVIA 2DYSH 2TDXA 3ZQGA 4I98B 3S3NA 2DA1A 1E3HA 2VQCA 4RGXA 3DBRB 3TOBA 4NB5A 4RS8A 3DV8A 1KQ0A 2K85A 2OAZA 3S3MA 3I59B 2VQGA 4BE0A 2FSWA 3GLXA 3J7AY 2W7NA 2R7VA 3MFKA 2ZXIA 3A02A 5FLVA 1K83J 4LOCA 2XDVA 1AWCA 3OS2A 3OMYA 1MJ9A 1FIPA 3S93A 3V4GA 4PFOA 2PMZA 1QRYA 3BR0A 1PUFA 4OAYA 2P6SA 3N4MA 2ADUA 3CCMI 3CUQC 2WAQN 5HLIA 1J9IA 1LDKB 4YFKF 5LHIA 2QGUA 1IRZA 4CH7A 1XB4A 3LA2A 1B1BA 3BR3A 4A3EJ 2ESNA 2KHMA 2L02A 3CJTB 2JA8J 2PI0A 3KPHA 5ICCA 2GXBA 2Z1DA 1T56A 3D1NI 5ILSA 2ELHA 4KYWA 4FASD 4BDZA 3ZCOA 4JP0A 3G1MA 3A01B 1G3YA 1ONVA 3OR1C 3RSNA 3QODA 1YO5C 3KP6A 5J8FA 4KT5C 1BW6A 2E19A 1CQTA 2ZKZA 4MO7A 4LG3A 2EWNA 2JUGA 2W82A 2OZ6A 3LA3A 2UXNA 4QPOA 5B3SH 3TQNA 2HPIA 2O61A 2DXIA 1DP3A 2FU4A 1E0EA 3WTSC 1F43A 2YS9A 3NAUA 1T8IA 3RZDJ 4AVPA 4DJAA 2IXSA 2M8GX 2MW8A 4EGZA 2ME0A 1SC7A 3L1PA 3TL4X 4UVBA 1U9OA 1XG1A 4I76A 2Q8KA 3GUDA 4OIRF 1YITI 3KE2A 5AIPA 4I6ZA 3O6BB 4DYRA 3M8EA 3C3WA 3CP2A 1JTXA 1TNTA 2BY1A 3BJOA 2VI6A 1Z77A 4BBRJ 5J1RA 2R5ZB 2M4GA 3SXYA 1XD7A 5HDKA 3H3VK 3ONQA 1SMYF 1OCRH 3H92A 2ECBA 1DUXC 1FMWA 1LFPA 1U6GA 3C2BA 5CJ9A 3EUKL 1XMAA 1KA8A 3CMYA 1YS7A 1IV8A 5LHGA 3ZR8X 2EH3A 2VBXA 2LVSA 2L0KA 3BDDA 4A3LJ 4KIFA 2MLKA 1AU7A 2Z16A 1U0JA 3EUAA 3GX4X 4OMYA 4MEYF 1IGNA 1QZYA 4BE1A 3K7AJ 3WGIA 3K10A 5E18F 1RZ4A 4G6QA 4X6AJ 3WTXC 4A3FJ 2J5PA 5LD2C 3LSKA 4OAZA 1TWFJ 2IS4A 2H27A 3Q0UA 1FIAA 1T0FA 3MQ0A 2OV7A 2ELKA 1R49A 1KZHA 2KIFA 2L54A 1F1ZA 1S6LA 3WGGA 2H09A 3EQLF 3CJQB 1Z21A 4HLXA 3K70C 4HRIA 2MG4A 5ILVA 4CCKA 2FBKA 3I3LA 1KONA 2CUJA 3E97A 3FKIJ 1FT9A 2F5VA 2FNAA 4UUSA 1I6XA 3BZ6A 3OS0A 1O7FA 4Z6YA 2L01A 4TV7A 3E5XA 1WGXA 3S16J 2G0EA 1UJ8A 1QA6A 3RPUA 2VJ5A 1IV6A 4QPQA 3R4KA 3OYNA 1XTAA 5JVTA 4FQGA 1JE8A 5ED4A 4RAGA 5A2QZ 2EFWA 3Q9SA 4CICA 1TW3A 3G3ZA 3PFYA 4IO9F 3RZOJ 5DCMB 4M73A 1DPRA 4ASNA 2XF6A 3D5RC 3M9AA 5DS9A 5FB2A 5IT3A 1J59A 2X85A 4ENNA 3FBIB 3G71I 1MDMA 1T0FC 2G9WA 2R7WA 4HW0A 3OSGA 2HOAA 2BGCA 1IF1A 1A6IA 2IS6A 1GVJA 5D5WB 2NVQJ 5C44J 1SANA 1XCVA 2MH9A 4WWCA 3OYDA 2ZJPF 3JAMK 4G7ZF 3K4BA 1O4XA 1IDYA 4XLHA 4KMUX 4BH9A 4YELA 4ESJA 2F2EA 2RAEA 5KAIC 1EH8A 3KIOA 1ZREA 1OR7A 5CPRB 4NBQA 5K7HA 4ZC3A 2P0WA 3FHNA 2KMUA 3FXMA 3SFZA 3CCYA 2D1VA 1TT0A 4M3DA 2E5NA 3OL4A 3TGNA 2XAHA 2E36A 3Q5FA 1YE9A 2VBYA 3FZVA 4IXAA 4R79A 1VNDA 3RKYA 2HU9A 4CO8A 4HX8A 3HPHA 2KZVA 2XAJA 2XROA 4IL6C 4KIGA 4F7ZA 3WU1B 1IG7A 1R6RA 2E7WA 4C9YA 1HCRA 1U5TB 3NWSA 3IWZA 3EPZA 3KEYA 1ZAOA 4YFNF 2B7EA 2VJIA 2XGEA 1JKRC 2JRTA 2QUFA 3GTLJ 2L2OA 5K5RA 3KETA 3SYTA 2WB1N 1RETA 1XSVA 1P7IA 4M71A 2CW7A 2Y2ZA 3G73A 3GLLA 1RRJA 2JTVA 3HOYJ 2DPUA 4CYCB 2NVTJ 3CLOA 1TP4A 2LD5A 1U78A 2WAFA 1IC8A 1VQ4I 1FBUA 1OMIA 4HSTA 1OR7C 2Y31A 4W1UA 4BKXA 2VN2A 3IWFA 4UB6C 4KDPA 1MBHA 2CG4A 5HNHA 1ZRDA 2XKOA 2ZNYA 2GLOA 4KNYA 1S72I 5D5VB 4HDVA 4MFEA 4A2UA 3V7CA 3FHZA 1B9NA 3RJPA 2HVRA 3LNQA 3CJRB 2TCTA 3RIRA 2GAUA 1OJLA 4MFDA 4D7MA 2V79A 2CQ7A 1VQ8I 5HS7A 1B6AA 2F5EA 3NQOA 5LGTA 2D5VA 1RKTA 2DK8A 2CO5A 4X1EA 2OU2A 2JA6J 4A0YA 4IOCF 3FBNB 3PM1A 3AG2H 2M8EA 2LY9A 4UUVA 2R7UA 3KZYA 4D0PA 2ESHA 3UNGC 1G2HA 4Y4RA 2QEXI 1I3QJ 1VQ6I 2I8DA 2XV4S 1WRJA 5EGOA 2GOXB 2LKXA 2Q0OA 3HUGB 3M7GA 2QKMB 2B63J 1DDNA 3OWTA 4UHTA 3IH3A 1DP7P 1FC3A 1YI2I 3RYPA 3E0JB 4HPQA 4F52A 5EEAA 1WJBA 3J81Z 4WXHA 4CDGA 2FOKA 4DGWB 1ZN2A 2VB6A 4XONA 3GTPJ 4RDUA 1HDPA 2K4BA 1D8JA 3H35A 2EZIA 2HYFA 2X48A 3ML6A 5JLXA 1XMXA 3ZQFA 1Z3XA 2DA7A 4GDFA 3OYLA 3FM5A 2A5WA 2EV0A 1PUEE 5D8KB 4D5FA 1VQKI 1FZPB 3NARA 1S8NA 4P55A 3JTGA 4R1HA 3FXOA 2BYVE 4XN3A 4XQFA 5IOZA 1ZLJA 3TDUC 3IL2A 1Y0NA 4J01A 3OYMA 3A1YA 2E71A 4CXFA 4FE4A 3DBHB 3K1MA 1UG2A 4L5JA 2KQRA 2ZC2A 3IAS2 2Y69H 5E1ZB 3SHFA 2P4WA 2VC1A 2XAQA 2HOEA 3F6VA 3UR3C 4MGRA 2KDOA 3A4CA 1LJ9A 1Z0XA 5E3LA 3PIOF 4UY8I 3I9V2 1D1AA 2YX7A 3H3ZA 1S29A 2MGQA 2JT1A 4N4OB 4J00A 3RQIA 5DEQA 3U2RA 3BTIA 4HNTA 2HPMA 3GFIA 3F21A 3BLYA 1N25A 2QLZA 2P7VB 4W97A 4WXCA 3J7ZI 1SD7A 1XMKA 1VQNI 2K9QA 3V7RA 1QZEA 1CF7A 3BTLA 1X2NA 5LFAA 2KJBA 4U87A 1SVLA 2K4JA 3M8FA 3C2HA 1D0YA 4JOMA 4D9JA 4OIOF 1IRFA 3PO2J 2XUBA 2K7LA 3WGHA 4KA4A 2Z2SB 1ULYA 3HJEA 1B72B 1VTNC 4U7DA 2D1HA 2DMPA 1SEUA 4MIMA 3REOA 1EKEA 4C3IJ 1W7PD 3W6VA 4HG2A 3F9KA 3L09A 1XPXA 3JRAA 4BY1J 5H6QA 2CQXA 5GTHC 2VPRA 1RUOA 1NHAA 3CJNA 3CCRI 2OQRA 3CF5F 1FYKA 3ULQB 2QBYA 1R1VA 4RB2C 1J2XA 1JUMA 1PJRA 1FJLA 3FXQA 3BWGA 2EJRA 3J80Z 3RI4A 1X4PA 2JQ7A 1AA7A 3ECHA 1MBGA 2CMPA 4IF4A 4HYEA 1XN7A 1XCBA 4BJTA 1K79A 2AQFA 3HIFA 4BEHB 3OSFA 1A04A 3LQRA 2M9HA 2W1OA 2WBMA 3S2HJ 4HBLA 3K4KA 4E7HA 2E1MB 2Y0MA 5E20A 5HNFA 1SFXA 4B43A 3RQ4A 3KLOA 2E1OA 5B5EC 4M9ZA 3R61A 4XSXF 4KT6A 4BHPA 1YOVB 4B44A 2VKHA 4CZZA 1X1AA 4CZCA 4M6YA 2IBDA 2L9NA 1JGSA 3GTQJ 2XRNA 3HOWJ 2J5OA 3FMQA 2MSYA 1QPIA 3GEZA 3QYEA 1D5VA 5IT9K 5GTIC 2GQQA 3VSLA 2R5YB 3GCMA 4WXDA 1TBXA 4JX4A 4OMZA 3GTKJ 3WHBA 2EIMH 1X1CA 2EFQA 1T2KA 3T8TA 2F6CA 1R5GA 1G3SA 2EZLA 2VKVA 3CLQA 3ABKH 3WTUC 2V6EA 2CUZA 2LFBA 3KYDB 3DEEA 4XLPF 1YJ9I 1SAUA 1YQAA 3RKQA 3ZQQA 3CMEI 1SD4A 2QCOA 2LBFA 1DU0A 1P4XA 2DA6A 3HGYA 4ZDLA 3PJRA 1HSTA 5IP9J 4PK4A 1ON1A 3KZZA 1EA3A 4OINF 3BQYA 2BY2A 3C7JA 3J7YJ 1BR2A 1A6QA 2P5VA 5E8GA 5DD4A 3DU6A 4IX7A 1ZG1A 2TRTA 3CMAI 1OISA 2F5DA 2LKSA 2FNPA 2VLAA 4OIPF 1MSEC 3L2WA 3BZKA 5K7ZA 1ITYA 1FEXA 2FEZA 3R0JA 2XB5A 5ERIA 3QRFF 4OOIA 1SFEA 2OD5A 3SFIA 5BS6A 2ZMEA 4DYCA 1XGOA 2L5QA 1BJZA 5BNGA 2FOWA 3KEOA 4A3GJ 4HV6A 4YG2F 3K4CA 4IJAA 3I53A 2ELJA 1V5EA 2A68F 4P9FA 2DQRA 3F72A 2DU9A 5FD5A 5LRRA 1NG6A 5IYDJ 4I0BA 4MQ9F 4IHVA 3E6MA 3OL3A 2YU9J 1OCPA 2HVQA 2LTPA 4L9NA 4GO1A 1EF4A 4U0VA 1YW7A 1I5ZA 9ANTA 1K61A 4KITB 2NNYA 2K86A 2VQLA 4A5NA 3MKWB 2DA2A 1P4WA 3K69A 2VBZA 3NWTA 3CESA 1FWZA 2FJ1A 5GPCA 4ANJA 5HDGA 3LSTA 5E1WA 2DI3A 4EQQA 2NVYJ 4BQNA 5B66C 1MSFC 3BG6A 3BR6A 5KCMA 2KJCA 4RM2A 4BQQA 4WF2A 4XLNF 1VF9A 2V9VA 2PJRA 2NOGA 3MD2A 1MJAA 2ZMEC 1WPKA 4DW6A 1REPC 2X51A 4RAFA 1X58A 3OIPA 1YW9A 2HZTA 3VB2A 1ZR4A 3H36A 3PUFA 1RUNA 1ZYRF 2X6YA 3RTRA 3ZMVA 1HKTA 2M87A 3DBLB 2R7ZJ 2XRLA 4GRIA 2EQRA 1SFUA 2IGKA 4BGDA 1X1DA 2IA2A 1N78A 4RAYA 3W2VA 4A5MA 3I55I 3CCEI 2I5UA 4PZJA 2ICWG 4BNCA 4O6JA 3COAC 2JSPA 4DOZA 4LG0B 3B02A 1JI8A 3UKGA 1ZG3A 2RNJA 2R7RA 1YX3A 4IHXA 4E7LA 2LP0A 4IHYA 1D0XA 1QVUA 3CQZJ 3ZQCA 3HHHA 2G7HA 5J47A 4YFXF 4LLNA 1YS6A 2V1DA 1LE8A 3FDYA 4KUMA 1BI2A 1WH5A 2HZDA 5F0HA 1IDZA 2MABA 2QZ8A 1RIOH 4EMSA 3SDBA 4AC0A 1ZHFA 3HKZA 1B8IA 2HQ5A 3FXUA 1P92A 2A6TA 3J7AO 4B3XA 4NQWB 3BPVA 3QOPA 1ZARA 3D0SA 3E3VA 2ZNZA 3QPTA 3OYJA 1IO2A 1MIJA 2EZHA 4Y17A 1D1BA 4I2OA 2HKOA 4RA2A 5L3GA 4I0AA 4Q47A 1TLHB 2K40A 3T1BA 3G6EI 3I4MJ 4O5VA 3HBLA 2DDAA 2HDCA 4L5IA 2JPCA 3ZQ7A 2K3PA 3LFUA 3MCZA 1Z05A 2FUG2 1IN4A 2V26A 1QU3A 2VOOA 1UZCA 2E2IJ 2DFIA 3QAHA 2FE3A 4EJOA 1UG0A 2XF5A 2ZB9A 3JRFA 1P4AA 1HF0A 1I6HJ 3SJMA 3LSHA 1BC8C 3ZRGA 2O9LA 2HI3A 3ZP5A 3V8LA 4B8XA 2HYGD 1UHMA 3JRIA 1NG7A 4KFCA 1YRNB 2CQQA 2COMA 2DMNA 2O8KA 5CYVA 1WJEA 1ODDA 5EEGA 1O3TA 2L9RA 1FP2A 3GFLA 2VKDA 5E3NA 4KN4X 4HAMA 4L5EA 2E1MC 5F27A 3V8JA 5DM7F 4IZZA 1TQIA 2F4OB 4C2MJ 1YHQI 6PAXA 2O03A 2NOJB 3CP8A 2NXNB 1WCMJ 3F6OA 2CQNA 3P5JA 1MNEA 4GYGA 3FISA 2QQ8A 2X0LA 3ERED 1TL8A 4LJZF 4Y7NJ 4EM1A 2MBFA 1T38A 1G59A 1MBEA 2IPQX 5JI6A 5IP6A 2LREA 4CCMA 4DIQA 3CD6I 4NNJA 1Z67A 3A2KA 4IQ4A 4YIFA 3N97A 2WC2A 3Q3SA 1O7LA 5LHHA 2AS5F 2QENA 2E2JJ 4HF0A 5LLQA 3AG1H 2Y48A 1TQMA 3VPRA 4N4NB 2WY7Q 4RGUA 2A6HF 2BVLA 3NRVA 1DGRM 2ZSIB 5L3EA 1MMNA 3L7WA 2V9PA 1VQMI 2KRCA 2F4MB 2WV1A 2DK5A 1UMQA 5HLGA 2KKOA 2CUFA 2IGOA 1I39A 2XB0X 2KP6A 4RB0A 3ZOBA 3CC2I 2HEOA 1R58A 2HDDA 5EG0A 5BMZA 1GVDA 4D5CA 5F6FA 5M5YJ 1D3YA 2BV6A 2DYRH 5EF6A 1WJ5A 4PJ0C 4IRHA 3HGGA 4XKBA 2I10A 4N0BA 5D4SA 2ISYA 4JYKA 2JN6A 2WAQA 4N9HA 1GLNA 4O3MA 2VPLA 3K2AA 5HLHA 5D5UB 1Z1DA 2BW3B 2EK5A 4GGGA 1E3OC 1FX7A 3KFWX 4UXNA 1KU3A 1J0RA 1TW2A 2E34A 3K4MA 2VJJA 1Z7LA 3QYFA 3S1RJ 2Y9ZA 4LFUA 2OTJI 4JX5A 2GIZA 1LUJB 5ICGA 4UNOA 3S32A 1LFBA 3GTGJ 3HRTA 5ICFA 3IAM2 1D0ZA 2DN0A 2JVGA 2WADA 5CQEA 2BY3A 4FE7A 1P9QC 2AO9A 3L2RA 4RLFA 2QQAA 5BQTA 1DPUA 1KGSA 3DKWA 4IHWA 1AOYA 2CFXA 3Q0VA 4E7SA 1VQOI 4HQMA 1V3FA 3K0LA 5L3FA 1RI7A 3ZXSA 4XL9A 1V54H 2GA2A 4C3JJ 3F8NA 2ACJA 4F92B 3O8GA 2F48A 4XRSA 5FLXZ 2A05A 1POGA 3GFMA 1WSUA 1WVRA 4LK0F 3H9GA 1WI9A 2NS0A 2CV2A 1KQ8A 3BP8A 3ZQHA 2Z3YA 1MZBA 4A3CJ 4CGZA 2GWRA 2ZXHA 3MZYA 3HOXJ 3IKTA 1PYVA 2BHYA 4PCQA 3JREA 3L2VA 2CW0F 3HHGA 3JSPA 1IN5A 3LSMA 5GPAA 2LNBA 2HVSA 3I59A 1W36C 3WE2A 4ZZLA 2M30A 2UZKA 1NK2P 3DP7A 3BT9A 5AONA 2B0LA 1FBQA 5D4RA 3MAJA 1LKXA 2IJLA 4A69C 1Z6RA 4ON0A 4A3DJ 4HF2A 5DM6F 1UAAA 4J19A 5D6FA 4JQFA 1A31A 4BAYA 4XKWA 5HDNA 1Q1VA 4XOTA 5CQGA 5FKNA 4C2UA 1B9MA 1I50J 1MBJA 2QWWA 5EJCA 2IS2A 4M6VA 4CCOA 2RQPA 5FD6A 5DUIA 3HRMA 4BHCA 1W1WE 1K78B 4B09A 3A01A 1XDUA 2OPTA 1NK3P 4UV9A 4D1QA 4EJWA 2E2HJ 3FX3A 4MNUA 2V6CA 2LG4A 3G1LA 3GFJA 4PGHA 3U9GA 3VSKA 1K4SA 3ISPA 3GZNB 1IXSB 2IGMA 2KRHA 5B1BH 5TISC 2ETHA 2R7FA 2MD0A 2XGCA 4E7IA 2K02A 1WJCA 3TO7A 4BS9A 3DPTA 2VBWA 1IN8A 3JTHA 1ZELA 3TO9A 5C3EJ 5J40A 4BJ6C 4PGGA 1H8AC 1H9TA 1EH7A 1E17A 5CVUA 1Z91A 2KDZA 5FKOA 2VXDA 5J8CA 3KZIC 5BPIA 3OOPA 3VYTB 1S9HA 1BOBA 3I64A 3CO6C 3ZQLA 1H9GA 3KP2A 4M6XA 4QWQA 4U0WA 2R5ZA 1IRGA 3HPGA 3AL0B 1ENHA 2KRFA 3BJ6A 1JKOC 1PDNC 1YX5A 5KK1A 2HFHA 3OR2C 1R36A 1WJDA 4C2TA 1ZGAA 2H8RA 5FO5A 4ZDOA 2EILH 1QZZA 2Z33A 1X1BA 1X3UA 2DTRA 3HOTA 4GYIA 1QGPA 4PUSA 1T6SA 2YPRA 1V5GA 2DQLA 2BOLA 1P7JA 1K6OA 4XN0A 4EM2A 3S14J 1VFCA 3H5AA 4L9VA 4ZYDA 2W24A 4XLFA 2FQ3A 2VODA 1SVOA 2Q2EB 4YIRX 1F5TA 5K7FA 2LLKA 2HOTA 3VYRB 4F91B 4E70A 2QYOA 1TZLA 2CGPA 2JPBA 3WHCA 3DWLE 4CUGA 1SD5A 4BACA 1FOKA 4BY7J 3VYUB 3ZN0A 2CUEA 3K2ZA 3OYGA 4EJTA 2OA4A 1FMVA 1S7OA 3M3YJ 4QSHA 1YLFA 1ACIA 4CCLA 2VC0A 2ISZA 5TRDA 4M3GA 4EEFG 3KP4A 1BR1A 2H1LA 3CCJI 2BY0A 2WB1A 4HNUA 3PSFA 3EDPA 3NEUA 1BA5A 1VQ5I 2VOPA 1HW2A 2R7OA 2PX9A 3K4NA 2OF7A 3Q0WA 2LMDA 2LDUA 2A07F 2RC4A 3LWFA 5JVGF 3IC7A 2CQKA 5HODA 2K3FA 5L3DA 4UB8C 5DCMA 4XSZF 3SEZA 3MKZA 3LSJA 3H3UA 2FQ4A 3KP7A 2X1CA 2OJED 2VT2A 2ECCA 4AIHA 4IHTA 3BTJA 1AKHB 4HOBA 1BN5A 4B3AA 1X3WB 4M74A 3DU5A 3MWMA 2DW4A 4U7BA 3CC4I 3JW4A 2ZJ2A 3G4SI 1R22A 3ASNH 3HOVJ 5A2QK 3R6SA 4H4KC 4ZTFA 2PMUA 4KICA 3OS1A 2HYJA 1WH7A 3C2GA 1IAWA 2HGCA 4RB3C 3GO5A 3HOZJ 4A3KJ 3JCUC 2GXGA 4RM3A 2GBYA 3CCSI 4FX0A 3TKYA 2A5YB 3IKVA 2V9KA 4A6DA 1W7PB 4XLCA 1V4RA 2VE9A 3TW6A 3QP5A 3V7SA 2WTEA 4BXUA 2MC3A 2WY8Q 3DF8A 1UHSA 4A3IJ 3BR1A 3LA7A 3TP3A 2KZGA 4U88A 5IP7J 1GT0C 3M4OJ 4BQAA 1XGMA 4MTEA 1IUYA 3VEPA 3WTTC 3BJAA 1U5TA 2PG4A 3E6CC 3CUQB 2KPMA 1W0UA 4ZJZA 2RVCA 3QWLA 3HTUA 4NC8A 2LY2A 5LEKA 4AVZA 1FOWA 4OWRB 1EJ9A 1FLIA 4HZFA 4BYYA 3SZTA 2C6YA 1MW7A 2MLGA 2VONA 2M0CA 5J4YA 4ZDPA 2X6XA 3KP3A 2HS5A 3HSFA 2E5ZA 4CYCA 2E1CA 3QPHA 3MMYB 1YIOA 4S04A 1X2MA 1MMDA 3S1MJ 1HW1A 4MTDA 4LB5A 2WAEA 1MJBA 2EINH 1Z6TA 3ECOA 3WTVC 1USTA 3BOQA 1M1EB 2EA4A 4XOPA 5ILUA 1YIJI 1TT5B 1AHDP 4EATA 5ICEA 5D5XB 2MH2A 2W25A 3K4LA 3S3OA 3ZMUA 2QA4I 4YIIA 1RKWA 5E17F 1O3RA 2Z5UA 4S05A 2L9SA 4BE2A 4ZTJA 1U8RA 5KVRA 4M9SA 1PUFB 1U5TC 3JSOA 5BOXA 2DOAA 3ERMA 3DTEA 2LY1A 3HB9A 4UV8A 2P8TA 3TMOA 1BJAA 4EVIA 2RKHA 4II2A 4A6EA 4G6TB 1VQ9I 1IN7A 2ZJQF 2EPFA 4RGRA 3VFZA 3LOCA 2F5CA 4PJLA
chains in the Genus database with same CATH topology
3ABUA 1KU7A 2W57A 4FT8A 4HV5A 3I58A 1UHWA 2PN6A 4ESFA 4G9YA 4L18B 3BPXA 3LQQA 3O2PE 2XVCA 3HUGA 3C1DA 3ZMDA 1GXPA 1LNWA 2H6BA 5FFZA 3FM3A 1IXRC 2HWVA 2F5FA 3HSEA 4IRIA 3I5UA 2CSOA 2O0YA 4I02A 3W6JB 2MA3A 3K1NA 3IRQA 3CO7C 4XRFA 3ZMSA 2M5WA 3U1DA 2E7XA 3HYIA 3I71A 2HTJA 2NRAC 2FMYA 1H0MA 3IHUA 5F1RA 2GIVA 2KIUA 3J81K 4AD9A 3B73A 3GZ6A 1USSA 3HRUA 4EJUA 4ZYGA 2M1BA 1BC7C 3P7NA 3WODF 4I7HA 1EH6A 1R1UA 2GZWA 2L4AA 2QM3A 1OYWA 2DAOA 1ZGJA 4AWXB 3KCCA 2PMHA 4LGWA 4Q5SF 2BE5F 3R60A 2IRFG 3BY6A 1HSJA 1SAXA 3F8MA 1TTYA 2HQRA 1HBXG 4P9UA 2STTA 2DT5A 3GXOA 5HOOA 1LB2A 2QVOA 3JAMZ 3ELKA 1XGSA 2A3SA 5JHUA 1E2XA 2RV8A 3L9FA 1R5HA 1WWXA 2A61A 1YW8A 5L3BA 2EB7A 1O3QA 1MDMB 4AIJA 1T98A 1GHCA 4DNCA 2QQ9A 2EV5A 5LGNA 1OPCA 4HDUA 2W84A 2XAFA 1STZA 3FWEA 1EV7A 4RAZA 3J80K 5H6RA 2XHKA 4HLYA 2X4HA 1QPMA 1XDSA 5F64A 4ZYHA 3P9IA 1I1SA 2UXXA 1BOAA 1QBJA 4L9TA 2ZO4A 3T5XA 3RKWA 2P6TA 1ZG5A 4M72A 2EV6A 2EFNA 1RNLA 3HTSB 5FGMA 2R7DA 2PFBA 1L0OC 2GA1A 2NNNA 4UVCA 2ZFWA 3ZMTA 3DQVC 1MKMA 3RKXA 3S2WA 2D45A 1B4AA 2H6CA 2EA2A 4BHBA 4KMFA 2PJPA 4U0YA 2WV0A 2L3DA 4MHGA 4XBFA 2Z9OA 1ZLKA 5K5OA 3T0YA 5E1XA 1Z9CA 3QU6A 4MQVA 4GCVA 5DUKA 2L4MA 3M1EA 2XGXA 3DEUA 1BIAA 5CLSA 1WQ2A 3K9TA 3TO6A 1FYLA 4RB1A 3RYRA 4A0XA 5D8LB 2YR2A 2FA5A 3WTYC 2DBBA 2AXLA 1LDJA 2IVMA 3GVAA 4N9IA 1PP8F 3WG9A 1GXQA 1PP7U 3D5LA 1LEAA 1BBYA 2DLLA 4ETSA 1KYZA 4GXOA 2LKPA 4RGSA 1I1GA 1FY7A 1IZ1A 1FSEA 4WCGA 2VE8A 2W85A 1BI1A 2PBIA 2O3FA 4LLGF 5DCFA 2IP2A 2XASA 1JXSA 4G94A 4ENKA 3ZN1A 3LAJA 3DFGA 4LG0A 2EFOA 1QQIA 2G7UA 3WTWC 4LLLA 1B59A 3F23A 3QP6A 3RDIA 3L2CA 5HS8A 3I54A 1HXDA 2LF7A 4NQWA 1CF7B 5HVQC 4WX9A 2YSRA 3CUOA 1UB9A 1ZRCA 1G3TA 4P5OA 3GYHX 1R23A 2ZCWA 3OV8A 2P5LC 2EFPA 4AIKA 4FHTA 4HA8A 2ZXJA 2O6GE 1HKQA 4Y13A 4PDKA 3FMSA 4A0ZA 2OQGA 4LMYA 2DPDA 1TQPA 1SMTA 1FYMA 4HQEA 4JBAA 2QBYB 4G7HF 1XSDA 4CHUA 3PFIA 4LD5A 3MEXA 3F8CA 1XSXA 5K5QA 2PLYA 5DYMA 2FMLA 1L3LA 3GF2A 2BBYA 5IT9Z 4K2EA 1UFMA 3ZPLA 4L9JA 3KP5A 4HF1A 5FFXA 3E6DA 1HKSA 4Y15A 3GZ5A 4G6DA 2JSCA 1BIBA 1J7KA 2HKXA 2V1XA 1FPQA 2LSOA 1TNSA 1BI0A 1T39A 4I09A 3F3XA 1S3JA 3DXJF 1FBSA 4ENJA 4NHJA 4WK8F 3P9CA 1J75A 4OIQF 4L0ZB 1G6NA 1D8KA 1G4DA 1K7AA 2P7CB 3E5QA 1CGPA 3CTAA 2FXAA 3ABTA 4DQ2A 4M9XA 3CDHA 3F8FA 1Q1HA 5LRSA 3FMRA 2P5KA 1C0WA 2ZMEB 3L00A 3PQJA 1UCRA 3SQNA 2NAZA 4Z2YA 5CVVA 3Q9VA 2Y75A 1KU2A 3FXRA 5JR3A 1QO0D 1G3WA 1ZH5A 4L0YB 2D2WA 4Q48A 3F22A 1SD6A 1OYYA 3ZMZA 2VT3A 1MD0A 3F8BA 3MZHA 4IPAA 1P2FA 3VODA 3EUHA 1KU9A 3WU0A 3WTZA 1R00A 2HQNA 5BPDA 3TOAA 3C18A 3LAPA 3AAFA 2HR3A 2OBPA 1Z7UA 2FF4A 1W5TA 3BROA 3DPLC 3KLNA 1W5SA 4R8HA 2JZYA 3EYYA 2HTSA 4OU0A 2IA1A 1BI3A 3IRRA 5FLXK 3LFKA 1I27A 1HW5A 4LB6B 1P6RA 3I4PA 3E6BA 3KEQA 5DV5A 1LQ1A 4EM0B 1WKMA 3R0AA 4P96A 3RPQA 2WWYA 5K1YA 4FX4A 2V1UA 1K78A 1YFHA 2IT0A 2PEXA 1ZRFA 2XAGA 5LBQA 5HS9A 5AIQA 2LF8A 2Z99A 3W6KB 1OYIA 4I01A 2RN7A 3FF5A 4MEXF 3QU3A 4EGYA 4KIBA 1IW7F 2FBHA 1O3SA 3WE3A 2RDPA 1XGNA 2OZUA 1JHHA 1U2WA 3T8RA 2H94A 2XIGA 1FP1D 3E5UA 1S7AA 1HQCA 2M45A 2YU3A 5CVJA 4JK1X 4Q4ZF 1Y0UA 2RGVA 1BM9A 5LGUA 3HRSA 1FNNA 4ZYEA 2A6EF 2BEOA 5EEHA 2E1NA 2R3SA 5DDGA 5J6XA 3HOSA 2YX4A 1FSHA 5DD8A 3SZPA 2Q2EA 2PQ8A 5H20A 4LK1F 2O8XA 1F4KA 2STWA 3O3KA 2FRHA 3TDZC 4HX7A 1MGTA 1R7JA 1W4MA 2UWMA 1YYVA 2CYYA 5TJJA 4IHSA 2CWEA 4ZZDA 5L3CA 3I0TA 3HSRA 2FBIA 2XKPA 1JHFA 1KQ9A 2QQBA 4QLCU 2ZBKA 1KYWA 1OKRA 4A12A 1IXCA 1LDDA 1YTYA 2VXZA 1ON2A 3V8KA 3K1PA 5D6EA 3PQKA 5JFRA 4ZH4F 1F9NA 1J5YA 3VOEA 3GWZA 1QNTA 5CVRA 2IW5A 2KIMA 1O57A 2K27A 4H0EA 2IA0A 3GW2A 4EV0A 2DO7A 4KN7X 5E8IA 1YG2A 2MD5A 1W7PA 1R1TA 2A69F 4G7OF 4ENMA 2NYXA 4EJVA 5LEJA 4CYDA 3ROUA 4G8XA 4ESBA 4IVNA 3P9KA 4HX4A 3EETA 3CUQA 4UVAA 1LEBA 1IN6A 1LVAA 1U3EM 3EYIA 4IRGA 5CVIA 2TDXA 4I98B 4RGXA 3TOBA 4NB5A 4RS8A 3DV8A 1KQ0A 2OAZA 3I59B 2FSWA 3GLXA 3MFKA 1AWCA 1MJ9A 3V4GA 2P6SA 3N4MA 2ADUA 3CUQC 5HLIA 1J9IA 1LDKB 4YFKF 5LHIA 1XB4A 3LA2A 1B1BA 2ESNA 2L02A 2PI0A 5ICCA 2GXBA 5ILSA 2ELHA 4KYWA 1G3YA 1ONVA 1YO5C 3KP6A 5J8FA 4KT5C 2ZKZA 2EWNA 2OZ6A 3LA3A 2UXNA 3TQNA 2O61A 2FU4A 3WTSC 4AVPA 4EGZA 4UVBA 2Q8KA 3GUDA 4OIRF 3KE2A 5AIPA 3O6BB 3M8EA 3C3WA 1TNTA 3BJOA 3SXYA 1XD7A 5HDKA 1SMYF 3H92A 1DUXC 1U6GA 5CJ9A 1XMAA 1KA8A 1YS7A 5LHGA 2VBXA 3BDDA 4KIFA 2MLKA 4OMYA 3GX4X 4MEYF 1QZYA 3WGIA 5E18F 1RZ4A 4G6QA 3WTXC 2J5PA 2H27A 1T0FA 3MQ0A 2KIFA 2L54A 1F1ZA 1S6LA 3WGGA 2H09A 3EQLF 4HLXA 5ILVA 2FBKA 3E97A 1FT9A 2FNAA 1I6XA 3BZ6A 1O7FA 2L01A 4TV7A 3E5XA 3RPUA 3R4KA 5JVTA 1JE8A 5ED4A 5A2QZ 2EFWA 4CICA 3Q9SA 1TW3A 3G3ZA 5DCMB 4M73A 1DPRA 4ASNA 3M9AA 5FB2A 5IT3A 1J59A 4ENNA 1MDMA 2G9WA 4HW0A 2BGCA 1IF1A 1GVJA 5D5WB 1XCVA 2MH9A 4WWCA 3JAMK 4G7ZF 4BH9A 4KMUX 4ESJA 2F2EA 1EH8A 1ZREA 1OR7A 3SFZA 2D1VA 3TGNA 2XAHA 3Q5FA 2VBYA 3FZVA 4IXAA 4R79A 3RKYA 4CO8A 4HX8A 2XAJA 2XROA 4KIGA 4F7ZA 3WU1B 2E7WA 1U5TB 3IWZA 1ZAOA 4YFNF 2JRTA 2QUFA 5K5RA 3KETA 1XSVA 4M71A 3G73A 2JTVA 2DPUA 3CLOA 1U78A 1FBUA 1OMIA 2VN2A 3IWFA 4KDPA 2CG4A 1ZRDA 2XKOA 2ZNYA 4KNYA 5D5VB 4HDVA 4A2UA 3V7CA 3FHZA 1B9NA 3RJPA 3RIRA 2GAUA 2V79A 5HS7A 1B6AA 2F5EA 3NQOA 5LGTA 2DK8A 2CO5A 2OU2A 4A0YA 2M8EA 4UUVA 3KZYA 4D0PA 2ESHA 2XV4S 1WRJA 2Q0OA 3M7GA 1DDNA 4UHTA 1DP7P 1FC3A 3RYPA 3J81Z 4WXHA 4CDGA 2FOKA 1ZN2A 2K4BA 1D8JA 2HYFA 3ML6A 3FM5A 2EV0A 1PUEE 5D8KB 1FZPB 1S8NA 4P55A 3JTGA 4R1HA 2BYVE 1ZLJA 3TDUC 3IL2A 4CXFA 3K1MA 4L5JA 5E1ZB 3SHFA 2P4WA 2VC1A 2XAQA 2HOEA 3F6VA 4MGRA 1LJ9A 2YX7A 3H3ZA 1S29A 2JT1A 5DEQA 3U2RA 3GFIA 3F21A 2QLZA 2P7VB 4WXCA 1SD7A 1XMKA 3V7RA 1CF7A 2KJBA 3M8FA 2K4JA 4OIOF 1IRFA 2XUBA 2K7LA 3WGHA 4KA4A 1ULYA 1VTNC 4U7DA 2D1HA 3REOA 1W7PD 3L09A 5H6QA 1RUOA 1NHAA 3CJNA 2OQRA 1FYKA 3ULQB 2QBYA 1R1VA 4RB2C 1J2XA 3FXQA 3BWGA 2EJRA 3J80Z 3RI4A 3ECHA 4IF4A 4HYEA 1XN7A 1XCBA 1K79A 3HIFA 1A04A 3LQRA 4HBLA 2Y0MA 5E20A 1SFXA 3KLOA 4M9ZA 3R61A 4XSXF 4BHPA 4CZZA 4M6YA 1JGSA 2XRNA 2J5OA 3FMQA 3GEZA 1D5VA 5IT9K 2GQQA 4WXDA 1TBXA 4OMZA 2EFQA 1T2KA 3T8TA 1R5GA 1G3SA 3WTUC 4XLPF 1YQAA 1SD4A 1P4XA 1HSTA 1ON1A 3KZZA 4OINF 3C7JA 5E8GA 2P5VA 5DD4A 1ZG1A 2F5DA 2FNPA 4OIPF 2FEZA 3R0JA 5ERIA 3QRFF 4OOIA 1SFEA 2OD5A 5BS6A 2ZMEA 1XGOA 3KEOA 4HV6A 4YG2F 4IJAA 3I53A 2A68F 4P9FA 2DQRA 3F72A 2DU9A 5FD5A 5LRRA 4I0BA 4MQ9F 3E6MA 4L9NA 4GO1A 4U0VA 1YW7A 1I5ZA 2NNYA 2K86A 4A5NA 1P4WA 3K69A 2VBZA 1FWZA 5HDGA 3LSTA 4EQQA 5E1WA 2DI3A 2KJCA 4WF2A 4XLNF 2V9VA 1MJAA 1REPC 3VB2A 1YW9A 2HZTA 1RUNA 1ZYRF 3RTRA 3ZMVA 1HKTA 2M87A 1SFUA 2IA2A 4RAYA 4A5MA 4PZJA 4BNCA 4O6JA 3COAC 4LG0B 3B02A 1ZG3A 2RNJA 3HHHA 2G7HA 4YFXF 4LLNA 1YS6A 2V1DA 4KUMA 1BI2A 2QZ8A 1RIOH 4EMSA 1ZHFA 3FXUA 1P92A 3J7AO 3BPVA 3QOPA 1ZARA 3D0SA 3E3VA 2ZNZA 3QPTA 4Y17A 4I2OA 2HKOA 5L3GA 4I0AA 4Q47A 1TLHB 3T1BA 4O5VA 2HDCA 4L5IA 2JPCA 3ZQ7A 3MCZA 1Z05A 1IN4A 2VOOA 2DFIA 3QAHA 2FE3A 4EJOA 1P4AA 1BC8C 3ZP5A 3V8LA 4B8XA 2HYGD 1UHMA 4KFCA 2COMA 5CYVA 1ODDA 5EEGA 1O3TA 1FP2A 3GFLA 4KN4X 4HAMA 3V8JA 1TQIA 6PAXA 2O03A 3F6OA 4GYGA 2X0LA 3ERED 4LJZF 4EM1A 2MBFA 1T38A 2IPQX 5JI6A 4YIFA 3N97A 2WC2A 5LHHA 1O7LA 2AS5F 2QENA 4HF0A 5LLQA 2Y48A 1TQMA 4RGUA 2A6HF 3NRVA 5L3EA 3L7WA 2DK5A 5HLGA 2KKOA 4RB0A 2HEOA 1R58A 5BMZA 5F6FA 1D3YA 2BV6A 4IRHA 4N0BA 5D4SA 2ISYA 4N9HA 4O3MA 5HLHA 5D5UB 1Z1DA 2EK5A 4GGGA 1FX7A 3KFWX 4UXNA 1KU3A 1J0RA 1TW2A 4LFUA 5ICGA 4UNOA 3HRTA 5ICFA 2QQAA 5BQTA 1DPUA 1KGSA 3DKWA 1AOYA 2CFXA 4HQMA 1V3FA 3K0LA 5L3FA 1RI7A 2GA2A 3F8NA 2ACJA 5FLXZ 3GFMA 1WSUA 4LK0F 1KQ8A 1WI9A 2NS0A 3BP8A 2Z3YA 1MZBA 4CGZA 2GWRA 3MZYA 3IKTA 4PCQA 2CW0F 3HHGA 3JSPA 1IN5A 2LNBA 3I59A 3WE2A 4ZZLA 2M30A 2UZKA 3DP7A 5AONA 2B0LA 1FBQA 5D4RA 3MAJA 2IJLA 1Z6RA 4ON0A 4HF2A 5D6FA 4JQFA 4BAYA 5HDNA 1B9MA 2QWWA 2RQPA 5FD6A 5DUIA 3HRMA 4BHCA 1K78B 4B09A 1XDUA 4UV9A 4EJWA 3FX3A 4MNUA 2V6CA 3GFJA 4PGHA 3U9GA 3ISPA 1IXSB 2ETHA 2R7FA 2K02A 3TO7A 3DPTA 2VBWA 1IN8A 3JTHA 3TO9A 4PGGA 1H9TA 1EH7A 1E17A 5CVUA 1Z91A 5J8CA 5BPIA 3OOPA 3I64A 3CO6C 1H9GA 3KP2A 4M6XA 4QWQA 4U0WA 1IRGA 3BJ6A 2KRFA 1PDNC 5KK1A 2HFHA 1R36A 1ZGAA 5FO5A 1QZZA 2Z33A 1X3UA 2DTRA 3HOTA 4GYIA 1QGPA 1T6SA 2YPRA 2DQLA 1K6OA 4EM2A 4L9VA 4ZYDA 2W24A 2FQ3A 2VODA 1F5TA 4E70A 2QYOA 2CGPA 2JPBA 1SD5A 1FOKA 3ZN0A 3K2ZA 4EJTA 2OA4A 1S7OA 1YLFA 2VC0A 2ISZA 5TRDA 3KP4A 3EDPA 3NEUA 2VOPA 1HW2A 2A07F 2LDUA 2RC4A 3LWFA 3IC7A 2CQKA 5L3DA 5DCMA 4XSZF 3H3UA 3KP7A 2VT2A 4AIHA 4IHTA 4HOBA 1BN5A 4M74A 3MWMA 2DW4A 4U7BA 3JW4A 2ZJ2A 1R22A 5A2QK 3R6SA 2PMUA 4KICA 1IAWA 2HGCA 4RB3C 3GO5A 2GXGA 4FX0A 3TKYA 2A5YB 3IKVA 4A6DA 1W7PB 2VE9A 1V4RA 3QP5A 3V7SA 2WTEA 4BXUA 2MC3A 3DF8A 3LA7A 4U88A 4BQAA 1XGMA 4MTEA 1IUYA 3VEPA 3WTTC 3BJAA 1U5TA 2PG4A 3E6CC 3CUQB 2RVCA 3HTUA 5LEKA 1FLIA 4HZFA 4BYYA 3SZTA 2C6YA 2MLGA 2VONA 3KP3A 2E1CA 2HS5A 3HSFA 3QPHA 4S04A 1YIOA 1HW1A 4MTDA 4LB5A 1MJBA 1Z6TA 3ECOA 3WTVC 1USTA 3BOQA 2EA4A 5ILUA 5ICEA 5D5XB 2MH2A 2W25A 3ZMUA 4YIIA 5E17F 1O3RA 2Z5UA 4S05A 1U8RA 5KVRA 4M9SA 1U5TC 3JSOA 5BOXA 4UV8A 2P8TA 4EVIA 1BJAA 2RKHA 4A6EA 1IN7A 4RGRA 3VFZA 2F5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABU A;  1KU7 A;  2W57 A;  4FT8 A;  4HV5 A;  3I58 A;  1UHW A;  2PN6 A;  4ESF A;  4G9Y A;  4L18 B;  3BPX A;  3LQQ A;  3O2P E;  2XVC A;  3HUG A;  3C1D A;  3ZMD A;  1GXP A;  1LNW A;  2H6B A;  5FFZ A;  3FM3 A;  1IXR C;  2HWV A;  2F5F A;  3HSE A;  4IRI A;  3I5U A;  2CSO A;  2O0Y A;  4I02 A;  3W6J B;  2MA3 A;  3K1N A;  3IRQ A;  3CO7 C;  4XRF A;  3ZMS A;  2M5W A;  3U1D A;  2E7X A;  3HYI A;  3I71 A;  2HTJ A;  2NRA C;  2FMY A;  1H0M A;  3IHU A;  5F1R A;  2GIV A;  2KIU A;  3J81 K;  4AD9 A;  3B73 A;  3GZ6 A;  1USS A;  3HRU A;  4EJU A;  4ZYG A;  2M1B A;  1BC7 C;  3P7N A;  3WOD F;  4I7H A;  1EH6 A;  1R1U A;  2GZW A;  2L4A A;  2QM3 A;  1OYW A;  2DAO A;  1ZGJ A;  4AWX B;  3KCC A;  2PMH A;  4LGW A;  4Q5S F;  2BE5 F;  3R60 A;  2IRF G;  3BY6 A;  1HSJ A;  1SAX A;  3F8M A;  1TTY A;  2HQR A;  1HBX G;  4P9U A;  2STT A;  2DT5 A;  3GXO A;  5HOO A;  1LB2 A;  2QVO A;  3JAM Z;  3ELK A;  1XGS A;  2A3S A;  5JHU A;  1E2X A;  2RV8 A;  3L9F A;  1R5H A;  1WWX A;  2A61 A;  1YW8 A;  5L3B A;  2EB7 A;  1O3Q A;  1MDM B;  4AIJ A;  1T98 A;  1GHC A;  4DNC A;  2QQ9 A;  2EV5 A;  5LGN A;  1OPC A;  4HDU A;  2W84 A;  2XAF A;  1STZ A;  3FWE A;  1EV7 A;  4RAZ A;  3J80 K;  5H6R A;  2XHK A;  4HLY A;  2X4H A;  1QPM A;  1XDS A;  5F64 A;  4ZYH A;  3P9I A;  1I1S A;  2UXX A;  1BOA A;  1QBJ A;  4L9T A;  2ZO4 A;  3T5X A;  3RKW A;  2P6T A;  1ZG5 A;  4M72 A;  2EV6 A;  2EFN A;  1RNL A;  3HTS B;  5FGM A;  2R7D A;  2PFB A;  1L0O C;  2GA1 A;  2NNN A;  4UVC A;  2ZFW A;  3ZMT A;  3DQV C;  1MKM A;  3RKX A;  3S2W A;  2D45 A;  1B4A A;  2H6C A;  2EA2 A;  4BHB A;  4KMF A;  2PJP A;  4U0Y A;  2WV0 A;  2L3D A;  4MHG A;  4XBF A;  2Z9O A;  1ZLK A;  5K5O A;  3T0Y A;  5E1X A;  1Z9C A;  3QU6 A;  4MQV A;  4GCV A;  5DUK A;  2L4M A;  3M1E A;  2XGX A;  3DEU A;  1BIA A;  5CLS A;  1WQ2 A;  3K9T A;  3TO6 A;  1FYL A;  4RB1 A;  3RYR A;  4A0X A;  5D8L B;  2YR2 A;  2FA5 A;  3WTY C;  2DBB A;  2AXL A;  1LDJ A;  2IVM A;  3GVA A;  4N9I A;  1PP8 F;  3WG9 A;  1GXQ A;  1PP7 U;  3D5L A;  1LEA A;  1BBY A;  2DLL A;  4ETS A;  1KYZ A;  4GXO A;  2LKP A;  4RGS A;  1I1G A;  1FY7 A;  1IZ1 A;  1FSE A;  4WCG A;  2VE8 A;  2W85 A;  1BI1 A;  2PBI A;  2O3F A;  4LLG F;  5DCF A;  2IP2 A;  2XAS A;  1JXS A;  4G94 A;  4ENK A;  3ZN1 A;  3LAJ A;  3DFG A;  4LG0 A;  2EFO A;  1QQI A;  2G7U A;  3WTW C;  4LLL A;  1B59 A;  3F23 A;  3QP6 A;  3RDI A;  3L2C A;  5HS8 A;  3I54 A;  1HXD A;  2LF7 A;  4NQW A;  1CF7 B;  5HVQ C;  4WX9 A;  2YSR A;  3CUO A;  1UB9 A;  1ZRC A;  1G3T A;  4P5O A;  3GYH X;  1R23 A;  2ZCW A;  3OV8 A;  2P5L C;  2EFP A;  4AIK A;  4FHT A;  4HA8 A;  2ZXJ A;  2O6G E;  1HKQ A;  4Y13 A;  4PDK A;  3FMS A;  4A0Z A;  2OQG A;  4LMY A;  2DPD A;  1TQP A;  1SMT A;  1FYM A;  4HQE A;  4JBA A;  2QBY B;  4G7H F;  1XSD A;  4CHU A;  3PFI A;  4LD5 A;  3MEX A;  3F8C A;  1XSX A;  5K5Q A;  2PLY A;  5DYM A;  2FML A;  1L3L A;  3GF2 A;  2BBY A;  5IT9 Z;  4K2E A;  1UFM A;  3ZPL A;  4L9J A;  3KP5 A;  4HF1 A;  5FFX A;  3E6D A;  1HKS A;  4Y15 A;  3GZ5 A;  4G6D A;  2JSC A;  1BIB A;  1J7K A;  2HKX A;  2V1X A;  1FPQ A;  2LSO A;  1TNS A;  1BI0 A;  1T39 A;  4I09 A;  3F3X A;  1S3J A;  3DXJ F;  1FBS A;  4ENJ A;  4NHJ A;  4WK8 F;  3P9C A;  1J75 A;  4OIQ F;  4L0Z B;  1G6N A;  1D8K A;  1G4D A;  1K7A A;  2P7C B;  3E5Q A;  1CGP A;  3CTA A;  2FXA A;  3ABT A;  4DQ2 A;  4M9X A;  3CDH A;  3F8F A;  1Q1H A;  5LRS A;  3FMR A;  2P5K A;  1C0W A;  2ZME B;  3L00 A;  3PQJ A;  1UCR A;  3SQN A;  2NAZ A;  4Z2Y A;  5CVV A;  3Q9V A;  2Y75 A;  1KU2 A;  3FXR A;  5JR3 A;  1QO0 D;  1G3W A;  1ZH5 A;  4L0Y B;  2D2W A;  4Q48 A;  3F22 A;  1SD6 A;  1OYY A;  3ZMZ A;  2VT3 A;  1MD0 A;  3F8B A;  3MZH A;  4IPA A;  1P2F A;  3VOD A;  3EUH A;  1KU9 A;  3WU0 A;  3WTZ A;  1R00 A;  2HQN A;  5BPD A;  3TOA A;  3C18 A;  3LAP A;  3AAF A;  2HR3 A;  2OBP A;  1Z7U A;  2FF4 A;  1W5T A;  3BRO A;  3DPL C;  3KLN A;  1W5S A;  4R8H A;  2JZY A;  3EYY A;  2HTS A;  4OU0 A;  2IA1 A;  1BI3 A;  3IRR A;  5FLX K;  3LFK A;  1I27 A;  1HW5 A;  4LB6 B;  1P6R A;  3I4P A;  3E6B A;  3KEQ A;  5DV5 A;  1LQ1 A;  4EM0 B;  1WKM A;  3R0A A;  4P96 A;  3RPQ A;  2WWY A;  5K1Y A;  4FX4 A;  2V1U A;  1K78 A;  1YFH A;  2IT0 A;  2PEX A;  1ZRF A;  2XAG A;  5LBQ A;  5HS9 A;  5AIQ A;  2LF8 A;  2Z99 A;  3W6K B;  1OYI A;  4I01 A;  2RN7 A;  3FF5 A;  4MEX F;  3QU3 A;  4EGY A;  4KIB A;  1IW7 F;  2FBH A;  1O3S A;  3WE3 A;  2RDP A;  1XGN A;  2OZU A;  1JHH A;  1U2W A;  3T8R A;  2H94 A;  2XIG A;  1FP1 D;  3E5U A;  1S7A A;  1HQC A;  2M45 A;  2YU3 A;  5CVJ A;  4JK1 X;  4Q4Z F;  1Y0U A;  2RGV A;  1BM9 A;  5LGU A;  3HRS A;  1FNN A;  4ZYE A;  2A6E F;  2BEO A;  5EEH A;  2E1N A;  2R3S A;  5DDG A;  5J6X A;  3HOS A;  2YX4 A;  1FSH A;  5DD8 A;  3SZP A;  2Q2E A;  2PQ8 A;  5H20 A;  4LK1 F;  2O8X A;  1F4K A;  2STW A;  3O3K A;  2FRH A;  3TDZ C;  4HX7 A;  1MGT A;  1R7J A;  1W4M A;  2UWM A;  1YYV A;  2CYY A;  5TJJ A;  4IHS A;  2CWE A;  4ZZD A;  5L3C A;  3I0T A;  3HSR A;  2FBI A;  2XKP A;  1JHF A;  1KQ9 A;  2QQB A;  4QLC U;  2ZBK A;  1KYW A;  1OKR A;  4A12 A;  1IXC A;  1LDD A;  1YTY A;  2VXZ A;  1ON2 A;  3V8K A;  3K1P A;  5D6E A;  3PQK A;  5JFR A;  4ZH4 F;  1F9N A;  1J5Y A;  3VOE A;  3GWZ A;  1QNT A;  5CVR A;  2IW5 A;  2KIM A;  1O57 A;  2K27 A;  4H0E A;  2IA0 A;  3GW2 A;  4EV0 A;  2DO7 A;  4KN7 X;  5E8I A;  1YG2 A;  2MD5 A;  1W7P A;  1R1T A;  2A69 F;  4G7O F;  4ENM A;  2NYX A;  4EJV A;  5LEJ A;  4CYD A;  3ROU A;  4G8X A;  4ESB A;  4IVN A;  3P9K A;  4HX4 A;  3EET A;  3CUQ A;  4UVA A;  1LEB A;  1IN6 A;  1LVA A;  1U3E M;  3EYI A;  4IRG A;  5CVI A;  2TDX A;  4I98 B;  4RGX A;  3TOB A;  4NB5 A;  4RS8 A;  3DV8 A;  1KQ0 A;  2OAZ A;  3I59 B;  2FSW A;  3GLX A;  3MFK A;  1AWC A;  1MJ9 A;  3V4G A;  2P6S A;  3N4M A;  2ADU A;  3CUQ C;  5HLI A;  1J9I A;  1LDK B;  4YFK F;  5LHI A;  1XB4 A;  3LA2 A;  1B1B A;  2ESN A;  2L02 A;  2PI0 A;  5ICC A;  2GXB A;  5ILS A;  2ELH A;  4KYW A;  1G3Y A;  1ONV A;  1YO5 C;  3KP6 A;  5J8F A;  4KT5 C;  2ZKZ A;  2EWN A;  2OZ6 A;  3LA3 A;  2UXN A;  3TQN A;  2O61 A;  2FU4 A;  3WTS C;  4AVP A;  4EGZ A;  4UVB A;  2Q8K A;  3GUD A;  4OIR F;  3KE2 A;  5AIP A;  3O6B B;  3M8E A;  3C3W A;  1TNT A;  3BJO A;  3SXY A;  1XD7 A;  5HDK A;  1SMY F;  3H92 A;  1DUX C;  1U6G A;  5CJ9 A;  1XMA A;  1KA8 A;  1YS7 A;  5LHG A;  2VBX A;  3BDD A;  4KIF A;  2MLK A;  4OMY A;  3GX4 X;  4MEY F;  1QZY A;  3WGI A;  5E18 F;  1RZ4 A;  4G6Q A;  3WTX C;  2J5P A;  2H27 A;  1T0F A;  3MQ0 A;  2KIF A;  2L54 A;  1F1Z A;  1S6L A;  3WGG A;  2H09 A;  3EQL F;  4HLX A;  5ILV A;  2FBK A;  3E97 A;  1FT9 A;  2FNA A;  1I6X A;  3BZ6 A;  1O7F A;  2L01 A;  4TV7 A;  3E5X A;  3RPU A;  3R4K A;  5JVT A;  1JE8 A;  5ED4 A;  5A2Q Z;  2EFW A;  4CIC A;  3Q9S A;  1TW3 A;  3G3Z A;  5DCM B;  4M73 A;  1DPR A;  4ASN A;  3M9A A;  5FB2 A;  5IT3 A;  1J59 A;  4ENN A;  1MDM A;  2G9W A;  4HW0 A;  2BGC A;  1IF1 A;  1GVJ A;  5D5W B;  1XCV A;  2MH9 A;  4WWC A;  3JAM K;  4G7Z F;  4BH9 A;  4KMU X;  4ESJ A;  2F2E A;  1EH8 A;  1ZRE A;  1OR7 A;  3SFZ A;  2D1V A;  3TGN A;  2XAH A;  3Q5F A;  2VBY A;  3FZV A;  4IXA A;  4R79 A;  3RKY A;  4CO8 A;  4HX8 A;  2XAJ A;  2XRO A;  4KIG A;  4F7Z A;  3WU1 B;  2E7W A;  1U5T B;  3IWZ A;  1ZAO A;  4YFN F;  2JRT A;  2QUF A;  5K5R A;  3KET A;  1XSV A;  4M71 A;  3G73 A;  2JTV A;  2DPU A;  3CLO A;  1U78 A;  1FBU A;  1OMI A;  2VN2 A;  3IWF A;  4KDP A;  2CG4 A;  1ZRD A;  2XKO A;  2ZNY A;  4KNY A;  5D5V B;  4HDV A;  4A2U A;  3V7C A;  3FHZ A;  1B9N A;  3RJP A;  3RIR A;  2GAU A;  2V79 A;  5HS7 A;  1B6A A;  2F5E A;  3NQO A;  5LGT A;  2DK8 A;  2CO5 A;  2OU2 A;  4A0Y A;  2M8E A;  4UUV A;  3KZY A;  4D0P A;  2ESH A;  2XV4 S;  1WRJ A;  2Q0O A;  3M7G A;  1DDN A;  4UHT A;  1DP7 P;  1FC3 A;  3RYP A;  3J81 Z;  4WXH A;  4CDG A;  2FOK A;  1ZN2 A;  2K4B A;  1D8J A;  2HYF A;  3ML6 A;  3FM5 A;  2EV0 A;  1PUE E;  5D8K B;  1FZP B;  1S8N A;  4P55 A;  3JTG A;  4R1H A;  2BYV E;  1ZLJ A;  3TDU C;  3IL2 A;  4CXF A;  3K1M A;  4L5J A;  5E1Z B;  3SHF A;  2P4W A;  2VC1 A;  2XAQ A;  2HOE A;  3F6V A;  4MGR A;  1LJ9 A;  2YX7 A;  3H3Z A;  1S29 A;  2JT1 A;  5DEQ A;  3U2R A;  3GFI A;  3F21 A;  2QLZ A;  2P7V B;  4WXC A;  1SD7 A;  1XMK A;  3V7R A;  1CF7 A;  2KJB A;  3M8F A;  2K4J A;  4OIO F;  1IRF A;  2XUB A;  2K7L A;  3WGH A;  4KA4 A;  1ULY A;  1VTN C;  4U7D A;  2D1H A;  3REO A;  1W7P D;  3L09 A;  5H6Q A;  1RUO A;  1NHA A;  3CJN A;  2OQR A;  1FYK A;  3ULQ B;  2QBY A;  1R1V A;  4RB2 C;  1J2X A;  3FXQ A;  3BWG A;  2EJR A;  3J80 Z;  3RI4 A;  3ECH A;  4IF4 A;  4HYE A;  1XN7 A;  1XCB A;  1K79 A;  3HIF A;  1A04 A;  3LQR A;  4HBL A;  2Y0M A;  5E20 A;  1SFX A;  3KLO A;  4M9Z A;  3R61 A;  4XSX F;  4BHP A;  4CZZ A;  4M6Y A;  1JGS A;  2XRN A;  2J5O A;  3FMQ A;  3GEZ A;  1D5V A;  5IT9 K;  2GQQ A;  4WXD A;  1TBX A;  4OMZ A;  2EFQ A;  1T2K A;  3T8T A;  1R5G A;  1G3S A;  3WTU C;  4XLP F;  1YQA A;  1SD4 A;  1P4X A;  1HST A;  1ON1 A;  3KZZ A;  4OIN F;  3C7J A;  5E8G A;  2P5V A;  5DD4 A;  1ZG1 A;  2F5D A;  2FNP A;  4OIP F;  2FEZ A;  3R0J A;  5ERI A;  3QRF F;  4OOI A;  1SFE A;  2OD5 A;  5BS6 A;  2ZME A;  1XGO A;  3KEO A;  4HV6 A;  4YG2 F;  4IJA A;  3I53 A;  2A68 F;  4P9F A;  2DQR A;  3F72 A;  2DU9 A;  5FD5 A;  5LRR A;  4I0B A;  4MQ9 F;  3E6M A;  4L9N A;  4GO1 A;  4U0V A;  1YW7 A;  1I5Z A;  2NNY A;  2K86 A;  4A5N A;  1P4W A;  3K69 A;  2VBZ A;  1FWZ A;  5HDG A;  3LST A;  4EQQ A;  5E1W A;  2DI3 A;  2KJC A;  4WF2 A;  4XLN F;  2V9V A;  1MJA A;  1REP C;  3VB2 A;  1YW9 A;  2HZT A;  1RUN A;  1ZYR F;  3RTR A;  3ZMV A;  1HKT A;  2M87 A;  1SFU A;  2IA2 A;  4RAY A;  4A5M A;  4PZJ A;  4BNC A;  4O6J A;  3COA C;  4LG0 B;  3B02 A;  1ZG3 A;  2RNJ A;  3HHH A;  2G7H A;  4YFX F;  4LLN A;  1YS6 A;  2V1D A;  4KUM A;  1BI2 A;  2QZ8 A;  1RIO H;  4EMS A;  1ZHF A;  3FXU A;  1P92 A;  3J7A O;  3BPV A;  3QOP A;  1ZAR A;  3D0S A;  3E3V A;  2ZNZ A;  3QPT A;  4Y17 A;  4I2O A;  2HKO A;  5L3G A;  4I0A A;  4Q47 A;  1TLH B;  3T1B A;  4O5V A;  2HDC A;  4L5I A;  2JPC A;  3ZQ7 A;  3MCZ A;  1Z05 A;  1IN4 A;  2VOO A;  2DFI A;  3QAH A;  2FE3 A;  4EJO A;  1P4A A;  1BC8 C;  3ZP5 A;  3V8L A;  4B8X A;  2HYG D;  1UHM A;  4KFC A;  2COM A;  5CYV A;  1ODD A;  5EEG A;  1O3T A;  1FP2 A;  3GFL A;  4KN4 X;  4HAM A;  3V8J A;  1TQI A;  6PAX A;  2O03 A;  3F6O A;  4GYG A;  2X0L A;  3ERE D;  4LJZ F;  4EM1 A;  2MBF A;  1T38 A;  2IPQ X;  5JI6 A;  4YIF A;  3N97 A;  2WC2 A;  5LHH A;  1O7L A;  2AS5 F;  2QEN A;  4HF0 A;  5LLQ A;  2Y48 A;  1TQM A;  4RGU A;  2A6H F;  3NRV A;  5L3E A;  3L7W A;  2DK5 A;  5HLG A;  2KKO A;  4RB0 A;  2HEO A;  1R58 A;  5BMZ A;  5F6F A;  1D3Y A;  2BV6 A;  4IRH A;  4N0B A;  5D4S A;  2ISY A;  4N9H A;  4O3M A;  5HLH A;  5D5U B;  1Z1D A;  2EK5 A;  4GGG A;  1FX7 A;  3KFW X;  4UXN A;  1KU3 A;  1J0R A;  1TW2 A;  4LFU A;  5ICG A;  4UNO A;  3HRT A;  5ICF A;  2QQA A;  5BQT A;  1DPU A;  1KGS A;  3DKW A;  1AOY A;  2CFX A;  4HQM A;  1V3F A;  3K0L A;  5L3F A;  1RI7 A;  2GA2 A;  3F8N A;  2ACJ A;  5FLX Z;  3GFM A;  1WSU A;  4LK0 F;  1KQ8 A;  1WI9 A;  2NS0 A;  3BP8 A;  2Z3Y A;  1MZB A;  4CGZ A;  2GWR A;  3MZY A;  3IKT A;  4PCQ A;  2CW0 F;  3HHG A;  3JSP A;  1IN5 A;  2LNB A;  3I59 A;  3WE2 A;  4ZZL A;  2M30 A;  2UZK A;  3DP7 A;  5AON A;  2B0L A;  1FBQ A;  5D4R A;  3MAJ A;  2IJL A;  1Z6R A;  4ON0 A;  4HF2 A;  5D6F A;  4JQF A;  4BAY A;  5HDN A;  1B9M A;  2QWW A;  2RQP A;  5FD6 A;  5DUI A;  3HRM A;  4BHC A;  1K78 B;  4B09 A;  1XDU A;  4UV9 A;  4EJW A;  3FX3 A;  4MNU A;  2V6C A;  3GFJ A;  4PGH A;  3U9G A;  3ISP A;  1IXS B;  2ETH A;  2R7F A;  2K02 A;  3TO7 A;  3DPT A;  2VBW A;  1IN8 A;  3JTH A;  3TO9 A;  4PGG A;  1H9T A;  1EH7 A;  1E17 A;  5CVU A;  1Z91 A;  5J8C A;  5BPI A;  3OOP A;  3I64 A;  3CO6 C;  1H9G A;  3KP2 A;  4M6X A;  4QWQ A;  4U0W A;  1IRG A;  3BJ6 A;  2KRF A;  1PDN C;  5KK1 A;  2HFH A;  1R36 A;  1ZGA A;  5FO5 A;  1QZZ A;  2Z33 A;  1X3U A;  2DTR A;  3HOT A;  4GYI A;  1QGP A;  1T6S A;  2YPR A;  2DQL A;  1K6O A;  4EM2 A;  4L9V A;  4ZYD A;  2W24 A;  2FQ3 A;  2VOD A;  1F5T A;  4E70 A;  2QYO A;  2CGP A;  2JPB A;  1SD5 A;  1FOK A;  3ZN0 A;  3K2Z A;  4EJT A;  2OA4 A;  1S7O A;  1YLF A;  2VC0 A;  2ISZ A;  5TRD A;  3KP4 A;  3EDP A;  3NEU A;  2VOP A;  1HW2 A;  2A07 F;  2LDU A;  2RC4 A;  3LWF A;  3IC7 A;  2CQK A;  5L3D A;  5DCM A;  4XSZ F;  3H3U A;  3KP7 A;  2VT2 A;  4AIH A;  4IHT A;  4HOB A;  1BN5 A;  4M74 A;  3MWM A;  2DW4 A;  4U7B A;  3JW4 A;  2ZJ2 A;  1R22 A;  5A2Q K;  3R6S A;  2PMU A;  4KIC A;  1IAW A;  2HGC A;  4RB3 C;  3GO5 A;  2GXG A;  4FX0 A;  3TKY A;  2A5Y B;  3IKV A;  4A6D A;  1W7P B;  2VE9 A;  1V4R A;  3QP5 A;  3V7S A;  2WTE A;  4BXU A;  2MC3 A;  3DF8 A;  3LA7 A;  4U88 A;  4BQA A;  1XGM A;  4MTE A;  1IUY A;  3VEP A;  3WTT C;  3BJA A;  1U5T A;  2PG4 A;  3E6C C;  3CUQ B;  2RVC A;  3HTU A;  5LEK A;  1FLI A;  4HZF A;  4BYY A;  3SZT A;  2C6Y A;  2MLG A;  2VON A;  3KP3 A;  2E1C A;  2HS5 A;  3HSF A;  3QPH A;  4S04 A;  1YIO A;  1HW1 A;  4MTD A;  4LB5 A;  1MJB A;  1Z6T A;  3ECO A;  3WTV C;  1UST A;  3BOQ A;  2EA4 A;  5ILU A;  5ICE A;  5D5X B;  2MH2 A;  2W25 A;  3ZMU A;  4YII A;  5E17 F;  1O3R A;  2Z5U A;  4S05 A;  1U8R A;  5KVR A;  4M9S A;  1U5T C;  3JSO A;  5BOX A;  4UV8 A;  2P8T A;  4EVI A;  1BJA A;  2RKH A;  4A6E A;  1IN7 A;  4RGR A;  3VFZ A;  2F5C A; 
#chains in the Genus database with same CATH topology
 2B9S A;  3ABU A;  1ETW A;  2K9S A;  4QIW N;  1KU7 A;  2W57 A;  4FT8 A;  2QF7 A;  4HV5 A;  3VWB A;  2RRE A;  3I58 A;  1WJF A;  2HNH A;  1UHW A;  1A35 A;  3W3C A;  2LR8 A;  2PN6 A;  4ESF A;  4G9Y A;  5IPA A;  5C4J J;  3BPX A;  3LQQ A;  4L18 B;  3O2P E;  1JUP A;  2XVC A;  4BBS J;  3HUG A;  3C1D A;  3BZC A;  1FTZ A;  4ZYA A;  4F3Q A;  3ZMD A;  1GXP A;  1JKQ C;  1LNW A;  2H6B A;  5FFZ A;  2LOO A;  4XNF A;  2OCE A;  3H9J A;  1D5Y A;  4M3B A;  3FM3 A;  1IXR C;  2HWV A;  2F5F A;  3HSE A;  1ETO A;  1ZK8 A;  1NH3 A;  4IRI A;  2DMU A;  5GAE J;  3DCF A;  1XS9 A;  1GV5 A;  3I5U A;  5FKL A;  2CSO A;  2O0Y A;  3JRH A;  3HDD A;  1Y1W J;  5E79 C;  4I02 A;  3W6J B;  2MA3 A;  3K1N A;  3IRQ A;  3CO7 C;  2RNG A;  1X1P A;  3BC8 A;  4XRF A;  3ZMS A;  2XSD C;  2M5W A;  2WA0 A;  3H9Q A;  4XRM A;  3U1D A;  2E7X A;  3HYI A;  3I71 A;  4HEA 2;  2HTJ A;  2LRD A;  2R7T A;  2NRA C;  2FMY A;  1OLT A;  1H0M A;  3IHU A;  4HSR A;  5F1R A;  3H5N A;  4XK4 A;  1ZQ3 P;  2GIV A;  2KIU A;  3J81 K;  4AD9 A;  1K6Y A;  3B73 A;  3KYL A;  3GZ6 A;  2Y0S N;  2DMQ A;  1USS A;  3IUO A;  3TW7 A;  3HRU A;  4EJU A;  1JTY A;  4ZYG A;  4A3B J;  3AG3 H;  2M1B A;  3H1C A;  1RR8 C;  3PIP F;  1BC7 C;  4RLQ A;  3P7N A;  1TWG J;  3SZG A;  3WOD F;  2M4K A;  4XRS G;  4I7H A;  2X9D A;  2PMZ N;  1EH6 A;  2Q1Z B;  1R1U A;  3RCO A;  2GZW A;  2XF7 A;  2L4A A;  4LIV A;  2QM3 A;  1OYW A;  3L2U A;  2DAO A;  1ZGJ A;  2XPW A;  2R7X A;  4AWX B;  4S0H B;  2M7B A;  3KCC A;  2PMH A;  3AG4 H;  3QPS A;  4LGW A;  5FRO A;  1Y39 A;  4Q5S F;  2BE5 F;  3ESW B;  1VQ7 I;  2V1N A;  4LIT A;  3R60 A;  3ZQI A;  2JWT A;  1E3P A;  2IRF G;  1ZTR A;  2VIX A;  3DKX A;  4FTH A;  1B72 A;  2CRG A;  3BY6 A;  2DA4 A;  1HSJ A;  1SAX A;  3FKJ A;  2KL4 A;  2UV1 A;  4F55 A;  1W36 D;  1HDD C;  3F8M A;  3GTO J;  4UUS B;  1TTY A;  2DOF A;  2HQR A;  2DFH A;  2M0M A;  5E3O A;  4P9U A;  1HBX G;  3JRD A;  4BXX J;  2STT A;  3GBG A;  2DT5 A;  4XID A;  3GXO A;  3W2W A;  2X1D A;  5HOO A;  3V42 A;  1LB2 A;  3BCB A;  4E6K G;  2QVO A;  4DZP A;  4MLO A;  1ORK A;  3JAM Z;  4XMY A;  2JK3 A;  2DJN A;  3ELK A;  2R93 J;  1XGS A;  2A3S A;  1RES A;  5JHU A;  1E2X A;  2RV8 A;  3L9F A;  4Y52 J;  1R5H A;  1WWX A;  2FX0 A;  2A61 A;  1YW8 A;  5L3B A;  4BEH A;  3QOE A;  4IEJ A;  2EB7 A;  2KFD A;  1O3Q A;  1GUU A;  1TWA J;  1MDM B;  4AIJ A;  1T98 A;  1GHC A;  4DNC A;  3DLL F;  2QQ9 A;  2EV5 A;  5LGN A;  1R9T J;  4ITV A;  4AM3 A;  1OPC A;  4HDU A;  4V2F A;  1MMA A;  3FXK A;  2W84 A;  3I56 I;  3QQA A;  2NVX J;  2XAF A;  1MMG A;  1STZ A;  2VQH A;  3FWE A;  1JKP C;  3FK7 A;  1EV7 A;  4RAZ A;  1ETQ A;  2VAS A;  2HDW A;  5GAD J;  3J80 K;  3H0D A;  1LFU P;  3G2B A;  3M07 A;  2M2E A;  1SFK A;  2H1K A;  1T95 A;  5H6R A;  3A0B C;  3ABM H;  4FCY A;  2XHK A;  2Y0S A;  4HLY A;  2X4H A;  1QPM A;  1XDS A;  5F64 A;  2XPU A;  4ZYH A;  3DTK A;  3P9I A;  1I1S A;  2OCC H;  2UXX A;  2R5Y A;  1TC3 C;  1BOA A;  2CS3 A;  1R5I D;  1QHH D;  1QBJ A;  4L9T A;  1IJW C;  3U1K A;  3BTC A;  2O7O A;  1N75 A;  3LL7 A;  1WJA A;  2ZO4 A;  2M34 A;  4G12 A;  5GAH J;  3T5X A;  1JT6 A;  3RKW A;  2P6T A;  3S1N J;  5FJ8 J;  1ZG5 A;  4M72 A;  5KNL A;  2OUM A;  2EV6 A;  2EFN A;  4E7Z A;  1RNL A;  3A03 A;  1H88 C;  4YEJ A;  5FGM A;  3HTS B;  2R4G A;  2R7D A;  2PFB A;  1L0O C;  2GA1 A;  2NNN A;  2QSG X;  4PJN A;  1JJ8 C;  4UVC A;  2GOM A;  4DBQ A;  5M3M J;  2ZFW A;  1HC8 A;  2L9V A;  4JX6 A;  4PJM A;  3ZMT A;  2R0Q C;  3DQV C;  1MKM A;  3RKX A;  3S2W A;  2D45 A;  1B4A A;  2H6C A;  2EA2 A;  4BHB A;  4KMF A;  1ETK A;  2PJP A;  4U0Y A;  2WV0 A;  2DA5 A;  2L3D A;  4MHG A;  4XBF A;  2Z9O A;  2DFE A;  1ZLK A;  5K5O A;  3T0Y A;  2DDB A;  2HXI A;  5E1X A;  1Z9C A;  1RPW A;  3QU6 A;  3MKL A;  4MQV A;  2EZK A;  4GCV A;  5DUK A;  2L4M A;  3IP4 B;  5J1Y A;  3M1E A;  2N8G A;  2XGX A;  3IH4 A;  3E7L A;  5KAF C;  3DEU A;  1BIA A;  5CLS A;  1WQ2 A;  3TP0 A;  4FIS A;  4BU2 A;  1OQY A;  3K9T A;  3O8H A;  3TO6 A;  1FYL A;  4RB1 A;  3AKZ A;  3HC7 A;  1GV2 A;  3RYR A;  4XLE A;  4A0X A;  1MMS A;  3QYB A;  2MYS A;  5D8L B;  2YR2 A;  2FA5 A;  2Y9Y A;  3JRB A;  2W4S A;  2W00 A;  3WTY C;  5EGO B;  2DBB A;  1ETV A;  1MND A;  1JT0 A;  2AXL A;  1LDJ A;  2IVM A;  2H8W A;  2V4J C;  3GVA A;  3PUB A;  4N9I A;  1PP8 F;  3WG9 A;  1W5C C;  3CF2 A;  1GXQ A;  1PP7 U;  3D5L A;  3U21 A;  1LEA A;  3KYC B;  4BL0 B;  1BBY A;  4HNV A;  1HLV A;  1APL C;  2DLL A;  2KT0 A;  4ETS A;  3I4N J;  1KYZ A;  4GXO A;  2LKP A;  5F0C A;  3W2A A;  4RGS A;  3HOU J;  3OYC A;  1I1G A;  1FY7 A;  1IZ1 A;  2YUS A;  1FSE A;  4WCG A;  1R71 A;  2VE8 A;  2W85 A;  4C30 A;  1BI1 A;  2PBI A;  1ZGW A;  2O3F A;  4LLG F;  5DCF A;  4B47 A;  2IP2 A;  2XAS A;  1JXS A;  4G94 A;  2V7F A;  2ZXW H;  1Z3Y A;  4ENK A;  3ZN1 A;  2XAU A;  3LAJ A;  3DFG A;  2VL8 A;  2AHQ A;  4LG0 A;  2L7Z A;  2EFO A;  5F08 A;  5EDN A;  3K4J A;  1QQI A;  2G7U A;  1WI3 A;  2X6O A;  3CMM A;  3PNY A;  2E35 A;  4BQO A;  1I3A A;  2K9L A;  3WTW C;  4PJJ A;  4LLL A;  1B59 A;  4B48 A;  3F23 A;  3QP6 A;  3RDI A;  1ETY A;  3VDX A;  4V19 K;  1X4O A;  3L2C A;  5HS8 A;  3I54 A;  5F04 A;  1HXD A;  5FRN A;  2LF7 A;  5M5W J;  1VI0 A;  4NQW A;  1CF7 B;  4CA0 A;  5HVQ C;  4WX9 A;  2YSR A;  3B6A A;  2COB A;  3CUO A;  1Y56 A;  1UB9 A;  1ZRC A;  1G3T A;  4P5O A;  2CJJ A;  3SDG A;  3BR5 A;  2UUZ A;  1RR7 A;  3OYF A;  1FTT A;  3GYH X;  1R23 A;  2ZCW A;  3OV8 A;  2P5L C;  2QKL B;  1J09 A;  2IS1 A;  2EFP A;  4AIK A;  4FHT A;  4HA8 A;  2OTL I;  2ZXJ A;  3S15 J;  2O6G E;  4GFB A;  1HKQ A;  4Y13 A;  3CZ6 A;  4PDK A;  3CCU I;  3FMS A;  4A0Z A;  2OQG A;  4LMY A;  3DPU A;  2DPD A;  1TQP A;  1MBK A;  2EBI A;  1SMT A;  5FKM A;  1LVK A;  2K5C A;  4AU7 A;  1BW5 A;  5GP9 A;  3FXL A;  1FYM A;  5B1A H;  4HQE A;  4JBA A;  3ASO H;  3LSI A;  2QBY B;  4G7H F;  1XSD A;  4CHU A;  3PFI A;  4LD5 A;  3MEX A;  1YRN A;  3F8C A;  1N77 A;  1XSX A;  3N05 A;  1PVE A;  5K5Q A;  1IUF A;  2M7A A;  3G1O A;  2PLY A;  5DYM A;  2FML A;  1L3L A;  3GF2 A;  2BBY A;  5IT9 Z;  4K2E A;  1OFC X;  2CFO A;  2DJI A;  4CCJ A;  1UFM A;  3ZPL A;  5FLM J;  4L9J A;  3E1S A;  3KP5 A;  3TBI A;  4BJ5 C;  3PL8 A;  3GME A;  4HF1 A;  1VQL I;  3KX2 A;  5FFX A;  2KLO A;  3E6D A;  1TWH J;  1HKS A;  2MFZ A;  4Y15 A;  3GZ5 A;  3M1C A;  4G6D A;  4E4H A;  4IKF A;  2JSC A;  1BL0 A;  1BIB A;  1R4M B;  3HG9 A;  2VKE A;  1J7K A;  4YRV A;  3SEQ A;  2AQE A;  4IQJ A;  5E3M A;  3BCA A;  2XPV A;  2HKX A;  2V1X A;  1FPQ A;  2LSO A;  1TNS A;  1BI0 A;  2MC4 A;  3DKY A;  1T39 A;  1WFX A;  2IGN A;  4NDL A;  4I09 A;  3F3X A;  4PSW A;  2LH9 A;  1S3J A;  2DT6 A;  3DXJ F;  2QSH X;  3BG9 A;  3B6C A;  5DTD A;  3BQZ A;  1FBS A;  5IYB J;  4XOR A;  4ENJ A;  4NHJ A;  2LBF B;  1WHU A;  4WK8 F;  3OYI A;  2M3A A;  4NC6 A;  2E60 A;  3P9C A;  3JR9 A;  1J75 A;  4OIQ F;  5EZG A;  4L0Z B;  4BDY A;  3MKY B;  3CDL A;  1G6N A;  1D8K A;  3F0C A;  1G4D A;  4DBR A;  1T33 A;  1K7A A;  4V2G A;  2P7C B;  3S1Q J;  1ZKG A;  3E5Q A;  1U9N A;  4AUX A;  1CGP A;  1F36 A;  4B4C A;  2DA3 A;  3FXJ A;  3CTA A;  3TED A;  3FK6 A;  2FXA A;  3PNT A;  1FOY A;  2CH0 A;  3ABT A;  4DQ2 A;  1V5F A;  2Y30 A;  4M9X A;  2KIS A;  2BW3 A;  3ZGK A;  1H89 C;  3CDH A;  3F8F A;  4A93 J;  3PO3 J;  1Q1H A;  5LRS A;  3FMR A;  2P5K A;  1C0W A;  2ZME B;  3L00 A;  3PQJ A;  1UCR A;  2EIK H;  3VYS B;  3SQN A;  2NAZ A;  1YJN I;  3BG3 A;  3WG7 H;  3HXL A;  4Z2Y A;  3S17 J;  5CVV A;  3Q9V A;  2Y75 A;  3M8J A;  1BR4 A;  1KU2 A;  1G8X A;  3FXR A;  5JR3 A;  1QO0 D;  1G3W A;  1ZH5 A;  4X0G A;  1X19 A;  4L0Y B;  2ZFU A;  2D2W A;  3DEW A;  4AYB N;  4Q48 A;  3F22 A;  1SD6 A;  5IOY A;  4A3M J;  1ETX A;  1OYY A;  3ZMZ A;  2VT3 A;  1MD0 A;  3GTJ J;  3F8B A;  3MZH A;  4IPA A;  1P2F A;  1SVM A;  3VOD A;  4BUP A;  4Y3O A;  3HM5 A;  2CU7 A;  3EUH A;  1KU9 A;  3WU0 A;  3WTZ A;  3OY9 A;  1R00 A;  2HQN A;  3L2Q A;  5BPD A;  1DGW Y;  3TOA A;  3BG7 A;  3C18 A;  3LAP A;  3AAF A;  1Y1V J;  2HR3 A;  2JMW A;  2OBP A;  4NC7 A;  1Z7U A;  2XGD A;  3LSR A;  1LPQ A;  2PJR B;  2FF4 A;  1NTC A;  1W5T A;  3BRO A;  2KIQ A;  3DPL C;  2GXA A;  3KLN A;  2ZSH B;  1Y8Q B;  1W5S A;  4PFP A;  1U8B A;  4R8H A;  1JGG A;  2JZY A;  3EYY A;  4CSW A;  2FD5 A;  4M3E A;  3K6G A;  1YJW I;  2HTS A;  4OU0 A;  5J4V A;  5HLT A;  3LMM A;  2IA1 A;  1BI3 A;  2BXY A;  1WZ2 A;  2OC6 A;  1V55 H;  3IRR A;  5FLX K;  5F0F A;  3S2D J;  1QVT A;  3LFK A;  1DQU A;  3WU2 C;  1I27 A;  1HW5 A;  4LB6 B;  1S5L C;  3DTI A;  1P6R A;  2F4I A;  3E6B A;  3I4P A;  3IV5 A;  2NS8 A;  3MN2 A;  5GAG J;  3KEQ A;  5DV5 A;  3EUH C;  2BHZ A;  2BXZ A;  1LQ1 A;  4EM0 B;  1WKM A;  3R0A A;  4P96 A;  3RPQ A;  5H2F C;  2WWY A;  5K1Y A;  2K9N A;  1D1C A;  4F93 B;  3CCL I;  1LE8 B;  4FX4 A;  2V1U A;  5JLW A;  5IY5 H;  1K78 A;  2CV1 A;  1YFH A;  3FIW A;  2IT0 A;  1B8I B;  1A5J A;  2PEX A;  3X2Q H;  1ZRF A;  2CV0 A;  4XKV A;  2XAG A;  5J1U A;  5LBQ A;  5HS9 A;  5AIQ A;  3CCQ I;  2DMT A;  2DTZ A;  2LF8 A;  4QTR A;  2ZJR F;  2VUM J;  2Z99 A;  3A0H C;  3W6K B;  2O5R A;  3CCV I;  1OYI A;  4I01 A;  2W48 A;  2RN7 A;  2VJ4 A;  3OYA A;  3FF5 A;  3H0G J;  3MVP A;  1OCC H;  4MEX F;  3QU3 A;  4EGY A;  3GTM J;  1ZR2 A;  1X3Z B;  4CCN A;  1Y6I A;  1DU6 A;  3PNV A;  4KIB A;  2EIJ H;  3CDI A;  4P1W A;  2LC2 A;  1JUS A;  1IW7 F;  2FBH A;  4AYB A;  5JHF A;  1O3S A;  2L7K A;  3PSI A;  2L7F P;  4XLA A;  2DCE A;  3WE3 A;  2RDP A;  1XGN A;  4C3H J;  2P81 A;  2OZU A;  1JHH A;  4LIU A;  5F1J A;  5TGT A;  1U2W A;  2XSJ C;  2H94 A;  2XIG A;  3T8R A;  1FP1 D;  1A36 A;  1GDT A;  1W0T A;  3D5S C;  3E5U A;  2GM4 A;  1S7A A;  4RBO A;  1HQC A;  3HZJ A;  4ABZ A;  2M45 A;  2YU3 A;  5CVJ A;  1MH3 A;  4JK1 X;  2R7Q A;  1Y0U A;  2RGV A;  4Q4Z F;  4XM3 A;  1BM9 A;  4RMN A;  3LSP A;  3CC7 I;  4BXF A;  3OOU A;  5LGU A;  3HRS A;  1FNN A;  4IOA F;  5CKT A;  4ZYE A;  2A6E F;  1T08 B;  2BEO A;  1XC5 A;  5EEH A;  1TWC J;  1OCZ H;  2E1N A;  1K4T A;  2R3S A;  3HEF A;  2X1E A;  3OYB A;  2JJ7 A;  1MBF A;  5DDG A;  2RQQ A;  1IRX A;  2BZT A;  2YX4 A;  5J6X A;  3HOS A;  2DOD A;  5DD8 A;  3BG5 A;  3SZP A;  1FSH A;  4DZJ A;  5J3L A;  2Q2E A;  2PQ8 A;  5H20 A;  3BR2 A;  1JJ6 C;  2NVU B;  2IEK A;  1XX5 A;  2XC7 A;  1ERD A;  4LK1 F;  2O8X A;  2AXT C;  1F4K A;  2STW A;  3O3K A;  2JVH A;  2FRH A;  3TDZ C;  5M5X J;  2R92 J;  4HX7 A;  1MGT A;  1R7J A;  3HKZ N;  1W4M A;  2UWM A;  1YYV A;  2CYY A;  5TJJ A;  2JRM A;  4II3 A;  2CWE A;  1MNM C;  4IHS A;  4ZZD A;  3AL0 C;  2ID3 A;  5L3C A;  3I0T A;  3AFH A;  5IYC J;  3K70 D;  1RC9 A;  3HSR A;  1MH4 A;  2FBI A;  2XKP A;  2CW8 A;  1JHF A;  1KQ9 A;  2QQB A;  4QLC U;  3IH2 A;  2ZBK A;  1KYW A;  1OKR A;  4A12 A;  4KJZ A;  2ME6 A;  1IXC A;  2X6W A;  2IAI A;  5M3F J;  1LDD A;  3DLA A;  3LSG A;  4XR6 A;  1YTY A;  2VXZ A;  1ON2 A;  3V8K A;  3K1P A;  3OIO A;  2R7S A;  4KIS A;  2LK2 A;  1OCT C;  5D6E A;  4FET A;  4E7J A;  3JRC A;  3PQK A;  4I99 C;  5EYR A;  1Y8R B;  2QSF X;  5JFR A;  4ZH4 F;  1F9N A;  5EG0 B;  1AKH A;  2L7M P;  1J5Y A;  3VOE A;  3GWZ A;  5FRM A;  1QNT A;  2DFF A;  5CVR A;  3OIQ A;  2IW5 A;  5EZH A;  5FKK A;  2KIM A;  2NS7 A;  3OYH A;  1O57 A;  2K27 A;  4H0E A;  3MZ8 A;  4DYQ A;  3HL2 A;  4M3F A;  2JA5 J;  2IA0 A;  1FOX A;  2HQA A;  3GW2 A;  4EV0 A;  2DO7 A;  3OYE A;  4A3J J;  4KN7 X;  5E8I A;  1YG2 A;  5C4X J;  2MD5 A;  1VQP I;  4Y33 A;  2BVM A;  1S7E A;  1W7P A;  3QPL A;  1UEL B;  4XIC A;  1R1T A;  2A69 F;  4G7O F;  3S8P A;  2JA7 J;  4ENM A;  1R4N B;  2DT7 B;  3RPU D;  2NYX A;  4EJV A;  5LEJ A;  2JA2 A;  4CYD A;  4E7K A;  4XKC A;  3ROU A;  4AID A;  4G8X A;  4ESB A;  3H5R A;  2DOE A;  3JRG A;  4IVN A;  3P9K A;  2HXO A;  4HX4 A;  4UUT A;  2HOS A;  3EET A;  3CUQ A;  5KHD A;  4D7N A;  2K9M A;  3ABL H;  1VZ0 A;  2JUC A;  1OCO H;  4NUB A;  4PSX A;  4UVA A;  2LYC A;  1HOM A;  1LEB A;  1QHG A;  1IN6 A;  1LVA A;  1U3E M;  3OYK A;  1HA8 A;  3EYI A;  4IRG A;  2ID6 A;  4B1R A;  1SFO J;  5CVI A;  2DYS H;  2TDX A;  3ZQG A;  4I98 B;  3S3N A;  2DA1 A;  1E3H A;  2VQC A;  4RGX A;  3DBR B;  3TOB A;  4NB5 A;  4RS8 A;  3DV8 A;  1KQ0 A;  2K85 A;  2OAZ A;  3S3M A;  3I59 B;  2VQG A;  4BE0 A;  2FSW A;  3GLX A;  3J7A Y;  2W7N A;  2R7V A;  3MFK A;  2ZXI A;  3A02 A;  5FLV A;  1K83 J;  4LOC A;  2XDV A;  1AWC A;  3OS2 A;  3OMY A;  1MJ9 A;  1FIP A;  3S93 A;  3V4G A;  4PFO A;  2PMZ A;  1QRY A;  3BR0 A;  1PUF A;  4OAY A;  2P6S A;  3N4M A;  2ADU A;  3CCM I;  3CUQ C;  2WAQ N;  5HLI A;  1J9I A;  1LDK B;  4YFK F;  5LHI A;  2QGU A;  1IRZ A;  4CH7 A;  1XB4 A;  3LA2 A;  1B1B A;  3BR3 A;  4A3E J;  2ESN A;  2KHM A;  2L02 A;  3CJT B;  2JA8 J;  2PI0 A;  3KPH A;  5ICC A;  2GXB A;  2Z1D A;  1T56 A;  3D1N I;  5ILS A;  2ELH A;  4KYW A;  4FAS D;  4BDZ A;  3ZCO A;  4JP0 A;  3G1M A;  3A01 B;  1G3Y A;  1ONV A;  3OR1 C;  3RSN A;  3QOD A;  1YO5 C;  3KP6 A;  5J8F A;  4KT5 C;  1BW6 A;  2E19 A;  1CQT A;  2ZKZ A;  4MO7 A;  4LG3 A;  2EWN A;  2JUG A;  2W82 A;  2OZ6 A;  3LA3 A;  2UXN A;  4QPO A;  5B3S H;  3TQN A;  2HPI A;  2O61 A;  2DXI A;  1DP3 A;  2FU4 A;  1E0E A;  3WTS C;  1F43 A;  2YS9 A;  3NAU A;  1T8I A;  3RZD J;  4AVP A;  4DJA A;  2IXS A;  2M8G X;  2MW8 A;  4EGZ A;  2ME0 A;  1SC7 A;  3L1P A;  3TL4 X;  4UVB A;  1U9O A;  1XG1 A;  4I76 A;  2Q8K A;  3GUD A;  4OIR F;  1YIT I;  3KE2 A;  5AIP A;  4I6Z A;  3O6B B;  4DYR A;  3M8E A;  3C3W A;  3CP2 A;  1JTX A;  1TNT A;  2BY1 A;  3BJO A;  2VI6 A;  1Z77 A;  4BBR J;  5J1R A;  2R5Z B;  2M4G A;  3SXY A;  1XD7 A;  5HDK A;  3H3V K;  3ONQ A;  1SMY F;  1OCR H;  3H92 A;  2ECB A;  1DUX C;  1FMW A;  1LFP A;  1U6G A;  3C2B A;  5CJ9 A;  3EUK L;  1XMA A;  1KA8 A;  3CMY A;  1YS7 A;  1IV8 A;  5LHG A;  3ZR8 X;  2EH3 A;  2VBX A;  2LVS A;  2L0K A;  3BDD A;  4A3L J;  4KIF A;  2MLK A;  1AU7 A;  2Z16 A;  1U0J A;  3EUA A;  3GX4 X;  4OMY A;  4MEY F;  1IGN A;  1QZY A;  4BE1 A;  3K7A J;  3WGI A;  3K10 A;  5E18 F;  1RZ4 A;  4G6Q A;  4X6A J;  3WTX C;  4A3F J;  2J5P A;  5LD2 C;  3LSK A;  4OAZ A;  1TWF J;  2IS4 A;  2H27 A;  3Q0U A;  1FIA A;  1T0F A;  3MQ0 A;  2OV7 A;  2ELK A;  1R49 A;  1KZH A;  2KIF A;  2L54 A;  1F1Z A;  1S6L A;  3WGG A;  2H09 A;  3EQL F;  3CJQ B;  1Z21 A;  4HLX A;  3K70 C;  4HRI A;  2MG4 A;  5ILV A;  4CCK A;  2FBK A;  3I3L A;  1KON A;  2CUJ A;  3E97 A;  3FKI J;  1FT9 A;  2F5V A;  2FNA A;  4UUS A;  1I6X A;  3BZ6 A;  3OS0 A;  1O7F A;  4Z6Y A;  2L01 A;  4TV7 A;  3E5X A;  1WGX A;  3S16 J;  2G0E A;  1UJ8 A;  1QA6 A;  3RPU A;  2VJ5 A;  1IV6 A;  4QPQ A;  3R4K A;  3OYN A;  1XTA A;  5JVT A;  4FQG A;  1JE8 A;  5ED4 A;  4RAG A;  5A2Q Z;  2EFW A;  3Q9S A;  4CIC A;  1TW3 A;  3G3Z A;  3PFY A;  4IO9 F;  3RZO J;  5DCM B;  4M73 A;  1DPR A;  4ASN A;  2XF6 A;  3D5R C;  3M9A A;  5DS9 A;  5FB2 A;  5IT3 A;  1J59 A;  2X85 A;  4ENN A;  3FBI B;  3G71 I;  1MDM A;  1T0F C;  2G9W A;  2R7W A;  4HW0 A;  3OSG A;  2HOA A;  2BGC A;  1IF1 A;  1A6I A;  2IS6 A;  1GVJ A;  5D5W B;  2NVQ J;  5C44 J;  1SAN A;  1XCV A;  2MH9 A;  4WWC A;  3OYD A;  2ZJP F;  3JAM K;  4G7Z F;  3K4B A;  1O4X A;  1IDY A;  4XLH A;  4KMU X;  4BH9 A;  4YEL A;  4ESJ A;  2F2E A;  2RAE A;  5KAI C;  1EH8 A;  3KIO A;  1ZRE A;  1OR7 A;  5CPR B;  4NBQ A;  5K7H A;  4ZC3 A;  2P0W A;  3FHN A;  2KMU A;  3FXM A;  3SFZ A;  3CCY A;  2D1V A;  1TT0 A;  4M3D A;  2E5N A;  3OL4 A;  3TGN A;  2XAH A;  2E36 A;  3Q5F A;  1YE9 A;  2VBY A;  3FZV A;  4IXA A;  4R79 A;  1VND A;  3RKY A;  2HU9 A;  4CO8 A;  4HX8 A;  3HPH A;  2KZV A;  2XAJ A;  2XRO A;  4IL6 C;  4KIG A;  4F7Z A;  3WU1 B;  1IG7 A;  1R6R A;  2E7W A;  4C9Y A;  1HCR A;  1U5T B;  3NWS A;  3IWZ A;  3EPZ A;  3KEY A;  1ZAO A;  4YFN F;  2B7E A;  2VJI A;  2XGE A;  1JKR C;  2JRT A;  2QUF A;  3GTL J;  2L2O A;  5K5R A;  3KET A;  3SYT A;  2WB1 N;  1RET A;  1XSV A;  1P7I A;  4M71 A;  2CW7 A;  2Y2Z A;  3G73 A;  3GLL A;  1RRJ A;  2JTV A;  3HOY J;  2DPU A;  4CYC B;  2NVT J;  3CLO A;  1TP4 A;  2LD5 A;  1U78 A;  2WAF A;  1IC8 A;  1VQ4 I;  1FBU A;  1OMI A;  4HST A;  1OR7 C;  2Y31 A;  4W1U A;  4BKX A;  2VN2 A;  3IWF A;  4UB6 C;  4KDP A;  1MBH A;  2CG4 A;  5HNH A;  1ZRD A;  2XKO A;  2ZNY A;  2GLO A;  4KNY A;  1S72 I;  5D5V B;  4HDV A;  4MFE A;  4A2U A;  3V7C A;  3FHZ A;  1B9N A;  3RJP A;  2HVR A;  3LNQ A;  3CJR B;  2TCT A;  3RIR A;  2GAU A;  1OJL A;  4MFD A;  4D7M A;  2V79 A;  2CQ7 A;  1VQ8 I;  5HS7 A;  1B6A A;  2F5E A;  3NQO A;  5LGT A;  2D5V A;  1RKT A;  2DK8 A;  2CO5 A;  4X1E A;  2OU2 A;  2JA6 J;  4A0Y A;  4IOC F;  3FBN B;  3PM1 A;  3AG2 H;  2M8E A;  2LY9 A;  4UUV A;  2R7U A;  3KZY A;  4D0P A;  2ESH A;  3UNG C;  1G2H A;  4Y4R A;  2QEX I;  1I3Q J;  1VQ6 I;  2I8D A;  2XV4 S;  1WRJ A;  5EGO A;  2GOX B;  2LKX A;  2Q0O A;  3HUG B;  3M7G A;  2QKM B;  2B63 J;  1DDN A;  3OWT A;  4UHT A;  3IH3 A;  1DP7 P;  1FC3 A;  1YI2 I;  3RYP A;  3E0J B;  4HPQ A;  4F52 A;  5EEA A;  1WJB A;  3J81 Z;  4WXH A;  4CDG A;  2FOK A;  4DGW B;  1ZN2 A;  2VB6 A;  4XON A;  3GTP J;  4RDU A;  1HDP A;  2K4B A;  1D8J A;  3H35 A;  2EZI A;  2HYF A;  2X48 A;  3ML6 A;  5JLX A;  1XMX A;  3ZQF A;  1Z3X A;  2DA7 A;  4GDF A;  3OYL A;  3FM5 A;  2A5W A;  2EV0 A;  1PUE E;  5D8K B;  4D5F A;  1VQK I;  1FZP B;  3NAR A;  1S8N A;  4P55 A;  3JTG A;  4R1H A;  3FXO A;  2BYV E;  4XN3 A;  4XQF A;  5IOZ A;  1ZLJ A;  3TDU C;  3IL2 A;  1Y0N A;  4J01 A;  3OYM A;  3A1Y A;  2E71 A;  4CXF A;  4FE4 A;  3DBH B;  3K1M A;  1UG2 A;  4L5J A;  2KQR A;  2ZC2 A;  3IAS 2;  2Y69 H;  5E1Z B;  3SHF A;  2P4W A;  2VC1 A;  2XAQ A;  2HOE A;  3F6V A;  3UR3 C;  4MGR A;  2KDO A;  3A4C A;  1LJ9 A;  1Z0X A;  5E3L A;  3PIO F;  4UY8 I;  3I9V 2;  1D1A A;  2YX7 A;  3H3Z A;  1S29 A;  2MGQ A;  2JT1 A;  4N4O B;  4J00 A;  3RQI A;  5DEQ A;  3U2R A;  3BTI A;  4HNT A;  2HPM A;  3GFI A;  3F21 A;  3BLY A;  1N25 A;  2QLZ A;  2P7V B;  4W97 A;  4WXC A;  3J7Z I;  1SD7 A;  1XMK A;  1VQN I;  2K9Q A;  3V7R A;  1QZE A;  1CF7 A;  3BTL A;  1X2N A;  5LFA A;  2KJB A;  4U87 A;  1SVL A;  2K4J A;  3M8F A;  3C2H A;  1D0Y A;  4JOM A;  4D9J A;  4OIO F;  1IRF A;  3PO2 J;  2XUB A;  2K7L A;  3WGH A;  4KA4 A;  2Z2S B;  1ULY A;  3HJE A;  1B72 B;  1VTN C;  4U7D A;  2D1H A;  2DMP A;  1SEU A;  4MIM A;  3REO A;  1EKE A;  4C3I J;  1W7P D;  3W6V A;  4HG2 A;  3F9K A;  3L09 A;  1XPX A;  3JRA A;  4BY1 J;  5H6Q A;  2CQX A;  5GTH C;  2VPR A;  1RUO A;  1NHA A;  3CJN A;  3CCR I;  2OQR A;  3CF5 F;  1FYK A;  3ULQ B;  2QBY A;  1R1V A;  4RB2 C;  1J2X A;  1JUM A;  1PJR A;  1FJL A;  3FXQ A;  3BWG A;  2EJR A;  3J80 Z;  3RI4 A;  1X4P A;  2JQ7 A;  1AA7 A;  3ECH A;  1MBG A;  2CMP A;  4IF4 A;  4HYE A;  1XN7 A;  1XCB A;  4BJT A;  1K79 A;  2AQF A;  3HIF A;  4BEH B;  3OSF A;  1A04 A;  3LQR A;  2M9H A;  2W1O A;  2WBM A;  3S2H J;  4HBL A;  3K4K A;  4E7H A;  2E1M B;  2Y0M A;  5E20 A;  5HNF A;  1SFX A;  4B43 A;  3RQ4 A;  3KLO A;  2E1O A;  5B5E C;  4M9Z A;  3R61 A;  4XSX F;  4KT6 A;  4BHP A;  1YOV B;  4B44 A;  2VKH A;  4CZZ A;  1X1A A;  4CZC A;  4M6Y A;  2IBD A;  2L9N A;  1JGS A;  3GTQ J;  2XRN A;  3HOW J;  2J5O A;  3FMQ A;  2MSY A;  1QPI A;  3GEZ A;  3QYE A;  1D5V A;  5IT9 K;  5GTI C;  2GQQ A;  3VSL A;  2R5Y B;  3GCM A;  4WXD A;  1TBX A;  4JX4 A;  4OMZ A;  3GTK J;  3WHB A;  2EIM H;  1X1C A;  2EFQ A;  1T2K A;  3T8T A;  2F6C A;  1R5G A;  1G3S A;  2EZL A;  2VKV A;  3CLQ A;  3ABK H;  3WTU C;  2V6E A;  2CUZ A;  2LFB A;  3KYD B;  3DEE A;  4XLP F;  1YJ9 I;  1SAU A;  1YQA A;  3RKQ A;  3ZQQ A;  3CME I;  1SD4 A;  2QCO A;  2LBF A;  1DU0 A;  1P4X A;  2DA6 A;  3HGY A;  4ZDL A;  3PJR A;  1HST A;  5IP9 J;  4PK4 A;  1ON1 A;  3KZZ A;  1EA3 A;  4OIN F;  3BQY A;  2BY2 A;  3C7J A;  3J7Y J;  1BR2 A;  1A6Q A;  2P5V A;  5E8G A;  5DD4 A;  3DU6 A;  4IX7 A;  1ZG1 A;  2TRT A;  3CMA I;  1OIS A;  2F5D A;  2LKS A;  2FNP A;  2VLA A;  4OIP F;  1MSE C;  3L2W A;  3BZK A;  5K7Z A;  1ITY A;  1FEX A;  2FEZ A;  3R0J A;  2XB5 A;  5ERI A;  3QRF F;  4OOI A;  1SFE A;  2OD5 A;  3SFI A;  5BS6 A;  2ZME A;  4DYC A;  1XGO A;  2L5Q A;  1BJZ A;  5BNG A;  2FOW A;  3KEO A;  4A3G J;  4HV6 A;  4YG2 F;  3K4C A;  4IJA A;  3I53 A;  2ELJ A;  1V5E A;  2A68 F;  4P9F A;  2DQR A;  3F72 A;  2DU9 A;  5FD5 A;  5LRR A;  1NG6 A;  5IYD J;  4I0B A;  4MQ9 F;  4IHV A;  3E6M A;  3OL3 A;  2YU9 J;  1OCP A;  2HVQ A;  2LTP A;  4L9N A;  4GO1 A;  1EF4 A;  4U0V A;  1YW7 A;  1I5Z A;  9ANT A;  1K61 A;  4KIT B;  2NNY A;  2K86 A;  2VQL A;  4A5N A;  3MKW B;  2DA2 A;  1P4W A;  3K69 A;  2VBZ A;  3NWT A;  3CES A;  1FWZ A;  2FJ1 A;  5GPC A;  4ANJ A;  5HDG A;  3LST A;  5E1W A;  2DI3 A;  4EQQ A;  2NVY J;  4BQN A;  5B66 C;  1MSF C;  3BG6 A;  3BR6 A;  5KCM A;  2KJC A;  4RM2 A;  4BQQ A;  4WF2 A;  4XLN F;  1VF9 A;  2V9V A;  2PJR A;  2NOG A;  3MD2 A;  1MJA A;  2ZME C;  1WPK A;  4DW6 A;  1REP C;  2X51 A;  4RAF A;  1X58 A;  3OIP A;  1YW9 A;  2HZT A;  3VB2 A;  1ZR4 A;  3H36 A;  3PUF A;  1RUN A;  1ZYR F;  2X6Y A;  3RTR A;  3ZMV A;  1HKT A;  2M87 A;  3DBL B;  2R7Z J;  2XRL A;  4GRI A;  2EQR A;  1SFU A;  2IGK A;  4BGD A;  1X1D A;  2IA2 A;  1N78 A;  4RAY A;  3W2V A;  4A5M A;  3I55 I;  3CCE I;  2I5U A;  4PZJ A;  2ICW G;  4BNC A;  4O6J A;  3COA C;  2JSP A;  4DOZ A;  4LG0 B;  3B02 A;  1JI8 A;  3UKG A;  1ZG3 A;  2RNJ A;  2R7R A;  1YX3 A;  4IHX A;  4E7L A;  2LP0 A;  4IHY A;  1D0X A;  1QVU A;  3CQZ J;  3ZQC A;  3HHH A;  2G7H A;  5J47 A;  4YFX F;  4LLN A;  1YS6 A;  2V1D A;  1LE8 A;  3FDY A;  4KUM A;  1BI2 A;  1WH5 A;  2HZD A;  5F0H A;  1IDZ A;  2MAB A;  2QZ8 A;  1RIO H;  4EMS A;  3SDB A;  4AC0 A;  1ZHF A;  3HKZ A;  1B8I A;  2HQ5 A;  3FXU A;  1P92 A;  2A6T A;  3J7A O;  4B3X A;  4NQW B;  3BPV A;  3QOP A;  1ZAR A;  3D0S A;  3E3V A;  2ZNZ A;  3QPT A;  3OYJ A;  1IO2 A;  1MIJ A;  2EZH A;  4Y17 A;  1D1B A;  4I2O A;  2HKO A;  4RA2 A;  5L3G A;  4I0A A;  4Q47 A;  1TLH B;  2K40 A;  3T1B A;  3G6E I;  3I4M J;  4O5V A;  3HBL A;  2DDA A;  2HDC A;  4L5I A;  2JPC A;  3ZQ7 A;  2K3P A;  3LFU A;  3MCZ A;  1Z05 A;  2FUG 2;  1IN4 A;  2V26 A;  1QU3 A;  2VOO A;  1UZC A;  2E2I J;  2DFI A;  3QAH A;  2FE3 A;  4EJO A;  1UG0 A;  2XF5 A;  2ZB9 A;  3JRF A;  1P4A A;  1HF0 A;  1I6H J;  3SJM A;  3LSH A;  1BC8 C;  3ZRG A;  2O9L A;  2HI3 A;  3ZP5 A;  3V8L A;  4B8X A;  2HYG D;  1UHM A;  3JRI A;  1NG7 A;  4KFC A;  1YRN B;  2CQQ A;  2COM A;  2DMN A;  2O8K A;  5CYV A;  1WJE A;  1ODD A;  5EEG A;  1O3T A;  2L9R A;  1FP2 A;  3GFL A;  2VKD A;  5E3N A;  4KN4 X;  4HAM A;  4L5E A;  2E1M C;  5F27 A;  3V8J A;  5DM7 F;  4IZZ A;  1TQI A;  2F4O B;  4C2M J;  1YHQ I;  6PAX A;  2O03 A;  2NOJ B;  3CP8 A;  2NXN B;  1WCM J;  3F6O A;  2CQN A;  3P5J A;  1MNE A;  4GYG A;  3FIS A;  2QQ8 A;  2X0L A;  3ERE D;  1TL8 A;  4LJZ F;  4Y7N J;  4EM1 A;  2MBF A;  1T38 A;  1G59 A;  1MBE A;  2IPQ X;  5JI6 A;  5IP6 A;  2LRE A;  4CCM A;  4DIQ A;  3CD6 I;  4NNJ A;  1Z67 A;  3A2K A;  4IQ4 A;  4YIF A;  3N97 A;  2WC2 A;  3Q3S A;  1O7L A;  5LHH A;  2AS5 F;  2QEN A;  2E2J J;  4HF0 A;  5LLQ A;  3AG1 H;  2Y48 A;  1TQM A;  3VPR A;  4N4N B;  2WY7 Q;  4RGU A;  2A6H F;  2BVL A;  3NRV A;  1DGR M;  2ZSI B;  5L3E A;  1MMN A;  3L7W A;  2V9P A;  1VQM I;  2KRC A;  2F4M B;  2WV1 A;  2DK5 A;  1UMQ A;  5HLG A;  2KKO A;  2CUF A;  2IGO A;  1I39 A;  2XB0 X;  2KP6 A;  4RB0 A;  3ZOB A;  3CC2 I;  2HEO A;  1R58 A;  2HDD A;  5EG0 A;  5BMZ A;  1GVD A;  4D5C A;  5F6F A;  5M5Y J;  1D3Y A;  2BV6 A;  2DYR H;  5EF6 A;  1WJ5 A;  4PJ0 C;  4IRH A;  3HGG A;  4XKB A;  2I10 A;  4N0B A;  5D4S A;  2ISY A;  4JYK A;  2JN6 A;  2WAQ A;  4N9H A;  1GLN A;  4O3M A;  2VPL A;  3K2A A;  5HLH A;  5D5U B;  1Z1D A;  2BW3 B;  2EK5 A;  4GGG A;  1E3O C;  1FX7 A;  3KFW X;  4UXN A;  1KU3 A;  1J0R A;  1TW2 A;  2E34 A;  3K4M A;  2VJJ A;  1Z7L A;  3QYF A;  3S1R J;  2Y9Z A;  4LFU A;  2OTJ I;  4JX5 A;  2GIZ A;  1LUJ B;  5ICG A;  4UNO A;  3S32 A;  1LFB A;  3GTG J;  3HRT A;  5ICF A;  3IAM 2;  1D0Z A;  2DN0 A;  2JVG A;  2WAD A;  5CQE A;  2BY3 A;  4FE7 A;  1P9Q C;  2AO9 A;  3L2R A;  4RLF A;  2QQA A;  5BQT A;  1DPU A;  1KGS A;  3DKW A;  4IHW A;  1AOY A;  2CFX A;  3Q0V A;  4E7S A;  1VQO I;  4HQM A;  1V3F A;  3K0L A;  5L3F A;  1RI7 A;  3ZXS A;  4XL9 A;  1V54 H;  2GA2 A;  4C3J J;  3F8N A;  2ACJ A;  4F92 B;  3O8G A;  2F48 A;  4XRS A;  5FLX Z;  2A05 A;  1POG A;  3GFM A;  1WSU A;  1WVR A;  4LK0 F;  3H9G A;  1WI9 A;  2NS0 A;  2CV2 A;  1KQ8 A;  3BP8 A;  3ZQH A;  2Z3Y A;  1MZB A;  4A3C J;  4CGZ A;  2GWR A;  2ZXH A;  3MZY A;  3HOX J;  3IKT A;  1PYV A;  2BHY A;  4PCQ A;  3JRE A;  3L2V A;  2CW0 F;  3HHG A;  3JSP A;  1IN5 A;  3LSM A;  5GPA A;  2LNB A;  2HVS A;  3I59 A;  1W36 C;  3WE2 A;  4ZZL A;  2M30 A;  2UZK A;  1NK2 P;  3DP7 A;  3BT9 A;  5AON A;  2B0L A;  1FBQ A;  5D4R A;  3MAJ A;  1LKX A;  2IJL A;  4A69 C;  1Z6R A;  4ON0 A;  4A3D J;  4HF2 A;  5DM6 F;  1UAA A;  4J19 A;  5D6F A;  4JQF A;  1A31 A;  4BAY A;  4XKW A;  5HDN A;  1Q1V A;  4XOT A;  5CQG A;  5FKN A;  4C2U A;  1B9M A;  1I50 J;  1MBJ A;  2QWW A;  5EJC A;  2IS2 A;  4M6V A;  4CCO A;  2RQP A;  5FD6 A;  5DUI A;  3HRM A;  4BHC A;  1W1W E;  1K78 B;  4B09 A;  3A01 A;  1XDU A;  2OPT A;  1NK3 P;  4UV9 A;  4D1Q A;  4EJW A;  2E2H J;  3FX3 A;  4MNU A;  2V6C A;  2LG4 A;  3G1L A;  3GFJ A;  4PGH A;  3U9G A;  3VSK A;  1K4S A;  3ISP A;  3GZN B;  1IXS B;  2IGM A;  2KRH A;  5B1B H;  5TIS C;  2ETH A;  2R7F A;  2MD0 A;  2XGC A;  4E7I A;  2K02 A;  1WJC A;  3TO7 A;  4BS9 A;  3DPT A;  2VBW A;  1IN8 A;  3JTH A;  1ZEL A;  3TO9 A;  5C3E J;  5J40 A;  4BJ6 C;  4PGG A;  1H8A C;  1H9T A;  1EH7 A;  1E17 A;  5CVU A;  1Z91 A;  2KDZ A;  5FKO A;  2VXD A;  5J8C A;  3KZI C;  5BPI A;  3OOP A;  3VYT B;  1S9H A;  1BOB A;  3I64 A;  3CO6 C;  3ZQL A;  1H9G A;  3KP2 A;  4M6X A;  4QWQ A;  4U0W A;  2R5Z A;  1IRG A;  3HPG A;  3AL0 B;  1ENH A;  2KRF A;  3BJ6 A;  1JKO C;  1PDN C;  1YX5 A;  5KK1 A;  2HFH A;  3OR2 C;  1R36 A;  1WJD A;  4C2T A;  1ZGA A;  2H8R A;  5FO5 A;  4ZDO A;  2EIL H;  1QZZ A;  2Z33 A;  1X1B A;  1X3U A;  2DTR A;  3HOT A;  4GYI A;  1QGP A;  4PUS A;  1T6S A;  2YPR A;  1V5G A;  2DQL A;  2BOL A;  1P7J A;  1K6O A;  4XN0 A;  4EM2 A;  3S14 J;  1VFC A;  3H5A A;  4L9V A;  4ZYD A;  2W24 A;  4XLF A;  2FQ3 A;  2VOD A;  1SVO A;  2Q2E B;  4YIR X;  1F5T A;  5K7F A;  2LLK A;  2HOT A;  3VYR B;  4F91 B;  4E70 A;  2QYO A;  1TZL A;  2CGP A;  2JPB A;  3WHC A;  3DWL E;  4CUG A;  1SD5 A;  4BAC A;  1FOK A;  4BY7 J;  3VYU B;  3ZN0 A;  2CUE A;  3K2Z A;  3OYG A;  4EJT A;  2OA4 A;  1FMV A;  1S7O A;  3M3Y J;  4QSH A;  1YLF A;  1ACI A;  4CCL A;  2VC0 A;  2ISZ A;  5TRD A;  4M3G A;  4EEF G;  3KP4 A;  1BR1 A;  2H1L A;  3CCJ I;  2BY0 A;  2WB1 A;  4HNU A;  3PSF A;  3EDP A;  3NEU A;  1BA5 A;  1VQ5 I;  2VOP A;  1HW2 A;  2R7O A;  2PX9 A;  3K4N A;  2OF7 A;  3Q0W A;  2LMD A;  2LDU A;  2A07 F;  2RC4 A;  3LWF A;  5JVG F;  3IC7 A;  2CQK A;  5HOD A;  2K3F A;  5L3D A;  4UB8 C;  5DCM A;  4XSZ F;  3SEZ A;  3MKZ A;  3LSJ A;  3H3U A;  2FQ4 A;  3KP7 A;  2X1C A;  2OJE D;  2VT2 A;  2ECC A;  4AIH A;  4IHT A;  3BTJ A;  1AKH B;  4HOB A;  1BN5 A;  4B3A A;  1X3W B;  4M74 A;  3DU5 A;  3MWM A;  2DW4 A;  4U7B A;  3CC4 I;  3JW4 A;  2ZJ2 A;  3G4S I;  1R22 A;  3ASN H;  3HOV J;  5A2Q K;  3R6S A;  4H4K C;  4ZTF A;  2PMU A;  4KIC A;  3OS1 A;  2HYJ A;  1WH7 A;  3C2G A;  1IAW A;  2HGC A;  4RB3 C;  3GO5 A;  3HOZ J;  4A3K J;  3JCU C;  2GXG A;  4RM3 A;  2GBY A;  3CCS I;  4FX0 A;  3TKY A;  2A5Y B;  3IKV A;  2V9K A;  4A6D A;  1W7P B;  4XLC A;  1V4R A;  2VE9 A;  3TW6 A;  3QP5 A;  3V7S A;  2WTE A;  4BXU A;  2MC3 A;  2WY8 Q;  3DF8 A;  1UHS A;  4A3I J;  3BR1 A;  3LA7 A;  3TP3 A;  2KZG A;  4U88 A;  5IP7 J;  1GT0 C;  3M4O J;  4BQA A;  1XGM A;  4MTE A;  1IUY A;  3VEP A;  3WTT C;  3BJA A;  1U5T A;  2PG4 A;  3E6C C;  3CUQ B;  2KPM A;  1W0U A;  4ZJZ A;  2RVC A;  3QWL A;  3HTU A;  4NC8 A;  2LY2 A;  5LEK A;  4AVZ A;  1FOW A;  4OWR B;  1EJ9 A;  1FLI A;  4HZF A;  4BYY A;  3SZT A;  2C6Y A;  1MW7 A;  2MLG A;  2VON A;  2M0C A;  5J4Y A;  4ZDP A;  2X6X A;  3KP3 A;  2HS5 A;  3HSF A;  2E5Z A;  4CYC A;  2E1C A;  3QPH A;  3MMY B;  1YIO A;  4S04 A;  1X2M A;  1MMD A;  3S1M J;  1HW1 A;  4MTD A;  4LB5 A;  2WAE A;  1MJB A;  2EIN H;  1Z6T A;  3ECO A;  3WTV C;  1UST A;  3BOQ A;  1M1E B;  2EA4 A;  4XOP A;  5ILU A;  1YIJ I;  1TT5 B;  1AHD P;  4EAT A;  5ICE A;  5D5X B;  2MH2 A;  2W25 A;  3K4L A;  3S3O A;  3ZMU A;  2QA4 I;  4YII A;  1RKW A;  5E17 F;  1O3R A;  2Z5U A;  4S05 A;  2L9S A;  4BE2 A;  4ZTJ A;  1U8R A;  5KVR A;  4M9S A;  1PUF B;  1U5T C;  3JSO A;  5BOX A;  2DOA A;  3ERM A;  3DTE A;  2LY1 A;  3HB9 A;  4UV8 A;  2P8T A;  3TMO A;  1BJA A;  4EVI A;  2RKH A;  4II2 A;  4A6E A;  4G6T B;  1VQ9 I;  1IN7 A;  2ZJQ F;  2EPF A;  4RGR A;  3VFZ A;  3LOC A;  2F5C A;  4PJL A; 
#chains in the Genus database with same CATH homology
 3ABU A;  1KU7 A;  2W57 A;  4FT8 A;  4HV5 A;  3I58 A;  1UHW A;  2PN6 A;  4ESF A;  4G9Y A;  4L18 B;  3BPX A;  3LQQ A;  3O2P E;  2XVC A;  3HUG A;  3C1D A;  3ZMD A;  1GXP A;  1LNW A;  2H6B A;  5FFZ A;  3FM3 A;  1IXR C;  2HWV A;  2F5F A;  3HSE A;  4IRI A;  3I5U A;  2CSO A;  2O0Y A;  4I02 A;  3W6J B;  2MA3 A;  3K1N A;  3IRQ A;  3CO7 C;  4XRF A;  3ZMS A;  2M5W A;  3U1D A;  2E7X A;  3HYI A;  3I71 A;  2HTJ A;  2NRA C;  2FMY A;  1H0M A;  3IHU A;  5F1R A;  2GIV A;  2KIU A;  3J81 K;  4AD9 A;  3B73 A;  3GZ6 A;  1USS A;  3HRU A;  4EJU A;  4ZYG A;  2M1B A;  1BC7 C;  3P7N A;  3WOD F;  4I7H A;  1EH6 A;  1R1U A;  2GZW A;  2L4A A;  2QM3 A;  1OYW A;  2DAO A;  1ZGJ A;  4AWX B;  3KCC A;  2PMH A;  4LGW A;  4Q5S F;  2BE5 F;  3R60 A;  2IRF G;  3BY6 A;  1HSJ A;  1SAX A;  3F8M A;  1TTY A;  2HQR A;  1HBX G;  4P9U A;  2STT A;  2DT5 A;  3GXO A;  5HOO A;  1LB2 A;  2QVO A;  3JAM Z;  3ELK A;  1XGS A;  2A3S A;  5JHU A;  1E2X A;  2RV8 A;  3L9F A;  1R5H A;  1WWX A;  2A61 A;  1YW8 A;  5L3B A;  2EB7 A;  1O3Q A;  1MDM B;  4AIJ A;  1T98 A;  1GHC A;  4DNC A;  2QQ9 A;  2EV5 A;  5LGN A;  1OPC A;  4HDU A;  2W84 A;  2XAF A;  1STZ A;  3FWE A;  1EV7 A;  4RAZ A;  3J80 K;  5H6R A;  2XHK A;  4HLY A;  2X4H A;  1QPM A;  1XDS A;  5F64 A;  4ZYH A;  3P9I A;  1I1S A;  2UXX A;  1BOA A;  1QBJ A;  4L9T A;  2ZO4 A;  3T5X A;  3RKW A;  2P6T A;  1ZG5 A;  4M72 A;  2EV6 A;  2EFN A;  1RNL A;  3HTS B;  5FGM A;  2R7D A;  2PFB A;  1L0O C;  2GA1 A;  2NNN A;  4UVC A;  2ZFW A;  3ZMT A;  3DQV C;  1MKM A;  3RKX A;  3S2W A;  2D45 A;  1B4A A;  2H6C A;  2EA2 A;  4BHB A;  4KMF A;  2PJP A;  4U0Y A;  2WV0 A;  2L3D A;  4MHG A;  4XBF A;  2Z9O A;  1ZLK A;  5K5O A;  3T0Y A;  5E1X A;  1Z9C A;  3QU6 A;  4MQV A;  4GCV A;  5DUK A;  2L4M A;  3M1E A;  2XGX A;  3DEU A;  1BIA A;  5CLS A;  1WQ2 A;  3K9T A;  3TO6 A;  1FYL A;  4RB1 A;  3RYR A;  4A0X A;  5D8L B;  2YR2 A;  2FA5 A;  3WTY C;  2DBB A;  2AXL A;  1LDJ A;  2IVM A;  3GVA A;  4N9I A;  1PP8 F;  3WG9 A;  1GXQ A;  1PP7 U;  3D5L A;  1LEA A;  1BBY A;  2DLL A;  4ETS A;  1KYZ A;  4GXO A;  2LKP A;  4RGS A;  1I1G A;  1FY7 A;  1IZ1 A;  1FSE A;  4WCG A;  2VE8 A;  2W85 A;  1BI1 A;  2PBI A;  2O3F A;  4LLG F;  5DCF A;  2IP2 A;  2XAS A;  1JXS A;  4G94 A;  4ENK A;  3ZN1 A;  3LAJ A;  3DFG A;  4LG0 A;  2EFO A;  1QQI A;  2G7U A;  3WTW C;  4LLL A;  1B59 A;  3F23 A;  3QP6 A;  3RDI A;  3L2C A;  5HS8 A;  3I54 A;  1HXD A;  2LF7 A;  4NQW A;  1CF7 B;  5HVQ C;  4WX9 A;  2YSR A;  3CUO A;  1UB9 A;  1ZRC A;  1G3T A;  4P5O A;  3GYH X;  1R23 A;  2ZCW A;  3OV8 A;  2P5L C;  2EFP A;  4AIK A;  4FHT A;  4HA8 A;  2ZXJ A;  2O6G E;  1HKQ A;  4Y13 A;  4PDK A;  3FMS A;  4A0Z A;  2OQG A;  4LMY A;  2DPD A;  1TQP A;  1SMT A;  1FYM A;  4HQE A;  4JBA A;  2QBY B;  4G7H F;  1XSD A;  4CHU A;  3PFI A;  4LD5 A;  3MEX A;  3F8C A;  1XSX A;  5K5Q A;  2PLY A;  5DYM A;  2FML A;  1L3L A;  3GF2 A;  2BBY A;  5IT9 Z;  4K2E A;  1UFM A;  3ZPL A;  4L9J A;  3KP5 A;  4HF1 A;  5FFX A;  3E6D A;  1HKS A;  4Y15 A;  3GZ5 A;  4G6D A;  2JSC A;  1BIB A;  1J7K A;  2HKX A;  2V1X A;  1FPQ A;  2LSO A;  1TNS A;  1BI0 A;  1T39 A;  4I09 A;  3F3X A;  1S3J A;  3DXJ F;  1FBS A;  4ENJ A;  4NHJ A;  4WK8 F;  3P9C A;  1J75 A;  4OIQ F;  4L0Z B;  1G6N A;  1D8K A;  1G4D A;  1K7A A;  2P7C B;  3E5Q A;  1CGP A;  3CTA A;  2FXA A;  3ABT A;  4DQ2 A;  4M9X A;  3CDH A;  3F8F A;  1Q1H A;  5LRS A;  3FMR A;  2P5K A;  1C0W A;  2ZME B;  3L00 A;  3PQJ A;  1UCR A;  3SQN A;  2NAZ A;  4Z2Y A;  5CVV A;  3Q9V A;  2Y75 A;  1KU2 A;  3FXR A;  5JR3 A;  1QO0 D;  1G3W A;  1ZH5 A;  4L0Y B;  2D2W A;  4Q48 A;  3F22 A;  1SD6 A;  1OYY A;  3ZMZ A;  2VT3 A;  1MD0 A;  3F8B A;  3MZH A;  4IPA A;  1P2F A;  3VOD A;  3EUH A;  1KU9 A;  3WU0 A;  3WTZ A;  1R00 A;  2HQN A;  5BPD A;  3TOA A;  3C18 A;  3LAP A;  3AAF A;  2HR3 A;  2OBP A;  1Z7U A;  2FF4 A;  1W5T A;  3BRO A;  3DPL C;  3KLN A;  1W5S A;  4R8H A;  2JZY A;  3EYY A;  2HTS A;  4OU0 A;  2IA1 A;  1BI3 A;  3IRR A;  5FLX K;  3LFK A;  1I27 A;  1HW5 A;  4LB6 B;  1P6R A;  3I4P A;  3E6B A;  3KEQ A;  5DV5 A;  1LQ1 A;  4EM0 B;  1WKM A;  3R0A A;  4P96 A;  3RPQ A;  2WWY A;  5K1Y A;  4FX4 A;  2V1U A;  1K78 A;  1YFH A;  2IT0 A;  2PEX A;  1ZRF A;  2XAG A;  5LBQ A;  5HS9 A;  5AIQ A;  2LF8 A;  2Z99 A;  3W6K B;  1OYI A;  4I01 A;  2RN7 A;  3FF5 A;  4MEX F;  3QU3 A;  4EGY A;  4KIB A;  1IW7 F;  2FBH A;  1O3S A;  3WE3 A;  2RDP A;  1XGN A;  2OZU A;  1JHH A;  1U2W A;  3T8R A;  2H94 A;  2XIG A;  1FP1 D;  3E5U A;  1S7A A;  1HQC A;  2M45 A;  2YU3 A;  5CVJ A;  4JK1 X;  4Q4Z F;  1Y0U A;  2RGV A;  1BM9 A;  5LGU A;  3HRS A;  1FNN A;  4ZYE A;  2A6E F;  2BEO A;  5EEH A;  2E1N A;  2R3S A;  5DDG A;  5J6X A;  3HOS A;  2YX4 A;  1FSH A;  5DD8 A;  3SZP A;  2Q2E A;  2PQ8 A;  5H20 A;  4LK1 F;  2O8X A;  1F4K A;  2STW A;  3O3K A;  2FRH A;  3TDZ C;  4HX7 A;  1MGT A;  1R7J A;  1W4M A;  2UWM A;  1YYV A;  2CYY A;  5TJJ A;  4IHS A;  2CWE A;  4ZZD A;  5L3C A;  3I0T A;  3HSR A;  2FBI A;  2XKP A;  1JHF A;  1KQ9 A;  2QQB A;  4QLC U;  2ZBK A;  1KYW A;  1OKR A;  4A12 A;  1IXC A;  1LDD A;  1YTY A;  2VXZ A;  1ON2 A;  3V8K A;  3K1P A;  5D6E A;  3PQK A;  5JFR A;  4ZH4 F;  1F9N A;  1J5Y A;  3VOE A;  3GWZ A;  1QNT A;  5CVR A;  2IW5 A;  2KIM A;  1O57 A;  2K27 A;  4H0E A;  2IA0 A;  3GW2 A;  4EV0 A;  2DO7 A;  4KN7 X;  5E8I A;  1YG2 A;  2MD5 A;  1W7P A;  1R1T A;  2A69 F;  4G7O F;  4ENM A;  2NYX A;  4EJV A;  5LEJ A;  4CYD A;  3ROU A;  4G8X A;  4ESB A;  4IVN A;  3P9K A;  4HX4 A;  3EET A;  3CUQ A;  4UVA A;  1LEB A;  1IN6 A;  1LVA A;  1U3E M;  3EYI A;  4IRG A;  5CVI A;  2TDX A;  4I98 B;  4RGX A;  3TOB A;  4NB5 A;  4RS8 A;  3DV8 A;  1KQ0 A;  2OAZ A;  3I59 B;  2FSW A;  3GLX A;  3MFK A;  1AWC A;  1MJ9 A;  3V4G A;  2P6S A;  3N4M A;  2ADU A;  3CUQ C;  5HLI A;  1J9I A;  1LDK B;  4YFK F;  5LHI A;  1XB4 A;  3LA2 A;  1B1B A;  2ESN A;  2L02 A;  2PI0 A;  5ICC A;  2GXB A;  5ILS A;  2ELH A;  4KYW A;  1G3Y A;  1ONV A;  1YO5 C;  3KP6 A;  5J8F A;  4KT5 C;  2ZKZ A;  2EWN A;  2OZ6 A;  3LA3 A;  2UXN A;  3TQN A;  2O61 A;  2FU4 A;  3WTS C;  4AVP A;  4EGZ A;  4UVB A;  2Q8K A;  3GUD A;  4OIR F;  3KE2 A;  5AIP A;  3O6B B;  3M8E A;  3C3W A;  1TNT A;  3BJO A;  3SXY A;  1XD7 A;  5HDK A;  1SMY F;  3H92 A;  1DUX C;  1U6G A;  5CJ9 A;  1XMA A;  1KA8 A;  1YS7 A;  5LHG A;  2VBX A;  3BDD A;  4KIF A;  2MLK A;  4OMY A;  3GX4 X;  4MEY F;  1QZY A;  3WGI A;  5E18 F;  1RZ4 A;  4G6Q A;  3WTX C;  2J5P A;  2H27 A;  1T0F A;  3MQ0 A;  2KIF A;  2L54 A;  1F1Z A;  1S6L A;  3WGG A;  2H09 A;  3EQL F;  4HLX A;  5ILV A;  2FBK A;  3E97 A;  1FT9 A;  2FNA A;  1I6X A;  3BZ6 A;  1O7F A;  2L01 A;  4TV7 A;  3E5X A;  3RPU A;  3R4K A;  5JVT A;  1JE8 A;  5ED4 A;  5A2Q Z;  2EFW A;  4CIC A;  3Q9S A;  1TW3 A;  3G3Z A;  5DCM B;  4M73 A;  1DPR A;  4ASN A;  3M9A A;  5FB2 A;  5IT3 A;  1J59 A;  4ENN A;  1MDM A;  2G9W A;  4HW0 A;  2BGC A;  1IF1 A;  1GVJ A;  5D5W B;  1XCV A;  2MH9 A;  4WWC A;  3JAM K;  4G7Z F;  4BH9 A;  4KMU X;  4ESJ A;  2F2E A;  1EH8 A;  1ZRE A;  1OR7 A;  3SFZ A;  2D1V A;  3TGN A;  2XAH A;  3Q5F A;  2VBY A;  3FZV A;  4IXA A;  4R79 A;  3RKY A;  4CO8 A;  4HX8 A;  2XAJ A;  2XRO A;  4KIG A;  4F7Z A;  3WU1 B;  2E7W A;  1U5T B;  3IWZ A;  1ZAO A;  4YFN F;  2JRT A;  2QUF A;  5K5R A;  3KET A;  1XSV A;  4M71 A;  3G73 A;  2JTV A;  2DPU A;  3CLO A;  1U78 A;  1FBU A;  1OMI A;  2VN2 A;  3IWF A;  4KDP A;  2CG4 A;  1ZRD A;  2XKO A;  2ZNY A;  4KNY A;  5D5V B;  4HDV A;  4A2U A;  3V7C A;  3FHZ A;  1B9N A;  3RJP A;  3RIR A;  2GAU A;  2V79 A;  5HS7 A;  1B6A A;  2F5E A;  3NQO A;  5LGT A;  2DK8 A;  2CO5 A;  2OU2 A;  4A0Y A;  2M8E A;  4UUV A;  3KZY A;  4D0P A;  2ESH A;  2XV4 S;  1WRJ A;  2Q0O A;  3M7G A;  1DDN A;  4UHT A;  1DP7 P;  1FC3 A;  3RYP A;  3J81 Z;  4WXH A;  4CDG A;  2FOK A;  1ZN2 A;  2K4B A;  1D8J A;  2HYF A;  3ML6 A;  3FM5 A;  2EV0 A;  1PUE E;  5D8K B;  1FZP B;  1S8N A;  4P55 A;  3JTG A;  4R1H A;  2BYV E;  1ZLJ A;  3TDU C;  3IL2 A;  4CXF A;  3K1M A;  4L5J A;  5E1Z B;  3SHF A;  2P4W A;  2VC1 A;  2XAQ A;  2HOE A;  3F6V A;  4MGR A;  1LJ9 A;  2YX7 A;  3H3Z A;  1S29 A;  2JT1 A;  5DEQ A;  3U2R A;  3GFI A;  3F21 A;  2QLZ A;  2P7V B;  4WXC A;  1SD7 A;  1XMK A;  3V7R A;  1CF7 A;  2KJB A;  3M8F A;  2K4J A;  4OIO F;  1IRF A;  2XUB A;  2K7L A;  3WGH A;  4KA4 A;  1ULY A;  1VTN C;  4U7D A;  2D1H A;  3REO A;  1W7P D;  3L09 A;  5H6Q A;  1RUO A;  1NHA A;  3CJN A;  2OQR A;  1FYK A;  3ULQ B;  2QBY A;  1R1V A;  4RB2 C;  1J2X A;  3FXQ A;  3BWG A;  2EJR A;  3J80 Z;  3RI4 A;  3ECH A;  4IF4 A;  4HYE A;  1XN7 A;  1XCB A;  1K79 A;  3HIF A;  1A04 A;  3LQR A;  4HBL A;  2Y0M A;  5E20 A;  1SFX A;  3KLO A;  4M9Z A;  3R61 A;  4XSX F;  4BHP A;  4CZZ A;  4M6Y A;  1JGS A;  2XRN A;  2J5O A;  3FMQ A;  3GEZ A;  1D5V A;  5IT9 K;  2GQQ A;  4WXD A;  1TBX A;  4OMZ A;  2EFQ A;  1T2K A;  3T8T A;  1R5G A;  1G3S A;  3WTU C;  4XLP F;  1YQA A;  1SD4 A;  1P4X A;  1HST A;  1ON1 A;  3KZZ A;  4OIN F;  3C7J A;  5E8G A;  2P5V A;  5DD4 A;  1ZG1 A;  2F5D A;  2FNP A;  4OIP F;  2FEZ A;  3R0J A;  5ERI A;  3QRF F;  4OOI A;  1SFE A;  2OD5 A;  5BS6 A;  2ZME A;  1XGO A;  3KEO A;  4HV6 A;  4YG2 F;  4IJA A;  3I53 A;  2A68 F;  4P9F A;  2DQR A;  3F72 A;  2DU9 A;  5FD5 A;  5LRR A;  4I0B A;  4MQ9 F;  3E6M A;  4L9N A;  4GO1 A;  4U0V A;  1YW7 A;  1I5Z A;  2NNY A;  2K86 A;  4A5N A;  1P4W A;  3K69 A;  2VBZ A;  1FWZ A;  5HDG A;  3LST A;  4EQQ A;  5E1W A;  2DI3 A;  2KJC A;  4WF2 A;  4XLN F;  2V9V A;  1MJA A;  1REP C;  3VB2 A;  1YW9 A;  2HZT A;  1RUN A;  1ZYR F;  3RTR A;  3ZMV A;  1HKT A;  2M87 A;  1SFU A;  2IA2 A;  4RAY A;  4A5M A;  4PZJ A;  4BNC A;  4O6J A;  3COA C;  4LG0 B;  3B02 A;  1ZG3 A;  2RNJ A;  3HHH A;  2G7H A;  4YFX F;  4LLN A;  1YS6 A;  2V1D A;  4KUM A;  1BI2 A;  2QZ8 A;  1RIO H;  4EMS A;  1ZHF A;  3FXU A;  1P92 A;  3J7A O;  3BPV A;  3QOP A;  1ZAR A;  3D0S A;  3E3V A;  2ZNZ A;  3QPT A;  4Y17 A;  4I2O A;  2HKO A;  5L3G A;  4I0A A;  4Q47 A;  1TLH B;  3T1B A;  4O5V A;  2HDC A;  4L5I A;  2JPC A;  3ZQ7 A;  3MCZ A;  1Z05 A;  1IN4 A;  2VOO A;  2DFI A;  3QAH A;  2FE3 A;  4EJO A;  1P4A A;  1BC8 C;  3ZP5 A;  3V8L A;  4B8X A;  2HYG D;  1UHM A;  4KFC A;  2COM A;  5CYV A;  1ODD A;  5EEG A;  1O3T A;  1FP2 A;  3GFL A;  4KN4 X;  4HAM A;  3V8J A;  1TQI A;  6PAX A;  2O03 A;  3F6O A;  4GYG A;  2X0L A;  3ERE D;  4LJZ F;  4EM1 A;  2MBF A;  1T38 A;  2IPQ X;  5JI6 A;  4YIF A;  3N97 A;  2WC2 A;  5LHH A;  1O7L A;  2AS5 F;  2QEN A;  4HF0 A;  5LLQ A;  2Y48 A;  1TQM A;  4RGU A;  2A6H F;  3NRV A;  5L3E A;  3L7W A;  2DK5 A;  5HLG A;  2KKO A;  4RB0 A;  2HEO A;  1R58 A;  5BMZ A;  5F6F A;  1D3Y A;  2BV6 A;  4IRH A;  4N0B A;  5D4S A;  2ISY A;  4N9H A;  4O3M A;  5HLH A;  5D5U B;  1Z1D A;  2EK5 A;  4GGG A;  1FX7 A;  3KFW X;  4UXN A;  1KU3 A;  1J0R A;  1TW2 A;  4LFU A;  5ICG A;  4UNO A;  3HRT A;  5ICF A;  2QQA A;  5BQT A;  1DPU A;  1KGS A;  3DKW A;  1AOY A;  2CFX A;  4HQM A;  1V3F A;  3K0L A;  5L3F A;  1RI7 A;  2GA2 A;  3F8N A;  2ACJ A;  5FLX Z;  3GFM A;  1WSU A;  4LK0 F;  1KQ8 A;  1WI9 A;  2NS0 A;  3BP8 A;  2Z3Y A;  1MZB A;  4CGZ A;  2GWR A;  3MZY A;  3IKT A;  4PCQ A;  2CW0 F;  3HHG A;  3JSP A;  1IN5 A;  2LNB A;  3I59 A;  3WE2 A;  4ZZL A;  2M30 A;  2UZK A;  3DP7 A;  5AON A;  2B0L A;  1FBQ A;  5D4R A;  3MAJ A;  2IJL A;  1Z6R A;  4ON0 A;  4HF2 A;  5D6F A;  4JQF A;  4BAY A;  5HDN A;  1B9M A;  2QWW A;  2RQP A;  5FD6 A;  5DUI A;  3HRM A;  4BHC A;  1K78 B;  4B09 A;  1XDU A;  4UV9 A;  4EJW A;  3FX3 A;  4MNU A;  2V6C A;  3GFJ A;  4PGH A;  3U9G A;  3ISP A;  1IXS B;  2ETH A;  2R7F A;  2K02 A;  3TO7 A;  3DPT A;  2VBW A;  1IN8 A;  3JTH A;  3TO9 A;  4PGG A;  1H9T A;  1EH7 A;  1E17 A;  5CVU A;  1Z91 A;  5J8C A;  5BPI A;  3OOP A;  3I64 A;  3CO6 C;  1H9G A;  3KP2 A;  4M6X A;  4QWQ A;  4U0W A;  1IRG A;  3BJ6 A;  2KRF A;  1PDN C;  5KK1 A;  2HFH A;  1R36 A;  1ZGA A;  5FO5 A;  1QZZ A;  2Z33 A;  1X3U A;  2DTR A;  3HOT A;  4GYI A;  1QGP A;  1T6S A;  2YPR A;  2DQL A;  1K6O A;  4EM2 A;  4L9V A;  4ZYD A;  2W24 A;  2FQ3 A;  2VOD A;  1F5T A;  4E70 A;  2QYO A;  2CGP A;  2JPB A;  1SD5 A;  1FOK A;  3ZN0 A;  3K2Z A;  4EJT A;  2OA4 A;  1S7O A;  1YLF A;  2VC0 A;  2ISZ A;  5TRD A;  3KP4 A;  3EDP A;  3NEU A;  2VOP A;  1HW2 A;  2A07 F;  2LDU A;  2RC4 A;  3LWF A;  3IC7 A;  2CQK A;  5L3D A;  5DCM A;  4XSZ F;  3H3U A;  3KP7 A;  2VT2 A;  4AIH A;  4IHT A;  4HOB A;  1BN5 A;  4M74 A;  3MWM A;  2DW4 A;  4U7B A;  3JW4 A;  2ZJ2 A;  1R22 A;  5A2Q K;  3R6S A;  2PMU A;  4KIC A;  1IAW A;  2HGC A;  4RB3 C;  3GO5 A;  2GXG A;  4FX0 A;  3TKY A;  2A5Y B;  3IKV A;  4A6D A;  1W7P B;  2VE9 A;  1V4R A;  3QP5 A;  3V7S A;  2WTE A;  4BXU A;  2MC3 A;  3DF8 A;  3LA7 A;  4U88 A;  4BQA A;  1XGM A;  4MTE A;  1IUY A;  3VEP A;  3WTT C;  3BJA A;  1U5T A;  2PG4 A;  3E6C C;  3CUQ B;  2RVC A;  3HTU A;  5LEK A;  1FLI A;  4HZF A;  4BYY A;  3SZT A;  2C6Y A;  2MLG A;  2VON A;  3KP3 A;  2E1C A;  2HS5 A;  3HSF A;  3QPH A;  4S04 A;  1YIO A;  1HW1 A;  4MTD A;  4LB5 A;  1MJB A;  1Z6T A;  3ECO A;  3WTV C;  1UST A;  3BOQ A;  2EA4 A;  5ILU A;  5ICE A;  5D5X B;  2MH2 A;  2W25 A;  3ZMU A;  4YII A;  5E17 F;  1O3R A;  2Z5U A;  4S05 A;  1U8R A;  5KVR A;  4M9S A;  1U5T C;  3JSO A;  5BOX A;  4UV8 A;  2P8T A;  4EVI A;  1BJA A;  2RKH A;  4A6E A;  1IN7 A;  4RGR A;  3VFZ A;  2F5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...