1HD1A

Heterogeneous nuclear ribonucleoprotein d0 (hnrnp d0 rbd1), nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
KMFIGGLSWDTTKKDLKDYFSKFGEVVDCTLKLDPITGRSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEIN (HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN D0)
publication title Structure and interactions with RNA of the N-terminal UUAG-specific RNA-binding domain of hnRNP D0.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 1999-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hd1A00
3UCZP 4F25A 2KM8C 3MUMP 5CXTA 3BEGB 3CUNA 4W92B 1A7GE 3CCMS 4CIOA 1H2TZ 5JVHQ 2CQCA 1VBXA 4OZ0A 2N3OA 1KC8T 3K0JA 2Q79A 3TP2A 1F9FA 5ITHA 5GAHU 1U1OA 1D8ZA 1X4CA 3SDEB 3SMZA 5DETA 1WHYA 3TYTA 3ULHA 3CF5Q 1H2UX 1SJRA 2LMIA 5CA5A 1YHQS 2M0GB 3VAGA 2HGLA 2HVZA 4F26A 1ZZNA 4Y0FA 1VBYA 3J7YU 1K73T 1WG5A 2PE8A 2DGQA 2ADCA 2M8HA 2RT3A 1KQSR 2ADBA 3MUVP 3CCSS 2G4BA 2AYGA 3G96A 2RRBA 2KG1A 3CCJS 1DZ5A 2DK2A 2MQQA 1WTBA 3R1HA 1WEZA 1M90T 5HO4A 4ED5A 5DM7Q 2U2FA 1HD0A 2CPYA 1VQLS 1FXLA 3EX7B 1HA1A 3CCRS 1NO8A 4YB1P 1K8AT 3R1LA 3DLLQ 5CYJA 5LSOA 3NMRA 1FNXH 2MQNA 3U1MA 5IFMA 4CH1A 1QVFR 3UCUP 3MI7X 1VQPS 3UWTA 1WG1A 1WI6A 5D78A 5BJRA 1Q86T 1YIJS 1X4BA 2CPIA 4F02A 2DGVA 3UCGA 1JJHA 1KOOA 2DNHA 3MUTP 4QU7A 2L9WA 2JX2A 2XS2A 2D3OR 2KG0A 3CD6S 3MD1A 1CVJA 5LXYA 1R8PA 2GHPA 1O0PA 3CCUS 3FEYB 5D77A 1B7FA 4J5OA 2N7CA 1VQ4S 5IM0B 2LYVA 4YUDA 1X4FA 4TLQA 3CCES 2JVOA 4TU7A 2JVRA 2D9PA 4IO9Q 2KXFA 4C0OC 1NU4A 2AYBA 2DISA 3EGZA 2DNMA 3P6YC 4TU8A 1RK8A 5MLCV 2AYEA 2M9KA 2CQIA 2F9DA 1VQ6S 1VQ5S 4IOCQ 1WHXA 1U1NA 2JWNA 3RW6A 2FY1A 1BY9A 1U1RA 3V4MA 2E5HA 1JJ2R 3IWNC 4U67Q 1W2BR 2MKCA 4WFAQ 3HI9A 2JRSA 1DBDA 1KD1T 1QM9A 2LA4A 4TU9A 2MQLA 4CQ1A 2CJKA 2M88A 2DH7A 3DXBA 2MGZA 3CTRA 2J76E 4C4WA 2MYFA 1U2FA 2DH8A 2MQMA 1X4EA 2DHSA 3THTA 2E5IA 2MKKA 3CMES 3CMAS 4IUFA 2FC8A 2D9OA 2DO4A 2ZJPQ 2RRAA 2DGXA 2M52A 1YJ9S 1VC6A 2YWKA 2YH1A 2DGUA 2NZ4A 3J7ZT 1FJCA 5JVGQ 5DDPC 4C7QA 1OPIA 3D2WA 1X4HA 2K3KA 2OSRA 1M1KT 1AUDA 2KRRA 2DNGA 2WBRA 2DHAA 2BOPA 1WF2A 3VAHA 2KI2A 3CC7S 1A9NB 1VC5A 1PO6A 2DNYA 2DGOA 3I55S 3NS6A 4FXWA 3VAJA 3RW7A 3BO3A 3CCVS 2XNQA 2MZRA 3S6EA 1U1LA 4BS2A 2J0SD 2LCWA 5DDOC 2DNNA 3OW2R 1DRZA 2KN4A 2KYXA 2J8AA 3G71S 4W90B 1P1TA 2E5JA 1WELA 1SXLA 1WF0A 4Z2XA 3BS9A 2MZTA 2DHGA 2HGMA 3PIOQ 4WFNQ 2OJ3A 3I56S 2VONA 2OTLS 3IRWP 1P27B 4WKRA 2X1AA 3MOJB 4QU6A 2XB2D 2MSTA 2MKIA 1UFWA 2KT5A 5HL7Q 1L3KA 1X0FA 3CCQS 2DNZA 1X5OA 1FO1A 2VODA 2MY7A 2DNPA 2LEAA 1NJIT 4M5DB 2OTJS 2KHCA 1Q82T 2M70A 2UP1A 3FEXB 2MHNA 2MKSA 2DO0A 1HL6A 1N88A 3LPYA 2KH9A 1RKJA 2MQPA 3Q2TC 2E5GA 2YH0A 2NLWA 3G4SS 4QPTA 2X1GA 1U1KA 2RQ4A 5IQQA 1YI2S 1YJWS 2FHOB 4PKDB 3SDEA 2KFYA 2F3JA 2M7SA 2AD9A 1D9AA 4ERDA 2VOPA 3G8SA 1U1QA 2X1BA 2DB1A 2CPFA 4EGLA 2V94A 1YJNS 1N54B 3H2UB 5LJ5Y 2N82B 2CQDA 2RS2A 1VQ7S 5DDRC 3S7RA 2RUGA 1R8HA 2ERRA 2CQHA 2CQ2A 2CPJA 2MB0B 2KXNB 2OSQA 3VALA 3VAMA 2LXUA 3B4MA 2CPEA 1ZH5A 2DNKA 1SJFA 1X4DA 3CCLS 2ZJRQ 2F9JA 5GMKa 1QVGR 4OZ1A 2XS7A 1SJQA 1VQ8S 2M8DB 1Q7YT 1YWXA 1OO0B 1YTYA 1N8RT 2CPZA 5EN1A 2DNOA 2KVIA 2EK1A 1X5SA 2LA6A 1VQKS 4WIIA 1IQTA 1WEYA 1VC0A 3PIPQ 5GVQA 3MDFA 1JJ4A 4IOAQ 2MZJA 1M5OC 2DH9A 2RNEA 1U6BA 2CQ0A 3P49B 2CQ1A 5DDQC 1G2EA 2FC9A 3VAFA 2LECA 2RS8A 3EGNA 2MKJA 3CULA 4PRFA 3NS5A 2MMYA 3UD3P 4UY8T 1URNA 2G0CA 3VAIA 2E44A 3CPWR 5GAEU 3CC4S 2QEXS 2M4MA 3S01A 2I38A 5GADU 5GAGU 3TO8A 3JB9k 1VQNS 4WF9Q 2CQGA 2DGWA 4LJMA 1X5PA 2O3DA 1WEXA 2B0GA 2HZCA 2MPUA 3LQVA 5IM0A 2XS5A 3MURP 1WI8A 3MD3A 2J0QD 2K8GA 3BO4A 3HHNB 1HD1A 2QA4S 1FJEB 1M5KC 1YITS 1U1MA 2DIVA 2DNRA 2MKHA 2DNLA 3THPA 1Q81T 2DNQA 3ZZZA 3L3CA 3R27A 2CQ4A 2EVZA 1UW4A 2U1AA 2HGNA 2BZ2A 2DGTA 2MSSA 2LQ5A 4A8XA 4P6QA 2L41A 2YTCA 5H1SV 2QFJA 2MGZB 2DGSA 3CXCR 3G6ES 5FJ4A 1OIAA 1JMTA 1M5VC 4RU2A 2LXIA 3US5A 1WHVA 4PR6A 1VQMS 4QQBA 4LMZA 2DITA 2SXLA 1U1PA 4WCEQ 1ZZFA 2MY8A 1VQOS 2YKAA 1UAWA 2GO9A 2M2BA 3H2VE 3P5TL 3Q2SC 3N9UC 3UE2A 1X5TA 1KOHA 2MZ1A 1WG4A 2RU3A 2HYIB 2KRBA 1UP1A 2CPHA 3VF0B 1VQ9S 4V19X 1SJ3P 2A3JA 2XSFA 3B4DA 2CQ3A 1WHWA 2MJUA 3NNHA 4YOEA 2RVJA 1FJ7A 2CPXA 1K9MT 2I2YA 1OWXA 2FPHX 1S72S 4FXVA 2PEHA 5LJ3Y 2RQCA 2LKZA 5LSLA 1X4AA 4WFBQ 1DHMA 4LIRA 2CQPA 3UD4P 2MXYA 3MXHP 1N52B 2DHXA 3VAKA 2MJNA 2CPDA 2LEBA 1XN9A 2N3LA 3NNAA 2MZQA 3P3DA 4ZKAA 3BO2A 2CQBA 2G1DA 4CH0S 2KXHA 1WWHA 2KM8B 2XNRA 5LXRA 3NNCA 2L08A 3SXLA 2OIHA 2VOOA 3U1LA 3G8TA 1S79A 2ZJQQ 1FHTA 4Y00A 1VBZA 2EK6A 1H2VZ 1X4GA 5DM6Q 2AYMA 2KU7A 2X1FA 2MZSA 3ZZYA 1SJ4P 1PGZA 1FT8A 1U6FA 1M5PC 2MQOA 3G9CA 1WF1A 4UQTA 1H6KX 2DIUA 3S8SA 3CC2S
chains in the Genus database with same CATH superfamily
4PWDA 4N8OA 1P6TA 2C2EA 2DR8A 4NPOA 3LH2S 2R7SA 1DFDA 1B64A 1BQXA 2WVDA 5B0EA 3TYTA 2D3UA 4F4YA 5CA5A 1J27A 2OAUA 3GJTB 4QPXA 3BBFA 5AXNA 2ZBCA 4OYOA 2AWZA 4IQMA 1JIHA 2HVDA 2I9SA 2ASLA 1N36J 3PY8A 2POKA 1MMNA 1S99A 1M90T 1AYEA 5HO4A 4F2RA 5DM7Q 2U2FA 3F73A 4B17A 1XMOF 1FEEA 3R1LA 1PILA 5CABA 1PJ7A 3RG6A 3GJQB 3OL9A 1AB8A 1HNXJ 4RR5A 3UCGA 3TZYA 1UEVA 2XI2A 2E9ZA 2LLZA 2YNIB 4WTYA 1IBKF 1HR0J 3IRXA 4ZCMA 4RNFA 4CO3A 5D3GB 1MWYA 2KFZA 1IKWA 3H5SA 4USUA 2AYBA 3EM1A 1RTIA 2ZDPA 2R7WA 4BLGA 1VQ6S 4KPCA 2FJDB 4UZBA 5D0GA 3HM9A 3VCDA 1WORA 4DQIA 5KFQA 2MKCA 3BSCA 3MM5A 1DBDA 2VFRA 2EW9A 4CQ1A 2UUCJ 3GILA 3JQKA 1F9HA 2E5IA 3PXGa 3H8YA 1L3TA 2BW7A 1IKVB 4NYPA 3Q0AA 3RB4A 4ZP8A 5HJYA 3DRPA 1CQNA 4MKAA 1R89A 3R2DJ 4DFKA 2H65B 1VRTA 1TL7B 5DDPC 5A8KB 1H7XA 3OT9A 1QE1B 3QT8A 1WF2A 3FBCA 2HQCA 1F0XA 2WB4A 3I55S 3PYFA 4A47A 2VBWA 1YGYA 4JV1A 3M2VA 2UUAJ 2LCWA 4X62J 1UL3A 3MM6B 1HQUA 1WF0A 4KFBB 3OV7A 1U2CA 4DPWA 4HVZA 2JEGA 4CT8A 3JYTA 2DR7A 2V2KA 1FTRA 4DR2J 3Q22A 3OXGA 4M5DB 1UPPA 4DL0C 4TN2A 5KFHA 2HMIA 1FKPA 5J2QB 4L76A 1WSRA 2AEMA 3LPYA 2XO6A 4MYTA 3M8RA 3BQ1A 5KFEA 1ACMB 3Q2TC 5CZVA 8RUCA 5C24A 5J1PA 5E3PA 4USKA 4DR1J 5HJXA 4PZVA 4IRDA 1S1WA 2ZH8A 4NXNF 2CQDA 2UU9F 4A8YA 4AT1B 4G65A 3I4HX 4OI3A 5I3QA 4KGVB 3OR2A 2CPEA 4R0JA 2J7WA 3PRDA 2XHCA 2CDQA 1OO0B 4PQAA 3PW7A 3B8HA 5EN1A 4IRKA 2YWFA 3GG1A 5DQIA 1IJEB 1IQZA 3LALA 3FQKA 4DX7A 1NJZA 2B8QA 1J5EF 1YK9A 3UD3P 1URNA 3VAIA 4DV0F 5IT9Y 3MAQA 1HHSA 4DL2A 4FBTA 2CQGA 2OMLA 2GGPB 2R2TA 2J0QD 2Z2YB 4GKJF 4YR0A 3QGIA 4K4YA 2BKOA 3ZZZA 4G1PA 4OZNA 4DPOA 2C2DA 2BZ2A 2LQ5A 4LF1A 2O5DA 2DGSA 4USIA 3WBZA 1RWPB 3G6ES 5E5NA 1BXNA 3MR6A 2RHSB 1RLCL 4QQBA 4O44A 4NMXA 3W8GA 2HNDA 1WC3A 3LAKA 3IAS9 1RJJA 1FRIA 1R43A 1N34J 4JV5J 2QV6A 2XMKA 5F3ZA 1NJXA 4ZS6A 1WSVA 3K5NA 4I1TA 3R5GA 5KOWA 5LJ3Y 3KLFA 5LSLA 4YR3A 3MR5A 2IPOB 3ILLA 1VYAA 4U7UK 4WU3A 4YDXA 1XN9A 1HIYA 2CQBA 3MCMA 4HI1A 4LFCJ 4ZVEA 4CH0S 4ZLPA 1WWHA 4MK8A 5B0AA 3BF4A 4A8WA 2XNRA 1LFWA 2L08A 3O1LA 1ZAWA 1S79A 2YNFB 2IBOA 4KE5A 4B9MA 4UQTA 2WSEC 3C3LA 5K5MA 5C42A 3VGTA 3JSMB 4F25A 2PFFB 2GMJA 4CIOA 3MEKA 2N3OA 2VDHA 2UVUA 2M3DA 3NEKA 5ITHA 4LF9J 2OP5A 5DETA 1WHYA 4N41A 1RHQB 4DUZF 4DZDA 3I5AA 7FDRA 2Y3YA 1A0OB 2E7XA 2YKMB 5CYMB 4FNIA 2M8HA 4PWUA 4ZVSB 2ZVSA 3UQSA 1NMEB 1Z1ZA 2HRUA 4A8OA 2V67A 2XYHB 3IAM9 2AYGA 1RT1A 3CCJS 1Q16B 1WTBA 4CI0B 1K1SA 2XZDB 4HACA 4QWBA 4YB1P 3TOQA 4RLEA 2HIYA 1SC1B 2V9KA 1IKVA 3KOAA 3MI7X 2HHWA 5ETQA 2DGVA 3PNIA 4DUYF 1RTJA 3MUTP 3BM7A 4M94A 4OYWA 3VQTA 4HHUA 2GHPA 4ANDA 2OEKA 2DY1A 2VFTA 2GW8A 1X4FA 2XCPA 4K4ZA 2I8EA 1KVKA 2UV8G 3W2VA 4M5MA 2V9WA 1S1VA 3AD8C 1UEUA 2HAIA 3HLUA 4DV6F 4JI7J 5D0EA 4ECRA 4WJBA 2CJKA 4Y65A 3BPDA 1NH8A 2MQMA 1JXEA 1IXKA 2Y8WA 4U96A 4USWA 2DJWA 3FDSA 5HBMA 3ETMA 1JLCA 2DGXA 3UDEA 5IV3A 3HCXA 3OSPA 3GSDA 4C7QA 2QMUB 2OSRA 4X66F 3K17A 4IFYA 4J9PA 2BOPA 2DYAA 3NXZA 1C4AA 4DDFA 2K1RB 5B0BA 1PO6A 4XAKA 2OMOA 1V5VA 3AJ2A 3BSOA 3DLKA 2J0SD 2YWWA 3G86A 4DU8A 3GP9A 1J2VA 4QR2A 4ZA1A 1KSPA 3MOJB 2MKIA 3J7AN 2GIFA 2ZITA 4KYZA 1OMSA 2OEMA 3QFWA 4X64J 1SH0A 3GIIA 5I42B 4JYAF 5E3QA 1F5CA 1SL0A 2P5VA 3GSIA 3NWRA 1M5SA 4KSEB 1V5IB 3GYGA 2MLXA 4I64A 3KLVA 3FCVA 4CZCA 4JI1F 3L4BC 3SDEA 4KQZA 3A8IA 5T14A 3PW0A 2LU1A 4LSLB 3V2UC 2RS2A 1HKAA 2ZM6J 2CQHA 3UNGC 2OPQA 2YKOA 2PIIA 2RKIA 3CD0A 4I7FA 5F8HA 4IDKA 2IRUA 2XS7A 3O2IA 5A8RB 3CJ5A 4EEYA 3N5BA 2OHDA 1ITPA 3J81U 5AJ3F 4FVMA 2KVIA 3OFHA 1IQTA 1ZETA 2WW4A 2N4CA 4NX9A 3W66A 1R31A 1AFIA 4N56A 4DFPA 1G2EA 4ED4A 2FC9A 3LUYA 4DR4J 2FHKA 1YZ7A 4PRFA 2B51A 4C9DA 3HVTA 2OFHX 2PO4A 3IWXA 3A8JA 3QWUA 3GFHA 2V8HA 2I38A 4CLTA 2H4WB 2BA9A 2DGWA 2B0GA 4CTAA 1NPKA 3UDVA 3EGVA 2CQ4A 2YX7A 2DGTA 1Y0HA 4FP9A 2YNFA 1LNQA 3LP1A 2IVMA 1QAJA 2VBXA 4MMOA 1KLMA 1NPPA 1NK9A 3PR5B 2Q1LA 4LMZA 1RYRA 4PQUA 3KUHA 3JSMA 3N9UC 1X5TA 1M1GA 2EFVA 3T1YF 1Q8KA 3DMJA 2EFNA 5DGAA 1QAXA 3C2PA 2CJYB 1EAYC 1ZA2B 4PG7A 3KMSA 2J7KA 2E29A 5HQLA 3ZTSA 1WDDA 2IJNA 4ZLNA 3PW4A 3NNAA 2HNZB 1R27B 2GAGC 4JI2J 4LQ3A 2ZZNA 1XR7A 5IWAJ 3C15A 4PG4A 4Y00A 1HBNA 3J81Y 1L3VA 4NLSA 1NUEA 1ZM4A 3NG8A 1FT8A 2O01C 1CULB 1HWUA 5CXTA 3HVRA 3G6VA 2IAJA 1VK3A 1KC8T 2QO3A 5B0FA 2W8KA 3UD5A 3SMZA 3BGFA 3V6DA 4RNOA 3CF5Q 5KFGA 1FERA 1S1TB 2XC9A 2ZBIA 2IM1A 1HW8A 4N47A 3D3CJ 2QA4G 3MECB 4QR1A 4PPZA 3PG9A 2R2SA 3HX9A 2MQQA 4QYZK 1RT2B 1FXLA 3H59A 3KMQA 3ILJA 2ZOGA 3MM9B 3H2LA 1FNXH 1U6ZA 3D6HB 1ZS6A 1WI6A 4FZVA 4H4MA 4ZP7A 4RPFA 2CPIA 1LWCB 2VG7B 4ER8A 2VPZB 2L9WA 2JX2A 5CQGA 3CO0P 3GTYX 1IR2A 3LF0A 4OZJA 4Y6IA 2KT2A 3TVZA 4TLQA 3CCES 3PM9A 1UVKA 2YXLA 3P6YC 1QUVA 2AX1A 3V81B 2FJXA 1HWLA 3R6LB 3IBWA 2YKPA 3QIPB 3HI9A 5KFIA 2LA4A 3M8QB 4TU9A 3MM7A 3CTRA 4C4WA 2DHSA 1O51A 5CCMA 1T03B 2M52A 4M5HA 2E5LJ 4KO0B 3HSDA 4F2SA 2MEWA 4B9UA 3X1LB 2IA6A 2DXDA 2KJVA 1HNVB 2G2YA 4FF3A 2HNYA 5THWA 4BS2A 3PYDA 2E66A 5CZXA 3KK3A 2P6TA 5HK4A 2X3DA 1WC1A 1CEZA 2OTLS 2B7BB 2V4RA 1NJYA 3I0SB 1Y3KA 5J2MB 3RRHA 1S57A 3T1HJ 2VODA 3AY0A 2HHSA 3KLHA 1N36F 4DBQA 1VCTA 3NWGA 3C14B 1RKJA 3GJRB 3R6GB 3LOUA 3G4SS 3ENWA 2CA9A 5E2QA 5L38A 3OR1A 1ZYQA 2V2ZA 3H2UB 2BJ1A 4X4PA 3DOLB 3T9ZA 4LSNA 2RUGA 1HNXF 2ERRA 1X9MA 2NCKL 2DNKA 2A6OA 2C3UA 2YQ1A 2D7SA 3T5HA 3K5LA 4K2JA 2UVRA 5HI7A 1HR0F 3AH6A 5A0YB 1N8RT 1QSLA 3TUJC 2DNOA 1RU1A 4DCPB 2BJEA 1JJ4A 3N6MA 3P49B 2NUHA 3DRSB 2D69A 1D0EA 2BUNA 3TAQA 3HK2A 2V6AA 3GB0A 4DFMA 3NS5A 2ROEA 4O3SA 4U8VA 1Q5YA 4O3NA 3OFEA 3CC4S 2N4DA 2UUCF 1VLYA 3DXSX 4J9QA 4NLWA 2JH3A 1S5ZA 4LJMA 3MWBA 2D3ZA 5KG7A 2VQFJ 2XS5A 5ETOA 2HFNA 1FA0A 4B3TF 1YITS 1U1MA 3HKZD 2DNRA 4F7VA 3RRKA 3R7NB 2IM3A 1IWGA 2CUYA 3W2WB 2QFJA 3W3SA 4RU2A 1KFDA 4RL1A 1LW2B 5KFRA 4EU0A 1S48A 1AZSB 1RE1B 4X4RA 2UUAF 2VF3A 3OHBA 4X62F 1KRPA 4QZVB 2VKRA 3LP2A 1K9MT 1KKHA 1FRJA 1U48A 2BVZA 4OJGA 2YY3A 3PYEA 5GMEA 1OY6A 1OS5A 4DU7A 1SKWA 3H40A 2R8HA 3N6NA 2GV1A 4DR2F 2QLWA 1Y7PA 5LMNJ 3QLHA 3RBXA 2KXHA 3M8SA 4DOZA 2HLUA 1XWLA 1BQNA 4EK2A 4DR1F 4ES3A 4ED7A 3AOCA 5KFSA 3OUYA 3AQPA 1NH7A 3PW2A 4HDHA 4TY9A 3UO0A 3GIMA 2DIUA 3D0IE 5HLFA 3I32A 3AT1B 3BEGB 4ZJLA 1S6QB 1UJ5A 2FHMA 1V3ZA 4ZJOA 2IY5B 3DFEA 4DCJB 3VAGA 1TL1A 1ZZNA 1AT1B 3KHGA 3H20A 4EO8A 2LQ8A 4EWTA 4DF8A 2WVBA 2MQ8A 1HYSB 2R7OA 1FWPA 3MM8B 1HWKA 2D1CA 1T7PA 5C25A 2KG1A 5HSPA 5DO2A 5HP1A 2AZ1A 1NO8A 2KHDA 4CLKA 2F4VJ 2V8PA 4R8UB 4MYUA 2HRTA 5BYRA 3GR1A 3HFKA 3NY0A 1IR0A 1Q86T 1YIJS 1T05B 3CD6S 1RTDB 1CVJA 3KJQB 2XI3A 3POTA 2XMWA 4DX5A 2Q3PA 2YQ0A 4LR9A 2VUGA 2BX6A 1N34F 4Q2LA 3KYLA 4EYHB 4JV5F 2AZ3A 3PEJA 2NPIA 5DLFA 2HWHA 1NSKL 3RU0A 3GJSB 5A8WB 3PHEA 3OXFA 3DXBA 3E2EA 4OYAA 3OFFA 3P8BB 1X4EA 1RHKB 5ETMA 1WKJA 1GXLA 3A8EA 1PJ6A 1AW0A 4R5PB 4LFCF 3HHLD 2DGUA 3LGNA 4I2PA 1IBLJ 3SV4A 3KNGA 2VFVA 3HSJA 5KTQA 1FDAA 1UFLA 2YKNB 2K3KA 4JB8B 4BWJA 1VI7A 2UXCJ 2IDEA 4ZJQA 2IC3B 3NS6A 2ZBQA 3M8PB 4MK7A 1HNWJ 5L39A 1U1LA 2JFKA 1FEHA 5GAGI 2QRRA 4DX6A 3H5UA 2OFGX 1WUUA 1S1UB 1DAXA 4LF9F 2Z4PA 3ET6A 2OJ3A 2EFQA 1ZOTA 4MTPA 1I94F 1CLFA 4FYVB 4OJ3A 4IH7A 4IH5A 1L3KA 1X5OA 2FDNA 3TZXA 2GAHC 2XG8A 1N56A 2MKSA 4K4VA 4NXMJ 2IHR1 3R97A 2GIRA 2Y0BB 4QPTA 4ICLA 3WIVA 2IA0A 2KFYA 1NDKA 2VOPA 2HZVA 1YBUA 3DYAB 3ICLA 1N54B 3AOAA 3A12A 3LWLA 1WTFA 2IDLA 2WB1D 2NPFA 2GVDB 2FLNA 1EP4B 3O5TB 3TUIC 3BJYA 1NHVA 4IYQA 1REGX 1Q7YT 1F60B 5H9FK 4F3MA 3WZ0A 4RW7B 2VFSA 2B9YA 1TMMA 4WFXA 4C3MA 1M5OC 3H98A 1KVJA 4QR0A 4ZHRB 1CJKB 2J0XA 3BR9A 3VAFA 3U7JA 4LRBA 4JI8J 3BKUA 1WC6A 2W9CA 2WAQD 1S6PA 4HTIA 3WX4A 1SIZA 2J9DE 3MMBB 3DRXA 1DTTB 4TKTA 2GQQA 4J9RA 2APOA 5IM0A 1WI8A 1SIWB 2OELA 2DIVA 1ULRA 2FJWA 4PYDA 3IR5B 3H90A 3IWLA 2GC8A 3EVOA 1M5VC 1JMTA 3C16B 3HHDA 3WDOA 4ANCA 1VLOA 5F8JA 2C2MB 1FKOA 3R7BB 1WG4A 4JI5J 3VF0B 1RBAA 1XK8A 4DUTA 2HS3A 3HMJG 2YX4A 4DV4J 4K4XA 1NNDA 5KFDA 2EBGA 5BXIA 3IG1A 4IFVB 2HBZB 3MPUB 1ZBTA 4WP9A 4EBDA 3M6UA 1IM4A 2VOOA 2G2ZA 4NRUA 3BYPA 2R8IA 4UY85 3G82A 1TK8A 3SSRA 1PSDA 5DM6Q 1LKZA 2CWXA 3JTPA 4YB5A 1U6FA 3G9CA 2ZM6F 3RRGA 3OL8A 4PEOA 4USMA 1PYSB 4N7TA 1TL3A 4OI0A 4QJVA 2VH7A 5I4MA 2CQCA 4OZ0A 2M5YA 1Q4RA 5F8LA 3H5YA 3PRBA 3Q8YA 2W4CA 3KNAA 1GMUA 1BLUA 3R5CA 5SUHA 3MAAA 4G6VB 3IM9A 3RR8A 1K73T 2RQKA 1T02A 2UXDJ 4DR4F 4GMKA 4RX6A 4TY8A 4XDDA 3M30B 3FJ2A 2RRBA 2HVEA 1OQ3A 1C0TA 1HA1A 2HK2A 1R0AB 2VJVA 3J81j 4TNOA 2LXFA 3MEGA 2IJRA 4OZ5A 2RH3A 3OSNA 2OPSB 1P9QC 1RI7A 4R25A 1TKTB 3PKMA 3FZ2A 4L73A 2BKPA 3CD5A 1E6VB 2NXCA 4P2FA 1AA1B 5DG8A 1S0OA 2MKYA 1HI0P 4IOCQ 2BE9B 2ZE2B 3M32A 4CDIA 2YWEA 3I0RB 4JI4F 2GQCA 2HLTA 5IXUA 1U2RA 3AODA 3OTEA 2FLOA 2XMTA 4JI2F 2ALZA 1SC4B 3MMCB 4CLZA 5IWAF 4MKYA 2VKZG 1Q5VA 1VJWA 5JVGQ 3D2WA 4UF4A 5J2PA 1SQEA 5L1IA 3UW1A 5IV4A 1X8DA 3TAPA 2GJFA 1B3TA 2LFVA 3RB0A 1FESA 2CNOB 3I82A 1HBUA 3CE8A 4OX7A 2GVDA 1CJUB 2BKNA 4ID5A 1FD8A 4JI6J 5HATA 4ZCKA 2JOQA 3G6YA 1SXLA 1RAGB 2NYHA 3BH7B 1S9GA 4DPXA 4ZLLA 7FD1A 1S9EA 2ZH5A 2H51B 2W9BB 1WKKA 1UFWA 3EWGA 2KT5A 3KK1A 4RW7A 5KT6A 4LT6A 2LEAA 4DG1A 1U4BA 1EIYB 4OYBA 1Q78A 4DS4A 2AF6A 1NKBA 4OMFG 5BYSA 3CJ4A 3HD2A 4P72A 4WK1A 1LV5A 1RP5A 2YH0A 5K14A 4WPAA 1YJWS 2UUBJ 4ZPVR 1JQGA 2NXEA 1HHQA 2X1BA 2AJ2A 1TP7A 5HVFA 1JJCB 3W61A 1T95A 3UN3A 2YWHA 3W5ZA 3Q8VA 2ZZTA 4Q43A 2ZJRQ 1EQMA 5M2PA 2OO4A 2M8DB 2EFOA 4DV3J 2JEJA 4WE1B 1P8GA 1YTYA 3M1VB 4DQRA 2KZMA 4BC9A 1GTHA 1T9XA 3LW5C 2PEBA 4DJBA 5LSRA 3W63A 2HG4A 4F3QA 2G0CA 5JXSA 4CH7A 3GWCA 3MR2A 1XEZA 1M5HA 3EGWB 1FK9A 5GADI 2HZCA 3MD3A 1VRUA 3ILIA 4ZVGA 1LW0A 1Y5LB 4PXCA 2DNQA 1WC4A 2E5LF 2AJFE 2VL1A 2COLA 5CCLA 2XYPB 1RABB 2XULA 4PR6A 1VQMS 5FIIA 3H42A 1X9SA 1LFPA 2GO9A 2CIMA 2XGQA 4Q45A 4ECWA 1KOHA 1DQAA 2ZNYA 1SJ3P 2XSFA 4K5RA 3LP0B 4CWBA 4ZVQB 2H3EB 4LF7J 3NCRA 2PEHA 1Q0NA 4C6AA 2E1AA 2J5AA 2LKZA 3T1HF 3EDQB 5A6PA 2JLFA 3PHTA 3EE3A 2PSZA 2GNKA 4LBPA 2G9OA 2V8VA 4P2XA 2ASJA 1UPMB 4I2QA 3I4PA 2XWXA 5FLXU 3JSRA 1VBZA 2BACA 1H2VZ 3PO5A 3PZPA 1QTMA 4MFBB 3KXDA 5G0RA 3MEEB 1VBKA 4C48A 2B5JB 1KDNA 3UCZP 4X84A 1UZDA 4ANEA 5B08A 3MUMP 4W92B 5FDLB 2BE7D 1H73A 3ETOA 5E3AA 4JBCA 3EJMA 1D8ZA 3DOMB 3CCWA 3AA9A 4O4GB 3ZTOA 5F8GA 2HPUA 1TK5A 2AGPA 5KT7A 3TA2A 4Y0FA 1TAQA 4KKOB 3MFIA 2J0WA 3D0HE 3ZZOA 1KQSR 1RSCA 2IBKA 1MU2A 1WC0A 2QC3A 1O8BA 3QAUA 3DRRB 3R1HA 3QO9B 1NDCA 2CPYA 3SSSA 3EX7B 3ZZTA 3CCRS 4UUWA 3KJVB 3Q83A 1HI1A 2VQFF 4C0BA 5IFMA 3BB5A 1QVFR 2BR0A 1F2GA 3P96A 1EARA 5AE3A 1JLFA 1W25A 2LEPA 1IKXA 2CJXB 4X4OA 2YPZA 1APSA 5D77A 3NS7B 2ZHOA 3FRYA 2OD4A 2CG4A 1FDDA 2N7CA 4NA2A 3FUYA 4DFJA 2IVFB 1U45A 2AGQA 2XO7A 1FJGJ 5KT2A 3OBIA 3EGZA 4B3RJ 3G2XA 1LWFA 2ILZA 1SBRA 3SQOP 4NI2A 2ZKTA 4L3KA 4DL6A 1WJ9A 2KO1A 1YVFA 3FZBA 4ED8A 1QM9A 4DCOB 2PMZD 3NGSA 3ZTQA 3QWPA 2HHVA 2CNLB 1RHJB 4LRAA 4IG3B 5LMNF 1T9WA 2ZJPQ 4IR1A 1JLQA 4KHRA 2YH1A 4F04B 3DGPB 5KFXA 5C2GA 1X0PA 1X4HA 3K2YA 3KK2A 6FDRA 3IA0A 1HNIA 3BKTA 4RW6A 4USHA 4HT5A 2L9NA 1A9NB 1HQEA 4P9SA 1NPRA 2J9EA 5KFFA 3DOKA 5B0GA 2DCLA 4ZIWA 2KYXA 4WXOA 2EKNA 1RWKB 2JC0A 3KLEB 1MMLA 2H9ZA 4ED1A 3IR6B 1LEOA 3CW2C 8ATCB 3FNNA 3GG0A 1G7CB 4C2MA 1D1UA 1RHRB 3L7UA 2EG2A 1RT3B 3GLJA 1B70B 2CZ4A 2IRXA 5L9XA 3ZZ0A 2VIHA 1X31C 4DPTA 2AX0A 2ALYB 3P45B 3RZAA 2RILA 4LVOP 2ZOMA 2F4VF 2DXEA 4ERDA 1YX2A 2V94A 1DURA 4YDDB 2NS1B 2W7AA 3C46A 1Q53A 3S7RA 1R8HA 4GO7X 1REVA 2W2NP 3TJ9A 3K59A 4GKKJ 2GJ2A 5HANA 2RRNA 1TK0A 1S49A 2F9JA 1AFJA 1QVGR 2HRYA 9ATCB 1VQ8S 1SB6A 4QYRA 2NUUG 5K8MA 3VVTA 3C6TB 3RBEA 2GZOA 4XIUA 4TYAA 3PTWA 1JLAA 4D3HA 1UW9A 3FBEA 2RS8A 4FYXB 4F4ZA 3O6QA 2MMYA 5J2NA 4MKBA 2E44A 4NLOA 4IR9A 1R0BG 2UVVA 4BHQA 5F41A 1U7LA 1WEXA 3G87A 4QOTA 4ID8A 2V5HG 2HAFA 3FKBA 4ECZA 3DM2A 1Q79A 3BO4A 2Z58B 3SV3A 1HD1A 2P8IA 2XYGB 1IBLF 1SUQA 5CYQB 4F0KA 2VICA 2XZTB 3B82A 4DZ6A 4KIAA 3CJSA 2L41A 2AEJA 1SPBP 4EMDA 3TEHB 4GO5X 2UXCF 2OPRB 1LWEA 4MFBA 1QY7A 2I6WA 1HNWF 1VQOS 3FSYA 3M6WA 1N5TA 1YRXA 3NMAA 2KVQE 1HARA 5SZTA 4C11A 2V63A 3F56A 3DLEB 3NNHA 2WONB 1ZAXA 1RWOB 4U8YA 2BE2B 2PMWA 4FXVA 3V6HA 5CD4H 4CNYA 4CO0A 2B6AA 2V4JA 3OL6A 2FHJD 4YP3A 2ACYA 4FN5A 1PAUB 2C42A 1H38A 1S1XB 4NLRA 2UXBJ 4NXMF 1FVSA 1RADB 5LXRA 3NAHA 3UN5A 3MFHA 3WC2A 3LO3A 3NBPA 1JKHA 2X1FA 3MCOA 2RF2B 2VD3A 2B7CB 4C3LA 1N6QB 4M63A 1H7WA 2PA3A 1FCAA 2HURA 3GCWP 2VU5A 1I1GA 5I3UA 3SIPB 3CJ3A 3I31A 5KG1A 2HGLA 1PC4A 4B02A 2HVZA 3QZ7A 4P2SA 4UZCA 4PCQA 3MGJA 2E1PA 4MIWA 1UCNA 2ADCA 3HJFA 5KFTA 2HQ3A 4RUCA 4JI8F 4ZPWR 5CH7B 3MCSA 1I5OB 3MEDA 1U47A 4XDCA 5LT5A 2IMOA 4B9LA 3IBFB 4B3OB 5HMZA 3DLLQ 4JI3J 3WC0A 3NGTA 3QQCD 3T3FA 2Y1IA 1VQPS 3CCZA 2A2CA 3QBCA 5A6WA 5HROB 4AXJA 2KZZA 4F02A 4IOBA 3HZEA 4GVBA 1RQ0A 2R7VA 4ZVTB 1ZAVA 5LOQA 4HH1A 2YNHB 4NZ6A 1VQ4S 3RBDA 4RZRA 3MPDA 2JVOA 3MMAA 2CZVC 4J90A 2D9PA 1NU4A 4UUXA 2FQQB 4JI5F 3GV8B 3M8YA 3V4IA 2GX8A 2W25A 2JWNA 4X2BA 4Y2IA 2V0NA 5T7LB 4DQPA 3GIRA 4DV4F 1T3NA 3W9JA 4ZVPB 4ETZA 4KGMA 2MQLA 3IMQJ 2RDDA 4M8LA 2ASYA 2XHWA 4RW8B 4OLOA 3CMES 4EBCA 2IVYA 3I5BA 4IUFA 4TQRA 4MIAA 4K2XA 2D9OA 1VMBA 4HDGA 3IS9B 3BDEA 4NA3A 1RWXB 4IG0B 3ISZA 3TVYA 4OV6A 4DSIA 2RIJA 1AUDA 5F8NA 5ADZA 1F5BA 4PG6A 3D4JA 4X65J 1J5OB 4DSKA 3CDUA 2Z56B 1HBMB 4PUOB 4NLGA 5EX0A 2K7JA 1BQMB 4KTQA 3AFGA 2J8AA 3Q89A 3WHIA 2H54B 1P27B 4M5NA 4ELVA 3FEZA 4LBIA 3VZIA 3C19A 3AA8A 3OLAA 4DS5A 3H4DA 2UP1A 1VQYA 2MHNA 1S76D 3HHKA 2GQ2A 1E6YA 3IFEA 2E5GA 1C1CA 2HHHF 3TAMA 1XIQA 3KHRA 3PEHA 2HK3A 4P74A 1DARA 3K57A 4NZ0A 4X4NA 1R0CB 3ZXWA 4C8ZA 3T5LA 2AU0A 2L3MA 2CPJA 3KLGB 5A76A 2DEIA 3J7Z5 2F7VA 3DI6B 3L95X 2I1RA 3W5YA 1S9FA 3TX8A 2LA6A 3PIPQ 2H5EA 2MZJA 4XTTA 3W62A 3LAMA 1H3DA 2W2QP 1MLAA 1PYTA 4RW4A 4CLUA 2QFIA 3M2RB 4P71A 5GAEU 2VHGA 5IZHA 2C28A 1HPZB 2V2VA 2BANB 1U26A 4F50A 4DR6J 3JB9k 1HMVB 3LQVA 3I5CA 2QLBB 2NZCA 4YN3B 1RT4A 2VG6B 1JLBA 3SQGB 2XY5A 1TKZA 1FF2A 5KFOA 2EVZA 4CYUA 5KG3A 3AB2B 3G6XA 2B4VA 5L1JA 1RAIB 5FJ4A 2H48B 2B4PA 4DF4A 1N6QA 4O4RA 2IRYA 2MY8A 3DLGB 4JI6F 2OI2A 2XZWA 1QJHA 3MAHA 2BRLA 1F5AA 4B08A 5RUBA 3OJSA 2CQ3A 2RVJA 2I2YA 1S72S 5F9LA 3IGNA 2LDIA 1DHMA 3W8PA 2Q43A 2F4FA 3GYXB 4AQYJ 2A0FB 2LQJA 1FFSB 2W7OA 3BV8A 2MZQA 3P3DA 4FKXA 4PWWA 4ZKAA 1NB7A 2GO8A 2VC0A 2W2PP 5HVGA 4OX8A 3SXLA 3G8TA 2V8GA 2ZJQQ 2UUBF 1MROA 5AXLA 4G1QA 2ZH6A 1BHNA 4WP3A 3QT7A 1SJ4P 5FD1A 2MQOA 5EGYA 5KFBA 1EETB 5J1EB 1RHMB 4RW9B 1VHIA 3PJ9A 4S0MA 5KFMA 4FKYA 3CCMS 3QGPA 1NKEA 3KFWX 1H2TZ 2AIRB 4B3TJ 3RYLA 3TP2A 3GIJA 4DV3F 2PGCA 1UTAA 4H4OA 1N5YB 1YHQS 1FNMA 3M2UB 4NRTA 3WX8A 3AOBA 4AL7A 4OI4A 2DPJA 1YDLA 2PE8A 4BDPA 3IXQA 1JLEA 2ADBA 5ETNA 1WKLA 3EZOA 4RNMA 2LQ9A 2QA2A 3CDBA 5D0HA 3M9OB 2DK2A 2XSJA 1WEZA 1K8AT 2YKQA 3M7VA 4HTJA 5LSOA 3NMRA 4CH1A 3UWTA 1MMDA 2WK4A 4K4TA 1ZM2A 3R7SB 3QT5A 3RB6A 3ZZPA 1TKXA 3BZQA 1R8PA 5H9EJ 2I0XA 5D4OA 1HBOA 5K9FA 4ECTA 3I9V9 1VOMA 1F1BB 3UDCA 4ITSA 4OHWA 4TXSA 1SL2A 3QPIA 3OTOJ 1FRMA 1FX4A 4W98A 3T1AA 4ILRA 1U1NA 2HVIA 1NCLA 1SJ1A 1EZZB 4LF7F 3IR7B 3T6JA 4L6V3 2MGZA 2MYFA 4MIBA 1KS2A 4NYZA 1RB0A 4E98A 2QG9B 4PAAA 1FVQA 1SKSA 2N7YA 3ITHB 2EG1A 2JEFA 4DV7J 3CJ8A 4NLPA 4WFYA 1ICEB 4QIFA 2DHAA 1GH8A 4QCLA 3CDEA 2DNYA 4FBUA 1RT5A 3VAJA 4NLXA 4J9OA 2AW0A 1QUPA 2JLEA 4W90B 4DQSA 1RTHB 1YJUA 1TVRA 5KAKA 1RU2A 3PIOQ 1RYSA 4KGZB 5BR8J 4QU6A 2HZAA 5KFZA 3VV2B 1S4EA 3JTOA 2A2DA 3QNWB 5KFAA 4K4SA 3T5JA 2OH2A 1HI8A 5L8RC 4B3SJ 4K8RA 2Y0SD 1MWZA 2MQPA 1JXVA 1VIXA 3P5BP 1IWAA 3HZGA 4JI0J 3N5FA 2HFVA 3D1OA 1D9AA 3OTCA 4KPYA 1BUXA 2BQ3A 4J9UE 3ZO7A 1VQ7S 3OJUA 1R7IA 3R9LA 2RE1A 2ROGA 1ZH5A 4DR5J 1SJFA 3CCLS 2YNGB 1M1HA 1JB0C 3E8OA 3DDNA 3HF5A 1DLOB 2EK1A 5GVQA 2A6MA 1FJGF 4B3RF 4M5LA 2RNEA 3TW0A 2BJ9A 3NL0A 2RAQA 4A8MP 4NLVA 4ZPDA 3HP6A 1NM2A 2YNIA 2C2OB 2JSXA 4B9NA 1S77D 1LQ9A 5GADU 3OHAA 4GC7A 4URGA 2ZC3A 1I94J 5D3GA 1SQFA 3FMWA 3UVJB 4EBEA 1QSYA 2Q66A 3H25A 4CNZA 2P2CB 1C0UB 1RT7B 3CWJA 3RAXA 4NCGB 4PABA 1GX5A 3TVKA 2XY7A 2H4YB 2AJ1A 1TV6B 4ED6A 1UZHA 4NYOA 1BWVA 2V8DA 2W2OP 4GC6A 4WKYA 1KEKA 1BD6A 4XO0A 3JAMU 3UR0A 2HHUA 2MZ1A 1S6UA 2VBYA 4O0IA 3FVYA 4C8YA 1SV5B 1TL7A 1S7IA 5A8KA 2F63A 4UOHA 1QE1A 1N5QA 2CDRB 2B8PA 4USTA 1KHVA 4F4XA 3MXHP 4M5KA 3D54A 2ZOFA 2HQIA 4OYIA 2G1DA 4Q0BB 1Z2ZA 3MM6A 3QFHA 3ZTPA 4KFBA 3DN9A 3DU5A 1RDRA 3KLIB 2BJ3A 1SC6A 3CJKB 1RLDA 4C8MA 1WOOA 2JLGA 1WF1A 3VGUA 2BYCA 2ILYA 4M5DA 2FGCA 4K59A 3S8SA 4W4MA 1IKYB 5J2QA 2B4OA 1V3RA 4GKKF 3W64A 1XQIA 2V68A 2BABA 2FYXA 4NCAA 4WBFA 2OPPB 2R42A 2DKOB 1SJRA 1D09B 1LK7A 3TARA 2BJ7A 2Z8QA 4CLSA 3J7YU 2VG5B 4DV2J 1WG5A 1NK7A 3KJNB 1CJVB 4A8QA 3A8KA 4EYIB 5D4NA 1FE4A 1RA6A 3QJPA 3GFXA 2WCXA 1R6VA 2AKWB 1I6JA 1C1BB 2ZD1B 1OY8A 2WZ1A 1NRKA 3VZHA 3JAMY 4LF8J 1UWBB 2FZKB 2RMLA 4KGKA 1X4BA 3D3BJ 2JJ4D 4DL7A 2X3GA 3FFIB 1C4CA 2RB7A 2WOMB 3AJDA 2FJAB 2R2RA 1R8CA 1B4SA 3NOGA 4P7TA 2HSEB 2GGPA 3BSAA 4H4KC 5HAOA 4LIWA 1PKUA 3M8WA 2H1YA 3QYYA 4NCBA 1C2PA 3V4MA 3K58A 3IWNC 5J1NA 2JRSA 2MLZA 2BMBA 4TYBA 2XY6A 1U2FA 2DH8A 2Z57B 4RKUC 3CMAS 5U47A 2HWIA 5A2QU 1S0VA 2UXBF 4F4WA 3NGKA 4Z37A 3PJXA 1OPIA 2DGOA 1T94A 3C6UB 3RW7A 2RDJA 4NOHA 4WWSA 5L1LA 2DRAA 2J6TA 1GTEA 3D66A 3TWZA 1FRXA 2V50A 3KHLA 3DRYA 3R5BA 2DBBA 2QZ8A 1HQ2A 4Q7AA 2X1AA 4J9LA 2GVZB 1X0FA 5E41A 2XMAA 5LMUJ 3ONQA 2L48A 4ZPCA 1LXNA 3S1TA 4TQSA 4PWDB 1VRQC 3SZ2A 3NAIA 4OZLA 4AL6A 3MHYA 1V6HA 4F4KA 3FK4A 4UOFA 3SI8A 2VC1A 2UZAA 2A10A 1U1QA 1YJNS 2CAJA 5IS2A 4JI3F 4RO0A 3VHQA 2YKMA 4K7QA 5CYMA 4JI4J 2EI5A 1GFWB 2LXUA 1KN6A 4ECYA 4M1KA 1O6XA 1T0TV 5HMYA 4L72B 2CPZA 1QD1A 1VQKS 3D0GE 1WEYA 3KDNA 3MDFA 3Q8QB 4CLFA 2EFPA 1U6BA 4KJIA 3TQ1A 2CFXA 1O5JA 3IRXB 3ZNJ1 4ELTA 2QEXS 1T9UA 2WVCA 4CRJA 3TO8A 1IKWB 1F3FA 1CS4B 1BE4A 1RTIB 4FPIA 3T5KA 2K8GA 4MK9A 5E7OB 4FPRA 2MKHA 5ETLA 2H5IB 5HMXA 3MM5B 4X65F 4A8SA 5F0WA 2FGOA 3E3XA 1KHWA 2ZH9A 2C1EB 2SXLA 1OYDA 4V19J 1IKYA 1N5SA 2CJQA 4OI1A 2J8SA 3DRPB 3H2VE 3UE2A 1XNQF 1VRTB 1UP1A 1VQ9S 5D6GA 3A1YG 3B4DA 4QWAA 4OV1A 3QRPA 2FTRA 4OLPA 6FD1A 1EKSA 3EPIA 1KTVA 3JQMA 4LIRA 2K1RA 3FRZA 4RWXA 2CRLA 2R7XA 4KRWA 3M2VB 2L9DA 4DPYA 2FIUA 1HWJA 4PG5A 1HQUB 2F8MA 4C98A 2DT9A 4L74A 1FWKA 4HKQA 3JYTB 1PAEX 5HVHA 2VJUA 4UTGA 3NRBA 1NDLA 4DLGA 2W9AA 2HMIB 1FKPB 4WIQA 5LL6d 3CC2S 5I42A 3HSGA 2HFUA 4LFAJ 1T9TA 1A7GE 3B78A 5C24B 5L46A 2E9TA 3FFIA 4KY3A 5AT1B 4YB7A 1S1WB 2CVEA 3ULHA 4LF6J 1RACB 3OPKA 2DHHA 1OPZA 4LSLA 3THVA 1JNZB 3QMQA 2B56A 4NWBA 2C2NA 1CJTB 5DZ6A 3OR2B 3PX4A 1QDUB 4OYPA 1NB2A 3PW5A 4NLQA 5A8RA 4DR6F 3W5XA 2GIQA 4XK8C 2LDYA 4FS2A 1VK8A 4FYYB 4Y2CA 4L75A 3DLBA 5K20B 4GRSA 5DQHA 2B9EA 2WW8A 3W1YC 1XTZA 3JTNA 2DNHA 1QSSA 2D3OR 2B43A 2XMUA 4Q5VA 4DQQA 5D8HB 3EVWA 3C8YA 1S97A 3KWMA 1PBAA 2ZDOA 4O3PA 3M05A 3QATA 5KFLA 3HPOA 4ZVOB 1WHXA 2XMMA 4U67Q 1SC3B 2QL9B 2GVZA 3ISNC 4LSZB 2FZCB 5KT3A 2DH7A 4ES2A 4O44B 1CC7A 1T9VA 3GONA 1XMBA 2X7IA 2HNDB 4AQYF 2D74B 1VIOA 1NBEB 2KTQA 3R2CJ 3PR4A 3RAMA 2WVEA 2KJWA 4JUZA 4ZVUB 3A3PB 3KLFB 1M1KT 2KL8A 1KQFB 3CDWA 4KB7A 3TZZA 2WSFC 1KBRA 1NSAA 1HFEL 1U8WA 2WBMA 3EMTA 2V69A 1SKUB 3D1QA 3ENQA 3BSNA 2HNZA 2DNNA 2IM0A 1P1TA 1TL5A 4Z2XA 3BS9A 2DHGA 1Y11A 1RWNB 3AD7C 2XEXA 4OI2A 1B0VA 1H72C 4ZOSA 2DNZA 3HHEA 2R2UA 3CCQS 3T6BA 1VHFA 2DNPA 1NJIT 2VQEJ 5C42B 1Q82T 4DN0A 1B7YB 4ZDNA 1NHKL 1CULA 4DR7J 4M5JA 1HL6A 5IT0A 1AROP 2VV5A 2X1GA 1N33F 2JL9A 2RQ4A 5IQQA 4PKDB 3DLJA 2WVFA 2DB1A 1CS4A 2N82B 1U24A 1S1TA 5KFPA 5KFKA 4U6PA 4OFZA 4TLRA 3VALA 2J6UA 3VAMA 3MECA 1RT1B 1U25A 1ZA1B 1L3SA 4MAKA 5GMKa 1KONA 4K0KJ 4HACB 1RT2A 1KP6A 4ECQA 3CJ2A 1U0HB 2JC1A 1Y00A 1X5SA 5HMWA 3MOZA 1TQLA 1JLGB 1VDHA 3MM9A 2FJVA 4ILMA 4IOAQ 1PC5A 3OTOF 2QSWA 1RTJB 3MTJA 4RUAA 2VG7A 1LWCA 5IT9U 1RAOA 3X3UA 3W60A 4WZMA 1SH3A 1FWLA 1KR4A 2MPUA 1RUSA 4RBUA 1RWUA 3MURP 2MHEA 2IIHA 1JK9B 1IUJA 1RAHB 5E3RA 3W2VB 4WTOB 3K89A 1WOSA 1KNZA 1S1VB 3V81A 1UW4A 4DV7F 4LVNP 5KG5A 4A8XA 3QIPA 1Y5NB 1YJTA 3D67A 4LF4J 4OL8A 3CXCR 3M8QA 3Q8UA 2LVWA 3QGGA 3CT9A 3IN5A 5AXMA 1RAFB 5HBMB 1JLCB 4F0MA 1T03A 2ZUAA 5F0UA 2RU3A 2A3JA 3HULA 2XWYA 1OWXA 4ZN3A 3JSBA 4KO0A 5BR8F 4IFYB 1XNRJ 3PCOB 2FZGB 3UD4P 3SSQA 1HNVA 1N52B 2DHXA 2GCFA 1CC8A 2LEBA 3DLKB 1CJTA 2G13A 1F2HA 4B3SF 4ECSA 4U7CA 5KOXA 3NNCA 4C8KA 4WXWA 4JI0F 3Q8SB 1JX4A 1FXDA 3QZ8A 1FHTA 2AGOA 4OQJA 3I0SA 5J2MA 1NZ8A 5D15A 2UUTA 4A48A 1BGXT 3DGVA 3QT6A 4RUBA 1RAAB 2ZH1A 2HWTA 5BYQA 4KHPJ 4RU9A 4HI2A 4DR5F 1S7HA 1NEEA 3C14A 5ETSA 3SDEB 4ED2A 3HFVA 2LMIA 1FFWB 3DOLA 4QYZJ 2OPQB 1LWXA 6AT1B 2RKIB 1RWWB 4I7FB 2FD2A 2QGFB 4IDKB 2WHOA 3G96A 4J9KA 4B9TA 2R3VA 1HD0A 5DQGA 2Z2LA 3QJJA 3EZUA 5A0YA 3TUZC 4ILLA 2EEYA 5CYJA 2ABYA 4NZ7A 5DJBA 3MZIA 3DRSA 2W7PA 3QRRA 2R7RA 4ZP9A 3HVTB 3W7BA 1TKDA 2F5GA 1F9EB 4ZVHA 3PKYA 4J5OA 4NLYA 5G4DA 4CTAB 2XLKA 2KXFA 2DISA 2DNMA 5LM7E 2F9DA 3LP1B 4ENOA 2E5HA 3W2WA 1KLMB 1MWQA 5HQ8A 3CDAA 3M6XA 4PQUB 3CO9A 1LW2A 1FDBA 4OX9J 1AZSA 5M2UA 3OVSA 3BH6B 3DMJB 2AQ4A 2YWKA 4C97A 5B0DA 2P6SA 2KI2A 3CC7S 2ZVIA 3D7SB 2V34A 3EDRB 5GAEI 3CMQA 5C5JA 3GMGA 4MJKA 3CCVS 4DSLA 2MZRA 1NK6A 4E8UA 3C15B 1IR1A 3D6FB 2GHWA 3V6KA 3B6BA 2XBPA 1UKUA 1HBNB 1U0HA 2CXEA 4O23A 2E7VA 2CG8A 1JLGA 4DV2F 2DR5A 2IAJB 3CJ0A 1S6QA 2KB2A 1DY3A 4DSFA 3V6DB 2HQDA 2FHOB 3G8SA 3HHLB 5LJ5Y 4KGXB 2IYGA 4LF8F 4Q8FA 1HYSA 3KUEA 2OSQA 3MM8A 1X60A 1OY9A 2C22A 2B4UA 2AJQA 1KQKA 4ED3A 1TU0B 4R8UA 1GNKA 3W9IA 3R5DA 3HVAA 4H4MB 2VA2A 2CQ1A 2F8EX 2MKJA 1T05A 1YZ6A 4UY8T 1LK5A 2QX0A 5EHHA 3UFCX 3O3LA 1RTDA 3BDPA 3CSKA 2FB0A 1UA1A 3V5RA 1QTNB 2W24A 5IT4A 4I56A 4AFFA 3A4TA 2NR0A 5K8PA 2DNLA 3J80U 4Y2MA 2VDIA 2U1AA 3ELHA 1GAOA 3FC9A 2IYIA 8AT1B 4RNHA 3MM7B 2HHHJ 4ED0A 2DR6A 3BYRA 5A8WA 2HEKA 3BREA 5EWGA 3KG4A 1U1PA 4J9NA 3I87A 1UAWA 2M2BA 4R5PA 3QIDA 4ZMMA 4DHVA 2V2QA 1YBTA 2CPHA 2QN6B 4KR0B 1A6LA 1FJ7A 4KT0C 4RBVA 3L09A 2DEJA 4LR7A 2YKNA 4ETXA 2HKEA 5LMUF 4CM0A 2D41A 4CT9A 1NK5A 1N4LA 3KDOA 2MXYA 2ZNZA 2HNYB 3AXKA 2BM0A 2IC3A 2I5JB 3M8PA 1UVIA 3KJFB 3KK3B 3BQ0A 2VFUA 2KM8B 1G1XA 3D68A 3FBBA 1S1UA 1NHUA 1P1LA 1PJ5A 3EVMA 3SFUA 4I6AA 2KU7A 1RKIA 3HT0A 3R8YA 3VVUA 1OSCA 4Y28C 4QWEA 2W01A 3KLHB 2ZH3A 3CUNA 3KG1A 3HD1A 1NK8A 3ADAC 3PJWA 3OR1B 4N76A 5L1KA 2VPWB 5D0RA 3DYAA 5ETKA 1VBYA 4DXLA 3W9HA 4LSNB 4YEAA 4OHXA 1EP4A 1S4FA 3J80Y 3MUVP 3CCSS 2Z2ZA 2G4BA 2NQPA 3Q24A 1DZ5A 4CLYA 4HLBA 4ZN1A 2Y8YA 4V1Ak 1GMVA 3QJLA 4TVAB 2MQNA 1WG1A 3D9BA 3PFOA 4DN9A 3F44A 2HHXA 4ZHRA 1CJKA 2BJ8A 3JXOA 5F9NA 1KOOA 2CJBA 1YLXA 4QU7A 1UWAA 2KG0A 3MD1A 1O0PA 4UQGA 2YWGA 2Y1LB 3D28A 3FSIA 2C3OA 2ZZMA 2KT3A 3MMBA 4IKAA 1DTTA 4FVCA 2CJ9A 1RCXB 1G4CA 2CZ9A 4ZITA 2CQIA 3NLCA 2DY9A 1TELA 1IM6A 3T19A 1NK4A 1U1RA 1JJ2R 2J9DA 1W2BR 2VB6A 2Q6CA 4Y2KA 3Q8PB 2M88A 3PDNA 4KV8B 2GS8A 1K1QA 3C16A 4FDFA 3THTA 2R7UA 2BRKA 4M5GA 3K5OA 4AL5A 2XQCA 2RRAA 3LP2B 2XMVA 1FJCA 4FS1A 3U27A 2FY8A 4LRCA 3SFGA 4HYKA 3HHLA 2JHEA 3VAHA 4OJ1A 2EC0A 1VC5A 1ELOA 2QLFB 2W4PA 4FNHA 2ZHAA 2J9CA 3PFEA 3QLHB 2QA1A 4WP8A 3BO3A 2XNQA 3BGUA 4LFAF 3OVBA 4IFVA 1EB0A 3F0NA 3VGSA 3NKYA 5EWEA 1WELA 2ZKUA 4K4UA 1K47A 1BQNB 2MZTA 4QW8A 1FRHA 2HGMA 2ZC4A 5AXKA 2EFGA 1T8EA 3IRWP 4LF6F 3OUYB 2XB2D 3GYNA 4I69A 2NXUA 4P75A 5HLFB 3TA0A 2M70A 3FQLA 3ZNUA 4OHYA 1DTQB 2XCAA 1P9YA 2AJ4A 1YJRA 2HQFA 1H74A 1T11A 1YRUA 2NXJA 1TL1B 2IJFA 2F3JA 2AD9A 1UVMA 2LU2A 1JXLA 1TZ0A 4QWCA 3KHHA 4KH0B 3PVXA 4EZ6A 4EZ9A 1EQ0A 3AHPA 5DDRC 3DU6A 4LREA 3BN4A 1B99A 5H9FJ 5C25B 2GFFA 2OEJA 3M30A 1I51B 4A46A 3AB4B 1SJQA 5HP1B 3AQOA 2Y1JA 2JZ5A 3QAEA 3OXLA 1R0AA 1N0UA 2VBZA 1VC0A 4LF2A 4LRDA 2DH9A 2X51A 3OL7A 2DPIA 1XR6A 3BGOP 2DVIA 2ZEJA 3EYZA 3CPWR 2OPSA 3POTB 4DL5A 4WYLA 1UETA 2ZH7A 1TMJA 1RXOB 1TKTA 5JJBA 4NA1A 1E6VA 2EXUA 2I5JA 2O1PA 2KYZA 3ZTRA 3N6LA 3OVAA 4BBYA 2CKWA 1Q81T 3J7YI 3L3CA 3NGRA 2BM1A 2ZE2A 1RWMB 2AHOB 4ZK7M 3LANA 1S6OA 2AV5A 4F4AA 3NCQA 4URQU 3I0RA 3U02A 1ZZFA 3D6TB 2YKAA 3Q2SC 4I2PB 3MMCA 1Q7LB 1XMQJ 2VPXB 2E7WA 2DRBA 1B0PA 3DDKA 3PV8A 3FGVA 4LQ9A 4J91A 2CQPA 1N32J 5DLGA 5HQMA 4BC7A 3LPEA 2VQEF 2MJNA 2B9XA 4DR7F 1CJUA 3CJTA 3BO2A 5ETVA 4O3RA 5KG4A 3ET6B 2K06A 3H5XA 4NE9C 2FLPA 4K50A 2W9BA 4LUBA 1X4GA 1WDTA 4H54A 4P73A 2DRDA 2AYMA 5FLXY 2FVQA 1M5PC 5C7PA 1H6KX 2CJAA 4M5IA 3VWSA 5ETPA 4ATNA 5JVHQ 2XGPA 1VBXA 1TUGB 3E01B 4K0KF 4ICLB 2GMHA 5KG0A 4OIXA 4NASA 1YJ7A 5GAHI 3MPWA 3RGIA 1GXTA 3IM8A 3K8VA 2G1HA 2WTFA 3HVWA 1CQMA 2CVIA 3GCXP 4JOUA 3HO1A 1F6TA 4I4BA 4ED5A 3CNQP 3N4WA 4QW9A 2BV3A 1ZM3A 4KV8A 4WE1A 3RJMB 3BBBA 3MPYA 4YY3J 3GIKA 2Y9HA 5E3CA 3M1VA 2R8KA 1XERA 1NSPA 3FCWA 2RUSA 1UVJA 4DV5J 3EICA 3EXYA 1JJHA 2W9CB 1S6PB 4ECXA 3OTDA 2FJEB 3FEYB 1FNOA 4F67A 3RTVA 4JV2A 4LF4F 3GV7B 4DI6A 1N5VA 3ZZRA 3B54A 5IM0B 1QAIA 4PXDA 2JVRA 4FYWB 4IO1A 4MT1A 4NLUA 4YB6A 4TU8A 1RBLA 1V3SA 3KTQA 2GMLA 1WNEA 2R8JA 5AE1A 2FY1A 1BY9A 1T3OA 1XNRF 2GJIA 3L7PA 2J76E 3QRQA 2J6SA 2HS4A 4AD6A 4XPEA 2EPIA 1XJWB 2FC8A 1FKOB 2QLJB 3OTBA 3TRGA 1DTQA 1NSQA 3BBCA 1VC6A 2XLJA 4PG8A 3LP0A 2FUG9 2MTLA 2KRRA 2BEFA 3L9ZA 4FXWA 3BQ2A 1AXQA 3IG1B 2EBEA 3M8ZA 1MG7A 4KHPF 3DC2A 1DRZA 5CD4A 4EFAC 2E5JA 2HQGA 1Y9OA 3G82B 2VONA 2FVRA 4ZP6A 1SL1A 3DCAA 1SKRA 2P9EA 1FRKA 4EI2A 3SEOA 5F8IA 3L7OA 3MEEA 3FEXB 4USJC 2B5JA 4ZVRB 1TL3B 2DO0A 1ZTWA 4Q44A 1DQ8A 2Q6BA 4B3MJ 5FDLA 2R4FA 3E51A 4C8NA 4WU2A 1L3UA 4R0EA 3DOMA 1HNZJ 2M7SA 4O4GA 3HDSA 3MAAB 3O44A 1FXRA 4X4TA 1Z4UA 4KKOA 2A18A 2DD8S 4TY8B 2QYCA 2J7UA 1Q1KA 1X4DA 3DRRA 3M9NB 2PC6A 2ZWPA 1C0TB 3QO9A 2RQMA 4AXIA 4K4WA 3TZWA 3DHWC 4WIIA 3CIMA 3MEGB 1PG5B 3KJVA 2DXFA 2CQ0A 5IC4B 2AEFA 4QIWD 1EHWA 4H4KA 5EX3A 3CULA 4I6YA 1YG0A 1U0SA 3QGHA 2QLXA 2F8HA 1ZM9A 4OYXA 2O3DA 1NAQA 4OX9F 1U09A 5F8MA 5ETRA 4JV0A 2RSQA 3MR7A 5DGBA 4OI6A 2HGNA 2HBYB 1Y10A 1Y3JA 3D1HA 4DEZA 1DQ9A 4P6QA 1FX2A 5EUHA 1NKCA 2YTCA 3M32B 3LTOA 4CO1A 3F41A 1D8YA 1VR6A 4AUKA 4IG3A 4DV1J 3P5TL 4LFBJ 3BPSP 2B3TB 3E01A 1UJ6A 5J2PB 2AMCB 1WHWA 2MJUA 4YOEA 3DGPA 4FF1A 4X4UA 1X4AA 4WFBQ 1HBUB 3KUGA 1YRTA 3VAKA 1ZPVA 4ID5B 2HVHA 3WIUA 5D4PA 1B0TA 1S9GB 3PO4A 1RT6B 2CYYA 1S9EB 3KLEA 2G0IA 4C8OA 3KK1B 4DL4A 3H4BA 3ZZYA 3CCTA 2CNNB 2PA8D 4DG1B 1FKAF 1S0NA 4Y2AA 4UT4A 3DNCA 4Q2MA 3K5PA 1TL4A 4QIEA 1RT3A 2Z30B 4JI7F 3IC1A 1UVNA 2W2MP 1VS3A 3H7HB 5K14B 4HL9A 2PI4A 3K0JA 2Q79A 4CO2A 2W1BA 5ETTA 3UI3A 1HW9A 1U49A 4CLPA 1FE0A 1K0TA 5C2CA 5DZ7A 3BKFA 3NOCA 4LF5J 5KT5A 3VR1A 1XNQJ 1OYEA 3HFZB 3KKFA 1TAUA 5I3PA 4ELUA 3EUNA 4FF2A 4QIVA 5KFUA 3UCUP 2LQBA 1FTCA 4DR3J 3C6TA 1UJ4A 1KVIA 3ENVA 2P9GA 1L5UA 2DTJA 4KAIA 4KC5A 4A8FA 3ILOA 4X64F 3HXMA 1FK9B 2FLLA 2ASDA 4TU7A 1VRUB 5DRKA 2NYIA 1LW0B 2XMJA 3N01A 3SCKE 4RWWA 1RK8A 2AYEA 5M2RA 1VQ5S 3Q8RB 3N79A 2YBVA 5CYQA 2ZH2A 1SVDA 3I6PA 3TA1A 2R7TA 2OPRA 2XTJP 1KFSA 2MKKA 2O66A 1IN0A 3IO1A 1N0VC 3UR3C 4I68A 5JUMA 1IBMJ 2B9WA 3JQJA 3J7ZT 5B7WA 3DLEA 2ROPA 1Q8BA 2WONA 2DNGA 2HFOA 2BE2A 3J7A1 1YBAA 3LWMA 4Q8EA 5KFWA 2HHPA 1IJFB 3LGMA 2KKHA 3WQPA 1S1XA 4I2QB 3UDLA 2RDIA 3LA0A 3I56S 3DHXA 5B09A 4J9MA 3NCPA 2MSTA 2PI5A 4M95A 1RAJA 5G0RB 2MY7A 2RF2A 1IBCB 1G3OA 1TUVA 4P52A 3PX6A 2ZHBA 4OHZA 2KH9A 4YHHJ 5KFJA 3QSIA 3LGHA 2VASA 4N77A 1D9FA 1GMWA 1PIEA 1U1KA 3CIZA 1M0SA 1YI2S 3RR7A 2YX1A 1KTQA 2ACMA 4NEZA 3EPGA 4FYDA 1H98A 3RBZA 4GVLA 4BCAA 3OD2A 1MU2B 2W4DA 2K3IA 2CQ2A 2MB0B 3TUPA 4ZVFA 2HW3A 1TR0A 3CVKA 2D3O1 1QLNA 4OZ1A 3HHLC 3GPAA 2BQUA 2CADA 2E1CA 4IRCA 3MR3A 4B3OA 2AT1B 1CPZA 1JLFB 3MTKA 4ZLJA 3JSYA 3C66A 2LECA 2MLYA 5HROA 2BDPA 2FVPA 3TNVA 1IKXB 1NK0A 2IFXA 3CEDA 1GK8A 1XMOJ 1S12A 2YNHA 1X5PA 2Z0GA 3GZ7A 1RBOB 1LWFB 4RJVA 3PACA 3Q23A 5KG2A 3HHNB 2QA4S 1M5KC 4NI2B 4ZCIA 2NSBA 1RT6A 3GU0A 3VQSA 1K44A 4J9SA 3CJQA 2E9RX 4X4VA 5T7LA 2HFZA 3NGDA 1GT8A 1LOUA 4CO5A 1IBKJ 2K7KA 2LXIA 1WHVA 4NMLA 1N33J 2Z2MA 4RW8A 2YVSA 4ECUA 2C2KB 2HHTA 4D3GA 3K7RA 1JLQB 4IH6A 3IS9A 2HYIB 1RGVA 4IG0A 3TJAA 3KK2B 4CLWA 2FPHX 3A3NB 1HNIB 3Q86A 2C2ZB 4RW6B 1HQEB 4MH8A 1J5OA 2QIFA 3GR0A 3DOKB 1TUWA 4PUOA 1HBMA 2N3LA 3R3TA 1EX8A 2EKYA 1Y5IB 1GQEA 1PYOB 3U1NA 1BQMA 1WD6A 2FHJA 2VA3A 1KLNA 5JMNA 3PYGA 4HHHA 3RB3A 3FSXA 2C3MA 1UEKA 3IGVA 3D5MA 1F3VA 4NL5A 4G1IA 2Y1RI 4OYMA 4DSEA 4DMZA 5K8NA 5E0OA 4BWMA 2KM8C 4JP8A 1AUSL 4YR2A 1NXIA 3OQ2A 1F9FA 3BN7A 1U1OA 1BMQB 3EXCX 1NLKL 2AP6A 1RHUB 1TFWA 2M0GB 2R8GA 4F26A 3BGRB 4OX6A 4Z7CA 3R5AA 4L3NA 2DGQA 3BR8A 2C3PA 1REVB 4E2FB 3KLGA 3DDIA 2ZBPA 4E0DA 1SH2A 1I3OB 1MN7A 2PDAA 4ALZA 5F3TA 3DI6A 4AYBD 4K5SA 1NJWA 4NXNJ 3U1MA 1RZMA 2UU9J 1JLAB 5DS7A 4YFUA 2BW2A 5D78A 4QWDA 2NREA 5J2NB 1HWIA 2R9LA 2RU9A 3M4XA 3M2RA 1YKWA 4USVA 1HPZA 2K2PA 2BANA 2ZBRA 4HH0A 1PBUA 5EDWA 2LYVA 4YUDA 2R7QA 1TFYA 4PPDA 3DM2B 4IO9Q 4C8LA 1HMVA 1JWWA 1RCOB 4C0OC 4C0HA 2XM3A 1XMQF 1S0MA 4NEYA 1SUQB 2VG6A 3SQGA 1J5EJ 4CO4A 4CLLA 3UPFA 4ZPBA 4DV0J 2OLWA 2CWKA 1ROFA 1T9YA 1LWEB 2QE5A 2LP4A 1HLWA 2HBQB 1FDNA 1N32F 5D4LA 2HS0A 2E1RA 1SI9A 3ZC4A 3DLGA 4I6WA 2DO4A 4C11B 2IMWP 4GKJJ 4P7VA 2EWHA 2FVCA 3TX0A 2OGUA 5DG9A 3CJRA 4F3OA 2WBRA 2B6AB 3CGIA 2V4JB 2QL5B 5IOLA 3DKDA 3NP5A 3SYZA 2WSCC 1R8BA 3K5MA 4J37A 2O67A 3GQCA 1ZTTA 4YS2A 5HN0A 3FCHA 5DDOC 3AXMA 2UV8A 4YMEA 2BQRA 1KQGB 4YQWA 4WFNQ 2XLIA 2AJ0A 3NBPB 5KFYA 3N0VA 4WKRA 4MKVA 1JKHB 3T9NA 5HL7Q 2YQ3A 3SCIE 1W2IA 5GMDA 2OKQA 2BOAA 2ZWOA 2KHCA 2QJ3A 4B9SA 1EETA 5J1EA 4RW9A 2KFNA 3GV5B 4I0WA 5B0CA 5I3UB 4KHMA 3PRVA 5T41A 4ECVA 3OFGA 1N5YA 4YY3F 2V4QA 1LXJA 2BJDA 2CPFA 3M2UA 4EGLA 3DLHA 3P4UB 2RJZA 4DV5F 1V9OA 1PCAA 2KDOA 1UVLA 4I67A 3GFYA 3MEDB 2CNKB 2HIQA 4KBIA 3ENAA 4OHVA 4RUHA 2JFDA 2PMHA 7AT1B 3JS9A 4DUZJ 3GFZA 3RAQA 1YJVA 3V6JA 4GVBB 5E33A 2HBRB 1RISA 1WC5A 1VQNS 4WF9Q 3FBFA 3MMAB 1QAYA 2QSFA 2GA7A 2G0JA 4Y34A 4CCHA 3V4IB 1W26A 1YSJA 4WZQA 4O3QA 2UVWA 4DUYJ 1UFKA 2VZ9A 2MSSA 1BC6A 4DLEA 1OIAA 5AE2A 1GMWD 2DITA 4B9VA 4UW2A 4WFZA 3D6MB 3MPVA 1OSDA 2PN6A 1MSWD 2KRBA 3ITHA 4XPCA 2CPXA 5MAOA 4DV6J 4LR8A 2ZUGA 1GXUA 2RD5C 3BGRA 5KFVA 4UOGA 3TR5A 1Y4ZB 1Q8IA 2CPDA 1MW7A 3HSZA 3VGVA 9RUBA 3UNYA 1FFGB 2W8LA 3EZ5A 3HT3A 1VJQA 1MNEA 2ATLA 4B3MF 2G2OA 4LRFA 1RTHA 3RUBL 3AAWB 4QBUA 2OIHA 4X66J 2H5JB 2PFDA 4N5SA 3A3OB 1HNZF 3AJ1A 2MZSA 4HT7A 4NLDA 2FVSA 1PGZA 1X7VA 4U9RA 3R5JB 4NLTA 4URSA 3ISND 2OD6A 4A4JA 1E6YB 1C1CB 4EO6A 3TAMB 3QSYB 2QTWA 4ZCLA 4OZ3A 5GAHU 1X4CA 1H2UX 4LBHA 1UA0A 2MDAA 1FRLA 4U7UD 2JNJA 4ES1A 4JYAJ 4F36A 4F8RA 2RT3A 1Q95G 2F40A 1ZPWX 1K0VA 2YNGA 4P10A 2C2RA 3MMJA 4JI1J 1VQLS 1RWVB 3FMBA 3TI0A 1DJ0A 1DLOA 3HJVA 1NZAA 4DX8H 4FXDA 5L9NA 5BJRA 3TQEA 4ZPAA 3IP0A 4RW4B 1SCJB 1OJ4A 2XS2A 5KG6A 1JNRB 5LXYA 3CCUS 2DR9A 5KFNA 1B7FA 4A8KA 2QT7A 3TJ8A 5AJ3J 5EWFA 3CD7A 3O8WA 5H9EK 4DV1F 2A1BA 1RT4B 4LFBF 4F0HA 1JLBB 5MLCV 2ZFHA 2M9KA 3KG0A 3UVJA 1TKZB 1GX6A 2EC2A 1H0HB 4CYUB 2YPYA 3RW6A 1C0UA 4WFAQ 3K8WA 1CSJA 1RT7A 2JDJA 1KD1T 4NCGA 2F65A 1TV6A 2QMXA 1BWEA 2FJBB 4OYZA 4OJHA 3CB4A 1IVZA 1YQHA 1YJ9S 2NZ4A 4Y3CA 5A2QY 2QMWA 1N48A 1S59A 1SV5A 4IQXA 2WRMA 4CP5A 3TEGA 5DG7A 3SCJE 2VPYB 3I9ZA 2GHVC 1EKRA 2QL7B 4ZPTR 4WYWA 4UOCA 3G8QA 3OLBA 3S6EA 2ZH4A 3OW2R 1FD2A 2KN4A 3G71S 3T1YJ 2DCUB 4HHJA 1UMJA 3ZFVA 1WOPA 3M6VA 1EJ7L 4Q0BA 1MROB 2BBEA 4G1QB 3KLIA 3CJKA 1FO1A 1U8SA 4RBTA 1SQGA 1RAEB 2OTJS 4LF5F 4O0NA 1XR5A 5CHCB 1D3WA 4PYAA 1N88A 1Q8LA 2NLWA 4H4OB 4CM2A 3VTIA 2OPPA 1R6YA 2NXNA 1W7WA 3MCNA 4HR2A 3H0PA 2PT0A 4DR3F 4DWIA 2VG5A 1S10A 1JLEB 1CJVA 2KXNB 5K8OA 1KWMA 3B4MA 2XSJB 4RNNA 5KT4A 3UN2A 1YWXA 1D9DA 1C1BA 1RTZA 2ZD1A 1XC9A 1FI4A 3M9MB 5DDQC 1XBWA 1UWBA 3EGNA 3ZZUA 3W65A 1TKXB 1X9WA 5IQ6A 4X4QA 4C3KA 1HBOB 2F1FA 1R3NA 2M4MA 3S01A 3I96A 2WOMA 5GAGU 4KH1B 4Z7YA 1OQ6A 3PX0A 3N28A 4O3OA 2ATCB 1FJEB 1IBMF 4HEA9 3THPA 3R27A 2QYGA 1Z2LA 4P2MA 4X4SA 3SBMA 1HHTP 1MN9A 4DL3A 5H1SV 3GE9A 1VFJA 3AD9C 1U02A 2MGZB 2JEIA 3US5A 3T41A 1NDPA 2UXDF 4OZ2A 4WCEQ 1GEHA 4DSJA 4N8NA 2RHQB 4EUVA 4V19X 4DPUA 1WACA 2BXJA 2IM2A 2E1MC 3HKWA 3TANA 3MF5A 4AE5A 1G6BA 2RQCA 1RT5B 3NGUA 2P9CA 4PXBA 1VISA 2OUGA 3SCLE 3C6UA 2HFSA 4QIGA 3IBCB 4YHHF 4U95A 4G3IA 1TVRB 1VGYA 1TTHB 2UUWA 4PXEA 4WK3A 3U1LA 1VQSA 3BGLA 2HHQA 5IC6B 2PD1A 3A13A 5CAAA 4J9VA 2EK6A 2NSCA 1CBKA 1R8AA 4FF4A 4J7CA 5KFCA 1RA7A 4ZIVA 2C3YA 1URRA 1CG2A
chains in the Genus database with same CATH topology
1IKYB 5J2QA 2CJAA 4PWDA 2B4OA 1V3RA 4GKKF 1TL3A 3VWSA 4N8OA 4ATNA 1P6TA 2VH7A 4QJVA 4OI0A 5I4MA 5JVHQ 2CQCA 2XGPA 4OZ0A 2C2EA 1VBXA 3E01B 2DR8A 4NPOA 4K0KF 2M5YA 1Q4RA 3LH2S 5F8LA 2R7SA 3H5YA 3PRBA 4ICLB 2BABA 1DFDA 2GMHA 5KG0A 4OIXA 1B64A 4NCAA 1BQXA 2OPPB 5B0EA 3TYTA 5GAHI 1SJRA 2D3UA 2W4CA 3MPWA 4F4YA 3KNAA 5CA5A 2OAUA 1BLUA 1LK7A 4QPXA 3TARA 3R5CA 5SUHA 1GXTA 5AXNA 2Z8QA 3J7YU 2ZBCA 4G6VB 3RR8A 2VG5B 2AWZA 1K73T 3K8VA 4IQMA 2RQKA 1WG5A 1T02A 1NK7A 1JIHA 4DR4F 4GMKA 4RX6A 2I9SA 2WTFA 4A8QA 4EYIB 2ASLA 5D4NA 1FE4A 4TY8A 3HVWA 4XDDA 1CQMA 2CVIA 1RA6A 4JOUA 3PY8A 3QJPA 3M30B 3GFXA 3FJ2A 2RRBA 3HO1A 2POKA 1MMNA 1S99A 1M90T 2WCXA 4I4BA 5HO4A 4F2RA 5DM7Q 4ED5A 2U2FA 3F73A 3N4WA 4QW9A 1I6JA 1OQ3A 1C0TA 1HA1A 1C1BB 2BV3A 1ZM3A 2ZD1B 4KV8A 4WE1A 4B17A 1XMOF 3MPYA 1R0AB 3GIKA 5E3CA 1FEEA 3R1LA 3M1VA 1PILA 2R8KA 1XERA 4TNOA 2LXFA 1NRKA 3MEGA 3OL9A 3VZHA 3JAMY 1UVJA 3EXYA 1UWBB 4KGKA 2RMLA 4OZ5A 1X4BA 2RH3A 3OSNA 3UCGA 1JJHA 2W9CB 1UEVA 2XI2A 1S6PB 4ECXA 3OTDA 2JJ4D 2OPSB 2E9ZA 2LLZA 1P9QC 2YNIB 4DL7A 2X3GA 4WTYA 2FJEB 3FEYB 1FNOA 1RI7A 3FFIB 4F67A 3RTVA 4JV2A 1IBKF 1C4CA 4R25A 1TKTB 4LF4F 2RB7A 3IRXA 2WOMB 4RNFA 4ZCMA 3GV7B 3PKMA 3FZ2A 2FJAB 4CO3A 3CD5A 2R2RA 1E6VB 1N5VA 1R8CA 3ZZRA 5IM0B 5D3GB 1MWYA 1QAIA 2KFZA 5DG8A 4PXDA 1IKWA 2JVRA 3H5SA 4P7TA 2GGPA 3BSAA 4H4KC 4IO1A 4NLUA 2AYBA 4YB6A 1S0OA 4LIWA 4TU8A 1RTIA 2ZDPA 2R7WA 1V3SA 1HI0P 2GMLA 3KTQA 1VQ6S 1WNEA 2FJDB 4IOCQ 3QYYA 4NCBA 3HM9A 3VCDA 2R8JA 2ZE2B 1C2PA 5AE1A 2FY1A 1BY9A 4DQIA 3V4MA 3K58A 3IWNC 5J1NA 5KFQA 2MKCA 3BSCA 1T3OA 3MM5A 2JRSA 1DBDA 3M32A 2VFRA 1XNRF 2EW9A 4CQ1A 2GJIA 2YWEA 4TYBA 3L7PA 2XY6A 3GILA 2J76E 1U2FA 2DH8A 2J6SA 2HS4A 3I0RB 2E5IA 4XPEA 4RKUC 3PXGa 2EPIA 3CMAS 3H8YA 4JI4F 2GQCA 2FC8A 2HLTA 5U47A 1U2RA 1FKOB 5IXUA 2HWIA 1L3TA 3OTEA 1IKVB 2FLOA 4NYPA 2XMTA 3Q0AA 3OTBA 4ZP8A 3TRGA 3RB4A 1S0VA 1DTQA 4JI2F 2ALZA 2UXBF 3DRPA 3MMCB 1CQNA 4MKAA 1R89A 1VC6A 4DFKA 5IWAF 2XLJA 4F4WA 3NGKA 1VRTA 4MKYA 2VKZG 4Z37A 1VJWA 4PG8A 5JVGQ 5DDPC 3PJXA 1OPIA 5A8KB 3D2WA 1H7XA 5J2PA 1SQEA 3LP0A 2FUG9 1QE1B 5L1IA 2KRRA 3UW1A 1X8DA 3TAPA 1WF2A 3RB0A 1F0XA 1FESA 3I82A 1HBUA 2WB4A 3CE8A 4OX7A 2DGOA 3I55S 1T94A 4FXWA 3BQ2A 1AXQA 4A47A 3C6UB 3IG1B 2VBWA 2EBEA 3RW7A 1YGYA 4ID5A 1FD8A 2RDJA 4NOHA 5L1LA 4JV1A 3M2VA 2J6TA 2DRAA 1GTEA 4KHPF 3DC2A 1FRXA 2LCWA 4ZCKA 1DRZA 4EFAC 3KHLA 3DRYA 1UL3A 2JOQA 3R5BA 2E5JA 3MM6B 1SXLA 3G6YA 1HQUA 2DBBA 1WF0A 1Y9OA 4KFBB 1S9GA 3OV7A 2QZ8A 4HVZA 7FD1A 1S9EA 2VONA 2ZH5A 2W9BB 4Q7AA 2X1AA 4J9LA 2JEGA 4CT8A 3JYTA 1UFWA 2KT5A 3KK1A 2FVRA 1X0FA 4ZP6A 5E41A 1SL1A 4RW7A 2DR7A 5KT6A 3DCAA 2V2KA 1FTRA 3ONQA 2L48A 4ZPCA 1SKRA 2P9EA 4LT6A 1FRKA 2LEAA 3Q22A 3OXGA 4M5DB 4DL0C 2HMIA 4TN2A 5KFHA 4DG1A 3SEOA 1FKPA 5F8IA 1LXNA 3L7OA 3MEEA 5J2QB 3FEXB 3S1TA 4TQSA 4PWDB 4USJC 2B5JA 1U4BA 1TL3B 3SZ2A 2DO0A 1ZTWA 3NAIA 4OZLA 4Q44A 3LPYA 1DQ8A 1Q78A 4AL6A 4MYTA 2Q6BA 3MHYA 1V6HA 2AF6A 4DS4A 3M8RA 1NKBA 3BQ1A 5FDLA 2R4FA 4OMFG 3E51A 3CJ4A 5BYSA 5KFEA 4F4KA 4WK1A 1LV5A 1RP5A 2YH0A 5K14A 5CZVA 3Q2TC 5C24A 4WU2A 4C8NA 5J1PA 1L3UA 5E3PA 3SI8A 1YJWS 2VC1A 2UZAA 4R0EA 2A10A 4IRDA 4ZPVR 3DOMA 1S1WA 2M7SA 4O4GA 1U1QA 3HDSA 2X1BA 2ZH8A 1YJNS 5IS2A 3O44A 1TP7A 4NXNF 1FXRA 4X4TA 1Z4UA 4JI3F 2CQDA 2UU9F 4KKOA 2A18A 1T95A 2DD8S 4A8YA 2YKMA 4TY8B 5CYMA 3I4HX 4OI3A 5I3QA 2EI5A 2QYCA 2J7UA 2YWHA 1Q1KA 3OR2A 2LXUA 1KN6A 2CPEA 4R0JA 4Q43A 4ECYA 2J7WA 3PRDA 1X4DA 2ZJRQ 3DRRA 3M9NB 4M1KA 2CDQA 2PC6A 5M2PA 2OO4A 2M8DB 2EFOA 2JEJA 1C0TB 4WE1B 3QO9A 1P8GA 2RQMA 4AXIA 1OO0B 4PQAA 5HMYA 4K4WA 4L72B 3PW7A 3B8HA 1YTYA 2CPZA 3DHWC 5EN1A 3M1VB 1VQKS 2YWFA 4IRKA 4WIIA 3D0GE 1WEYA 4DQRA 3CIMA 3MEGB 3KJVA 3GG1A 3MDFA 2KZMA 4BC9A 3Q8QB 1GTHA 5DQIA 3LW5C 2EFPA 1U6BA 2CQ0A 1IQZA 1IJEB 4KJIA 3LALA 4QIWD 3FQKA 4DJBA 5LSRA 4H4KA 1NJZA 5EX3A 1J5EF 3CULA 2HG4A 4I6YA 4F3QA 3UD3P 1URNA 2G0CA 1YG0A 3VAIA 3TQ1A 2CFXA 3QGHA 1O5JA 4DV0F 5IT9Y 3IRXB 2QLXA 4ELTA 2QEXS 5JXSA 1HHSA 3MAQA 4DL2A 4CH7A 4FBTA 2F8HA 1ZM9A 3GWCA 3TO8A 1XEZA 1M5HA 3EGWB 3MR2A 2CQGA 2OMLA 1IKWB 2O3DA 1FK9A 5GADI 2HZCA 2GGPB 1NAQA 4OX9F 2R2TA 1U09A 3MD3A 5F8MA 1RTIB 1VRUA 4ZVGA 2J0QD 4JV0A 3T5KA 1LW0A 2K8GA 4MK9A 5E7OB 4YR0A 3QGIA 4GKJF 1Y5LB 2RSQA 4FPRA 2MKHA 4PXCA 4K4YA 2DNQA 3ZZZA 2E5LF 5DGBA 4G1PA 4OI6A 2HGNA 4OZNA 4DPOA 2C2DA 2BZ2A 2AJFE 2LQ5A 1Y3JA 5HMXA 2VL1A 2COLA 3D1HA 5CCLA 3MM5B 1DQ9A 4DEZA 4P6QA 1NKCA 5EUHA 2YTCA 3M32B 2O5DA 4CO1A 4X65F 2DGSA 4A8SA 5F0WA 4USIA 3F41A 2FGOA 2XULA 3WBZA 3G6ES 1D8YA 3E3XA 5E5NA 3MR6A 1KHWA 4PR6A 2ZH9A 1VQMS 4QQBA 5FIIA 2SXLA 4O44A 1X9SA 2HNDA 1LFPA 4V19J 1IKYA 3LAKA 1N5SA 2CJQA 4OI1A 2GO9A 2CIMA 2XGQA 3DRPB 3IAS9 4AUKA 1RJJA 4IG3A 3H2VE 4Q45A 1FRIA 3P5TL 4ECWA 1R43A 3UE2A 1KOHA 1XNQF 1VRTB 2B3TB 1UP1A 1DQAA 2QV6A 1VQ9S 2XMKA 3E01A 2ZNYA