1HCJA

Photoproduct of the wild-type aequorea victoria green fluorescent protein
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
227
structure length
225
Chain Sequence
KGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLFVTAAGITH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GREEN FLUORESCENT PROTEIN
publication title Phototransformation of Green Fluorescent Protein with Uv and Visible Light Leads to Decarboxylation of Glutamate 222
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Luminescent protein
total genus 63
structure length 225
sequence length 227
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 1hcjA00
2H8QA 2WHUA 5T3IA 4DXIA 2POXA 3LS3A 3OSQA 4ZINA 2FWQA 4KF5C 5LTPA 3EVRA 3EK4A 4HE4A 3DQMA 5DU0A 3DQKA 3E5WA 5H89A 3DQFA 2G16B 3AKOA 2ZO6A 5AQBB 2IB5A 2EMDA 4GOBA 2GW4B 3V3DA 3LVAA 1EMFA 3DQ1A 2GX2A 4W7AA 2HJOA 3VICA 4KA9A 2H5PA 1GL4A 2B3PA 1S6ZA 3DQ7A 3IR8A 4W6RA 3ZUJA 3SSTA 3O78A 4IK8A 1MOUA 1CV7A 1YZWA 4XVPA 4JRBA 5HZTA 1ZUXA 4OHSA 5EXCI 1W7SA 3DQJA 4IZNA 3SV5A 4LJDC 2VZXA 1W7TA 2DUEA 4W6JA 2YFPA 1YFPA 4J89A 3W1DA 1EMGA 1Q4BA 3SVDA 1EMAA 2G3DB 3LVDA 2WHSA 3VK1A 5DPHA 4DXOA 5DQMA 3DQCA 4HQCA 3SG3A 3BXAA 2G3OA 3PJBA 3WLDA 4W6PA 4W7XA 3LSAA 2OTBA 2V4EA 1YHHA 2OGRA 2DUFA 1ZGPA 3P8UA 1RM9A 3NEDA 4OGSA 2ARLA 1OXEA 4IK1A 3U8PA 4J8AA 2ZMUA 2G2SB 1MYWA 2AWMA 3W1CA 3BX9A 3E5TA 5EXUA 5BTTB 3NT9A 2WIQA 2JADA 4ZFSA 1YJFA 2Z6YA 2YE1A 3E5VA 1XAEA 3PJ7A 1KYPA 4H3MA 2QZ0A 4RTCA 3PJ5A 3RWAA 3U0MA 2DUGA 4EDOA 4OJ0A 5DTYA 1OXFA 1KP5A 1Q4DA 3NF0A 4PPLA 4AR7A 1Q4EA 2AH8A 4W77A 5DRFA 1XMZA 1GFLA 3CFAA 5DPJA 5EXBA 1JC1A 1UISA 2QRFA 5HZSA 3DQEA 5H87A 1QY3A 2DUIA 3DPXA 1JBYA 4J88A 1W7UA 2QLHA 5EJUA 4W76A 5EB7A 4Z4MA 4KW8A 2QLEA 3EKHA 4W6IA 2HGYA 3EVVA 2B3QA 3SG6A 5FVGA 3GL4A 4JC2A 4W69A 3VHTB 4B30A 2AHAA 3ST2A 4Q7RA 4ZF3A 4W6LA 4ZBLA 2OKWA 4KF5A 2H5OA 1HUYA 3SVOA 3U0KA 2EMOA 2HQKA 3SG4A 2H5RA 3DPZA 4W6AA 1EMCA 5DPIA 3UFZA 1H6RA 3EVPA 2A53B 3SG5A 3DQLA 4GESB 1QYOA 1YJ2A 5FHVA 2AWJA 2C9JA 5FVFA 1Z1QA 4ZF4A 2VAEA 3H1RA 5EB6A 2WISA 3UG0A 5EHUA 4KAGA 4R6BA 2VVJA 5HZUA 4Q7TA 3ST4A 1YHGA 3DQ5A 4DXQA 4ORNA 4W6NA 3DQ2A 4IK5A 4ZF5A 5LTQA 3SSYA 5DQBA 3U0NA 4LJDA 4L12A 4W6DA 4KPIA 4IK4A 2O24A 2G5ZB 4UTSA 3SVNA 2O29A 1G7KA 4I2YA 3CD9A 3WCKA 3DQOA 2IB6A 3TMRA 3CB9A 4W7RA 3DQDA 4KEXA 4W75A 2QLGB 5HBDA 4JGEA 4EN1A 1Q73A 3DQ4A 4B30B 1EMMA 2A56B 5BQLA 2G6EA 1XA9A 1EMLA 2PXSA 4L13A 4W6SA 1RMPA 2YE0A 1B9CA 4LQUA 3DQAA 4KW4A 3EK7A 1RMOA 3AI4A 3O77A 2DDCA 2EMNA 3DQIA 2IE2A 3DQ3A 3EK8A 3CBEA 4Q9XA 5J2OA 4HQ8A 2P4MA 3ED8A 4LW5A 4PPKA 1RRXA 2VADA 3SSKA 4GF6B 4KW9A 2AWLA 5F9GA 2DD9A 2Z6XA 2RH7A 2FZUA 4W7CA 2DUHA 2O2BA 4RYWA 3GB3A 1Z1PA 4W6UA 2VVHA 3SSHA 5HGEA 4TZAA 4DXPA 3DQ6A 2HGDA 3SRYA 3SVEA 2ZO7A 3SVSA 2WHTA 5DTXA 2ZMWA 3SG7A 4DKNA 5DTZA 3DQHA 3DQ8A 4W6HA 4JF9A 4P76A 2G6YA 1EMEA 2GW3A 3NEZA 2A52B 2Z6ZA 4W6GA 1Q4CA 1XQMA 3KCTA 3M22A 4BDUA 4W7EA 5EBJA 3TMTA 4PFEA 4OY4A 4W6TA 3SVCA 4OQWA 4DXNA 3M24A 1F09A 4DKMA 4AS8A 4XGYA 4H47A 2V4EB 4W74A 5FVIA 4W6BA 4DXMA 4LQTA 2H5QA 3KCSA 5H88A 2HFCA 1ZGOA 4EULA 5DTLA 4L1IA 3SSLA 2DD7A 2VVIA 3H1OA 1KYSA 4Q9WA 5DY6A 1C4FA 4KGEA 5BTTA 2HQZA 2QLIA 3DQ9A 3EKJA 2HCGA 1YHIA 1EMKA 1JC0A 3SSPA 1HCJA 3AI5A 4JEOA 3PIBA 2HRSA 2Q6PA 1ZGQA 4LJBA 3SSVA 2YDZA 2OKYA 4ZB1A 5BT0A 1JBZA 3U8AA 2OTEA 3BXCA 4PPJA 1RMMA 4RYSA 1QYQA 3IP2A 4TZGA 4W7DA 3ZUFA 3GJ2A 2ICRA 3U0LA 3RWTA 3BXBA 4Z4KA 3OSRA 3ST0A 3LF4B 1EMBA 1KYRA 4W7FA 4W6OA 2H9WA 1GGXA 2QT2A 3ADFA 3S05A 4XOVA 4IK3A 3VHTA 3DQNA 4N3DA 4Q7UA 2WSOA 2WSNA 4H48A 4W6CA 4ZIOA 1QXTA 4H3LA 2Z1OA 1F0BA 5DPGA 1MOVA 3OGOA 2V4EC 2GX0A 4R6DA 2H6VA 4EDSA 4JFGA 4W72A 3U8CA 3DQUA 2A50B 3DPWA 1XSSA 3LA1A 3SG2A 5LTRA 4NWSA 4HVFA 1QYFA 2FL1A 3CFFA 5HW9A 2DDDA 4W6FA 4XL5A 3ST3A 5LK4A 2IOVA 1Q4AA 2HPWA 3ZULA 3ZTFA 3GJ1A 2BTJA 2A47A 4EMQA 3I19A 2AWKA 2G6XA 5DRGA 4IK9A 1OXDA 4W73A 2C9IA 4KF4A 3SVUA 4LJCA 3A8SA 3MGFA 3CFHA 2WURA 2OJKA 4H3NA 2PXWA 2Q57A 3LF3A 3CGLA 3G9AA 3GEXA 3K1KA 5KTGA 4B5YA 3LVCA 4U2VA 3WLCA 4ANJA 3P28A 2A46A 2QU1A 5HZOA 3SVBA 3NT3A 2A54B 2A48A 1BFPA 4P1QA 3SS0A 4W6MA 4W6KA 1H4UA 2Y0GA 3EVUA 2QLGA 4XOWA 4KGFA 3SVRA 3CD1A 4HQ9A
chains in the Genus database with same CATH superfamily
2H8QA 2WHUA 5T3IA 4DXIA 2POXA 3LS3A 3OSQA 4ZINA 2FWQA 4KF5C 5LTPA 3EVRA 3EK4A 4HE4A 3DQMA 5DU0A 3DQKA 3E5WA 5H89A 3DQFA 2G16B 3AKOA 2ZO6A 5AQBB 2IB5A 2EMDA 4GOBA 2GW4B 3V3DA 3LVAA 1EMFA 3DQ1A 2GX2A 4W7AA 2HJOA 3VICA 4KA9A 2H5PA 1GL4A 2B3PA 1S6ZA 3DQ7A 3IR8A 4W6RA 3ZUJA 3SSTA 3O78A 4IK8A 1MOUA 1CV7A 1YZWA 4XVPA 4JRBA 5HZTA 1ZUXA 4OHSA 5EXCI 1W7SA 3DQJA 4IZNA 3SV5A 4LJDC 2VZXA 1W7TA 2DUEA 4W6JA 2YFPA 1YFPA 4J89A 3W1DA 1EMGA 1Q4BA 3SVDA 1EMAA 2G3DB 3LVDA 2WHSA 3VK1A 5DPHA 4DXOA 5DQMA 3DQCA 4HQCA 3SG3A 3BXAA 2G3OA 3PJBA 3WLDA 4W6PA 4W7XA 3LSAA 2OTBA 2V4EA 1YHHA 2OGRA 2DUFA 1ZGPA 3P8UA 1RM9A 3NEDA 4OGSA 2ARLA 1OXEA 4IK1A 3U8PA 4J8AA 2ZMUA 2G2SB 1MYWA 2AWMA 3W1CA 3BX9A 3E5TA 5EXUA 5BTTB 3NT9A 2WIQA 2JADA 4ZFSA 1YJFA 2Z6YA 2YE1A 3E5VA 1XAEA 3PJ7A 1KYPA 4H3MA 2QZ0A 4RTCA 3PJ5A 3RWAA 3U0MA 2DUGA 4EDOA 4OJ0A 5DTYA 1OXFA 1KP5A 1Q4DA 3NF0A 4PPLA 4AR7A 1Q4EA 2AH8A 4W77A 5DRFA 1XMZA 1GFLA 3CFAA 5DPJA 5EXBA 1JC1A 1UISA 2QRFA 5HZSA 3DQEA 5H87A 1QY3A 2DUIA 3DPXA 1JBYA 4J88A 1W7UA 2QLHA 5EJUA 4W76A 5EB7A 4Z4MA 4KW8A 2QLEA 3EKHA 4W6IA 2HGYA 3EVVA 2B3QA 3SG6A 5FVGA 3GL4A 4JC2A 4W69A 3VHTB 4B30A 2AHAA 3ST2A 4Q7RA 4ZF3A 4W6LA 4ZBLA 2OKWA 4KF5A 2H5OA 1HUYA 3SVOA 3U0KA 2EMOA 2HQKA 3SG4A 2H5RA 3DPZA 4W6AA 1EMCA 5DPIA 3UFZA 1H6RA 3EVPA 2A53B 3SG5A 3DQLA 4GESB 1QYOA 1YJ2A 5FHVA 2AWJA 2C9JA 5FVFA 1Z1QA 4ZF4A 2VAEA 3H1RA 5EB6A 2WISA 3UG0A 5EHUA 4KAGA 4R6BA 2VVJA 5HZUA 4Q7TA 3ST4A 1YHGA 3DQ5A 4DXQA 4ORNA 4W6NA 3DQ2A 4IK5A 4ZF5A 5LTQA 3SSYA 5DQBA 3U0NA 4LJDA 4L12A 4W6DA 4KPIA 4IK4A 2O24A 2G5ZB 4UTSA 3SVNA 2O29A 1G7KA 4I2YA 3CD9A 3WCKA 3DQOA 2IB6A 3TMRA 3CB9A 4W7RA 3DQDA 4KEXA 4W75A 2QLGB 5HBDA 4JGEA 4EN1A 1Q73A 3DQ4A 4B30B 1EMMA 2A56B 5BQLA 2G6EA 1XA9A 1EMLA 2PXSA 4L13A 4W6SA 1RMPA 2YE0A 1B9CA 4LQUA 3DQAA 4KW4A 3EK7A 1RMOA 3AI4A 3O77A 2DDCA 2EMNA 3DQIA 2IE2A 3DQ3A 3EK8A 3CBEA 4Q9XA 5J2OA 4HQ8A 2P4MA 3ED8A 4LW5A 4PPKA 1RRXA 2VADA 3SSKA 4GF6B 4KW9A 2AWLA 5F9GA 2DD9A 2Z6XA 2RH7A 2FZUA 4W7CA 2DUHA 2O2BA 4RYWA 3GB3A 1Z1PA 4W6UA 2VVHA 3SSHA 5HGEA 4TZAA 4DXPA 3DQ6A 2HGDA 3SRYA 3SVEA 2ZO7A 3SVSA 2WHTA 5DTXA 2ZMWA 3SG7A 4DKNA 5DTZA 3DQHA 3DQ8A 4W6HA 4JF9A 4P76A 2G6YA 1EMEA 2GW3A 3NEZA 2A52B 2Z6ZA 4W6GA 1Q4CA 1XQMA 3KCTA 3M22A 4BDUA 4W7EA 5EBJA 3TMTA 4PFEA 4OY4A 4W6TA 3SVCA 4OQWA 4DXNA 3M24A 1F09A 4DKMA 4AS8A 4XGYA 4H47A 2V4EB 4W74A 5FVIA 4W6BA 4DXMA 4LQTA 2H5QA 3KCSA 5H88A 2HFCA 1ZGOA 4EULA 5DTLA 4L1IA 3SSLA 2DD7A 2VVIA 3H1OA 1KYSA 4Q9WA 5DY6A 1C4FA 4KGEA 5BTTA 2HQZA 2QLIA 3DQ9A 3EKJA 2HCGA 1YHIA 1EMKA 1JC0A 3SSPA 1HCJA 3AI5A 4JEOA 3PIBA 2HRSA 2Q6PA 1ZGQA 4LJBA 3SSVA 2YDZA 2OKYA 4ZB1A 5BT0A 1JBZA 3U8AA 2OTEA 3BXCA 4PPJA 1RMMA 4RYSA 1QYQA 3IP2A 4TZGA 4W7DA 3ZUFA 3GJ2A 2ICRA 3U0LA 3RWTA 3BXBA 4Z4KA 3OSRA 3ST0A 3LF4B 1EMBA 1KYRA 4W7FA 4W6OA 2H9WA 1GGXA 2QT2A 3ADFA 3S05A 4XOVA 4IK3A 3VHTA 3DQNA 4N3DA 4Q7UA 2WSOA 2WSNA 4H48A 4W6CA 4ZIOA 1QXTA 4H3LA 2Z1OA 1F0BA 5DPGA 1MOVA 3OGOA 2V4EC 2GX0A 4R6DA 2H6VA 4EDSA 4JFGA 4W72A 3U8CA 3DQUA 2A50B 3DPWA 1XSSA 3LA1A 3SG2A 5LTRA 4NWSA 4HVFA 1QYFA 2FL1A 3CFFA 5HW9A 2DDDA 4W6FA 4XL5A 3ST3A 5LK4A 2IOVA 1Q4AA 2HPWA 3ZULA 3ZTFA 3GJ1A 2BTJA 2A47A 4EMQA 3I19A 2AWKA 2G6XA 5DRGA 4IK9A 1OXDA 4W73A 2C9IA 4KF4A 3SVUA 4LJCA 3A8SA 3MGFA 3CFHA 2WURA 2OJKA 4H3NA 2PXWA 2Q57A 3LF3A 3CGLA 3G9AA 3GEXA 3K1KA 5KTGA 4B5YA 3LVCA 4U2VA 3WLCA 4ANJA 3P28A 2A46A 2QU1A 5HZOA 3SVBA 3NT3A 2A54B 2A48A 1BFPA 4P1QA 3SS0A 4W6MA 4W6KA 1H4UA 2Y0GA 3EVUA 2QLGA 4XOWA 4KGFA 3SVRA 3CD1A 4HQ9A
chains in the Genus database with same CATH topology
2H8QA 2WHUA 5T3IA 4DXIA 2POXA 3LS3A 3OSQA 4ZINA 2FWQA 4KF5C 5LTPA 3EVRA 3EK4A 4HE4A 3DQMA 5DU0A 3DQKA 3E5WA 5H89A 3DQFA 2G16B 3AKOA 2ZO6A 5AQBB 2IB5A 2EMDA 4GOBA 2GW4B 3V3DA 3LVAA 1EMFA 3DQ1A 2GX2A 4W7AA 2HJOA 3VICA 4KA9A 2H5PA 1GL4A 2B3PA 1S6ZA 3DQ7A 3IR8A 4W6RA 3ZUJA 3SSTA 3O78A 4IK8A 1MOUA 1CV7A 1YZWA 4XVPA 4JRBA 5HZTA 1ZUXA 4OHSA 5EXCI 1W7SA 3DQJA 4IZNA 3SV5A 4LJDC 2VZXA 1W7TA 2DUEA 4W6JA 2YFPA 1YFPA 4J89A 3W1DA 1EMGA 1Q4BA 3SVDA 1EMAA 2G3DB 3LVDA 2WHSA 3VK1A 5DPHA 4DXOA 5DQMA 3DQCA 4HQCA 3SG3A 3BXAA 2G3OA 3PJBA 3WLDA 4W6PA 4W7XA 3LSAA 2OTBA 2V4EA 1YHHA 2OGRA 2DUFA 1ZGPA 3P8UA 1RM9A 3NEDA 4OGSA 2ARLA 1OXEA 4IK1A 3U8PA 4J8AA 2ZMUA 2G2SB 1MYWA 2AWMA 3W1CA 3BX9A 3E5TA 5EXUA 5BTTB 3NT9A 2WIQA 2JADA 4ZFSA 1YJFA 2Z6YA 2YE1A 3E5VA 1XAEA 3PJ7A 1KYPA 4H3MA 2QZ0A 4RTCA 3PJ5A 3RWAA 3U0MA 2DUGA 4EDOA 4OJ0A 5DTYA 1OXFA 1KP5A 1Q4DA 3NF0A 4PPLA 4AR7A 1Q4EA 2AH8A 4W77A 5DRFA 1XMZA 1GFLA 3CFAA 5DPJA 5EXBA 1JC1A 1UISA 2QRFA 5HZSA 3DQEA 5H87A 1QY3A 2DUIA 3DPXA 1JBYA 4J88A 1W7UA 2QLHA 5EJUA 4W76A 5EB7A 4Z4MA 4KW8A 2QLEA 3EKHA 4W6IA 2HGYA 3EVVA 2B3QA 3SG6A 5FVGA 3GL4A 4JC2A 4W69A 3VHTB 4B30A 2AHAA 3ST2A 4Q7RA 4ZF3A 4W6LA 4ZBLA 2OKWA 4KF5A 2H5OA 1HUYA 3SVOA 3U0KA 2EMOA 2HQKA 3SG4A 2H5RA 3DPZA 4W6AA 1EMCA 5DPIA 3UFZA 1H6RA 3EVPA 2A53B 3SG5A 3DQLA 4GESB 1QYOA 1YJ2A 5FHVA 2AWJA 2C9JA 5FVFA 1Z1QA 4ZF4A 2VAEA 3H1RA 5EB6A 2WISA 3UG0A 5EHUA 4KAGA 4R6BA 2VVJA 5HZUA 4Q7TA 3ST4A 1YHGA 3DQ5A 4DXQA 4ORNA 4W6NA 3DQ2A 4IK5A 4ZF5A 5LTQA 3SSYA 5DQBA 3U0NA 4LJDA 4L12A 4W6DA 4KPIA 4IK4A 2O24A 2G5ZB 4UTSA 3SVNA 2O29A 1G7KA 4I2YA 3CD9A 3WCKA 3DQOA 2IB6A 3TMRA 3CB9A 4W7RA 3DQDA 4KEXA 4W75A 2QLGB 5HBDA 4JGEA 4EN1A 1Q73A 3DQ4A 4B30B 1EMMA 2A56B 5BQLA 2G6EA 1XA9A 1EMLA 2PXSA 4L13A 4W6SA 1RMPA 2YE0A 1B9CA 4LQUA 3DQAA 4KW4A 3EK7A 1RMOA 3AI4A 3O77A 2DDCA 2EMNA 3DQIA 2IE2A 3DQ3A 3EK8A 3CBEA 4Q9XA 5J2OA 4HQ8A 2P4MA 3ED8A 4LW5A 4PPKA 1RRXA 2VADA 3SSKA 4GF6B 4KW9A 2AWLA 5F9GA 2DD9A 2Z6XA 2RH7A 2FZUA 4W7CA 2DUHA 2O2BA 4RYWA 3GB3A 1Z1PA 4W6UA 2VVHA 3SSHA 5HGEA 4TZAA 4DXPA 3DQ6A 2HGDA 3SRYA 3SVEA 2ZO7A 3SVSA 2WHTA 5DTXA 2ZMWA 3SG7A 4DKNA 5DTZA 3DQHA 3DQ8A 4W6HA 4JF9A 4P76A 2G6YA 1EMEA 2GW3A 3NEZA 2A52B 2Z6ZA 4W6GA 1Q4CA 1XQMA 3KCTA 3M22A 4BDUA 4W7EA 5EBJA 3TMTA 4PFEA 4OY4A 4W6TA 3SVCA 4OQWA 4DXNA 3M24A 1F09A 4DKMA 4AS8A 4XGYA 4H47A 2V4EB 4W74A 5FVIA 4W6BA 4DXMA 4LQTA 2H5QA 3KCSA 5H88A 2HFCA 1ZGOA 4EULA 5DTLA 4L1IA 3SSLA 2DD7A 2VVIA 3H1OA 1KYSA 4Q9WA 5DY6A 1C4FA 4KGEA 5BTTA 2HQZA 2QLIA 3DQ9A 3EKJA 2HCGA 1YHIA 1EMKA 1JC0A 3SSPA 1HCJA 3AI5A 4JEOA 3PIBA 2HRSA 2Q6PA 1ZGQA 4LJBA 3SSVA 2YDZA 2OKYA 4ZB1A 5BT0A 1JBZA 3U8AA 2OTEA 3BXCA 4PPJA 1RMMA 4RYSA 1QYQA 3IP2A 4TZGA 4W7DA 3ZUFA 3GJ2A 2ICRA 3U0LA 3RWTA 3BXBA 4Z4KA 3OSRA 3ST0A 3LF4B 1EMBA 1KYRA 4W7FA 4W6OA 2H9WA 1GGXA 2QT2A 3ADFA 3S05A 4XOVA 4IK3A 3VHTA 3DQNA 4N3DA 4Q7UA 2WSOA 2WSNA 4H48A 4W6CA 4ZIOA 1QXTA 4H3LA 2Z1OA 1F0BA 5DPGA 1MOVA 3OGOA 2V4EC 2GX0A 4R6DA 2H6VA 4EDSA 4JFGA 4W72A 3U8CA 3DQUA 2A50B 3DPWA 1XSSA 3LA1A 3SG2A 5LTRA 4NWSA 4HVFA 1QYFA 2FL1A 3CFFA 5HW9A 2DDDA 4W6FA 4XL5A 3ST3A 5LK4A 2IOVA 1Q4AA 2HPWA 3ZULA 3ZTFA 3GJ1A 2BTJA 2A47A 4EMQA 3I19A 2AWKA 2G6XA 5DRGA 4IK9A 1OXDA 4W73A 2C9IA 4KF4A 3SVUA 4LJCA 3A8SA 3MGFA 3CFHA 2WURA 2OJKA 4H3NA 2PXWA 2Q57A 3LF3A 3CGLA 3G9AA 3GEXA 3K1KA 5KTGA 4B5YA 3LVCA 4U2VA 3WLCA 4ANJA 3P28A 2A46A 2QU1A 5HZOA 3SVBA 3NT3A 2A54B 2A48A 1BFPA 4P1QA 3SS0A 4W6MA 4W6KA 1H4UA 2Y0GA 3EVUA 2QLGA 4XOWA 4KGFA 3SVRA 3CD1A 4HQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8Q A;  2WHU A;  5T3I A;  4DXI A;  2POX A;  3LS3 A;  3OSQ A;  4ZIN A;  2FWQ A;  4KF5 C;  5LTP A;  3EVR A;  3EK4 A;  4HE4 A;  3DQM A;  5DU0 A;  3DQK A;  3E5W A;  5H89 A;  3DQF A;  2G16 B;  3AKO A;  2ZO6 A;  5AQB B;  2IB5 A;  2EMD A;  4GOB A;  2GW4 B;  3V3D A;  3LVA A;  1EMF A;  3DQ1 A;  2GX2 A;  4W7A A;  2HJO A;  3VIC A;  4KA9 A;  2H5P A;  1GL4 A;  2B3P A;  1S6Z A;  3DQ7 A;  3IR8 A;  4W6R A;  3ZUJ A;  3SST A;  3O78 A;  4IK8 A;  1MOU A;  1CV7 A;  1YZW A;  4XVP A;  4JRB A;  5HZT A;  1ZUX A;  4OHS A;  5EXC I;  1W7S A;  3DQJ A;  4IZN A;  3SV5 A;  4LJD C;  2VZX A;  1W7T A;  2DUE A;  4W6J A;  2YFP A;  1YFP A;  4J89 A;  3W1D A;  1EMG A;  1Q4B A;  3SVD A;  1EMA A;  2G3D B;  3LVD A;  2WHS A;  3VK1 A;  5DPH A;  4DXO A;  5DQM A;  3DQC A;  4HQC A;  3SG3 A;  3BXA A;  2G3O A;  3PJB A;  3WLD A;  4W6P A;  4W7X A;  3LSA A;  2OTB A;  2V4E A;  1YHH A;  2OGR A;  2DUF A;  1ZGP A;  3P8U A;  1RM9 A;  3NED A;  4OGS A;  2ARL A;  1OXE A;  4IK1 A;  3U8P A;  4J8A A;  2ZMU A;  2G2S B;  1MYW A;  2AWM A;  3W1C A;  3BX9 A;  3E5T A;  5EXU A;  5BTT B;  3NT9 A;  2WIQ A;  2JAD A;  4ZFS A;  1YJF A;  2Z6Y A;  2YE1 A;  3E5V A;  1XAE A;  3PJ7 A;  1KYP A;  4H3M A;  2QZ0 A;  4RTC A;  3PJ5 A;  3RWA A;  3U0M A;  2DUG A;  4EDO A;  4OJ0 A;  5DTY A;  1OXF A;  1KP5 A;  1Q4D A;  3NF0 A;  4PPL A;  4AR7 A;  1Q4E A;  2AH8 A;  4W77 A;  5DRF A;  1XMZ A;  1GFL A;  3CFA A;  5DPJ A;  5EXB A;  1JC1 A;  1UIS A;  2QRF A;  5HZS A;  3DQE A;  5H87 A;  1QY3 A;  2DUI A;  3DPX A;  1JBY A;  4J88 A;  1W7U A;  2QLH A;  5EJU A;  4W76 A;  5EB7 A;  4Z4M A;  4KW8 A;  2QLE A;  3EKH A;  4W6I A;  2HGY A;  3EVV A;  2B3Q A;  3SG6 A;  5FVG A;  3GL4 A;  4JC2 A;  4W69 A;  3VHT B;  4B30 A;  2AHA A;  3ST2 A;  4Q7R A;  4ZF3 A;  4W6L A;  4ZBL A;  2OKW A;  4KF5 A;  2H5O A;  1HUY A;  3SVO A;  3U0K A;  2EMO A;  2HQK A;  3SG4 A;  2H5R A;  3DPZ A;  4W6A A;  1EMC A;  5DPI A;  3UFZ A;  1H6R A;  3EVP A;  2A53 B;  3SG5 A;  3DQL A;  4GES B;  1QYO A;  1YJ2 A;  5FHV A;  2AWJ A;  2C9J A;  5FVF A;  1Z1Q A;  4ZF4 A;  2VAE A;  3H1R A;  5EB6 A;  2WIS A;  3UG0 A;  5EHU A;  4KAG A;  4R6B A;  2VVJ A;  5HZU A;  4Q7T A;  3ST4 A;  1YHG A;  3DQ5 A;  4DXQ A;  4ORN A;  4W6N A;  3DQ2 A;  4IK5 A;  4ZF5 A;  5LTQ A;  3SSY A;  5DQB A;  3U0N A;  4LJD A;  4L12 A;  4W6D A;  4KPI A;  4IK4 A;  2O24 A;  2G5Z B;  4UTS A;  3SVN A;  2O29 A;  1G7K A;  4I2Y A;  3CD9 A;  3WCK A;  3DQO A;  2IB6 A;  3TMR A;  3CB9 A;  4W7R A;  3DQD A;  4KEX A;  4W75 A;  2QLG B;  5HBD A;  4JGE A;  4EN1 A;  1Q73 A;  3DQ4 A;  4B30 B;  1EMM A;  2A56 B;  5BQL A;  2G6E A;  1XA9 A;  1EML A;  2PXS A;  4L13 A;  4W6S A;  1RMP A;  2YE0 A;  1B9C A;  4LQU A;  3DQA A;  4KW4 A;  3EK7 A;  1RMO A;  3AI4 A;  3O77 A;  2DDC A;  2EMN A;  3DQI A;  2IE2 A;  3DQ3 A;  3EK8 A;  3CBE A;  4Q9X A;  5J2O A;  4HQ8 A;  2P4M A;  3ED8 A;  4LW5 A;  4PPK A;  1RRX A;  2VAD A;  3SSK A;  4GF6 B;  4KW9 A;  2AWL A;  5F9G A;  2DD9 A;  2Z6X A;  2RH7 A;  2FZU A;  4W7C A;  2DUH A;  2O2B A;  4RYW A;  3GB3 A;  1Z1P A;  4W6U A;  2VVH A;  3SSH A;  5HGE A;  4TZA A;  4DXP A;  3DQ6 A;  2HGD A;  3SRY A;  3SVE A;  2ZO7 A;  3SVS A;  2WHT A;  5DTX A;  2ZMW A;  3SG7 A;  4DKN A;  5DTZ A;  3DQH A;  3DQ8 A;  4W6H A;  4JF9 A;  4P76 A;  2G6Y A;  1EME A;  2GW3 A;  3NEZ A;  2A52 B;  2Z6Z A;  4W6G A;  1Q4C A;  1XQM A;  3KCT A;  3M22 A;  4BDU A;  4W7E A;  5EBJ A;  3TMT A;  4PFE A;  4OY4 A;  4W6T A;  3SVC A;  4OQW A;  4DXN A;  3M24 A;  1F09 A;  4DKM A;  4AS8 A;  4XGY A;  4H47 A;  2V4E B;  4W74 A;  5FVI A;  4W6B A;  4DXM A;  4LQT A;  2H5Q A;  3KCS A;  5H88 A;  2HFC A;  1ZGO A;  4EUL A;  5DTL A;  4L1I A;  3SSL A;  2DD7 A;  2VVI A;  3H1O A;  1KYS A;  4Q9W A;  5DY6 A;  1C4F A;  4KGE A;  5BTT A;  2HQZ A;  2QLI A;  3DQ9 A;  3EKJ A;  2HCG A;  1YHI A;  1EMK A;  1JC0 A;  3SSP A;  1HCJ A;  3AI5 A;  4JEO A;  3PIB A;  2HRS A;  2Q6P A;  1ZGQ A;  4LJB A;  3SSV A;  2YDZ A;  2OKY A;  4ZB1 A;  5BT0 A;  1JBZ A;  3U8A A;  2OTE A;  3BXC A;  4PPJ A;  1RMM A;  4RYS A;  1QYQ A;  3IP2 A;  4TZG A;  4W7D A;  3ZUF A;  3GJ2 A;  2ICR A;  3U0L A;  3RWT A;  3BXB A;  4Z4K A;  3OSR A;  3ST0 A;  3LF4 B;  1EMB A;  1KYR A;  4W7F A;  4W6O A;  2H9W A;  1GGX A;  2QT2 A;  3ADF A;  3S05 A;  4XOV A;  4IK3 A;  3VHT A;  3DQN A;  4N3D A;  4Q7U A;  2WSO A;  2WSN A;  4H48 A;  4W6C A;  4ZIO A;  1QXT A;  4H3L A;  2Z1O A;  1F0B A;  5DPG A;  1MOV A;  3OGO A;  2V4E C;  2GX0 A;  4R6D A;  2H6V A;  4EDS A;  4JFG A;  4W72 A;  3U8C A;  3DQU A;  2A50 B;  3DPW A;  1XSS A;  3LA1 A;  3SG2 A;  5LTR A;  4NWS A;  4HVF A;  1QYF A;  2FL1 A;  3CFF A;  5HW9 A;  2DDD A;  4W6F A;  4XL5 A;  3ST3 A;  5LK4 A;  2IOV A;  1Q4A A;  2HPW A;  3ZUL A;  3ZTF A;  3GJ1 A;  2BTJ A;  2A47 A;  4EMQ A;  3I19 A;  2AWK A;  2G6X A;  5DRG A;  4IK9 A;  1OXD A;  4W73 A;  2C9I A;  4KF4 A;  3SVU A;  4LJC A;  3A8S A;  3MGF A;  3CFH A;  2WUR A;  2OJK A;  4H3N A;  2PXW A;  2Q57 A;  3LF3 A;  3CGL A;  3G9A A;  3GEX A;  3K1K A;  5KTG A;  4B5Y A;  3LVC A;  4U2V A;  3WLC A;  4ANJ A;  3P28 A;  2A46 A;  2QU1 A;  5HZO A;  3SVB A;  3NT3 A;  2A54 B;  2A48 A;  1BFP A;  4P1Q A;  3SS0 A;  4W6M A;  4W6K A;  1H4U A;  2Y0G A;  3EVU A;  2QLG A;  4XOW A;  4KGF A;  3SVR A;  3CD1 A;  4HQ9 A; 
#chains in the Genus database with same CATH topology
 2H8Q A;  2WHU A;  5T3I A;  4DXI A;  2POX A;  3LS3 A;  3OSQ A;  4ZIN A;  2FWQ A;  4KF5 C;  5LTP A;  3EVR A;  3EK4 A;  4HE4 A;  3DQM A;  5DU0 A;  3DQK A;  3E5W A;  5H89 A;  3DQF A;  2G16 B;  3AKO A;  2ZO6 A;  5AQB B;  2IB5 A;  2EMD A;  4GOB A;  2GW4 B;  3V3D A;  3LVA A;  1EMF A;  3DQ1 A;  2GX2 A;  4W7A A;  2HJO A;  3VIC A;  4KA9 A;  2H5P A;  1GL4 A;  2B3P A;  1S6Z A;  3DQ7 A;  3IR8 A;  4W6R A;  3ZUJ A;  3SST A;  3O78 A;  4IK8 A;  1MOU A;  1CV7 A;  1YZW A;  4XVP A;  4JRB A;  5HZT A;  1ZUX A;  4OHS A;  5EXC I;  1W7S A;  3DQJ A;  4IZN A;  3SV5 A;  4LJD C;  2VZX A;  1W7T A;  2DUE A;  4W6J A;  2YFP A;  1YFP A;  4J89 A;  3W1D A;  1EMG A;  1Q4B A;  3SVD A;  1EMA A;  2G3D B;  3LVD A;  2WHS A;  3VK1 A;  5DPH A;  4DXO A;  5DQM A;  3DQC A;  4HQC A;  3SG3 A;  3BXA A;  2G3O A;  3PJB A;  3WLD A;  4W6P A;  4W7X A;  3LSA A;  2OTB A;  2V4E A;  1YHH A;  2OGR A;  2DUF A;  1ZGP A;  3P8U A;  1RM9 A;  3NED A;  4OGS A;  2ARL A;  1OXE A;  4IK1 A;  3U8P A;  4J8A A;  2ZMU A;  2G2S B;  1MYW A;  2AWM A;  3W1C A;  3BX9 A;  3E5T A;  5EXU A;  5BTT B;  3NT9 A;  2WIQ A;  2JAD A;  4ZFS A;  1YJF A;  2Z6Y A;  2YE1 A;  3E5V A;  1XAE A;  3PJ7 A;  1KYP A;  4H3M A;  2QZ0 A;  4RTC A;  3PJ5 A;  3RWA A;  3U0M A;  2DUG A;  4EDO A;  4OJ0 A;  5DTY A;  1OXF A;  1KP5 A;  1Q4D A;  3NF0 A;  4PPL A;  4AR7 A;  1Q4E A;  2AH8 A;  4W77 A;  5DRF A;  1XMZ A;  1GFL A;  3CFA A;  5DPJ A;  5EXB A;  1JC1 A;  1UIS A;  2QRF A;  5HZS A;  3DQE A;  5H87 A;  1QY3 A;  2DUI A;  3DPX A;  1JBY A;  4J88 A;  1W7U A;  2QLH A;  5EJU A;  4W76 A;  5EB7 A;  4Z4M A;  4KW8 A;  2QLE A;  3EKH A;  4W6I A;  2HGY A;  3EVV A;  2B3Q A;  3SG6 A;  5FVG A;  3GL4 A;  4JC2 A;  4W69 A;  3VHT B;  4B30 A;  2AHA A;  3ST2 A;  4Q7R A;  4ZF3 A;  4W6L A;  4ZBL A;  2OKW A;  4KF5 A;  2H5O A;  1HUY A;  3SVO A;  3U0K A;  2EMO A;  2HQK A;  3SG4 A;  2H5R A;  3DPZ A;  4W6A A;  1EMC A;  5DPI A;  3UFZ A;  1H6R A;  3EVP A;  2A53 B;  3SG5 A;  3DQL A;  4GES B;  1QYO A;  1YJ2 A;  5FHV A;  2AWJ A;  2C9J A;  5FVF A;  1Z1Q A;  4ZF4 A;  2VAE A;  3H1R A;  5EB6 A;  2WIS A;  3UG0 A;  5EHU A;  4KAG A;  4R6B A;  2VVJ A;  5HZU A;  4Q7T A;  3ST4 A;  1YHG A;  3DQ5 A;  4DXQ A;  4ORN A;  4W6N A;  3DQ2 A;  4IK5 A;  4ZF5 A;  5LTQ A;  3SSY A;  5DQB A;  3U0N A;  4LJD A;  4L12 A;  4W6D A;  4KPI A;  4IK4 A;  2O24 A;  2G5Z B;  4UTS A;  3SVN A;  2O29 A;  1G7K A;  4I2Y A;  3CD9 A;  3WCK A;  3DQO A;  2IB6 A;  3TMR A;  3CB9 A;  4W7R A;  3DQD A;  4KEX A;  4W75 A;  2QLG B;  5HBD A;  4JGE A;  4EN1 A;  1Q73 A;  3DQ4 A;  4B30 B;  1EMM A;  2A56 B;  5BQL A;  2G6E A;  1XA9 A;  1EML A;  2PXS A;  4L13 A;  4W6S A;  1RMP A;  2YE0 A;  1B9C A;  4LQU A;  3DQA A;  4KW4 A;  3EK7 A;  1RMO A;  3AI4 A;  3O77 A;  2DDC A;  2EMN A;  3DQI A;  2IE2 A;  3DQ3 A;  3EK8 A;  3CBE A;  4Q9X A;  5J2O A;  4HQ8 A;  2P4M A;  3ED8 A;  4LW5 A;  4PPK A;  1RRX A;  2VAD A;  3SSK A;  4GF6 B;  4KW9 A;  2AWL A;  5F9G A;  2DD9 A;  2Z6X A;  2RH7 A;  2FZU A;  4W7C A;  2DUH A;  2O2B A;  4RYW A;  3GB3 A;  1Z1P A;  4W6U A;  2VVH A;  3SSH A;  5HGE A;  4TZA A;  4DXP A;  3DQ6 A;  2HGD A;  3SRY A;  3SVE A;  2ZO7 A;  3SVS A;  2WHT A;  5DTX A;  2ZMW A;  3SG7 A;  4DKN A;  5DTZ A;  3DQH A;  3DQ8 A;  4W6H A;  4JF9 A;  4P76 A;  2G6Y A;  1EME A;  2GW3 A;  3NEZ A;  2A52 B;  2Z6Z A;  4W6G A;  1Q4C A;  1XQM A;  3KCT A;  3M22 A;  4BDU A;  4W7E A;  5EBJ A;  3TMT A;  4PFE A;  4OY4 A;  4W6T A;  3SVC A;  4OQW A;  4DXN A;  3M24 A;  1F09 A;  4DKM A;  4AS8 A;  4XGY A;  4H47 A;  2V4E B;  4W74 A;  5FVI A;  4W6B A;  4DXM A;  4LQT A;  2H5Q A;  3KCS A;  5H88 A;  2HFC A;  1ZGO A;  4EUL A;  5DTL A;  4L1I A;  3SSL A;  2DD7 A;  2VVI A;  3H1O A;  1KYS A;  4Q9W A;  5DY6 A;  1C4F A;  4KGE A;  5BTT A;  2HQZ A;  2QLI A;  3DQ9 A;  3EKJ A;  2HCG A;  1YHI A;  1EMK A;  1JC0 A;  3SSP A;  1HCJ A;  3AI5 A;  4JEO A;  3PIB A;  2HRS A;  2Q6P A;  1ZGQ A;  4LJB A;  3SSV A;  2YDZ A;  2OKY A;  4ZB1 A;  5BT0 A;  1JBZ A;  3U8A A;  2OTE A;  3BXC A;  4PPJ A;  1RMM A;  4RYS A;  1QYQ A;  3IP2 A;  4TZG A;  4W7D A;  3ZUF A;  3GJ2 A;  2ICR A;  3U0L A;  3RWT A;  3BXB A;  4Z4K A;  3OSR A;  3ST0 A;  3LF4 B;  1EMB A;  1KYR A;  4W7F A;  4W6O A;  2H9W A;  1GGX A;  2QT2 A;  3ADF A;  3S05 A;  4XOV A;  4IK3 A;  3VHT A;  3DQN A;  4N3D A;  4Q7U A;  2WSO A;  2WSN A;  4H48 A;  4W6C A;  4ZIO A;  1QXT A;  4H3L A;  2Z1O A;  1F0B A;  5DPG A;  1MOV A;  3OGO A;  2V4E C;  2GX0 A;  4R6D A;  2H6V A;  4EDS A;  4JFG A;  4W72 A;  3U8C A;  3DQU A;  2A50 B;  3DPW A;  1XSS A;  3LA1 A;  3SG2 A;  5LTR A;  4NWS A;  4HVF A;  1QYF A;  2FL1 A;  3CFF A;  5HW9 A;  2DDD A;  4W6F A;  4XL5 A;  3ST3 A;  5LK4 A;  2IOV A;  1Q4A A;  2HPW A;  3ZUL A;  3ZTF A;  3GJ1 A;  2BTJ A;  2A47 A;  4EMQ A;  3I19 A;  2AWK A;  2G6X A;  5DRG A;  4IK9 A;  1OXD A;  4W73 A;  2C9I A;  4KF4 A;  3SVU A;  4LJC A;  3A8S A;  3MGF A;  3CFH A;  2WUR A;  2OJK A;  4H3N A;  2PXW A;  2Q57 A;  3LF3 A;  3CGL A;  3G9A A;  3GEX A;  3K1K A;  5KTG A;  4B5Y A;  3LVC A;  4U2V A;  3WLC A;  4ANJ A;  3P28 A;  2A46 A;  2QU1 A;  5HZO A;  3SVB A;  3NT3 A;  2A54 B;  2A48 A;  1BFP A;  4P1Q A;  3SS0 A;  4W6M A;  4W6K A;  1H4U A;  2Y0G A;  3EVU A;  2QLG A;  4XOW A;  4KGF A;  3SVR A;  3CD1 A;  4HQ9 A; 
#chains in the Genus database with same CATH homology
 2H8Q A;  2WHU A;  5T3I A;  4DXI A;  2POX A;  3LS3 A;  3OSQ A;  4ZIN A;  2FWQ A;  4KF5 C;  5LTP A;  3EVR A;  3EK4 A;  4HE4 A;  3DQM A;  5DU0 A;  3DQK A;  3E5W A;  5H89 A;  3DQF A;  2G16 B;  3AKO A;  2ZO6 A;  5AQB B;  2IB5 A;  2EMD A;  4GOB A;  2GW4 B;  3V3D A;  3LVA A;  1EMF A;  3DQ1 A;  2GX2 A;  4W7A A;  2HJO A;  3VIC A;  4KA9 A;  2H5P A;  1GL4 A;  2B3P A;  1S6Z A;  3DQ7 A;  3IR8 A;  4W6R A;  3ZUJ A;  3SST A;  3O78 A;  4IK8 A;  1MOU A;  1CV7 A;  1YZW A;  4XVP A;  4JRB A;  5HZT A;  1ZUX A;  4OHS A;  5EXC I;  1W7S A;  3DQJ A;  4IZN A;  3SV5 A;  4LJD C;  2VZX A;  1W7T A;  2DUE A;  4W6J A;  2YFP A;  1YFP A;  4J89 A;  3W1D A;  1EMG A;  1Q4B A;  3SVD A;  1EMA A;  2G3D B;  3LVD A;  2WHS A;  3VK1 A;  5DPH A;  4DXO A;  5DQM A;  3DQC A;  4HQC A;  3SG3 A;  3BXA A;  2G3O A;  3PJB A;  3WLD A;  4W6P A;  4W7X A;  3LSA A;  2OTB A;  2V4E A;  1YHH A;  2OGR A;  2DUF A;  1ZGP A;  3P8U A;  1RM9 A;  3NED A;  4OGS A;  2ARL A;  1OXE A;  4IK1 A;  3U8P A;  4J8A A;  2ZMU A;  2G2S B;  1MYW A;  2AWM A;  3W1C A;  3BX9 A;  3E5T A;  5EXU A;  5BTT B;  3NT9 A;  2WIQ A;  2JAD A;  4ZFS A;  1YJF A;  2Z6Y A;  2YE1 A;  3E5V A;  1XAE A;  3PJ7 A;  1KYP A;  4H3M A;  2QZ0 A;  4RTC A;  3PJ5 A;  3RWA A;  3U0M A;  2DUG A;  4EDO A;  4OJ0 A;  5DTY A;  1OXF A;  1KP5 A;  1Q4D A;  3NF0 A;  4PPL A;  4AR7 A;  1Q4E A;  2AH8 A;  4W77 A;  5DRF A;  1XMZ A;  1GFL A;  3CFA A;  5DPJ A;  5EXB A;  1JC1 A;  1UIS A;  2QRF A;  5HZS A;  3DQE A;  5H87 A;  1QY3 A;  2DUI A;  3DPX A;  1JBY A;  4J88 A;  1W7U A;  2QLH A;  5EJU A;  4W76 A;  5EB7 A;  4Z4M A;  4KW8 A;  2QLE A;  3EKH A;  4W6I A;  2HGY A;  3EVV A;  2B3Q A;  3SG6 A;  5FVG A;  3GL4 A;  4JC2 A;  4W69 A;  3VHT B;  4B30 A;  2AHA A;  3ST2 A;  4Q7R A;  4ZF3 A;  4W6L A;  4ZBL A;  2OKW A;  4KF5 A;  2H5O A;  1HUY A;  3SVO A;  3U0K A;  2EMO A;  2HQK A;  3SG4 A;  2H5R A;  3DPZ A;  4W6A A;  1EMC A;  5DPI A;  3UFZ A;  1H6R A;  3EVP A;  2A53 B;  3SG5 A;  3DQL A;  4GES B;  1QYO A;  1YJ2 A;  5FHV A;  2AWJ A;  2C9J A;  5FVF A;  1Z1Q A;  4ZF4 A;  2VAE A;  3H1R A;  5EB6 A;  2WIS A;  3UG0 A;  5EHU A;  4KAG A;  4R6B A;  2VVJ A;  5HZU A;  4Q7T A;  3ST4 A;  1YHG A;  3DQ5 A;  4DXQ A;  4ORN A;  4W6N A;  3DQ2 A;  4IK5 A;  4ZF5 A;  5LTQ A;  3SSY A;  5DQB A;  3U0N A;  4LJD A;  4L12 A;  4W6D A;  4KPI A;  4IK4 A;  2O24 A;  2G5Z B;  4UTS A;  3SVN A;  2O29 A;  1G7K A;  4I2Y A;  3CD9 A;  3WCK A;  3DQO A;  2IB6 A;  3TMR A;  3CB9 A;  4W7R A;  3DQD A;  4KEX A;  4W75 A;  2QLG B;  5HBD A;  4JGE A;  4EN1 A;  1Q73 A;  3DQ4 A;  4B30 B;  1EMM A;  2A56 B;  5BQL A;  2G6E A;  1XA9 A;  1EML A;  2PXS A;  4L13 A;  4W6S A;  1RMP A;  2YE0 A;  1B9C A;  4LQU A;  3DQA A;  4KW4 A;  3EK7 A;  1RMO A;  3AI4 A;  3O77 A;  2DDC A;  2EMN A;  3DQI A;  2IE2 A;  3DQ3 A;  3EK8 A;  3CBE A;  4Q9X A;  5J2O A;  4HQ8 A;  2P4M A;  3ED8 A;  4LW5 A;  4PPK A;  1RRX A;  2VAD A;  3SSK A;  4GF6 B;  4KW9 A;  2AWL A;  5F9G A;  2DD9 A;  2Z6X A;  2RH7 A;  2FZU A;  4W7C A;  2DUH A;  2O2B A;  4RYW A;  3GB3 A;  1Z1P A;  4W6U A;  2VVH A;  3SSH A;  5HGE A;  4TZA A;  4DXP A;  3DQ6 A;  2HGD A;  3SRY A;  3SVE A;  2ZO7 A;  3SVS A;  2WHT A;  5DTX A;  2ZMW A;  3SG7 A;  4DKN A;  5DTZ A;  3DQH A;  3DQ8 A;  4W6H A;  4JF9 A;  4P76 A;  2G6Y A;  1EME A;  2GW3 A;  3NEZ A;  2A52 B;  2Z6Z A;  4W6G A;  1Q4C A;  1XQM A;  3KCT A;  3M22 A;  4BDU A;  4W7E A;  5EBJ A;  3TMT A;  4PFE A;  4OY4 A;  4W6T A;  3SVC A;  4OQW A;  4DXN A;  3M24 A;  1F09 A;  4DKM A;  4AS8 A;  4XGY A;  4H47 A;  2V4E B;  4W74 A;  5FVI A;  4W6B A;  4DXM A;  4LQT A;  2H5Q A;  3KCS A;  5H88 A;  2HFC A;  1ZGO A;  4EUL A;  5DTL A;  4L1I A;  3SSL A;  2DD7 A;  2VVI A;  3H1O A;  1KYS A;  4Q9W A;  5DY6 A;  1C4F A;  4KGE A;  5BTT A;  2HQZ A;  2QLI A;  3DQ9 A;  3EKJ A;  2HCG A;  1YHI A;  1EMK A;  1JC0 A;  3SSP A;  1HCJ A;  3AI5 A;  4JEO A;  3PIB A;  2HRS A;  2Q6P A;  1ZGQ A;  4LJB A;  3SSV A;  2YDZ A;  2OKY A;  4ZB1 A;  5BT0 A;  1JBZ A;  3U8A A;  2OTE A;  3BXC A;  4PPJ A;  1RMM A;  4RYS A;  1QYQ A;  3IP2 A;  4TZG A;  4W7D A;  3ZUF A;  3GJ2 A;  2ICR A;  3U0L A;  3RWT A;  3BXB A;  4Z4K A;  3OSR A;  3ST0 A;  3LF4 B;  1EMB A;  1KYR A;  4W7F A;  4W6O A;  2H9W A;  1GGX A;  2QT2 A;  3ADF A;  3S05 A;  4XOV A;  4IK3 A;  3VHT A;  3DQN A;  4N3D A;  4Q7U A;  2WSO A;  2WSN A;  4H48 A;  4W6C A;  4ZIO A;  1QXT A;  4H3L A;  2Z1O A;  1F0B A;  5DPG A;  1MOV A;  3OGO A;  2V4E C;  2GX0 A;  4R6D A;  2H6V A;  4EDS A;  4JFG A;  4W72 A;  3U8C A;  3DQU A;  2A50 B;  3DPW A;  1XSS A;  3LA1 A;  3SG2 A;  5LTR A;  4NWS A;  4HVF A;  1QYF A;  2FL1 A;  3CFF A;  5HW9 A;  2DDD A;  4W6F A;  4XL5 A;  3ST3 A;  5LK4 A;  2IOV A;  1Q4A A;  2HPW A;  3ZUL A;  3ZTF A;  3GJ1 A;  2BTJ A;  2A47 A;  4EMQ A;  3I19 A;  2AWK A;  2G6X A;  5DRG A;  4IK9 A;  1OXD A;  4W73 A;  2C9I A;  4KF4 A;  3SVU A;  4LJC A;  3A8S A;  3MGF A;  3CFH A;  2WUR A;  2OJK A;  4H3N A;  2PXW A;  2Q57 A;  3LF3 A;  3CGL A;  3G9A A;  3GEX A;  3K1K A;  5KTG A;  4B5Y A;  3LVC A;  4U2V A;  3WLC A;  4ANJ A;  3P28 A;  2A46 A;  2QU1 A;  5HZO A;  3SVB A;  3NT3 A;  2A54 B;  2A48 A;  1BFP A;  4P1Q A;  3SS0 A;  4W6M A;  4W6K A;  1H4U A;  2Y0G A;  3EVU A;  2QLG A;  4XOW A;  4KGF A;  3SVR A;  3CD1 A;  4HQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...