1HCEA

Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
118
structure length
118
Chain Sequence
MGNRAFKSHHGHFLSAEGEAVKTHHGHHDHHTHFHVENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGGKVSIKGHHHHYISADHHGHVSTKEHHDHDTTFEEIII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor.
pubmed doi rcsb
molecule keywords HISACTOPHILIN
molecule tags Actin binding
source organism Dictyostelium discoideum
total genus 6
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1994-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06268 Fascin Fascin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1hceA00
4P0LA 3VT0A 31BIA 4XFSA 4AN6A 1G9BA 1S0GA 3O44A 4HA2A 3CRHA 4ZKTB 2ZQOA 8I1BA 2ZR1B 1UPSA 3FJBA 3KMVA 2L5XA 2FO1A 4IY9A 4ZBVB 3IM6A 5BQUC 1PUUB 4ISRA 1PUMB 3K1XA 3I2XA 3P6IA 5JMCA 4I0YA 1JQZA 3CA1A 5BXRA 1IOBA 1DIWA 5F8WA 3IM5A 3BADA 2ET2A 3ZC8A 1G9CA 3RTJB 2YUGA 2NYYA 4ENDA 3ILAA 4GP3A 3NBDA 1L2HA 1V6WA 1AVAC 3A22A 3C9ZA 3N7LA 2RG9B 2D1ZA 1EYLA 4KEJA 1M2TB 3R4SA 3BAHA 3N7JA 4D0TA 3QR5A 4IQPA 2I1BA 3JUTA 4JKXB 3BA7A 1HWNB 3O4OA 1M16A 1SR4A 3WMUA 1DQGA 2Q9XA 3BA5A 4JAWA 3HMYA 3BAOA 2ZQNA 4JP0A 4L4IA 3FJEA 3O4AA 4QKRA 4J23B 2HWAA 1S0BA 3AZWA 3D7WB 1ISWA 1F31A 3POKA 6I1BA 2MIBA 4QBCA 1ONKB 21BIA 3I29B 1BFFA 4I3NA 1QXMA 3UDAA 2KI4A 1ITBA 1AVWB 3V0AB 5EHAA 41BIA 1S0EA 3FJDA 4LO3C 5DZUA 1IRAX 4IZXA 3UD7A 4L4HA 3A07A 3UJ4A 1Q1UA 2P23A 1G9DA 4LO1A 5GAQA 1EV2A 3AJ6A 2AAIB 3VT1A 2DREA 3NBCA 4LO7C 4I1BA 4DENA 3T8SA 1XZZA 3CA4A 3FJJA 4LO2C 5D62A 1GGPB 1II4A 5DSSB 3WO3A 1IHKA 4LO0C 1MC9A 3IAGC 4ZLBB 1NUNA 2FFVA 3ZX7A 4IYBA 3VUOA 4G6JA 1TP0A 4LO7B 2LIEA 3OBRA 1VCLA 3B9UA 1KNMA 3RSJA 1V6VA 2E4MA 4I2SA 1BA7A 4P0KA 1R8OA 3PMEA 1S0FA 1XYFA 3WINA 1XHBA 1JTCA 1Z2VA 2F2FA 3F1RA 1FV2A 3OGFA 1R8NA 4I4SA 4FGFA 1I1BA 1P63A 3AKHA 5HPZA 3OJMA 2AQZA 3SNVA 1K5UA 3CRIA 4G6MA 1Q04A 4HJJA 1G82A 4I4RA 1FMMS 3UJ0A 4ISQA 2FFUA 5BOWA 2DS0A 1FN0A 2GO2A 3VWCA 2F8XC 3AH2A 4P0JA 5BXTA 4XFUA 4YOLA 1MD6A 5FZUA 3BRDA 1TOOA 2KH2A 4QD2C 1DFQA 3MPPG 2QYIB 2RSTA 3PHZA 5FZYA 1ISYA 3CQAA 2HZ9A 1RG8A 1YXWA 5FZZA 3BRGC 2Y9FA 3CA3A 1HWPB 1JT7A 3FJ8A 4JPZA 4X37A 1V6XA 3H6RB 4IY8A 4HR6C 4QD2B 3WA1A 3IM7A 4EKXB 1YYNA 5BVPI 3H6SE 5F8YA 4IZEA 4I37A 5EG6C 3VT2A 3BX1C 2UUSA 1Z0HA 4H9WA 1DFCA 1HCDA 3FJIA 3BAGA 3BAVA 1DLLA 1SR4C 1NZKA 2D22A 4I4OA 3ZXDA 4DEPA 1A8DA 1BLDA 3NBNA 1DJSB 4QBVA 4PC4A 2Y9GA 4P6AA 1RMLA 1JLYA 1SZ6B 2NM1A 3BAUA 4D0ZA 2Y9WC 4I1EA 5FNWA 2XOAA 4JKQA 4F34A 2Z48A 4D8HA 4GOVA 3N7MA 1ISZA 1TWEA 3JRRA 3CA6A 5EC5A 4G9NA 5G00A 3BB2A 2DRZA 3WO4A 3MALA 2RQ9A 4TLPA 1BASA 1E0OA 1TFMB 3WMVA 2LIQA 1FQ9A 1WD3A 2VSEA 2VXTI 3PG0A 2WBCA 3RTIB 4EFRA 5BXPA 1G9AA 3V0AA 4G1RA 4A7ZA 1PC8B 4LO1C 3AKGA 3AH1A 3BA4A 1AVXB 4OEFA 5BXSA 3ZC9A 1ISXA 1DZDA 3FJKA 3OBTA 4Z8SB 4I6IA 1AXMA 4X39A 1YTOA 3P6JA 3V0BB 2VUAA 4GAFA 1FMZA 5BP5A 1DQOA 2KI6B 1DZCA 3IIRA 5DUYA 3NJ5A 2E4MC 1TIEA 1JT4A 5FNXA 3WINC 1RZOB 3HALA 3O4DA 4II0A 3FJFA 1WBAA 4ZFUB 2F2FC 3OJVA 4USOA 3VEQA 3WO2A 3HSMA 4QO3A 2Q3NB 3H6QA 3LLPA 4LO0A 4JQ0A 2D7IA 1HCEA 3W9TA 4Q91A 2AFGA 1IT0A 1ILR1 4Q9PA 1BFGA 2DRYA 2NZ9A 1JT5A 4OWLA 3S8KA 2QN4A 2P39A 3FJ9A 5JLVA 4CJMA 3V79C 3CRGA 4OUJA 1JLXA 4EFQA 4EB2B 2D23A 4ZFYB 3Q7YA 4OWJA 2IWTB 1T4QA 4A7YA 1JT3A 5DVHA 3LTQA 4I4YA 2HWMA 1OQLB 4I4XA 1Q03A 3TC2A 3Q7XA 1WBCA 4USPA 3BRFA 1AFCA 3EF2A 3P53A 4FVVA 4XKIA 1BLAA 1FWUA 1S0DA 4Z9WB 1J0SA 3HBWA 3VSZA 2HW9A 4ZGRB 2VLCA 2BFHA 5D61A 4IONA 3NBEA 1ISVA 4KEIA 5B2HA 2BEAA 1WD4A 5BQUA 3O3QA 3H6RA 1YBIA 4Q9GA 4I4QA 3AKFA 4I4UA 3FUQA 4J2YA 1EVTA 2Z49A 4H04A 1FV3A 2ESUA 3CAHA 2X2TA 1W3FA 2R9KB 3FFZA 4KC3A 1T9FA 2VSAA 1W3AA 3AZVA 2VU9A 4I4VA 4X3AA 2NVHA 2Y9XE 5F8SA 1Z4SA 5I1BA 2K43A 2BEBA 2KLLA 3Q7WA 1PWAA 3RMYA 4ZOTA 3N7KA 4I7IA 1BFCA 3FJAA 5D63A 2FGFA 1ABRB 9ILBA 4I8MA 2D24A 2D43A 4WBCA 2NP0A 1BARA 5F90A 4EEEB 2J3PA 1HIBA 1JY0A 3CA0A 2FDBM 2MLLB 2K4AB 3FGMA 1RY7A 3A23A 2MC2A 4F83A 2D7RA 1IRPA 4IHZA 1QQKA 4R6UB 7I1BA 3VSFA 3O4CA 3A21A 4QKSA 2ERMA 4OEEA 4EFPA 3HN1A 4OEGA 4OW4A 1N4KA 1K5VA 3F62B 3S8JA 1D0HA 3N0KA 1CVSA 3QYDA 2NTDA 4GP0A 4J2KA 4LO3A 4ZFWB 2D44A 3O5WB 1TTUA 1PZZA 1TWMA 1V6UA 2IHOA 5BP5C 4J2XA 4LO8B 3BAQA 3AH4A 3UD8A 5E24E 3RMXA 3V0BA 1BFBA 1QQLA 3FJCA 1W3GA 3I2AA 4DCKC 1IILA 1FWVA 4XFTA 3PUBA 1AF9A 4LO2A 2K8RA 3CU1B 4G9MA 2M49A 4I4PA 3AJ5A 4J2SA 1YF8B 3OJ2A 3HOMA 2GZBA 2KKIA 1IJTA 3O4BA 1XG6A 4OWKA 3O49A 4I96A 1CE7B 4KEKA 4QALA 3FUOA 3AKIA 1I1EA 4ZA3B 3E8LC 4AN7B 3OGGA 3UD9A 1S0LA 4GAIA 1HWMB 1FGAA 1AVUA 2VXRA 4GOYA 3FJHA 4X38A 4JRAA 4QC4A 1HWOB 2WRYA 3ZXGA 1S0CA 2D20A 2AXMA 2X2SA 1EPWA 3BTAA 1HKNA 4KBBA 3R4UA 4A7KA 3CA5A
chains in the Genus database with same CATH superfamily
4P0LA 3VT0A 31BIA 4XFSA 4AN6A 1G9BA 1S0GA 3O44A 4HA2A 3CRHA 4ZKTB 2ZQOA 8I1BA 2ZR1B 1UPSA 3FJBA 3KMVA 2L5XA 2FO1A 4IY9A 4ZBVB 3IM6A 5BQUC 1PUUB 4ISRA 1PUMB 3K1XA 3I2XA 3P6IA 5JMCA 4I0YA 1JQZA 3CA1A 5BXRA 1IOBA 1DIWA 5F8WA 3IM5A 3BADA 2ET2A 3ZC8A 1G9CA 3RTJB 2YUGA 2NYYA 4ENDA 3ILAA 4GP3A 3NBDA 1L2HA 1V6WA 1AVAC 3A22A 3C9ZA 3N7LA 2RG9B 2D1ZA 1EYLA 4KEJA 1M2TB 3R4SA 3BAHA 3N7JA 4D0TA 3QR5A 4IQPA 2I1BA 3JUTA 4JKXB 3BA7A 1HWNB 3O4OA 1M16A 1SR4A 3WMUA 1DQGA 2Q9XA 3BA5A 4JAWA 3HMYA 3BAOA 2ZQNA 4JP0A 4L4IA 3FJEA 3O4AA 4QKRA 4J23B 2HWAA 1S0BA 3AZWA 3D7WB 1ISWA 1F31A 3POKA 6I1BA 2MIBA 4QBCA 1ONKB 21BIA 3I29B 1BFFA 4I3NA 1QXMA 3UDAA 2KI4A 1ITBA 1AVWB 3V0AB 5EHAA 41BIA 1S0EA 3FJDA 4LO3C 5DZUA 1IRAX 4IZXA 3UD7A 4L4HA 3A07A 3UJ4A 1Q1UA 2P23A 1G9DA 4LO1A 5GAQA 1EV2A 3AJ6A 2AAIB 3VT1A 2DREA 3NBCA 4LO7C 4I1BA 4DENA 3T8SA 1XZZA 3CA4A 3FJJA 4LO2C 5D62A 1GGPB 1II4A 5DSSB 3WO3A 1IHKA 4LO0C 1MC9A 3IAGC 4ZLBB 1NUNA 2FFVA 3ZX7A 4IYBA 3VUOA 4G6JA 1TP0A 4LO7B 2LIEA 3OBRA 1VCLA 3B9UA 1KNMA 3RSJA 1V6VA 2E4MA 4I2SA 1BA7A 4P0KA 1R8OA 3PMEA 1S0FA 1XYFA 3WINA 1XHBA 1JTCA 1Z2VA 2F2FA 3F1RA 1FV2A 3OGFA 1R8NA 4I4SA 4FGFA 1I1BA 1P63A 3AKHA 5HPZA 3OJMA 2AQZA 4UY4A 1K5UA 3SNVA 3CRIA 4G6MA 1Q04A 4HJJA 1G82A 4I4RA 1FMMS 3UJ0A 4ISQA 2FFUA 5BOWA 2DS0A 1FN0A 2GO2A 3VWCA 2F8XC 3AH2A 4P0JA 5BXTA 4XFUA 4YOLA 1MD6A 5FZUA 3BRDA 1TOOA 2KH2A 4QD2C 1DFQA 3MPPG 2QYIB 2RSTA 3PHZA 5FZYA 1ISYA 3CQAA 2HZ9A 1RG8A 1YXWA 5FZZA 3BRGC 2Y9FA 3CA3A 1HWPB 1JT7A 3FJ8A 4JPZA 4X37A 1V6XA 3H6RB 4IY8A 4MZHA 4HR6C 4QD2B 3WA1A 3IM7A 4EKXB 1YYNA 5BVPI 3H6SE 5F8YA 4IZEA 4I37A 5EG6C 3VT2A 3BX1C 2UUSA 1Z0HA 4H9WA 1DFCA 1HCDA 3FJIA 3BAGA 3BAVA 1DLLA 1SR4C 1NZKA 2D22A 4I4OA 3ZXDA 4DEPA 1A8DA 1BLDA 3NBNA 1DJSB 4QBVA 4PC4A 2Y9GA 4P6AA 1RMLA 1JLYA 1SZ6B 2NM1A 3BAUA 4D0ZA 2Y9WC 4I1EA 5FNWA 2XOAA 4JKQA 4F34A 2Z48A 4D8HA 4GOVA 3N7MA 1ISZA 1TWEA 3JRRA 3CA6A 5EC5A 4G9NA 5G00A 3BB2A 2DRZA 3WO4A 3MALA 2RQ9A 4TLPA 1BASA 1E0OA 1TFMB 3WMVA 2LIQA 1FQ9A 1WD3A 2VSEA 2VXTI 3PG0A 2WBCA 3RTIB 4EFRA 5BXPA 1G9AA 3V0AA 4G1RA 4A7ZA 1PC8B 4LO1C 3AKGA 3AH1A 3BA4A 1AVXB 4OEFA 5BXSA 3ZC9A 1ISXA 1DZDA 3FJKA 3OBTA 4Z8SB 4I6IA 1AXMA 4MZGB 4X39A 1YTOA 3P6JA 3V0BB 2VUAA 4GAFA 1FMZA 5BP5A 1DQOA 2KI6B 1DZCA 3IIRA 5DUYA 3NJ5A 2E4MC 1TIEA 1JT4A 5FNXA 3WINC 1RZOB 3HALA 3O4DA 4II0A 3FJFA 1WBAA 4ZFUB 2F2FC 3OJVA 4USOA 3VEQA 3WO2A 3HSMA 4QO3A 2Q3NB 3H6QA 3LLPA 4LO0A 4JQ0A 2D7IA 1HCEA 3W9TA 4Q91A 2AFGA 1IT0A 1ILR1 4Q9PA 1BFGA 2DRYA 2NZ9A 1JT5A 4OWLA 3S8KA 2QN4A 2P39A 3FJ9A 5JLVA 4CJMA 3V79C 3CRGA 4OUJA 1JLXA 4H75A 4EFQA 4EB2B 2D23A 4ZFYB 3Q7YA 4OWJA 2IWTB 1T4QA 4A7YA 1JT3A 5DVHA 3LTQA 4I4YA 2HWMA 1OQLB 4I4XA 1Q03A 3TC2A 3Q7XA 1WBCA 4USPA 3BRFA 1AFCA 3EF2A 3P53A 4FVVA 4XKIA 1BLAA 1FWUA 1S0DA 4Z9WB 1J0SA 3HBWA 3VSZA 2HW9A 4ZGRB 2VLCA 2BFHA 5D61A 4IONA 3NBEA 1ISVA 4KEIA 5B2HA 2BEAA 1WD4A 5BQUA 3O3QA 3H6RA 1YBIA 4Q9GA 4I4QA 3AKFA 4I4UA 3FUQA 4J2YA 1EVTA 2Z49A 4H04A 1FV3A 2ESUA 3CAHA 2X2TA 1W3FA 2R9KB 3FFZA 4KC3A 1T9FA 2VSAA 1W3AA 3AZVA 2VU9A 4I4VA 4X3AA 2NVHA 2Y9XE 5F8SA 1Z4SA 5I1BA 2K43A 2BEBA 2KLLA 3Q7WA 1PWAA 3RMYA 4ZOTA 3N7KA 4I7IA 1BFCA 3FJAA 5D63A 2FGFA 1ABRB 9ILBA 4I8MA 2D24A 2D43A 4WBCA 2NP0A 1BARA 5F90A 4EEEB 2J3PA 1HIBA 1JY0A 3CA0A 2FDBM 2MLLB 2K4AB 3FGMA 1RY7A 3A23A 2MC2A 4F83A 2D7RA 1IRPA 4IHZA 4MZFB 1QQKA 4R6UB 7I1BA 3VSFA 3O4CA 3A21A 4QKSA 2ERMA 4OEEA 4EFPA 3HN1A 4OEGA 4OW4A 1N4KA 1K5VA 3F62B 3S8JA 1D0HA 3N0KA 1CVSA 3QYDA 2NTDA 4GP0A 4J2KA 4LO3A 4ZFWB 2D44A 3O5WB 1TTUA 1PZZA 1TWMA 1V6UA 2IHOA 5BP5C 4J2XA 4LO8B 3BAQA 3AH4A 3UD8A 5E24E 3RMXA 3V0BA 1BFBA 1QQLA 3FJCA 1W3GA 3I2AA 2NS2A 4DCKC 1IILA 1FWVA 4XFTA 3PUBA 1AF9A 4LO2A 2K8RA 3CU1B 4G9MA 2M49A 4I4PA 3AJ5A 4J2SA 1YF8B 3OJ2A 3HOMA 2GZBA 2KKIA 1IJTA 3O4BA 1XG6A 4OWKA 3O49A 4I96A 1CE7B 4KEKA 4QALA 3FUOA 3AKIA 1I1EA 4ZA3B 3E8LC 4AN7B 3OGGA 3UD9A 1S0LA 4GAIA 1HWMB 1FGAA 1AVUA 2VXRA 4GOYA 3FJHA 4X38A 4JRAA 4QC4A 1HWOB 2WRYA 3ZXGA 1S0CA 2D20A 2AXMA 2X2SA 1EPWA 3BTAA 1HKNA 4KBBA 3R4UA 4A7KA 3CA5A
chains in the Genus database with same CATH topology
4P0LA 3VT0A 31BIA 4XFSA 4AN6A 1G9BA 1S0GA 3O44A 4HA2A 3CRHA 4ZKTB 2ZQOA 8I1BA 2ZR1B 1UPSA 3FJBA 3KMVA 2L5XA 2FO1A 4IY9A 4ZBVB 3IM6A 5BQUC 1PUUB 4ISRA 1PUMB 3K1XA 3I2XA 3P6IA 5JMCA 4I0YA 1JQZA 3CA1A 5BXRA 1IOBA 1DIWA 5F8WA 3IM5A 3BADA 2ET2A 3ZC8A 1G9CA 3RTJB 2YUGA 2NYYA 4ENDA 3ILAA 4GP3A 3NBDA 1L2HA 1V6WA 1AVAC 3A22A 3C9ZA 3N7LA 2RG9B 2D1ZA 1EYLA 4KEJA 1M2TB 3R4SA 3BAHA 3N7JA 4D0TA 3QR5A 4IQPA 2I1BA 3JUTA 4JKXB 3BA7A 1HWNB 3O4OA 1M16A 1SR4A 3WMUA 1DQGA 2Q9XA 3BA5A 4JAWA 3HMYA 3BAOA 2ZQNA 4JP0A 4L4IA 3FJEA 3O4AA 4QKRA 4J23B 2HWAA 1S0BA 3AZWA 3D7WB 1ISWA 1F31A 3POKA 6I1BA 2MIBA 4QBCA 1ONKB 21BIA 3I29B 1BFFA 4I3NA 1QXMA 3UDAA 2KI4A 1ITBA 1AVWB 3V0AB 5EHAA 41BIA 1S0EA 3FJDA 4LO3C 5DZUA 1IRAX 4IZXA 3UD7A 4L4HA 3A07A 3UJ4A 1Q1UA 2P23A 1G9DA 4LO1A 5GAQA 1EV2A 3AJ6A 2AAIB 3VT1A 2DREA 3NBCA 4LO7C 4I1BA 4DENA 3T8SA 1XZZA 3CA4A 3FJJA 4LO2C 5D62A 1GGPB 1II4A 5DSSB 3WO3A 1IHKA 4LO0C 1MC9A 3IAGC 4ZLBB 1NUNA 2FFVA 3ZX7A 4IYBA 3VUOA 4G6JA 1TP0A 4LO7B 2LIEA 3OBRA 1VCLA 3B9UA 1KNMA 3RSJA 1V6VA 2E4MA 4I2SA 1BA7A 4P0KA 1R8OA 3PMEA 1S0FA 1XYFA 3WINA 1XHBA 1JTCA 1Z2VA 2F2FA 3F1RA 1FV2A 3OGFA 1R8NA 4I4SA 4FGFA 1I1BA 1P63A 3AKHA 5HPZA 3OJMA 2AQZA 4UY4A 1K5UA 3SNVA 3CRIA 4G6MA 1Q04A 4HJJA 1G82A 4I4RA 1FMMS 3UJ0A 4ISQA 2FFUA 5BOWA 2DS0A 1FN0A 2GO2A 3VWCA 2F8XC 3AH2A 4P0JA 5BXTA 4XFUA 4YOLA 1MD6A 5FZUA 3BRDA 1TOOA 2KH2A 4QD2C 1DFQA 3MPPG 2QYIB 2RSTA 3PHZA 5FZYA 1ISYA 3CQAA 2HZ9A 1RG8A 1YXWA 5FZZA 3BRGC 2Y9FA 3CA3A 1HWPB 1JT7A 3FJ8A 4JPZA 4X37A 1V6XA 3H6RB 4IY8A 4MZHA 4HR6C 4QD2B 3WA1A 3IM7A 4EKXB 1YYNA 5BVPI 3H6SE 5F8YA 4IZEA 4I37A 5EG6C 3VT2A 3BX1C 2UUSA 1Z0HA 4H9WA 1DFCA 1HCDA 3FJIA 3BAGA 3BAVA 1DLLA 1SR4C 1NZKA 2D22A 4I4OA 3ZXDA 4DEPA 1A8DA 1BLDA 3NBNA 1DJSB 4QBVA 4PC4A 2Y9GA 4P6AA 1RMLA 1JLYA 1SZ6B 2NM1A 3BAUA 4D0ZA 2Y9WC 4I1EA 5FNWA 2XOAA 4JKQA 4F34A 2Z48A 4D8HA 4GOVA 3N7MA 1ISZA 1TWEA 3JRRA 3CA6A 5EC5A 4G9NA 5G00A 3BB2A 2DRZA 3WO4A 3MALA 2RQ9A 4TLPA 1BASA 1E0OA 1TFMB 3WMVA 2LIQA 1FQ9A 1WD3A 2VSEA 2VXTI 3PG0A 2WBCA 3RTIB 4EFRA 5BXPA 1G9AA 3V0AA 4G1RA 4A7ZA 1PC8B 4LO1C 3AKGA 3AH1A 3BA4A 1AVXB 4OEFA 5BXSA 3ZC9A 1ISXA 1DZDA 3FJKA 3OBTA 4Z8SB 4I6IA 1AXMA 4MZGB 4X39A 1YTOA 3P6JA 3V0BB 2VUAA 4GAFA 1FMZA 5BP5A 1DQOA 2KI6B 1DZCA 3IIRA 5DUYA 3NJ5A 2E4MC 1TIEA 1JT4A 5FNXA 3WINC 1RZOB 3HALA 3O4DA 4II0A 3FJFA 1WBAA 4ZFUB 2F2FC 3OJVA 4USOA 3VEQA 3WO2A 3HSMA 4QO3A 2Q3NB 3H6QA 3LLPA 4LO0A 4JQ0A 2D7IA 1HCEA 3W9TA 4Q91A 2AFGA 1IT0A 1ILR1 4Q9PA 1BFGA 2DRYA 2NZ9A 1JT5A 4OWLA 3S8KA 2QN4A 2P39A 3FJ9A 5JLVA 4CJMA 3V79C 3CRGA 4OUJA 1JLXA 4H75A 4EFQA 4EB2B 2D23A 4ZFYB 3Q7YA 4OWJA 2IWTB 1T4QA 4A7YA 1JT3A 5DVHA 3LTQA 4I4YA 2HWMA 1OQLB 4I4XA 1Q03A 3TC2A 3Q7XA 1WBCA 4USPA 3BRFA 1AFCA 3EF2A 3P53A 4FVVA 4XKIA 1BLAA 1FWUA 1S0DA 4Z9WB 1J0SA 3HBWA 3VSZA 2HW9A 4ZGRB 2VLCA 2BFHA 5D61A 4IONA 3NBEA 1ISVA 4KEIA 5B2HA 2BEAA 1WD4A 5BQUA 3O3QA 3H6RA 1YBIA 4Q9GA 4I4QA 3AKFA 4I4UA 3FUQA 4J2YA 1EVTA 2Z49A 4H04A 1FV3A 2ESUA 3CAHA 2X2TA 1W3FA 2R9KB 3FFZA 4KC3A 1T9FA 2VSAA 1W3AA 3AZVA 2VU9A 4I4VA 4X3AA 2NVHA 2Y9XE 5F8SA 1Z4SA 5I1BA 2K43A 2BEBA 2KLLA 3Q7WA 1PWAA 3RMYA 4ZOTA 3N7KA 4I7IA 1BFCA 3FJAA 5D63A 2FGFA 1ABRB 9ILBA 4I8MA 2D24A 2D43A 4WBCA 2NP0A 1BARA 5F90A 4EEEB 2J3PA 1HIBA 1JY0A 3CA0A 2FDBM 2MLLB 2K4AB 3FGMA 1RY7A 3A23A 2MC2A 4F83A 2D7RA 1IRPA 4IHZA 4MZFB 1QQKA 4R6UB 7I1BA 3VSFA 3O4CA 3A21A 4QKSA 2ERMA 4OEEA 4EFPA 3HN1A 4OEGA 4OW4A 1N4KA 1K5VA 3F62B 3S8JA 1D0HA 3N0KA 1CVSA 3QYDA 2NTDA 4GP0A 4J2KA 4LO3A 4ZFWB 2D44A 3O5WB 1TTUA 1PZZA 1TWMA 1V6UA 2IHOA 5BP5C 4J2XA 4LO8B 3BAQA 3AH4A 3UD8A 5E24E 3RMXA 3V0BA 1BFBA 1QQLA 3FJCA 1W3GA 3I2AA 2NS2A 4DCKC 1IILA 1FWVA 4XFTA 3PUBA 1AF9A 4LO2A 2K8RA 3CU1B 4G9MA 2M49A 4I4PA 3AJ5A 4J2SA 1YF8B 3OJ2A 3HOMA 2GZBA 2KKIA 1IJTA 3O4BA 1XG6A 4OWKA 3O49A 4I96A 1CE7B 4KEKA 4QALA 3FUOA 3AKIA 1I1EA 4ZA3B 3E8LC 4AN7B 3OGGA 3UD9A 1S0LA 4GAIA 1HWMB 1FGAA 1AVUA 2VXRA 4GOYA 3FJHA 4X38A 4JRAA 4QC4A 1HWOB 2WRYA 3ZXGA 1S0CA 2D20A 2AXMA 2X2SA 1EPWA 3BTAA 1HKNA 4KBBA 3R4UA 4A7KA 3CA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0L A;  3VT0 A;  31BI A;  4XFS A;  4AN6 A;  1G9B A;  1S0G A;  3O44 A;  4HA2 A;  3CRH A;  4ZKT B;  2ZQO A;  8I1B A;  2ZR1 B;  1UPS A;  3FJB A;  3KMV A;  2L5X A;  2FO1 A;  4IY9 A;  4ZBV B;  3IM6 A;  5BQU C;  1PUU B;  4ISR A;  1PUM B;  3K1X A;  3I2X A;  3P6I A;  5JMC A;  4I0Y A;  1JQZ A;  3CA1 A;  5BXR A;  1IOB A;  1DIW A;  5F8W A;  3IM5 A;  3BAD A;  2ET2 A;  3ZC8 A;  1G9C A;  3RTJ B;  2YUG A;  2NYY A;  4END A;  3ILA A;  4GP3 A;  3NBD A;  1L2H A;  1V6W A;  1AVA C;  3A22 A;  3C9Z A;  3N7L A;  2RG9 B;  2D1Z A;  1EYL A;  4KEJ A;  1M2T B;  3R4S A;  3BAH A;  3N7J A;  4D0T A;  3QR5 A;  4IQP A;  2I1B A;  3JUT A;  4JKX B;  3BA7 A;  1HWN B;  3O4O A;  1M16 A;  1SR4 A;  3WMU A;  1DQG A;  2Q9X A;  3BA5 A;  4JAW A;  3HMY A;  3BAO A;  2ZQN A;  4JP0 A;  4L4I A;  3FJE A;  3O4A A;  4QKR A;  4J23 B;  2HWA A;  1S0B A;  3AZW A;  3D7W B;  1ISW A;  1F31 A;  3POK A;  6I1B A;  2MIB A;  4QBC A;  1ONK B;  21BI A;  3I29 B;  1BFF A;  4I3N A;  1QXM A;  3UDA A;  2KI4 A;  1ITB A;  1AVW B;  3V0A B;  5EHA A;  41BI A;  1S0E A;  3FJD A;  4LO3 C;  5DZU A;  1IRA X;  4IZX A;  3UD7 A;  4L4H A;  3A07 A;  3UJ4 A;  1Q1U A;  2P23 A;  1G9D A;  4LO1 A;  5GAQ A;  1EV2 A;  3AJ6 A;  2AAI B;  3VT1 A;  2DRE A;  3NBC A;  4LO7 C;  4I1B A;  4DEN A;  3T8S A;  1XZZ A;  3CA4 A;  3FJJ A;  4LO2 C;  5D62 A;  1GGP B;  1II4 A;  5DSS B;  3WO3 A;  1IHK A;  4LO0 C;  1MC9 A;  3IAG C;  4ZLB B;  1NUN A;  2FFV A;  3ZX7 A;  4IYB A;  3VUO A;  4G6J A;  1TP0 A;  4LO7 B;  2LIE A;  3OBR A;  1VCL A;  3B9U A;  1KNM A;  3RSJ A;  1V6V A;  2E4M A;  4I2S A;  1BA7 A;  4P0K A;  1R8O A;  3PME A;  1S0F A;  1XYF A;  3WIN A;  1XHB A;  1JTC A;  1Z2V A;  2F2F A;  3F1R A;  1FV2 A;  3OGF A;  1R8N A;  4I4S A;  4FGF A;  1I1B A;  1P63 A;  3AKH A;  5HPZ A;  3OJM A;  2AQZ A;  3SNV A;  1K5U A;  3CRI A;  4G6M A;  1Q04 A;  4HJJ A;  1G82 A;  4I4R A;  1FMM S;  3UJ0 A;  4ISQ A;  2FFU A;  5BOW A;  2DS0 A;  1FN0 A;  2GO2 A;  3VWC A;  2F8X C;  3AH2 A;  4P0J A;  5BXT A;  4XFU A;  4YOL A;  1MD6 A;  5FZU A;  3BRD A;  1TOO A;  2KH2 A;  4QD2 C;  1DFQ A;  3MPP G;  2QYI B;  2RST A;  3PHZ A;  5FZY A;  1ISY A;  3CQA A;  2HZ9 A;  1RG8 A;  1YXW A;  5FZZ A;  3BRG C;  2Y9F A;  3CA3 A;  1HWP B;  1JT7 A;  3FJ8 A;  4JPZ A;  4X37 A;  1V6X A;  3H6R B;  4IY8 A;  4HR6 C;  4QD2 B;  3WA1 A;  3IM7 A;  4EKX B;  1YYN A;  5BVP I;  3H6S E;  5F8Y A;  4IZE A;  4I37 A;  5EG6 C;  3VT2 A;  3BX1 C;  2UUS A;  1Z0H A;  4H9W A;  1DFC A;  1HCD A;  3FJI A;  3BAG A;  3BAV A;  1DLL A;  1SR4 C;  1NZK A;  2D22 A;  4I4O A;  3ZXD A;  4DEP A;  1A8D A;  1BLD A;  3NBN A;  1DJS B;  4QBV A;  4PC4 A;  2Y9G A;  4P6A A;  1RML A;  1JLY A;  1SZ6 B;  2NM1 A;  3BAU A;  4D0Z A;  2Y9W C;  4I1E A;  5FNW A;  2XOA A;  4JKQ A;  4F34 A;  2Z48 A;  4D8H A;  4GOV A;  3N7M A;  1ISZ A;  1TWE A;  3JRR A;  3CA6 A;  5EC5 A;  4G9N A;  5G00 A;  3BB2 A;  2DRZ A;  3WO4 A;  3MAL A;  2RQ9 A;  4TLP A;  1BAS A;  1E0O A;  1TFM B;  3WMV A;  2LIQ A;  1FQ9 A;  1WD3 A;  2VSE A;  2VXT I;  3PG0 A;  2WBC A;  3RTI B;  4EFR A;  5BXP A;  1G9A A;  3V0A A;  4G1R A;  4A7Z A;  1PC8 B;  4LO1 C;  3AKG A;  3AH1 A;  3BA4 A;  1AVX B;  4OEF A;  5BXS A;  3ZC9 A;  1ISX A;  1DZD A;  3FJK A;  3OBT A;  4Z8S B;  4I6I A;  1AXM A;  4X39 A;  1YTO A;  3P6J A;  3V0B B;  2VUA A;  4GAF A;  1FMZ A;  5BP5 A;  1DQO A;  2KI6 B;  1DZC A;  3IIR A;  5DUY A;  3NJ5 A;  2E4M C;  1TIE A;  1JT4 A;  5FNX A;  3WIN C;  1RZO B;  3HAL A;  3O4D A;  4II0 A;  3FJF A;  1WBA A;  4ZFU B;  2F2F C;  3OJV A;  4USO A;  3VEQ A;  3WO2 A;  3HSM A;  4QO3 A;  2Q3N B;  3H6Q A;  3LLP A;  4LO0 A;  4JQ0 A;  2D7I A;  1HCE A;  3W9T A;  4Q91 A;  2AFG A;  1IT0 A;  1ILR 1;  4Q9P A;  1BFG A;  2DRY A;  2NZ9 A;  1JT5 A;  4OWL A;  3S8K A;  2QN4 A;  2P39 A;  3FJ9 A;  5JLV A;  4CJM A;  3V79 C;  3CRG A;  4OUJ A;  1JLX A;  4EFQ A;  4EB2 B;  2D23 A;  4ZFY B;  3Q7Y A;  4OWJ A;  2IWT B;  1T4Q A;  4A7Y A;  1JT3 A;  5DVH A;  3LTQ A;  4I4Y A;  2HWM A;  1OQL B;  4I4X A;  1Q03 A;  3TC2 A;  3Q7X A;  1WBC A;  4USP A;  3BRF A;  1AFC A;  3EF2 A;  3P53 A;  4FVV A;  4XKI A;  1BLA A;  1FWU A;  1S0D A;  4Z9W B;  1J0S A;  3HBW A;  3VSZ A;  2HW9 A;  4ZGR B;  2VLC A;  2BFH A;  5D61 A;  4ION A;  3NBE A;  1ISV A;  4KEI A;  5B2H A;  2BEA A;  1WD4 A;  5BQU A;  3O3Q A;  3H6R A;  1YBI A;  4Q9G A;  4I4Q A;  3AKF A;  4I4U A;  3FUQ A;  4J2Y A;  1EVT A;  2Z49 A;  4H04 A;  1FV3 A;  2ESU A;  3CAH A;  2X2T A;  1W3F A;  2R9K B;  3FFZ A;  4KC3 A;  1T9F A;  2VSA A;  1W3A A;  3AZV A;  2VU9 A;  4I4V A;  4X3A A;  2NVH A;  2Y9X E;  5F8S A;  1Z4S A;  5I1B A;  2K43 A;  2BEB A;  2KLL A;  3Q7W A;  1PWA A;  3RMY A;  4ZOT A;  3N7K A;  4I7I A;  1BFC A;  3FJA A;  5D63 A;  2FGF A;  1ABR B;  9ILB A;  4I8M A;  2D24 A;  2D43 A;  4WBC A;  2NP0 A;  1BAR A;  5F90 A;  4EEE B;  2J3P A;  1HIB A;  1JY0 A;  3CA0 A;  2FDB M;  2MLL B;  2K4A B;  3FGM A;  1RY7 A;  3A23 A;  2MC2 A;  4F83 A;  2D7R A;  1IRP A;  4IHZ A;  1QQK A;  4R6U B;  7I1B A;  3VSF A;  3O4C A;  3A21 A;  4QKS A;  2ERM A;  4OEE A;  4EFP A;  3HN1 A;  4OEG A;  4OW4 A;  1N4K A;  1K5V A;  3F62 B;  3S8J A;  1D0H A;  3N0K A;  1CVS A;  3QYD A;  2NTD A;  4GP0 A;  4J2K A;  4LO3 A;  4ZFW B;  2D44 A;  3O5W B;  1TTU A;  1PZZ A;  1TWM A;  1V6U A;  2IHO A;  5BP5 C;  4J2X A;  4LO8 B;  3BAQ A;  3AH4 A;  3UD8 A;  5E24 E;  3RMX A;  3V0B A;  1BFB A;  1QQL A;  3FJC A;  1W3G A;  3I2A A;  4DCK C;  1IIL A;  1FWV A;  4XFT A;  3PUB A;  1AF9 A;  4LO2 A;  2K8R A;  3CU1 B;  4G9M A;  2M49 A;  4I4P A;  3AJ5 A;  4J2S A;  1YF8 B;  3OJ2 A;  3HOM A;  2GZB A;  2KKI A;  1IJT A;  3O4B A;  1XG6 A;  4OWK A;  3O49 A;  4I96 A;  1CE7 B;  4KEK A;  4QAL A;  3FUO A;  3AKI A;  1I1E A;  4ZA3 B;  3E8L C;  4AN7 B;  3OGG A;  3UD9 A;  1S0L A;  4GAI A;  1HWM B;  1FGA A;  1AVU A;  2VXR A;  4GOY A;  3FJH A;  4X38 A;  4JRA A;  4QC4 A;  1HWO B;  2WRY A;  3ZXG A;  1S0C A;  2D20 A;  2AXM A;  2X2S A;  1EPW A;  3BTA A;  1HKN A;  4KBB A;  3R4U A;  4A7K A;  3CA5 A; 
#chains in the Genus database with same CATH topology
 4P0L A;  3VT0 A;  31BI A;  4XFS A;  4AN6 A;  1G9B A;  1S0G A;  3O44 A;  4HA2 A;  3CRH A;  4ZKT B;  2ZQO A;  8I1B A;  2ZR1 B;  1UPS A;  3FJB A;  3KMV A;  2L5X A;  2FO1 A;  4IY9 A;  4ZBV B;  3IM6 A;  5BQU C;  1PUU B;  4ISR A;  1PUM B;  3K1X A;  3I2X A;  3P6I A;  5JMC A;  4I0Y A;  1JQZ A;  3CA1 A;  5BXR A;  1IOB A;  1DIW A;  5F8W A;  3IM5 A;  3BAD A;  2ET2 A;  3ZC8 A;  1G9C A;  3RTJ B;  2YUG A;  2NYY A;  4END A;  3ILA A;  4GP3 A;  3NBD A;  1L2H A;  1V6W A;  1AVA C;  3A22 A;  3C9Z A;  3N7L A;  2RG9 B;  2D1Z A;  1EYL A;  4KEJ A;  1M2T B;  3R4S A;  3BAH A;  3N7J A;  4D0T A;  3QR5 A;  4IQP A;  2I1B A;  3JUT A;  4JKX B;  3BA7 A;  1HWN B;  3O4O A;  1M16 A;  1SR4 A;  3WMU A;  1DQG A;  2Q9X A;  3BA5 A;  4JAW A;  3HMY A;  3BAO A;  2ZQN A;  4JP0 A;  4L4I A;  3FJE A;  3O4A A;  4QKR A;  4J23 B;  2HWA A;  1S0B A;  3AZW A;  3D7W B;  1ISW A;  1F31 A;  3POK A;  6I1B A;  2MIB A;  4QBC A;  1ONK B;  21BI A;  3I29 B;  1BFF A;  4I3N A;  1QXM A;  3UDA A;  2KI4 A;  1ITB A;  1AVW B;  3V0A B;  5EHA A;  41BI A;  1S0E A;  3FJD A;  4LO3 C;  5DZU A;  1IRA X;  4IZX A;  3UD7 A;  4L4H A;  3A07 A;  3UJ4 A;  1Q1U A;  2P23 A;  1G9D A;  4LO1 A;  5GAQ A;  1EV2 A;  3AJ6 A;  2AAI B;  3VT1 A;  2DRE A;  3NBC A;  4LO7 C;  4I1B A;  4DEN A;  3T8S A;  1XZZ A;  3CA4 A;  3FJJ A;  4LO2 C;  5D62 A;  1GGP B;  1II4 A;  5DSS B;  3WO3 A;  1IHK A;  4LO0 C;  1MC9 A;  3IAG C;  4ZLB B;  1NUN A;  2FFV A;  3ZX7 A;  4IYB A;  3VUO A;  4G6J A;  1TP0 A;  4LO7 B;  2LIE A;  3OBR A;  1VCL A;  3B9U A;  1KNM A;  3RSJ A;  1V6V A;  2E4M A;  4I2S A;  1BA7 A;  4P0K A;  1R8O A;  3PME A;  1S0F A;  1XYF A;  3WIN A;  1XHB A;  1JTC A;  1Z2V A;  2F2F A;  3F1R A;  1FV2 A;  3OGF A;  1R8N A;  4I4S A;  4FGF A;  1I1B A;  1P63 A;  3AKH A;  5HPZ A;  3OJM A;  2AQZ A;  4UY4 A;  1K5U A;  3SNV A;  3CRI A;  4G6M A;  1Q04 A;  4HJJ A;  1G82 A;  4I4R A;  1FMM S;  3UJ0 A;  4ISQ A;  2FFU A;  5BOW A;  2DS0 A;  1FN0 A;  2GO2 A;  3VWC A;  2F8X C;  3AH2 A;  4P0J A;  5BXT A;  4XFU A;  4YOL A;  1MD6 A;  5FZU A;  3BRD A;  1TOO A;  2KH2 A;  4QD2 C;  1DFQ A;  3MPP G;  2QYI B;  2RST A;  3PHZ A;  5FZY A;  1ISY A;  3CQA A;  2HZ9 A;  1RG8 A;  1YXW A;  5FZZ A;  3BRG C;  2Y9F A;  3CA3 A;  1HWP B;  1JT7 A;  3FJ8 A;  4JPZ A;  4X37 A;  1V6X A;  3H6R B;  4IY8 A;  4MZH A;  4HR6 C;  4QD2 B;  3WA1 A;  3IM7 A;  4EKX B;  1YYN A;  5BVP I;  3H6S E;  5F8Y A;  4IZE A;  4I37 A;  5EG6 C;  3VT2 A;  3BX1 C;  2UUS A;  1Z0H A;  4H9W A;  1DFC A;  1HCD A;  3FJI A;  3BAG A;  3BAV A;  1DLL A;  1SR4 C;  1NZK A;  2D22 A;  4I4O A;  3ZXD A;  4DEP A;  1A8D A;  1BLD A;  3NBN A;  1DJS B;  4QBV A;  4PC4 A;  2Y9G A;  4P6A A;  1RML A;  1JLY A;  1SZ6 B;  2NM1 A;  3BAU A;  4D0Z A;  2Y9W C;  4I1E A;  5FNW A;  2XOA A;  4JKQ A;  4F34 A;  2Z48 A;  4D8H A;  4GOV A;  3N7M A;  1ISZ A;  1TWE A;  3JRR A;  3CA6 A;  5EC5 A;  4G9N A;  5G00 A;  3BB2 A;  2DRZ A;  3WO4 A;  3MAL A;  2RQ9 A;  4TLP A;  1BAS A;  1E0O A;  1TFM B;  3WMV A;  2LIQ A;  1FQ9 A;  1WD3 A;  2VSE A;  2VXT I;  3PG0 A;  2WBC A;  3RTI B;  4EFR A;  5BXP A;  1G9A A;  3V0A A;  4G1R A;  4A7Z A;  1PC8 B;  4LO1 C;  3AKG A;  3AH1 A;  3BA4 A;  1AVX B;  4OEF A;  5BXS A;  3ZC9 A;  1ISX A;  1DZD A;  3FJK A;  3OBT A;  4Z8S B;  4I6I A;  1AXM A;  4MZG B;  4X39 A;  1YTO A;  3P6J A;  3V0B B;  2VUA A;  4GAF A;  1FMZ A;  5BP5 A;  1DQO A;  2KI6 B;  1DZC A;  3IIR A;  5DUY A;  3NJ5 A;  2E4M C;  1TIE A;  1JT4 A;  5FNX A;  3WIN C;  1RZO B;  3HAL A;  3O4D A;  4II0 A;  3FJF A;  1WBA A;  4ZFU B;  2F2F C;  3OJV A;  4USO A;  3VEQ A;  3WO2 A;  3HSM A;  4QO3 A;  2Q3N B;  3H6Q A;  3LLP A;  4LO0 A;  4JQ0 A;  2D7I A;  1HCE A;  3W9T A;  4Q91 A;  2AFG A;  1IT0 A;  1ILR 1;  4Q9P A;  1BFG A;  2DRY A;  2NZ9 A;  1JT5 A;  4OWL A;  3S8K A;  2QN4 A;  2P39 A;  3FJ9 A;  5JLV A;  4CJM A;  3V79 C;  3CRG A;  4OUJ A;  1JLX A;  4H75 A;  4EFQ A;  4EB2 B;  2D23 A;  4ZFY B;  3Q7Y A;  4OWJ A;  2IWT B;  1T4Q A;  4A7Y A;  1JT3 A;  5DVH A;  3LTQ A;  4I4Y A;  2HWM A;  1OQL B;  4I4X A;  1Q03 A;  3TC2 A;  3Q7X A;  1WBC A;  4USP A;  3BRF A;  1AFC A;  3EF2 A;  3P53 A;  4FVV A;  4XKI A;  1BLA A;  1FWU A;  1S0D A;  4Z9W B;  1J0S A;  3HBW A;  3VSZ A;  2HW9 A;  4ZGR B;  2VLC A;  2BFH A;  5D61 A;  4ION A;  3NBE A;  1ISV A;  4KEI A;  5B2H A;  2BEA A;  1WD4 A;  5BQU A;  3O3Q A;  3H6R A;  1YBI A;  4Q9G A;  4I4Q A;  3AKF A;  4I4U A;  3FUQ A;  4J2Y A;  1EVT A;  2Z49 A;  4H04 A;  1FV3 A;  2ESU A;  3CAH A;  2X2T A;  1W3F A;  2R9K B;  3FFZ A;  4KC3 A;  1T9F A;  2VSA A;  1W3A A;  3AZV A;  2VU9 A;  4I4V A;  4X3A A;  2NVH A;  2Y9X E;  5F8S A;  1Z4S A;  5I1B A;  2K43 A;  2BEB A;  2KLL A;  3Q7W A;  1PWA A;  3RMY A;  4ZOT A;  3N7K A;  4I7I A;  1BFC A;  3FJA A;  5D63 A;  2FGF A;  1ABR B;  9ILB A;  4I8M A;  2D24 A;  2D43 A;  4WBC A;  2NP0 A;  1BAR A;  5F90 A;  4EEE B;  2J3P A;  1HIB A;  1JY0 A;  3CA0 A;  2FDB M;  2MLL B;  2K4A B;  3FGM A;  1RY7 A;  3A23 A;  2MC2 A;  4F83 A;  2D7R A;  1IRP A;  4IHZ A;  4MZF B;  1QQK A;  4R6U B;  7I1B A;  3VSF A;  3O4C A;  3A21 A;  4QKS A;  2ERM A;  4OEE A;  4EFP A;  3HN1 A;  4OEG A;  4OW4 A;  1N4K A;  1K5V A;  3F62 B;  3S8J A;  1D0H A;  3N0K A;  1CVS A;  3QYD A;  2NTD A;  4GP0 A;  4J2K A;  4LO3 A;  4ZFW B;  2D44 A;  3O5W B;  1TTU A;  1PZZ A;  1TWM A;  1V6U A;  2IHO A;  5BP5 C;  4J2X A;  4LO8 B;  3BAQ A;  3AH4 A;  3UD8 A;  5E24 E;  3RMX A;  3V0B A;  1BFB A;  1QQL A;  3FJC A;  1W3G A;  3I2A A;  2NS2 A;  4DCK C;  1IIL A;  1FWV A;  4XFT A;  3PUB A;  1AF9 A;  4LO2 A;  2K8R A;  3CU1 B;  4G9M A;  2M49 A;  4I4P A;  3AJ5 A;  4J2S A;  1YF8 B;  3OJ2 A;  3HOM A;  2GZB A;  2KKI A;  1IJT A;  3O4B A;  1XG6 A;  4OWK A;  3O49 A;  4I96 A;  1CE7 B;  4KEK A;  4QAL A;  3FUO A;  3AKI A;  1I1E A;  4ZA3 B;  3E8L C;  4AN7 B;  3OGG A;  3UD9 A;  1S0L A;  4GAI A;  1HWM B;  1FGA A;  1AVU A;  2VXR A;  4GOY A;  3FJH A;  4X38 A;  4JRA A;  4QC4 A;  1HWO B;  2WRY A;  3ZXG A;  1S0C A;  2D20 A;  2AXM A;  2X2S A;  1EPW A;  3BTA A;  1HKN A;  4KBB A;  3R4U A;  4A7K A;  3CA5 A; 
#chains in the Genus database with same CATH homology
 4P0L A;  3VT0 A;  31BI A;  4XFS A;  4AN6 A;  1G9B A;  1S0G A;  3O44 A;  4HA2 A;  3CRH A;  4ZKT B;  2ZQO A;  8I1B A;  2ZR1 B;  1UPS A;  3FJB A;  3KMV A;  2L5X A;  2FO1 A;  4IY9 A;  4ZBV B;  3IM6 A;  5BQU C;  1PUU B;  4ISR A;  1PUM B;  3K1X A;  3I2X A;  3P6I A;  5JMC A;  4I0Y A;  1JQZ A;  3CA1 A;  5BXR A;  1IOB A;  1DIW A;  5F8W A;  3IM5 A;  3BAD A;  2ET2 A;  3ZC8 A;  1G9C A;  3RTJ B;  2YUG A;  2NYY A;  4END A;  3ILA A;  4GP3 A;  3NBD A;  1L2H A;  1V6W A;  1AVA C;  3A22 A;  3C9Z A;  3N7L A;  2RG9 B;  2D1Z A;  1EYL A;  4KEJ A;  1M2T B;  3R4S A;  3BAH A;  3N7J A;  4D0T A;  3QR5 A;  4IQP A;  2I1B A;  3JUT A;  4JKX B;  3BA7 A;  1HWN B;  3O4O A;  1M16 A;  1SR4 A;  3WMU A;  1DQG A;  2Q9X A;  3BA5 A;  4JAW A;  3HMY A;  3BAO A;  2ZQN A;  4JP0 A;  4L4I A;  3FJE A;  3O4A A;  4QKR A;  4J23 B;  2HWA A;  1S0B A;  3AZW A;  3D7W B;  1ISW A;  1F31 A;  3POK A;  6I1B A;  2MIB A;  4QBC A;  1ONK B;  21BI A;  3I29 B;  1BFF A;  4I3N A;  1QXM A;  3UDA A;  2KI4 A;  1ITB A;  1AVW B;  3V0A B;  5EHA A;  41BI A;  1S0E A;  3FJD A;  4LO3 C;  5DZU A;  1IRA X;  4IZX A;  3UD7 A;  4L4H A;  3A07 A;  3UJ4 A;  1Q1U A;  2P23 A;  1G9D A;  4LO1 A;  5GAQ A;  1EV2 A;  3AJ6 A;  2AAI B;  3VT1 A;  2DRE A;  3NBC A;  4LO7 C;  4I1B A;  4DEN A;  3T8S A;  1XZZ A;  3CA4 A;  3FJJ A;  4LO2 C;  5D62 A;  1GGP B;  1II4 A;  5DSS B;  3WO3 A;  1IHK A;  4LO0 C;  1MC9 A;  3IAG C;  4ZLB B;  1NUN A;  2FFV A;  3ZX7 A;  4IYB A;  3VUO A;  4G6J A;  1TP0 A;  4LO7 B;  2LIE A;  3OBR A;  1VCL A;  3B9U A;  1KNM A;  3RSJ A;  1V6V A;  2E4M A;  4I2S A;  1BA7 A;  4P0K A;  1R8O A;  3PME A;  1S0F A;  1XYF A;  3WIN A;  1XHB A;  1JTC A;  1Z2V A;  2F2F A;  3F1R A;  1FV2 A;  3OGF A;  1R8N A;  4I4S A;  4FGF A;  1I1B A;  1P63 A;  3AKH A;  5HPZ A;  3OJM A;  2AQZ A;  4UY4 A;  1K5U A;  3SNV A;  3CRI A;  4G6M A;  1Q04 A;  4HJJ A;  1G82 A;  4I4R A;  1FMM S;  3UJ0 A;  4ISQ A;  2FFU A;  5BOW A;  2DS0 A;  1FN0 A;  2GO2 A;  3VWC A;  2F8X C;  3AH2 A;  4P0J A;  5BXT A;  4XFU A;  4YOL A;  1MD6 A;  5FZU A;  3BRD A;  1TOO A;  2KH2 A;  4QD2 C;  1DFQ A;  3MPP G;  2QYI B;  2RST A;  3PHZ A;  5FZY A;  1ISY A;  3CQA A;  2HZ9 A;  1RG8 A;  1YXW A;  5FZZ A;  3BRG C;  2Y9F A;  3CA3 A;  1HWP B;  1JT7 A;  3FJ8 A;  4JPZ A;  4X37 A;  1V6X A;  3H6R B;  4IY8 A;  4MZH A;  4HR6 C;  4QD2 B;  3WA1 A;  3IM7 A;  4EKX B;  1YYN A;  5BVP I;  3H6S E;  5F8Y A;  4IZE A;  4I37 A;  5EG6 C;  3VT2 A;  3BX1 C;  2UUS A;  1Z0H A;  4H9W A;  1DFC A;  1HCD A;  3FJI A;  3BAG A;  3BAV A;  1DLL A;  1SR4 C;  1NZK A;  2D22 A;  4I4O A;  3ZXD A;  4DEP A;  1A8D A;  1BLD A;  3NBN A;  1DJS B;  4QBV A;  4PC4 A;  2Y9G A;  4P6A A;  1RML A;  1JLY A;  1SZ6 B;  2NM1 A;  3BAU A;  4D0Z A;  2Y9W C;  4I1E A;  5FNW A;  2XOA A;  4JKQ A;  4F34 A;  2Z48 A;  4D8H A;  4GOV A;  3N7M A;  1ISZ A;  1TWE A;  3JRR A;  3CA6 A;  5EC5 A;  4G9N A;  5G00 A;  3BB2 A;  2DRZ A;  3WO4 A;  3MAL A;  2RQ9 A;  4TLP A;  1BAS A;  1E0O A;  1TFM B;  3WMV A;  2LIQ A;  1FQ9 A;  1WD3 A;  2VSE A;  2VXT I;  3PG0 A;  2WBC A;  3RTI B;  4EFR A;  5BXP A;  1G9A A;  3V0A A;  4G1R A;  4A7Z A;  1PC8 B;  4LO1 C;  3AKG A;  3AH1 A;  3BA4 A;  1AVX B;  4OEF A;  5BXS A;  3ZC9 A;  1ISX A;  1DZD A;  3FJK A;  3OBT A;  4Z8S B;  4I6I A;  1AXM A;  4MZG B;  4X39 A;  1YTO A;  3P6J A;  3V0B B;  2VUA A;  4GAF A;  1FMZ A;  5BP5 A;  1DQO A;  2KI6 B;  1DZC A;  3IIR A;  5DUY A;  3NJ5 A;  2E4M C;  1TIE A;  1JT4 A;  5FNX A;  3WIN C;  1RZO B;  3HAL A;  3O4D A;  4II0 A;  3FJF A;  1WBA A;  4ZFU B;  2F2F C;  3OJV A;  4USO A;  3VEQ A;  3WO2 A;  3HSM A;  4QO3 A;  2Q3N B;  3H6Q A;  3LLP A;  4LO0 A;  4JQ0 A;  2D7I A;  1HCE A;  3W9T A;  4Q91 A;  2AFG A;  1IT0 A;  1ILR 1;  4Q9P A;  1BFG A;  2DRY A;  2NZ9 A;  1JT5 A;  4OWL A;  3S8K A;  2QN4 A;  2P39 A;  3FJ9 A;  5JLV A;  4CJM A;  3V79 C;  3CRG A;  4OUJ A;  1JLX A;  4H75 A;  4EFQ A;  4EB2 B;  2D23 A;  4ZFY B;  3Q7Y A;  4OWJ A;  2IWT B;  1T4Q A;  4A7Y A;  1JT3 A;  5DVH A;  3LTQ A;  4I4Y A;  2HWM A;  1OQL B;  4I4X A;  1Q03 A;  3TC2 A;  3Q7X A;  1WBC A;  4USP A;  3BRF A;  1AFC A;  3EF2 A;  3P53 A;  4FVV A;  4XKI A;  1BLA A;  1FWU A;  1S0D A;  4Z9W B;  1J0S A;  3HBW A;  3VSZ A;  2HW9 A;  4ZGR B;  2VLC A;  2BFH A;  5D61 A;  4ION A;  3NBE A;  1ISV A;  4KEI A;  5B2H A;  2BEA A;  1WD4 A;  5BQU A;  3O3Q A;  3H6R A;  1YBI A;  4Q9G A;  4I4Q A;  3AKF A;  4I4U A;  3FUQ A;  4J2Y A;  1EVT A;  2Z49 A;  4H04 A;  1FV3 A;  2ESU A;  3CAH A;  2X2T A;  1W3F A;  2R9K B;  3FFZ A;  4KC3 A;  1T9F A;  2VSA A;  1W3A A;  3AZV A;  2VU9 A;  4I4V A;  4X3A A;  2NVH A;  2Y9X E;  5F8S A;  1Z4S A;  5I1B A;  2K43 A;  2BEB A;  2KLL A;  3Q7W A;  1PWA A;  3RMY A;  4ZOT A;  3N7K A;  4I7I A;  1BFC A;  3FJA A;  5D63 A;  2FGF A;  1ABR B;  9ILB A;  4I8M A;  2D24 A;  2D43 A;  4WBC A;  2NP0 A;  1BAR A;  5F90 A;  4EEE B;  2J3P A;  1HIB A;  1JY0 A;  3CA0 A;  2FDB M;  2MLL B;  2K4A B;  3FGM A;  1RY7 A;  3A23 A;  2MC2 A;  4F83 A;  2D7R A;  1IRP A;  4IHZ A;  4MZF B;  1QQK A;  4R6U B;  7I1B A;  3VSF A;  3O4C A;  3A21 A;  4QKS A;  2ERM A;  4OEE A;  4EFP A;  3HN1 A;  4OEG A;  4OW4 A;  1N4K A;  1K5V A;  3F62 B;  3S8J A;  1D0H A;  3N0K A;  1CVS A;  3QYD A;  2NTD A;  4GP0 A;  4J2K A;  4LO3 A;  4ZFW B;  2D44 A;  3O5W B;  1TTU A;  1PZZ A;  1TWM A;  1V6U A;  2IHO A;  5BP5 C;  4J2X A;  4LO8 B;  3BAQ A;  3AH4 A;  3UD8 A;  5E24 E;  3RMX A;  3V0B A;  1BFB A;  1QQL A;  3FJC A;  1W3G A;  3I2A A;  2NS2 A;  4DCK C;  1IIL A;  1FWV A;  4XFT A;  3PUB A;  1AF9 A;  4LO2 A;  2K8R A;  3CU1 B;  4G9M A;  2M49 A;  4I4P A;  3AJ5 A;  4J2S A;  1YF8 B;  3OJ2 A;  3HOM A;  2GZB A;  2KKI A;  1IJT A;  3O4B A;  1XG6 A;  4OWK A;  3O49 A;  4I96 A;  1CE7 B;  4KEK A;  4QAL A;  3FUO A;  3AKI A;  1I1E A;  4ZA3 B;  3E8L C;  4AN7 B;  3OGG A;  3UD9 A;  1S0L A;  4GAI A;  1HWM B;  1FGA A;  1AVU A;  2VXR A;  4GOY A;  3FJH A;  4X38 A;  4JRA A;  4QC4 A;  1HWO B;  2WRY A;  3ZXG A;  1S0C A;  2D20 A;  2AXM A;  2X2S A;  1EPW A;  3BTA A;  1HKN A;  4KBB A;  3R4U A;  4A7K A;  3CA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...