1HE1C

Crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
176
structure length
176
Chain Sequence
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the Pseudomonas Aeruginosa Exos Toxin Downregulates Rac
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords EXOENZYME S
total genus 60
structure length 176
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he1C00
2QT1A 3TBKA 4RVCA 3OE7A 4TLCA 5FL7D 2FNAA 1WP9A 3OAAD 4MYUA 3RS7A 1U8YA 4DZZA 2XZLA 1HEIA 1E2PA 3AVPA 1Z3IX 1I2MA 3B8HA 2WBLC 2G77B 2FU5C 3RS3A 4UNRA 4QBGB 5AJVB 3K09C 1FMLA 1EG7A 1KK0A 4JLKA 1Z0JA 2JLWA 1XF9A 3RC8A 2H7VA 1P9RA 1E96A 4X8MA 4NP6A 4KYUA 4P4SA 3AKYA 4TQUS 1M34E 4DCSA 3AUYA 1IBRA 1IAQA 4H1UA 2F3TA 4IRUB 5FUWA 1N6RA 4NHOA 4TL9A 4TT3A 3UXMA 1S0UA 4UJ3A 3QKTA 3P4YA 3AKDA 2OV2A 1VPLA 4US1R 3U61B 4ESVA 2PCLA 3TW4A 1OFTA 2FEOA 5JRZA 3GPLA 2H5EA 3UMSA 2OAP1 3K9HA 4M9XA 5L3QA 3LW7A 4P4TA 2A78A 1LTQA 1MRSA 3SQWA 1XD8A 2ZRCA 2WSSA 4JVLA 3IEVA 1Q21A 1TEVA 3F0TA 1E9RA 1OXSC 2QL6A 1NIJA 2VHQA 2VP5A 4TMWA 1VTKA 1XJCA 3FWYA 2CK3A 4A9AA 4RKFA 2QA5A 1Z5ZA 4TYQA 1L8QA 1P9WA 2D2EA 1M8PA 2G0TA 1AIPA 2F9MA 2Z4SA 4BLPA 5LB2A 1MOZA 1KAOA 2FZLA 4Q7LA 2KBEA 4AG6A 1RPZA 3LXRA 4HLUC 3WNBA 1F2UA 1P9NA 3FKSD 4TTQA 1YKSA 3MAAC 3KFVA 5L3RA 4W5WA 5IT5A 3P32A 4DLTA 3I3SR 2AWNA 4C7OB 2QM7A 4IEIA 4M1OA 1VDZA 1XEWX 3SS8A 4XWOA 2V3CC 2PMDA 4KHZA 2X8AA 4PQYA 3SJBA 3B5JA 4BEJA 2JJ1D 5J4KA 3SC3A 3NIBA 1KI4A 4BFWA 3PQCA 5JFGA 3IUYA 1YZTA 2FJUA 4P33A 4LYJA 5FFMA 5E4FA 2H16A 2FH5B 4LPKA 2KSQA 2R9VA 1F60A 1ZJ6A 4LUCA 4DLXA 4ZCLA 2YOFA 3UWKA 2JLYA 5TARA 3BB1A 1CEEA 2ZRHA 2J45A 5FOXA 1SVSA 1TL7C 3IQWA 3FMPB 4B35A 3TUIC 4ZCMA 4B3DA 3PJRA 2XXAB 1KI6B 4L8GA 4QC2A 3BFXA 1JJVA 2J1LA 4BLQA 621PA 2VP2A 3KJIA 3ZLJA 2IYWA 1YJ5A 4M1YA 2QP9X 4JMPA 4OK6A 4DJTA 3H84A 3VTKA 2A5YB 3PEVA 4DCTA 1RRCA 4GOJA 3W3AA 3ZH9B 2WMNB 1II9A 4KFSA 4MKHA 5AWFC 2H8KA 3V4FA 2GTPA 4ERNA 5E7MA 1ZW6A 3WMFA 3LVRE 3SE0A 1E1QD 4Q9KA 3TVTA 4P0TA 1E0JA 1SXJD 4QGHA 2F6RA 4QHSA 5TVKA 1C1YA 2IA5A 1ZNZA 1WRBA 1CJTC 1GTVA 1GKYA 2VHCA 4TL7A 1CKEA 5F3WB 1DO2A 2ZR0A 3AM1A 4LBWA 2R44A 2VP9A 4ZO4A 2ODWA 4B74A 4JVSB 1SVOA 1EFCA 3B6EA 5FOSA 4IDHA 4OQNA 3AVQA 4A0FA 1KI7A 3U44B 3B60A 2R6CA 5JWOA 1HE8B 3ECCA 3B2EA 4FXPA 3NG1A 5BWMA 2FSIA 1YRBA 4GP6A 5FI0B 1TAGA 1Z2AA 3IHWA 2TMKA 1XCPA 4PHTA 4XVUA 3QF4A 3VNUA 4JLAA 2YOGA 3X1YA 3KQNA 2P6RA 2AX4A 2WZQA 2WWFA 4E5UA 3IQXA 3C5HA 4LJ8A 4MGYR 4CT4B 5JJIA 1GRNA 2G1JA 2X19A 1E2KA 3C5CA 4AKIA 2JIZD 2BJVA 2GJAA 3QKRB 4YDHB 2BOVA 2ZE6A 3GD7A 4HZIA 3MJRA 1YR8A 1T5LA 2RAPA 3K70C 1PUJA 2OBMA 3PG5A 1GNRA 4XH9B 2J87A 3SFZA 1KI3A 1V5WA 1UBCA 1KY3A 1GDDA 3VR4A 3CB4A 2Q3HA 5K8IA 4D0GA 2VTKA 1J2JA 2DHRA 4JLVA 3UANA 2FZ4A 2E9SA 2GJ8A 4RD0A 4RKEA 5FOUA 2J0VA 5FPTA 3WY9A 2YWGA 4AWXA 1TNDA 1DG3A 1W0KD 1JNYA 1UADA 2C9CA 4A8JA 5D3MB 2SHKA 1ZD8A 3GLIE 5CDFA 1JEEA 4O0MA 2WMOB 3RNLA 2HCBA 1XEXB 4BE7B 4IFEA 3IDQA 1TUEA 1Z07A 2NPIA 2GESA 1ZRHA 4PPQA 5AJYA 2GJKA 4JVMA 1BMFD 2WICA 1CJUC 4HLUA 3V00A 4PAQA 1CP2A 2FSGA 3B1ZA 3EXAA 5G53C 5DNYB 2ZJ2A 1L2TA 5KSZA 1KDTA 4Q9HA 2NG1A 5CB6A 5CITA 2FEMA 1NKSA 5FTNA 2EWWA 2O8EA 4MKFA 2B8WA 3EC2A 2C78A 4WXRA 1E32A 1KSFX 4FW9A 2WJGA 1R0XA 3PEWA 5AJXA 4HI0E 4OK3A 2QBYB 4TYWA 1ZCAA 3KUCA 4HAZA 4IDQA 3MWJA 2IS4A 3V9PA 3BOSA 4UNQA 5G3ZA 2Z5FA 2OBLA 5JI2E 1A7JA 1XBTA 4BLOA 2ZU6A 3FGNA 3V4RA 2JA1A 1M1YE 2XTNA 1J8MF 2DFLA 4EDHA 4GL2A 3L0SA 3OIYA 4GZMA 1RE0A 3UATA 3THWA 1P6XA 3OFND 2ORVA 3EAQA 3RRNA 1US8B 1WE2A 1XFAA 5KDOA 1XU4A 1G7RA 2P5SA 3S1AA 3WXMA 5DYGA 4ZI2A 1YRAA 4KJZA 1XEXA 1ETUA 4B6EA 3U7FB 1SXJA 1XTKA 4JKIA 1XXHA 4URYR 3E5HA 721PA 3QPUA 3X1DA 3CRVA 3F3YA 1W2HA 1A4RA 2YYZA 3X1ZA 4P3YA 2BMFA 2GAAA 1BH2A 4URXR 4JYCA 5BYKA 4PC6A 4B75A 1G16A 1T4GA 1GRQA 2AXNA 2WJVA 3CNNA 3VHXA 3L8ZA 1J7KA 2C98A 5EP1A 3EZ2A 3TK1A 1HQCA 3NHBA 3FMOB 2CNWD 2XNDD 2OCPA 2PBRA 4GOXA 1H8HD 4G5OA 2OLJA 2YNMA 2V7QD 1UM8A 1MO6A 4XWAA 3K9GA 2Y8EA 1ZU5A 3U7HB 3BAFA 5A0FA 5UKDA 4Q4HA 5EP2A 4BRUA 2RGBA 3W5IA 4TT3D 3NHAA 3D6TB 1Z63A 5FUXA 1OLOA 3HYTA 3SYKA 1COWD 1T0HB 1XMIA 4Q9LA 3W5JA 1C9KA 4EFLA 4TLBA 1CF4A 1E2DA 1TQDA 1NNEA 2WSMA 2LKDA 4MRRA 3DOEA 1KDOA 4PPNA 1NVVR 3QXCA 1E9AA 1R0ZA 3GEHA 2PJRA 4TLAA 4Q1DA 5KPJA 4C7OA 4P4SB 4PHFA 4PPFA 1DARA 4GZLA 4M0LA 4D0LB 3GFTA 4MA4A 4NYMQ 5J5CA 4DDTA 1OE0A 3LAWA 3RVBA 5JHHB 2GK6A 3QI2A 4A6XA 1XJ0A 1Q22A 5E3HA 4LHZA 3W8RA 4C2UA 3M0EA 2ERXA 3ND8A 1FQJA 2IYUA 4OQLA 1H8ED 4DEYA 1DELA 2RGNA 5J4VA 1YZLA 1ZC3A 2V1XA 4K46A 2ZYUX 1LNZA 1MO4A 4IOKA 1YE8A 1LS6A 1IXRC 1GL6A 1TX4B 2VHJA 2ZJ5A 3CRRA 3BRWD 4RSGA 3WMEA 1XCGB 1KDPA 4DSNA 2ERYA 1W0JD 3CPJB 2QY9A 3HPRA 1F5NA 1E6CA 1JI0A 1G64A 3LY5A 4WW0A 1Z0DA 3GJ3A 3OAAA 4A82A 3E2IA 2OAQ1 3K0SA 4HLDA 5FR1A 1NLFA 5DHFA 4AC9A 1YR6A 1JR6A 2X2EA 3NEJA 4KU4A 4QGFA 4D6PA 1SQ5A 2IUUA 3MUFA 4M1WA 2WJYA 3GLHA 1FMJA 3IBYA 3QKSB 3RLFA 2XJ9A 1XCMA 3HP1A 1CULC 1UF9A 1Z6GA 3AF4A 4DB4A 2WAYA 1G41A 3SHFA 2R65A 2F1HA 1T0JB 4RZ3A 2QBYA 5HCNA 2CJWA 2HDNB 4A0GA 2GNOA 2IL1A 5AUOB 4AKHA 2GILA 4BFVA 4RCZA 4DVGA 1AA9A 1EFRA 3T34A 3UMRA 4R2IA 3HDTA 1P60A 2QUZA 1X8LA 1NF3A 1QRAA 4EUNA 3Q5DA 2BWJA 3DMDA 2V55B 3U7GA 4IVRA 3B1WA 4C9BA 4NH0A 1OH6A 5KU1A 1W4AA 1LFDB 4Z51A 2A3RA 1KI6A 2GHIA 2F3RA 2W00A 5CIQA 5FOVA 521PA 2B8TA 3ZJYA 2ZJAA 4DDUA 3U7EB 2ZSDA 4WOPA 2ZSFA 1U90A 1GL7A 1SKQA 1ZM3A 3CKLA 5HZKA 3HJNA 2ORWA 3PUWA 3B78A 1R4AA 1KJZA 2B7BA 4JKYA 3TNFA 1T8TA 3H4MA 3EARA 3OIUA 3AB3A 4Q7KA 1DAGA 4G0NA 2QAGC 2D74A 2R62A 3EZ9A 3RS2A 3T61A 5L3VA 3ZS9A 4LYAA 3CPEA 3QOFA 2E87A 4LHWA 4LJ5A 1N6LA 1G4AE 2OUKA 4R9UC 1WA5A 2J5XA 4XIGS 3VFDA 3TUJC 4B47A 3LW8A 4TTPA 4W5HA 3RANA 2DFNA 1NVWQ 1YR9A 3R7WB 4AKEA 3IO3A 4B32A 2C03A 2ZJOA 2NO1A 2Z43A 4BFTA 2CL7X 2GBLA 2QM8A 2PCJA 4Q9IA 3MWYW 1G20E 4PO9A 3EASA 5HE9A 2JLQA 3SR0A 4G3XA 3RS0A 3LA6A 4XJXA 2EYQA 3U3KA 1GP2A 4D4LA 3AUXA 4I4LA 1W36C 1EFUA 3KB2A 2IS6A 3U4QB 5M04A 1M7GA 5B57C 3PITA 2NO6A 2QN6A 5K8TA 2F1JA 1ZVQA 3IGFA 2OCYC 3LBHA 2ONJA 1DAFA 3CR7A 5EE0A 1KO1A 4MRPA 3K0AB 1PLJA 5AK0A 3TLXA 1QHYA 1OT3A 1KMHB 3A4LA 2WPDA 4O3MA 5H1YA 2ONKA 1UPTA 1OYYA 4L9WA 3A58B 3ZD7A 1RVDA 2O8EB 1CR1A 2PZEA 4OHWA 2D2FA 4DLSA 3BC1A 2RMKA 5C18A 3ZVMA 1T3HA 1NG1A 1UBEA 2QPAA 3R8CA 2CCGA 5FPKA 2GJSA 4CIDA 5JLJA 2JLRA 1VIYA 4Q4JB 1OIVA 3QKRA 4NCJA 2EFGA 3IKJA 3AF1A 4C3ZA 5J40A 4E03A 1H8EA 3C4JA 4RJLA 4B71A 2IF0A 4MQBA 1ZNYA 2ZQ5A 4MKGA 1JQLB 4DDVA 2ZS7A 4RD1A 2QORA 2QAJA 2DFKB 1EWQA 1CRPA 4BFYA 5JHGB 4DSUA 2V4ZA 1GZSA 3CIOA 3BK7A 2VA8A 4Q02A 5SZIA 4GSYA 4C30A 3PUZA 4KCGA 3EA0A 4A8JC 1Q20A 3KKOA 3P20A 2I4IA 4A1FA 4PX9A 4DHEA 2YC2C 4PSVA 4AI6A 2G0NA 3E1SA 3VMFA 2DWPA 3KKQA 3H0KA 3KKPA 3Q7PA 4R98A 3DM9B 4DLWA 5FUVA 2ZRKA 1KI9A 3N70A 3U3MA 1W0KA 4PC7A 1P75A 3CO5A 4EPVA 2PT7A 1D5CA 1RKBA 2DWQA 1Q1BA 4NYIQ 3SBEA 4B2PA 1I4DD 4MYCA 1E3MA 2FFBA 1XX6A 2IW3A 5GVSA 1IM2A 3KQHA 4LI0A 1Z6AA 5DHAA 4TSFA 2IYQA 3ZZTA 1IXSB 2GRJA 3W8NA 4NYJQ 1CR4A 1TU3A 4Q7JB 4WXPA 3LD9A 4AURA 4IXNA 3KJGA 3WYAA 3ICEA 4RFSA 3QSYA 2D4HA 2JLXA 1XPRA 2ZRJA 3LLUA 4DT1A 4GMXA 1FNMA 1Z83A 2IYTA 4EPYA 4DLZA 4OBEA 2A2ZA 3NBYC 1NSFA 1S96A 4GNKA 4HUQB 2CEAA 2W0MA 2X77A 4B44A 5J47A 2AHOA 4YMSA 1RC8A 3RS5A 4EKDA 4IDPA 1HUQA 2ZE8A 3NDBB 4XSHA 1M2OB 3WNCA 3OF5A 3U3JA 3W34A 5IHPA 2J7KA 3WP0A 5JEDA 1XZPA 2DBYA 1NVXQ 3MWLA 2IXGA 1G17A 4BZQA 5HTKA 1II8B 3FVQA 2RHMA 2WKRA 2BCJQ 2RGAA 3RYTC 2BMEA 1NL3A 2VBCA 4B3BA 1E79D 2LKCA 3P1JA 1L4UA 4OK5A 3SEAA 2EWVA 2YZ2A 4B6FA 1I4TD 4PZLA 3CX7A 2R6AA 4BLRA 1ZUIA 1MO3A 1S1MA 2WKQA 1W47A 4ESHA 3A4NA 4JLMA 2PH1A 4C4PA 2BM0A 5FUYA 4BWYA 5D3QA 3ICQB 1YHNA 4LSGA 3AGQA 1NJGA 2QP3A 4DCVA 2J59A 3DEFA 2PEYA 2AD1A 5JSZB 1NBMA 4YXWA 4CZ2A 5DI9A 1NKTA 3NEYA 4LC1A 3DZDA 5KNCA 2IHYA 2HYDA 3I8SA 1HQYE 1Q1ZA 5BN5A 4BPBA 4OJQA 2Z6VA 4BLSA 2QQEA 2HCJB 2QTHA 3MJHA 2NO7A 3GEEA 3VKHA 1Z28A 5BN4A 3VQTA 1KKLA 4AYWA 3U60B 4MYHA 3R9WA 3UG6A 2YVUA 1FTNA 1EK0A 1ZBDA 2AN9A 2IYXA 2OFXA 4N3NA 4NPHA 4GI7A 2W58A 2JJ2A 1CIPA 1KO8A 1FW6A 4A0HA 2HUPA 2AD5A 3HU3A 2GXAA 2QQ0A 6Q21A 4NZYA 2GEUA 2RGNC 4KVGA 1G3RA 4PZYA 1JECA 3PIRA 2ZRIA 2JATA 1E9EA 4TLEA 2QGZA 2ODNA 3LVQE 4NYJR 4PTLA 2AL7A 4KITB 1VG8A 3QE0A 4NL4H 3X2SA 5EJEA 1RZ3A 3T06B 2CLCX 2F9LA 4V03A 3CX6A 1Q3HA 3FKSA 2AK3A 3QXJA 1X1SA 1YZNA 1OSNA 2R6FA 2OCAA 2A5FA 4W5JA 4LBZA 1SVLA 3A37A 2ZRBA 3L82B 4M1TA 3SN6A 4QKQA 2R6DA 4PPGA 4US0R 2G1KA 5FTMA 1DAEA 4AK9A 2BHRA 2NO9A 1QBKC 2JJ1A 3BGWA 3AVTA 1DADA 1KJYA 4Y0VA 1XMSA 4Q18A 4WAUA 1FPMA 5KPDA 3N2EA 5EXTA 3RWOA 4ARZA 3KXKA 2IUSA 1R5BA 1TEXA 3CRMA 1S2MA 2Q3FA 5CJPA 1IQPA 1UEIA 3BBPA 4C0SA 2WOJA 5HZHA 3GP8A 2I3BA 3CNLA 2O0HA 3FTQA 1OKKD 2KB0A 3CONA 5FPHA 4EIWA 2VQSA 1X86B 2ZJZA 1KMHA 4IHQA 1NIPA 1DG1G 2HXSA 4DSOA 2PJZA 4TMKA 2JIZA 1CS4C 1AM4D 4IDNA 1PVOA 821PA 3B82A 2CXXA 3EPKA 1RFLA 4URWR 4ABYA 2GK7A 3LRPA 4K8OA 5FL3A 3QVUA 1R0YA 2ZRMA 4MUAA 3T35A 4NKRA 1GNPA 1AS2A 1W0JA 2VP4A 3AVOA 3RHFA 2ZR9A 1NI3A 1M74A 2ZREA 1P7CA 4PO1A 5IF9A 1XD9A 1OXVA 3AP1A 2XXAA 3FMFA 1TQ4A 1AGPA 4OYHA 1W36B 1MO5A 1O3YA 2D7DA 5K8LA 2IYRA 1N3BA 3MRSA 1VMAA 4AIIA 1NN5A 4BLTA 2VSXA 2FX3A 2HLDA 1FTSA 4OHZA 2QG6A 4ASUD 3EWSA 3A1WA 2I1VB 2GBLC 3B9QA 2YV5A 5LBIA 3FHTA 1BMFA 1KK2A 4HZUB 3GCGA 1Z6XA 4XTCS 3K53A 4JSTA 3BD9A 2R2AA 1E2FA 3FFAA 421PA 1ZP6A 2HJVA 3P4XA 4M4SA 5CDFE 1U98A 1ZM7A 4Q48A 2REXB 2FSHA 4EFNA 1CU1A 1VECA 1W5SA 1X8KA 3GJXC 3GLFB 2ZI3A 4HATA 4QNMA 3TH5A 4ACAA 4IDOA 5BW8A 2OFOA 1G3MA 3T1TA 3WBJA 3A4MA 3GFOA 4V0KA 4TMTA 1NG9A 4MRVA 2PLRA 1US8A 1U0JA 3MG9A 2VHUA 3TE6A 3U2QA 2Q9AA 4TN1A 4F91B 221PA 3NKVA 1FOEB 4FINA 1XP8A 1E69A 3PEUA 1OPXA 2GZDA 2ZSBA 1U0LA 3KX2A 4TYYA 1OW3B 3ZS8A 2EVWX 4AKGA 1K5DA 3AKCA 2C8VA 1TMKA 1S1CA 3L0OA 3WMGA 1NVVQ 3Q85A 3BE4A 4NONA 3K9LA 1EX6A 4UJ5A 4A6PA 4FN5A 1E1QA 1FP6A 1VYUA 4U7DA 4YQFA 4LV6A 1RJ9B 1E98A 4PHGA 4Z8XA 3GJ4A 1E0AA 3SFVA 3AV0B 1PUIA 2WWWA 1Z2CA 3LLMA 1G8GA 1KO4A 4IW3B 3QKUA 3U3OA 4PAOA 4O2RA 2HJGA 1SXJC 1EXMA 4HZUA 2XX3A 2ZI7A 1W4RA 4D4MA 1A2BA 1GVNB 3VKGA 2NOAA 2XITA 3KQLA 2D62A 4PAMA 2BV3A 4KBFA 4DKXA 2P6UA 2CBZA 3QBVA 4L4UA 5C46F 2ZRFA 3EIQA 4EAQA 4B33A 1AQYA 3RSLA 1W2GA 3O8BA 5EE9A 2YHSA 5TV2A 1S4QA 2QE7A 2P6NA 4JBXA 5EE3A 3VR1A 3FHCB 3BWDD 4FCWA 4F92B 2C9YA 4ZIRB 3AP3A 1LV7A 1FX0A 2HV8A 5HE8A 5KNBA 1UDXA 3L2OB 3DVLA 2VLIA 3W3ZB 1OFHA 2CHQA 3LFUA 3L8YA 4V0LA 4LZZA 3ZIAA 1RIFA 4FI3C 1QVRA 4EPTA 2Q6TA 3E70C 3RSOA 2Q0HA 1VG0B 4EPXA 2WPDD 4MKIA 2PLFA 4H9GA 1K6MA 4EQ6B 5EZ6B 5KHOC 1ZAKA 5A5GA 3FE2A 4B3GA 3QVVA 1ESMA 4QBHA 3KQUA 2IS2A 1BYUA 2W0SA 3SOPA 4JBWA 5BXQC 2I1QA 4JL8A 2VP6A 1AKYA 1XJQA 4FMCF 4ZDJA 2WTUA 3EIEA 2B21A 2BEJA 2O8BA 1GAJA 5GADl 2ZJ8A 2JDID 1KI1A 3I92A 5HCIA 4CW7A 4OJKA 2CVHA 4PC2A 1NRJB 3X1XA 3PCRB 3BS4A 1SGWA 4RFSB 2CE7A 3FMIA 4TLDA 1OH5A 1G1MA 3OESA 1XXHB 2O8DB 3CZQA 5DN6D 1QDEA 2IWHA 1EWRA 3WYGA 4Q19A 5LB4A 2GZHA 1XNJA 5C1BA 1NN1A 3QPWA 5LD2B 4MH0R 2PZFA 1W5TA 1FUUA 2QRZA 4Q1BA 2P5TB 1HURA 1P2VA 4O2LA 3SZRA 1G5RA 1OXTA 2ODEA 4KBGA 2O5VA 5DI3A 2VEDA 5DLQC 2NMVA 2QT0A 1AKEA 3TIFA 3CRW1 1HT2E 3ZQJA 4DUGD 4FWTA 1AQUA 3SJZA 3G0HA 1G4UR 3J81k 1G8FA 3GJ5A 3AGPA 1T3LA 3Q9LA 2ZI9A 3ASYA 2L0XA 4L15A 3BFKA 2RGDA 3TGPA 5B30A 1E4VA 4LDJA 3NXSA 1H8HA 1N6KA 2HXYA 2BBSA 4QL3A 4XOIA 4Q47A 3W9YA 4NCHA 1E9CA 2J0UA 5BYJA 2NPFA 1QHGA 5ELXA 3QXSA 3R20A 4P31A 2JLSA 4ZCIA 2ODBA 2GCNA 4XSGA 4LPSA 3THYA 2IXFA 2JDIA 2XSZA 2EW1A 3PUXA 2WWXA 1D2MA 2JJ2D 1WB9A 2ZIAA 4DRZA 1OKKA 2YJTD 4G1UC 1GFIA 4HLQB 1G3QA 3JZAA 1XXHE 2IK8A 2ZRDA 4AD8A 4JJZA 3EW9A 2QPOA 4HLCA 2KE5A 1DE0A 2ZITA 2ZRGA 4Q4AA 3I5YA 1G6OA 4DLYA 1ESNA 5FI1B 4DCUA 5CYPA 4U5XA 1CRQA 1U9IA 1VYTA 2QENA 3T12A 5L3SB 2A30A 1HE1C 5EXSA 3AF0A 1JR3E 2NO0A 4I81A 3HR8A 2OLKA 3THWB 2HYIC 2NZJA 4B48A 1KKMA 4RZ2A 1XPOA 3U3RA 3T1OA 3CNOA 1E0SA 3KDSE 4UXJA 2FPKA 4FWIB 3OEED 4ZIRA 2QP4A 1A1VA 3ZGXA 1P62B 3N5CA 1M6NA 4RD6A 3BB4A 1KMQA 2GXQA 2BM1A 1NP6A 4JVNA 4GBMA 4P32A 3UPUA 4XTRA 2VSOA 3FYHA 2BC9A 3DDCA 3TMKA 2OCBA 2BBOA 1XWIA 4FIDA 2WIAA 2NQ2C 2ZTSA 4QHYA 4CRWB 2MSDB 1E1RD 2WOOA 3TAUA 4N0EA 4K81B 2QPTA 1ZD1A 2W2XA 4JL5A 4NU0A 5L8VA 3NH9A 2DY1A 1P2UA 2AKYA 3GJ0A 4BECA 1TF5A 2W2VA 1WXQA 1ODFA 1P72A 4QGGA 5C4GB 2O8FB 4MYTA 3EZ6A 4LRWA 1AJEA 1Z0FA 4C0BA 1CXZA 4V0OA 3SJAA 1T3SA 4LYHA 4CEJB 4PSAA 3AVYA 2BDTA 2GZAA 1KO5A 2E1RA 2OHFA 4PZZA 1H65A 2VYFA 2BBTA 3MWKA 4JIMA 4Q4AB 2REBA 2ZANA 3GLIA 2ZUCA 3DKVA 3QJYA 3VX4A 1G8PA 2H17A 5JS8A 2ZVQX 1SVKA 3LV8A 5SZJA 4G5GA 1R5OA 2F55A 1CTQA 4I1SA 3RS4A 3ZD6A 1QHSA 1FL9A 5AJWA 5KSOA 3M4YA 2WIBA 5TMPA 1NLZA 4U00A 3ADKA 3TKLA 3VR2A 2VH5R 3X1WA 1PLLA 4R71A 1RRPA 2LWIA 4IOMA 2IYYA 1DTSA 2ZETA 1U81A 5EZ5A 1Z6TA 2O8FA 1GIAA 2GEDA 3ZVRA 1JPJA 4IJMA 1HYQA 4TWZA 4Q9JA 2BMDA 1DVRA 1Q3TA 1Q57A 2FGKA 5JMTA 1XMVA 3TRFA 1KTVA 2OESA 4HAXA 2FFHA 1AS0A 1WMSA 4UXIA 3R8FA 4E22A 1MABA 3TQCA 1XEWY 2BIFA 1KNQA 4QBFA 1Q44A 2FA9A 2G3YA 2AK2A 4LHYA 2WWYA 2RKOA 2ZAOA 4Z8YA 1AZTA 1Z0IA 5DH9A 1DS6A 2N1BA 3NBZC 1LF5A 1EFRD 1ZC4A 3EPLA 4F4IA 4ZPXA 2QGNA 3TR5A 4NYIR 2DWOA 2LCFA 1OJLA 5CIWA 5AUNB 4Q1AA 4HAUA 5GVRA 4M53A 4MUBA 3K0EA 2VIIA 4PC3A 3RABA 1ZU4A 1Z47A 4HUTA 2JASA 2QI9C 1Z0KA 3I72A 5TDHA 3PVSA 3W90A 4B2IA 4TYPA 1AS3A 4EQ6A 5JBQA 3K0FB 1YQTA 3OZXA 2WJJA 1L7VC 4ZI3A 1JBKA 3AP2A 3K0CC 3KKMA 2AFHE 2ZI6A 1OYWA 2REOA 4NDZA 1HA3A 1OH8A 3EX7C 2O0JA 4LOAA 3CZPA 4MGKR 3PXGA 4YMUA 1IN5A 4KLZA 5DN6A 2HT6A 2QMEA 1EX7A 4WZAE 5D3MA 2ZRAA 4XWKA 4Q4HB 3WHKA 2H1LA 2CDNA 4M1KA 2CLDX 4U02A 1KGDA 1E0KA 3KL4A 4JLDA 1TTTA 4LJAA 1WQ1R 2JAQA 4ASUA 4FMDF 2HLDD 2ZS9A 3OEHD 1OB2A 3TVDA 2QMUA 1J99A 5FBQB 3SYNA 4QM6A 1RYFA 2RGEA 2ZYTX 3MGCA 3G82C 4KFRA 2C9OA 1ZM4A 4C2TA 1MT0A 1YR7A 1IJFA 1U99A 4FCVA 3GLGE 5J4YA 4AY2A 4M9QA 1TADA 3BJIC 4Z1MD 3A8TA 1PZNA 4GP7A 3SBDA 5F98A 4TQAA 1W4CA 3LX8A 1COWA 3RRMA 1IN6A 3FFBA 4DT1B 1CJVC 1N0WA 1LF0A 1QZXA 3DM5A 4GOKA 1YVDA 4XVRA 4CVNA 3ZVNA 1HH4A 1ZD9A 1UKVY 3LQRA 4TMVA 1KI2A 4D80A 1Q1EA 2J41A 2W6JD 4HUQA 4YLGA 2ZYWX 1D2NA 1UKYA 1KY2A 2GCOA 1KSJA 4TZ6A 3GJ7A 1KI8A 2ANBA 3LH5A 3Q5EA 1G3UA 1GOTA 4G01B 4JL6A 3TSWA 4HAYA 1ANKA 1NMXA 1UDWA 2ZE7A 2MSCB 4J0QA 2IC5A 1NY6A 2NTYC 3NC1C 4WZ6A 2QROA 2OE2A 1O87A 3LBIA 1W4BA 4HAWA 4WZBE 4WVFA 4AYXA 1R6BX 4KFUA 5LDDC 1JR3A 4NMMA 4O25A 4FMCB 4C0LA 2FGJA 2ZAMA 4ARZB 1IONA 1Z0AA 2CK3D 4CT5A 3GLGA 3BH0A 3OEHA 4PXAA 3CW2A 3ADDA 1E9BA 5G41A 3WRXC 2MMGA 1JALA 1E2MA 5L3QB 5F9FA 2ZE5A 1EESA 2Q3MA 3QQ5A 2H92A 2XB2A 2IHBA 5IRCD 4OHVA 1OF1A 2ATVA 2ZRPA 2V6IA 5EE5B 4DIDA 2BJWA 1E9DA 4ZDIA 3B1XA 3EWAA 4I1UA 2BKUA 4PSKA 2QTFA 3W6PA 1CR0A 4V0MA 1ZNXA 2OBNA 3CUEF 3IIJA 4QHTA 4QOSA 3AF3A 2ZM5A 1UJ2A 1KHTA 2ECKA 3QEOA 5B64A 1G9XA 1N5LA 4XVQA 3WYFA 1A82A 1E2NA 2OXCA 4A2WA 4QFMA 2EFHB 3QXXA 3TAHA 5H70A 3NH6A 4LJ9A 3PEYA 2OG2A 5DE3A 3SU8A 2PL3A 2WWGA 4OQFA 3BXZA 4Q01A 4DBLC 1G8YA 5E7JA 2NGRA 5HR5A 1XPUA 3S1AB 2EYUA 1FZQA 4YDSA 1VHLA 2FN4A 4Q21A 1XD2B 1YZKA 2CVFA 4IFBA 3D31A 4CEJA 3KXIA 2PEZA 5J4HA 5JCPA 4PFSA 3BH6A 3DKPA 4LX0A 4JS0A 3GJ8A 1R8SA 2UVQA 1ZCBA 1VYVA 4NCIA 4FMBB 1M7BA 1ZNWA 1Q1QA 2JEOA 3TQFA 5JJKA 4NBSA 3DMNA 1B0UA 5FTJA 4KVAA 1W49A 3LNCA 4URVR 3SI7A 5IK2A 1PV4A 3B1VA 1NLYA 4YMWA 1VG1A 1E2IA 4LY6A 2RHDA 1W44A 1E2HA 5EP4A 2YWHA 4Q7MB 3NVAA 1G5TA 3D8BA 3DL0A 5KO2A 1SKYE 1R8QA 2MSEB 4M22A 1N25A 3NC0C 4QXAA 5IK2D 2FPMA 1F48A 1QG4A 1N5IA 2EFDB 2Z4RA 4PQFA 1IN7A 1LW7A 5JEEA 4UNSA 2UZIR 3PFIA 3U6KA 3B7GA 1XD2A 3EG5A 4S35A 4D25A 3ONWA 4RY2A 1NN3A 5J4LA 4D82A 4LC0A 3ZZ0A 2ZRNA 2RGGA 5CM8B 5DO9A 1J8YF 3I73A 2GAOA 4DCNA 4B3XA 1R10A 2ZXUA 2X1VA 4ZKEA 3CPHA 4HSEA 4HB0A 3T5GA 1J90A 4MITA 2QMOA 1P2SA 4POAA 2VSFA 2ZUDA 2DPXA 3SHWA 1K5GA 1YU9A 2IYVA 1XZQA 1XTIA 3NBFA 3QNUA 4WA7A 5B2ZA 1NVUQ 4URZR 3ZZUA 2BCGY 2IYSA 2OT3B 4E07A 5JJLA 3Q7QA 3KUDA 3C41J 4MRNA 2OFWA 4PHHA 2B6HA 5FR2A 5JCZA 1N2CE 1M7HA 3MSXA 5FOTA 3REGA 4LGMA 1TQ6A 1UEJA 1DAKA 4HB3A 1QF9A 1P61B 1V43A 2FPLA 1GSIA 4HB4A 1QVAA 2XZOA 1FNNA 1SXJE 2B7CA 2BKEA 2DYKA 1DPFA 3JVUA 4JSYA 1JR3D 1P73A 2P3SA 4OI2A 3IPYA 4A0RA 4TTRA 4MDEA 2CHGA 4M1SA 3OE7D 4HDCA 3ZDQA 3B1YA 5JI3E 1SXJB 3EA5A 3KJEA 3EIHA 3QF7A 4E09A 1XEFA 3SDZA 4ZDKA 1CR2A 4OHYA 4DLUA 3DHWC 3CF6R 5BQ5A 2FFQA 2R6GA 3VKWA 1KK1A 2ZSEA 1KJWA 4F7WA 1VCIA 3GLFA 2WWHA 3PR1A 2W83A 1N0VC 1IJEA 2JLUA 1Z6YA 1UFQA 3A1UA 3UMFA 5KYKA 1KOFA 2FE4A 3KTAB 1NBMD 4YXWD 3C8UA 4N0DA 3N2IA 3UIEA 3K70B 2K5UA 4LJ7A 2PX0A 1IN4A 1BIFA 1G21E 1JXMA 2C96A 1IY2A 4CEIB 3I61A 5EQTA 4C0KA 3IO5A 4NYMR 121PA 3HU2A 4M9ZA 2W6JA 4JT4A 2GEVA 4B3CA 4BFSA 4LBVA 2Q21A 3WNDA 4R7ZA 4EJSA 3KKNA 4Q4JA 1NJFA 2ZVPX 3HR7A 4DC9A 1TF7A 4DWJA 4A36A 2JLVA 1TPZA 3F5FA 2CLSA 4RCYA 4RZUA 3EPJA 4LK2A 3LWNA 3LBNA 1JQJC 5G3YA 3D3QA 4KSBA 3LQQA 2XJ4A 2CCKA 3WBKA 2WHXA 3L0PA 3MCAA 3A36A 5AUQA 2GCOB 2C77A 3WRYC 4JYBA 4C0JA 2WWIA 3ASZA 2XOKD 3R9XA 1KNXA 3EC1A 1MR3F 2Q9CA 1G7CA 3VHLB 1Z22A 3FHOA 3OHMA 1TU4A 5FBVB 4XD7A 3QG1A 2XZPA 4V0ME 4IOJA 1OH7A 3ZQ6A 1VIAA 1CBUA 1N0UA 3CWQA 3IIMA 4LV8B 4LV5B 4Q4LA 4QJ4A 1XRJA 2N42A 1E9FA 2XB4A 4EJSC 1BS1A 1BOFA 1WCV1 3GEIA 5FPYA 1XTSA 2F43B 1TQ2A 4EFMA 4ILEA 2CCJA 4KV9A 4CGZA 2AKAB 2ZRLA 1XTQA 3A1SA 4Q1FA 1E2LA 4AYTA 3PUVA 3CH4B 2R8RA 4DSTA 1R0WA 5JS7A 2YKGA 4W7SA 4QJ5A 4NE2A 4MDFA 3THOA 4B2LA 2J3EA 1S3GA 2V8OA 5F9HA 3P27A 3ZIAD 3GLGB 2DR3A 4QNRA 4BASA 4II7A 4BQSA 5GJCA 3K9NA 5AJZA 2YWFA 2GVDC 1NMYA 1KZ7B 3DZ8A 5CLLA 4B3FX 3Q3JB 3K0CA 3U4QA 3AVUA 3GLHE 2KBFA 2V54A 1JB1A 4OI1A 4D2IA 5AUPB 3EZ7A 1U94A 3PUYA 5IDVA 4CEHB 1OXUA 1IN8A 1S9HA 4ACBA 4B43A 1QHHA 2FV8A 1S9DA 1C4OA 1I4LD 1D9ZA 4OL0A 3VAAA 4PQRA 5AR1A 1PJRA 2GJ9A 4KAXA 2IF2A 4I1VA 2WV9A 4HDQB 1QHIA 1DBSA 2FG5A 2W2TA 5K8UA 4RZXA 3LO5A 3Q8XB 2W6ID 4N1AA 1E9SA 5CJ2A 4RD4A 1GKUB 3REFA 2JLZA 2O8DA 1T5IA 1MABB 5CK4A 2VRWA 1GL9B 1VCNA 3ND9A 3A1TA 1T6NA 2EFCB 4KODA 4ITRC 1WDTA 5E7IA 1GILA 1I2DA 2A5GA 1E2GA 2ORIA 4JLOA 3BB3A 4RFVA 2D7CA 3B13B 4BRWA 4MRSA 2H18A 3CF2A 1Q12A 2A7QA 3HWSA 5E95A 1Q0UA 1E2JA 1T8UA 4D4KA 4DEXA 4F4CA 3NDPA 3U44A 4EPWA 2P67A 3EZFA 4JLNA 3T1VA 2ZS8A 4S2EA 2QSYA 1RRGA 4JBYA 2CNWA 2XNDA 4BFXA 1VG9B 3EPHA 4LHXA 3T15A 1RW4A 1TUIA 3GMTA 4PR0A 4NTZA 1DAMA 4HYYA 4BFUA 4W9MC 2IS1A 2UKDA 2VP0A 3I1FA 4R2HA 3DO6A 2G9NA 2KWIA 2RCNA 2AWOA 1OXXK 5EXXA 2YWEA 1GWNA 1LB1B 2C2HA 2OILA 1X1RA 5TB5A 2YC4C 3LX5A 2NIPA 3DPUA 1ZM9A 2GXSA 1GM5A 2A5JA 1NY5A 2CHVA 2FDCA 1EFTA 4UKDA 5FTLA 1XB2A 3C15C 2C5LA 1Z29A 1RRFA 3LDAA 5H68A 5H8WA 1IXZA 1DAIA 1OFIA 2O52A 1RYHA 2J9RA 1UAAA 1X6VA 1Y63A 4OI0A 4LCBA 5BN3A 1OHHA 5KTYA 1B23P 4D81A 5KSYA 1MV5A 2DCUA 4QG7A 3RDPA 1E99A 2F43A 4C0AC 2KI5A 4I1OA 1CLUA 4LYFA 4X8OA 3H1TA 5JECA 3THYB 1DAHA 4JLJA 5C2JB 2FFAA 2G83A 3HYRA 2JCSA 2A5DA 3MMPA 4JLBA 4TQ9A 2GKSA 2CE2X 1E79A 2YINC 3IIKA 3OEEA 4Q66C 3VR5A 1PLKA 3AVVA 1N6NA 2FOLA 3KJHA 1YZGA 5CK5A 1T91A 2IBMA 1TF2A 1XTRA 3CR8A 3VX3A 3ZYCA 4QBIA 4UNNA 5L3SA 2V7QA 3AVWA 4KYIB 1N5JA 1HV8A 4QRHA 4YC7A 1OFUX 5B58C 1MKYA 2GWHA 4CEHA 2PT5A 1SULA 2JJ8A 2QZ4A 2A9KA 1G291 2ZI5A 1J70A 4V02A 2IEZA 4AG5A 1U8AA 2N46A 3QPVA 1AN0A 3H86A 5JSZA 5HKKA 1G7SA 1SKYB 1LVGA 4IKEA 3IEUA 3K70D 3R9IA 1IY0A 2IWRA 5KDDA 2J7PA 2Q9BA 4Q5IA 1E94E 4H1VA 1OIXA 4B76A 5EXPA 4BZPA 3GLIB 4KLNA 3AVXA 2IEYA 4M9SA 2J0UB 3FKQA 3CWZA 1G8HA 1VCOA 3KQKA 3KTAA 2F1IA 3BORA 2FF7A 1X8JA 1JPNA 3U5ZB 2J46A 2BBWA 2C95A 4YONB 4LHVA 1KZGB 3T5DA 1W36D 4LJ4A 2GA8A 4XD7D 1ZINA 3VR6A 3DOFA 3L43A 2XOKA 1MH1A 5JZVA 3QY0A 1L4YA 3AF2A 5A4JA 2B92A 3K1JA 3MFYA 5DGXA 1SVMA 2CL0X 3L0IB 1WBDA 4TL8A 3I5XA 5CLQA 3WHLA 3LXXA 4A4DA 3KZ1E 4DLRA 2VO1A 4UNPA 4TMXA 2QRNA 8OHMA 2UZ3A 2WKPA 2VF7A 1S8FA 2QNRA 4FD2A 4Y0AA 1E1RA 1F6BA 3CM0A 3K09A 3C14C 1KAGA 2BVNA 2GF0A 2C99A 1ONBA 1HTWA 1XMJA 1F2TA 2ATXA 4M1MA 4IXMA 4A92A 5HKKD 1X3SA 1A5TA 2C04A 3GFPA 2DFTA 2QTVB 2ZR7A 1KDRA 2OEPA 4GMDA 4GDFA 3CBQA 2IX3A 2J0SA 1UBGA 4RD2A 1ZIPA 4OHXA 4ZKDA 4CEIA 2ZU0C 1NMZA 1EGAA 5EE1A 2AFIE 2IYLD 3QENA 4KO8A 3VU9B 2WM9B 4FCTA 1SHKA 4LWZA 3QUSA 3SJCA 3UKDA 3BFVA 4FMDB 4V0NA 5G40A 4D4JA 2RB4A 4BFZA 2IUTA 1NSTA 4L16A 2GF9A 3TR0A 5CB8A 1FFHA 1E2QA 3AQ4A 4QM7A 1ZUHA 3AH8A 4F38A 4HAVA 3QG5A 5EUMA 3W6OA 2QU8A 3IBGA 1OV4A 2J0QA 1W7AA 3HPQA 1VHTA 2ZPTX 1EFHA 1U9IC 2EU8A 5SZKB 2O8CB 3A6PC 4NCKA 2XTMA 3B85A 5FPSA 1ELOA 1CJKC 1SVIA 2IT1A 1F2TB 1OHHD 3QIAA 2KJQA 3CH5A 1IHUA 4MGIR 2Z0MA 4G5RA 5FBRB 5FTKA 4ZDWA 4OKSA 4YMTA 5GJBA 2XEXA 4LBYA 4EJSB 4QGAA 3K8YA 3I62A 1KIMA 4TYNA 3F8TA 1R2QA 4KFTA 2DB3A 2V1UA 2ZJYA 2OXRA 2VL7A 3M6AA 3QEJA 1G5PA 1GUAA 4GRAA 5GJWC 4JT2A 5FL7A 2D06A 1U0HC 2P65A 4OQXA 4ZV4A 3TSZA 5JWRA 3GLHB 2P0EA 3FDIA 1KO7A 5TY0A 1D6JA 3I4LA 4X8HA 1G18A 1W48A 1G6HA 4QJ3A 4A15A 1Z06A 3Q72A 1FQKA 3QKSA 4PANA 5JWHA 5HPYB 5CM9C 4NCNA 1JJ7A 2ZUBA 4HB2A 1OB5A 1ZMXA 4HDOB 4X8LA 3NWJA 1GG2A 2XAUA 5JRJA 2PZGA 1N5KA 1SHZA 1GNQA 2ZI4A 2RGCA 2HF8A 1AK2A 3RC3A 2G6BA 2IYZA 4L5BA 5KUTA 1DEKA 2J7PD 2MMCA 2WJHA 1JAHA 3FPAA 3C16C 2OSBA 1ZYUA 1U2RA 4CYMA 5EUQB 2O8CA 4URUR 4OQMA 4UXHA 1LY1A 4BZXA 1E2EA 1QHHB 3RAPR 2XSZD 3R7WA 3VR3A 2OO7A 3U6BA 2GCPA 2ZROA 1N6IA 4B73A 4PO8A 2EFEB 2W6IA 5LPNA 1ZIOA 3UK6A 4BEBA 1G19A 2FSFA 3CRQA 4EPRA 3ADCA 2GXUA 4IVPA 1II0A 3SYLA 4WBSA 3UG7A 1E4YA 4M21A 2NZ8A 2X2FA 3K0FA 2AXPA 4G5QA 1UBFA 3O8RA 3I8XA 4Q00A 2ZEJA 2XGJA 1UKEA 4BUJA 3HU1A 3O47A 4D26A 1JEDA 1F3OA 3W6NA 4JLPA 3SNHA 1P2TA 3QF4B 3TSOA 1HY3A 3ADBA 4DUGA 3KFXA 1GKIA 4Z54A 4KSCA 2FWRA 3B9PA 3JVVA 1MRNA 1SVWA 2PX3A 1AGRA 3VU9A 3G5UA 1Y3AA 2ASEA 5ANRB 2BMJA 1T9HA 4TSFD 3P26A 3TJZA 2PMKA 3AEZA 1U8ZA 1BYIA 4WIAA 4DB2A 5DISB 4TMZA 1N6OA 2GETA 1R5NA 2JGNA 1W46A 1R7RA 1AZSC 2ZJBA 3RRYA 3RRZA 3T1QA 2AR7A 2O8BB 3K0AA 2CL6X 4JJKA 2VPPA 1XTJA 4LJYA 2XNSA 3QBTA 4I99A 2V6JA 4HEJA 5SZHB 5FBLB 2GDJA 3GJ6A 1FX0B 3QXHA 3JZMA 5DSZA 1QHXA 1Z8FA 5DIFA 1S3SA 3CX8A 3I32A 4A8JB 5C4MA 1KYIA 2BEKA 1Z08A 2O0KA 5DYIA 2GVZC 2V9PA 1NN0A 5KOYA 3PENA 5CYOA 1K8RA 5EP3A 5KNDA 4UQOA 2QAGA 2WSSD 1IY1A 3IPXA 3SQXA 1RJ9A 4PC1A 2F7SA 4DIEA 2P2LA 2FMXA 2XTZA 5FOWA 1KSGA 5GJVC 2QMHA 3KXLA 5F2EA 4YMVA 3M1IA 1W1WA 1SZPA 1N6PA 1ZM2A 4JZKA 5FH9A 2IXEA 4DLVA 4DXAA 1P5ZB 4US2R 3BH7A 2YOHA 2OM2A 4OI4A 3FB4A 4CF7A 2HF9A 4A2QA 4P4UA 2VF8A 1NBME 2D3WA 2QE7D 3OIWA 3CF0A 1G7TA 4G5SA 1WBBA 1UKZA 1OIWA 4KI0A 1WF3A 4IVQA 1FUKA 1G3IA 1QG2A 3A1VA 3AKEA 4Q1EA 3TW8B 5P21A 5LD2C 2QEQA 1LS1A 2VHTA 2HT1A 1KK3A 4C0QC 1A2KC 4M8NE 5FBWB 1XDBA 4IOLA 1D2EA 1KSHA 1N6HA 4Z1MA 1DO0A 4TL6A 4KXFB 2ANCA 2WAXA 1DOAA 2WJIA 1P3JA 1IOZA 3H2YA 5DI3B 4IEEA 3TUZC 3THXA 1F2UB 2QSZA 3GQBA 2RH5A 3MLEA 2H57A 3KB1A 1P4SA 1YZUA 4Q1CA 3D7MA 1HT1E 2F1RA 1ZUNB 2WVJA 1BKDR 2RGXA 3IILA 4LJ6A 1BO6A 3O8DA 1JXOA 1JAIA 3ETLA 1QHNA 2EQBA 3O8CA 2CMKA 4F4JA 1GITA 4B34A 2CJWB 3IHLA 5KSPA 3FOZA 2QAGB 1VCMA 2G88A 3C7KA 2ZYVX 4L9SA 4MGZR 3RWMB 2ZSAA 3BERA 1FP7A 4A2PA 3GLFE 2OZEA 3CLVA 4GFDA 4GT1A 3WP1B 3ZVLA 3NBXX 1D8TA 4RD3A 4BGDA 4C0HA 3OFNA 4M2LA 1GRRA 4ON9A 4CDGA 4Q03A 3THXB 5KDLA 3UWOA 1II8A 2Z83A 1VKJA 1D9XA 3BIFA 3NTUA 4D0NA 4F93B 1CJMA 3VNVA 4DDWA 3PV0A 4TZ0A 2HEIA 5TXGA 3OIVA 1YZQA 3MD0A 4GPTA
chains in the Genus database with same CATH superfamily
5E6UA 1Q7TA 3H2ZA 1K7CA 3HLYA 3OE7A 4O08A 4RVCA 5AJTA 4TLCA 3TBKA 2FNAA 5HNKA 3ANYB 4D56A 2XZLA 2B83A 3ZXSA 3GGOA 2R5NA 2WBLC 4PZCA 1KY4A 3HCPA 3VVLA 2FU5C 4GWLA 1MG5A 3BIXA 2B2CA 3FBWA 1C9MA 1OXKB 4E5NA 3F67A 2AG1A 4MMYB 3S8EA 3FBGA 3ZJTA 3JPYA 1Z0JA 3SF8A 1XF9A 2FRDA 1KXJA 4J03A 3RC8A 5AD1A 4MQEA 1P1KA 3TN7A 3LP8A 4G41A 3AKYA 5KB3A 3C7TA 2FPIA 3DBHB 3EXIA 4TQUS 3VZBA 1G0OA 1H4TA 3OWXA 1UOQA 1IRIA 3AUYA 4RV5A 4H1UA 2F3TA 3FZQA 2HU7A 3GH3A 4CF3A 4DWOA 1PS0A 2IHZA 3NJ8A 1I80A 2RHHA 4U0JA 2PFGA 4N49A 1OGYA 4M9RA 2EF1A 2VHZA 3TGWA 4B0OA 3GVCA 1DFHA 1JVBA 1XDUA 5ER9A 5E6UB 4YQEA 2C5AA 3KR1A 2I6SA 2QMYA 3U4MA 3G2HA 4IQ0A 1N2CA 2JZCA 4G0ZA 4AL4A 2PCLA 5GIOE 2W42A 1FS5A 2Q5IA 1SIOA 3P9SA 2QQ5A 3SEQA 5JRZA 2AOVA 2NUAA 2HAEA 4DMUB 4PS1A 4ZT3A 1F8GA 3HRKA 1QM5A 3OZBA 3LW7A 4RETA 1VIVA 3GDFA 5JSFA 4ZVMA 3TZQA 3AIKA 1JFFB 4R8KA 2BFWA 1CDOA 3DE3X 3E7PA 3JAWB 1XCJA 1C8KA 4AY4A 1Z18A 3DKRA 5LJLA 1OXSC 4UU7A 2XUZA 1P1RA 1NIJA 3DBIA 5FFNA 2PKWA 2LPMA 2Z4TA 4WUTA 3WGGA 2ZBVA 4I08A 1BXGA 2CK3A 3EQZA 3FWYA 4RKFA 2QA5A 2IFTA 1Z5ZA 4D0RA 4KREA 4RL6A 2QL7A 1U9JA 2CSXA 1LUAA 1AIPA 2Z4SA 1FFXB 2ERCA 1ZICA 1KAOA 2AUNA 2IOYA 2O7NA 3AM3A 5K3CA 4AG6A 3LHKA 1PW7A 3FHJA 4HLUC 1P9NA 4TTQA 3MAAC 1O8CA 3LBFA 5TPZA 2VRNA 1KMNA 3HYSA 3P32A 2ZP1A 4DLTA 5ELLA 2AWNA 1L7MA 4IEIA 4M1OA 3ILXA 2Z2IA 2W4QA 2V3CC 4EHFA 2AJTA 1ODTC 4TMFA 3NPAA 3AOGA 3VZRA 2YWXA 2VDWB 3B5JA 1MAVA 2P2SA 4FPXA 1VSBA 3SC3A 1KI4A 3I23A 2HHHB 1Y3CE 3IUYA 4KQXA 4O33A 2Y6VA 4P8RA 4ZI5A 5FFMA 3T3GA 3V2HA 5E4FA 5FAXA 2NSLA 3GJRA 4LYEA 3TLCA 5A4MS 3DLBA 1ZJ6A 4N9QA 5DB4A 4WK0B 5ARBA 4OREX 2JLYA 1ODSA 1R64A 1TK9A 1B74A 2Q3CA 2YYAA 2ZRHA 4R3NA 4RK1A 2J45A 1F1JA 3PLAE 5KOHB 1MQSA 3IQWA 4RE5A 4B35A 4JDPA 3B6IA 1IUOA 1NOKA 3I6BA 4CIXA 4GW3A 4HMQA 4DC0A 5TJHA 3GGDA 1CUBA 3L4BC 4B47A 4Y6GB 4G0UA 621PA 4FP9A 1JVSA 2ET6A 1FW8A 2J32A 1WTCA 2Z2ZA 3EY4A 3O2SB 2V6FA 3OKAA 1R0SA 2VWPA 4FNGA 4GC9A 4M7OA 4Q12A 5ES4B 3PF8A 3EQ6A 2YBEA 4G6ZA 3VTKA 1GU0A 4PZUA 2R7MA 3V8QA 3JQ7B 3RTBA 2WMNB 3MTQA 4H15A 1RLMA 4XEUA 5SY6A 4O29A 2H5LA 4ERNA 2JKYA 5CLHA 3FH0A 5BQPA 4W5RA 4RAQA 5LP1A 1A5ZA 4XCVA 3USES 1YAHA 3TVTA 5TVKA 1KAMA 3T5MA 4BQRA 3NM4A 2PV0A 4A0QA 4OMUA 2WRZA 1CJTC 1GTVA 2XNCA 4FDMA 4TL7A 1U7TA 2I6QA 1CKEA 3UJPA 5F3WB 4MVJH 1JKFA 4TS3A 1FRQA 1QIDA 1KFJB 2DC1A 1UBNA 1AKMA 3MTJA 2OCIA 2NU7B 2OWDA 3FSGD 4PX5A 3JYNA 5FCDA 2H4YA 2EL9A 3KOXA 3PSHA 1T35A 3N2LA 4JX9A 3IP6A 1YS9A 1XZGA 4JVSB 4KQKA 4P82A 5LFAA 1Q1NA 1U2ZA 1XVVA 3ELBA 4RIFA 5YASA 1LCIA 4ZT5A 2IX9A 3PPWA 1T8WA 3AVQA 4DS3A 3O38A 4ALMA 4UVEA 1YCHA 1ISFA 1AE1A 4EFDA 5JFOA 3ZK9A 5JWOA 1DV2A 3ECCA 1Q7EA 2ZT6A 3BIWA 3NG1A 4MLZA 5AM3A 4TWBA 2BZGA 3BQ9A 4E6EA 3PNOA 1T9DA 1TAGA 2G9UA 4HY3A 4Z7NB 5EWMB 3K0HA 1NW6A 1M8JA 4N5HX 1VJ0A 4P3PA 5FUMA 3WFJA 3DC2A 3TLMA 2N47A 2HBRA 3KQVA 1K27A 1VPEA 2AT1A 4HTAA 4BNZA 3HV2A 3MOSA 3W5VA 2B9VA 4LK3A 5LZ5A 5I7HA 4ZHQF 3KQNA 1EZ4A 1WJGA 3PYLA 1OWOA 2BF4A 4I4NA 1I14A 4YV0A 4LJ8A 2VHYA 3H11B 2HJSA 1VSUA 1GRNA 5JJIA 5AVXA 3HSKA 2BSQA 3HNOA 3WI7A 2QK4A 3H1AA 5BW6B 3PUKA 5GGYA 4ZO9A 1USKA 4YPFA 4YDHB 3ANNA 2R84A 1J2RA 3GD7A 3VSEA 1Y1SA 3MJRA 4POOA 1YR8A 4BX3A 2RAPA 5CBPB 1QLHA 4YV7A 4JP3A 3EFBA 3Q8WA 5FLEX 6PFKA 2OBMA 1GNRA 1YUBA 2UYGA 4XH9B 4HO1X 4YRKA 2J87A 1RLIA 2GEBA 2KLHA 1KY3A 2VDUE 1Z7YA 4H7KA 5AI5A 1PR9A 1GDDA 2AZMA 2WSYB 2BFOA 2Q3HA 5CXXA 1PJCA 1DFIA 2YUIA 5KVQA 3A6GA 1QU3A 1XA3A 2VOEA 3MTIA 1SOUA 3OT1A 1QGAA 2QJOA 2FZ4A 4AJHA 1RBYA 4A1OA 4RD0A 5FPTA 1IOVA 3G1UA 1TNDA 4KR9A 4UE2A 3S6JA 1YWGO 2ACEA 3V4OA 3ZTTA 1W0KD 2YV3A 1JNYA 4A8JA 5JQWA 1UJ4A 3HMKA 3QPCA 2Z8YM 5D3MB 3WB2A 5GINE 3H5OA 3QHQA 4QOEA 2HQSA 1UOPA 1EK1A 4IHAA 4GOOD 4K6OA 5JS2A 4BE7B 2D00A 4E30A 1PWHA 1AT1A 1Z07A 2R1VB 1N2GA 1VRCA 4PSCA 5LDGA 1IHXA 4EHLA 1DKMA 2GJKA 1BMFD 3NUZA 3DMFA 1NDQA 3PFWO 4G85A 4PAQA 4XW2A 5I9TA 5KNCD 2Q4DA 4BO5A 3GCXA 4DNXA 1E2UA 1KMIY 5EFOA 3KTDA 5C1DA 3N7UA 1Z5NA 4XQCA 2HIHA 5IBQA 4HQ6A 3HR4A 1KDTA 2NG1A 5CITA 1ZRSA 4WCFB 1NKSA 4OJNA 4RHCA 2I22A 3B6JA 3WXBA 4EI2A 1EPUA 4BKPA 1CZKA 3K16A 2QRVB 2P3LA 4D9CA 2B8WA 1P7PA 3EC2A 2PZMA 1E32A 4UCQA 4UTNA 4B8ZA 1MPXA 1YS4A 1LBIA 3PEWA 1PF7E 3LUCA 4HI0E 2QJTA 4EUSA 1R4ZA 5TQVA 1IMJA 1JHPA 3G8CA 3MWJA 4RK4A 3MB8A 5BUQA 3K1ZA 5D51S 1X7YB 2JFPA 3ROQA 2R0QC 4V0QA 3A1NA 3FGNA 3F6CA 4DCGA 2I8LA 3UB2A 5KS2A 1J8MF 1WPRA 4RE6A 2V65A 2ZUSA 3L0SA 4KQGA 4GL2A 1J39A 1EFPA 4GZMA 1OA0A 1ZHFA 2BGJA 4H3SA 5KYXA 2OORA 2Y68A 2NADA 2IV2X 1GXSB 1E3WA 4ARUA 1ZX1A 3HJRA 3RRNA 4EX6A 4AUMA 5AW7A 3I6MA 1XFAA 1U3CA 5KDOA 1G7RA 3OG9A 4QATA 5ALIA 2NUBA 3WK8A 1GT6A 4IH4A 4E2XA 4N5NA 1QAMA 4B6EA 4WINA 1Q1GA 2PBLA 3FZGA 2HR1A 3E5HA 5JCOA 4LZOA 4CU2A 3OP1A 1VBNA 1TAQA 1A4RA 3BD7A 2JVKA 3D6MA 3KTOA 4P3YA 4YAOA 3JZDA 3TZEA 2GAAA 2F90A 1FXSA 1PN3A 3F6BX 2AFIB 1A96A 4JI8B 4BATA 1GRQA 2P62A 3NC4A 4WY2A 5J43A 3G0CA 3L8ZA 5CTAA 5GPBA 1C8LA 2P11A 2C98A 1O6GA 2XNDD 4QFBA 1QVWA 2JCXA 3ZGVA 2PBRA 4EKEA 1H8HD 3S2ZA 1C3XA 3C6QA 2YNMA 4Y7CA 4HX9A 5DSXA 3JQBC 2JCGA 5IJ9B 4I9FA 3K9GA 2Y8EA 4MUFA 2GD2A 1E3WB 2BFAA 2NXWA 3BAFA 3EUEA 4P38A 5HUQA 1W52X 1Y80A 4B4KA 4EB0A 2RGBA 3PPXA 3S55A 3W5IA 1H5QA 2IIPA 2G5GX 2YASA 4PBTA 5FUXA 3JVDA 1KYYA 2ZYRA 3HBLA 4Q9LA 1C9KA 1C1DB 3N2GB 3WK9A 3DOUA 4BX0A 1I1HA 2LKDA 4LIPD 4FIZA 1BD4A 3WLAA 1KDOA 1M34A 2GZRA 3GT7A 3ONFA 1SRRA 2A0XA 1OFVA 4MX8A 4TLAA 4Q1DA 3CVUA 1E63A 1PG2A 4Y9DA 5A4IS 1TRKA 4W5NA 5C8XA 2YMLA 5IJWA 1A9QA 3FZNA 4FKBA 4GZLA 4M0LA 3PGXA 4MA4A 5LOVB 2BFDB 2ZBUA 3JQAB 2Q4RA 5JHHB 3WAGA 1B14A 2QS9A 2J07A 3IAHA 2BI8A 1Q22A 2DUWA 4C2UA 2Y1WA 5I7RA 1Y3BE 2VUIB 1H8ED 1DELA 3M7IA 2BUBA 5EIXA 1EUDB 4PIVA 4EEXA 3G5MA 3GWGA 4LI3X 4QT4A 2VPYA 2E5FA 1MO4A 1D6NA 1YE8A 3ABIA 5BN5B 3WKBA 4I5DA 1Z2DA 1Z25A 4GM1A 2LV8A 5CB0A 1RJFA 1UBKS 3B1KA 1P33A 1Z15A 5I5EA 4N01A 1W0JD 2QY9A 3ML1A 3HPRA 4FSHA 5J59A 2EGGA 1E6CA 4ZREA 4O4IF 3S3TA 2PR7A 2NPOA 2YWRA 3UOGA 4OB8A 2HFJA 4PG5A 2PWPA 3LECA 2ZBRA 4FHGA 4F5WA 3MJ4A 1PCXA 4M1WA 2WJYA 1EM8A 5BQ3A 3MTEA 1GG5A 3IBYA 4RDIA 5KYUA 2HMYB 5ALDA 3AI7A 4CUJA 1JDVA 1XCMA 1CULC 1Z6GA 2YXEA 2BFDA 3AF4A 2X0IA 4J3JA 4FFSA 4YRRA 4G07A 4M89A 3SHFA 2NNLD 4B6GA 5E1BA 2WNIA 4IDAA 4MJ3A 3E5NA 1C9YA 1ZGGA 3L84A 2HDNB 3O8NA 4A0GA 2GNOA 3QEMB 5IT9A 2XCTB 4EVSA 4RKQA 5DNEA 4AKHA 2X7XA 1DP4A 1JDJA 1CF9A 3T34A 1EFRA 3VI4B 1XCOA 1DJQA 2APJA 2QUZA 3Q7SA 2VHXA 2IRWA 1V25A 1NF3A 1P8AA 1NUPA 1FP4A 1X8LA 2CFSA 2MSWA 5EGNA 3U7GA 3KPWA 5HP4A 3U4AA 1SUPA 1OU0A 5I9MA 2G4CA 3A32A 1YDMA 3NS7A 5KU1A 3KM0A 1XHLA 3I9OA 5G0WA 5KBYA 2WFLA 3KOOA 3QYAA 1KI6A 2NZ2A 3ZJYA 4JOSA 4B6RA 2DLDA 1AK9A 4IH1A 4RQAA 1YRLA 3UWSA 2J3IA 4EW1A 2Q3BA 4YK7A 3U7EB 1KE1A 1QYRA 2V7XA 3ACBA 2A8YA 1SKQA 5HZKA 2W2QA 2QTCA 1P4AA 3BD6A 1XLVA 2ORWA 3PUWA 4L7VA 4MP8A 3RIYA 5HSGA 5IXYA 1CS0B 5K4GA 3EAGA 1V7CA 3H4MA 3EARA 4RQUA 3AB3A 4K03A 4EHBA 5HR5A 4JYZA 4G0NA 3DE2X 4PWZA 2D74A 3T61A 3U80A 1SEPA 1O8BA 4EYGA 3GT4A 5T41A 3V8PA 1DCFA 5DGHA 1FUEA 2QM3A 1O9GA 3VGPA 4DW8A 1FSPA 1WZ2A 1G4AE 2WFZA 4U0KA 5LIRA 3TG8A 2J9GA 1UWCA 5JZMA 2QR5A 3TUJC 3NRCA 2VKTA 2ZIXA 2HN9A 1NVWQ 1IB6A 5AW9A 3G6WA 4AKEA 4R1NA 2GTHA 2DKNA 3TCNA 5HTOA 2NO1A 2Z43A 3N2KB 5D1NA 2HBYA 2CL7X 2GBLA 2M2IA 2MR6A 2PCJA 3KWFA 1D0VA 1EQUA 4Q9IA 4PO9A 1H3NA 2VRCD 2ZIUB 1L3IA 1PK7A 3BTVA 3NEAA 2JLQA 1RYMA 1W5EA 4G3XA 5BWBA 5H81A 4E3WA 2EYQA 2WSIA 1GP2A 1UMBB 2OAEA 4ECEA 3AUXA 4BNVA 2ODQA 5F2OA 1GV0A 1XIVA 3LXMA 4W1QA 3S5UA 2NO6A 1K7SN 3T9FA 1ONPA 1E6LA 4Z7JA 5K8TA 3LBHA 1T3TA 3MCWA 1Z8HA 4MRMB 4F8EA 3ZI4A 4BY9E 4BKRA 1PLJA 4D7AA 1QHYA 5BQOA 2AS0A 5F5XA 2R8BA 1Z35A 3EUWA 1RC1A 4RO0A 5H1YA 4UAGA 2HHCA 3N8IA 4ZI7F 1Z2OX 3ZWCA 2JFOA 2H2DA 4DLSA 4C21A 2AZXA 2IDMA 3ZVMA 1EBFA 3GPBA 2CCGA 4IF4A 4KJXA 5BO5A 3U4CA 3AM5A 5FWNA 2PD6A 3L4KA 4CLRA 2WMDA 3NGLA 3H9QA 3IKJA 1N9ZA 1LTHR 4ZMRA 1UDAA 2Q6KA 4E03A 3NHUA 5D3KA 3SS9X 4B71A 2I7CA 4BVKA 4EKGA 3K2BA 5C52B 4WH0A 3BIJA 1E6MA 5DOZA 4H16A 4G67A 4J1TA 2F8SA 5JHGB 2X8JA 2VDQB 3GG9A 1GJRA 3CIOA 5LZ4A 4GI5A 3KLNA 4C30A 2ZCVA 4XLLA 3FCAA 4NG4A 4KQ1A 2IEDA 1G42A 4FCCA 4MCIA 3D0KA 1A9TA 2RGUA 4XM1A 4FM9A 2CYAA 5IKOA 4A1FA 1HXHA 4AJ2A 4PSVA 5HKLA 4AI6A 2WYOA 2X1MA 3MQ4A 2RK3A 3M6WA 2DWPA 3N9IA 3KKPA 3V2GA 1NXVA 1W0KA 1ADBA 5JATA 1B8UA 3EFOB 3CO5A 2PT7A 3SMQA 1D5CA 4NYIQ 4MYCA 4P35A 3VDMA 2ZBFA 2XEDA 3C24A 2J5QA 1NC1A 3KQHA 4LI0A 3LFTA 2JAUA 3II6X 2D5CA 2WK1A 2GPBA 4L9RA 5BUZA 1Y4ZA 2DTDA 3ETDA 2JZOA 3IALA 1AU9A 1AHHA 1G4HA 4YUWA 1E3LA 4HWPA 4EHKA 4YI3A 3THYA 4L5CA 3H6HA 1HE2A 1SG6A 3DO5A 3KOMA 3K94A 3LHIA 3I1IA 1T26A 4MGEA 5JCJD 2FWNA 4TTTS 4CF4A 5I9SA 5LQKA 1YS1X 1W4LA 3QFHA 2JKVA 3RAEC 3W06A 3KJGA 4N65A 3WYAA 1GGHA 1Z4KA 4IJUA 3QSYA 1NVDA 3VYUB 4P5EA 1TZJA 3CO0S 3HG7A 1DSSG 3FDXA 4OQZA 3BE8A 5GZ6A 1NXTA 1P4HA 2HRZA 1WMAA 3HFSA 4BNTA 1RT9A 4N8DA 1DGQA 3AU8A 2GARA 2AN5A 2O7VA 1R00A 4W63A 5K2MA 1S96A 4HUQB 2J5BA 2Z98A 2CEAA 3DPIA 3NOXA 4LXUA 1Y7TA 3R5HA 1LPAB 1OYVA 2OO5C 1JH9A 2AHOA 5AKEA 4RAOA 3HB7A 1TZ2A 4QWWA 2DY0A 4ZOCA 4ZO6A 4M7RA 2YXDA 2ZE8A 3AL2A 4JX8A 3S28A 2R8ZA 5F23A 1W59A 2WKSA 3LT0A 3ZE0B 1XZPA 2DBYA 1NVXQ 2BN4A 1HMPA 3HZOA 3ZGYA 2NVBA 1G17A 3T5TA 2QX4A 1Y6JA 3S2GA 3FAZA 4D3DA 1P3Y1 1VLHA 2QD1A 4H3VA 4Q3LA 2P9ZA 1XZEA 2RGAA 1HYEA 3LS2A 3PFCA 3USCS 4ARVA 4FU0A 3MCUA 4B3BA 4OK5A 3P1JA 4O4JF 1IMOA 5DXJA 1MW9X 1N8NA 3LKBA 3KSMA 3A05A 4TWAA 4BVAA 1MO3A 1S1MA 4IO0A 4YFYA 2BEVB 1R6XA 3B20A 2BONA 3AOEC 3R44A 3IKMB 4H7JA 3D0QA 5BV8A 4JLMA 4IHJA 2W2LD 2PHZA 1XHEA 3D59A 3WQHA 2GVNA 1LC3A 3Q0TA 1E3IA 3RUAA 3VRHA 4LSGA 4BWYA 1GGKA 1JX6A 1CW2B 4D92A 1NJGA 4C3VA 4L74A 4EUFA 4RGQA 1FYWA 2ZKLA 2AD1A 3S68A 3T3HA 1NBMA 1NKTA 3NEYA 1KMCA 1B6RA 2DHQA 4I46A 4LC1A 5LP6C 1CUAA 1M8GA 2C97A 1I7LA 4G8JA 3HVRA 4MQ4A 3GRVA 3OMXA 4ENSA 2I29A 3R7LA 1PFUA 3FBTA 3ANLA 3FRJA 4BMVA 1AZWA 1Q50A 1CZLA 4OJQA 1XXLA 2YFHA 3ZWPA 4BPBA 1PFYA 4XFJA 4Z53A 3WLNA 2Q4EA 3STWA 3H4IA 3V46A 3VJMA 2WQ6A 2A84A 5L7YA 1N77A 3B7PA 1J42A 1ICIA 5CR9A 1YBMA 3NOQA 4NOJA 8MHTA 3FRHA 3OE1A 1KKLA 4AYWA 4MYHA 3HZZA 4QG3A 4UTOA 2SKEA 4TRNA 2AQIA 1U0TA 2AN9A 4NPHA 1JFFA 2IYXA 3K2EA 3FOCA 4RM2A 3T4PA 2C1EA 1Y82A 2W58A 3R4CA 4K88A 4EARA 1EUZA 3WADA 2QT9A 1KO8A 3KZNA 2GXAA 1OUMA 1W88A 3U9SA 1PK9A 3K2QA 1YVPA 3MUOA 4GVPA 5BW4A 3ROZA 1G3RA 3H5NA 4DCMA 3PIRA 3JU3A 4FGWA 1R9MA 1FPQA 4QXMA 5H9VA 1JKJA 3BSWA 3VOTA 3DLTA 1T34A 3I9MA 2A35A 4TLEA 3V1YA 5IFKA 4KBYA 1T15A 3DMGA 3U26A 1UPCA 1UJNA 1RXVA 4DQXA 3QE0A 5EJEA 1B2LA 3T06B 1ADJA 1P7WA 3OJ0A 2ENWA 5ITWA 1Q3HA 1FS4A 1Z73A 3RSFA 3B6KA 2R6FA 3BF7A 4Q3OA 2OCAA 2A5FA 4W5JA 5JZOA 3NMUF 1X7ZA 1Z7EA 4EZIA 3A37A 1RTTA 3D5QA 1DLIA 5EA2A 4BAUA 1KXZA 1QFJA 4PPGA 1VE9A 2GR9A 3P0HA 1JFLA 1DAEA 1LDEA 1RQ2A 2FP3A 1C7JA 2NLOA 2L42A 5ENVA 1HNWB 3NANA 1L5GB 1IFXA 2I7TA 2FWAA 4HQNA 1W73A 3FLAA 2XMCA 3M2PA 1LH0A 4NFLA 4MW2A 3HY4A 4FDAA 5EXTA 1LBQA 1EG2A 3GMSA 5CP8A 2BHLA 2Q50A 3L5KA 4FHCA 5B1DA 1R5BA 4ARZA 3S1SA 5I45A 4BNWA 1DQNA 5K3EA 1S2MA 4OHCA 2ABWA 1IQPA 1UEIA 3NI2A 3EHDA 3BBPA 4ZC8A 1W6UA 2WOJA 2XE8A 3IP9A 1V8FA 1KDVA 2B6NA 3E8XA 5MFZA 4NBLA 1VPVA 4OH7A 4LYYA 3HCOA 3UC5A 4X1YA 2KB0A 5JQGA 1O89A 2VQSA 4LSMA 3CWCA 5C7LO 1GA1A 2EG9A 2AVNA 2F62A 4R3UC 1M6HA 1LRLA 1QH0A 4G86A 1A8QA 4U7TB 1CS4C 2XRFA 2CBXA 4G56A 4M1EA 1CDZA 4CKBB 3DLHA 1WCWA 3VH3A 4URWR 2GK7A 3PR2B 3EQ9A 4MUAA 1R0YA 3W8DA 2B1IA 2WP8J 3GI1A 1IULA 3DXXA 2HK8A 3EN0A 2ZR9A 5AKHA 1NI3A 1TKAA 4Y2UA 2FMTA 4PO1A 1X8XA 1XD9A 1Z5OA 4N54A 1TQ4A 1L1RA 4HZGA 2I03A 3DEIA 3T3PB 1MP0A 2BF7A 4BMZA 1W36B 5HGXA 1RTKA 2X22A 2ID7A 3MTBA 1RQRA 3GLTA 2SCUA 2O2JA 2ZB2A 2W6CX 1MTOA 3D7LA 4HAOA 4WLVA 1PJTA 1NKVA 3A1WA 3H5TA 3D4IA 4NG5A 2I1VB 1QIHA 3RGGA 4WOJA 1X87A 3R77A 4B4VA 1ID1A 4HZUB 4OOFA 3NHPA 4XTCS 4X3PA 2WAAA 3V9AA 1CQIA 3BD9A 421PA 4DL9A 5CDFE 5JQGF 3GIWA 4HS9A 2XUKA 2BGTA 1ZM7A 1OASA 1ZWLA 2FSHA 5I7AA 3GP3A 1MQ9A 3GJXC 4J0FA 3GC6A 4IQ4A 4K5QA 3WWEA 1A8UA 3A3YA 2X0FA 2GCIA 1VMKA 5IYZF 4DR2B 2QLNA 3UB4A 2V45A 4IDOA 1PTJC 2FK7A 1SOMA 4TXNA 3JY6A 2XCSB 4YT4A 1AKRA 4ADSG 5CH3A 3KU4A 5DMHA 5JDIC 4MRVA 1FRNA 2YDYA 1HOTA 1NQUA 3MG9A 3QLTA 2VHUA 4XOUA 2HJRA 3KKKA 3G2KA 3LE8A 4BMOB 1FOEB 1YDGA 2D0PB 3KD2A 5LA6A 2O0LA 2PX6A 4L51A 4WFKA 3V32A 3IMCA 4TYYA 1X0VA 3L79A 1M33A 3ZS8A 4PLPA 2EVWX 1HRKA 2C8VA 5LSAA 1SHUX 2HY7A 1IZ7A 1NVVQ 1V95A 2AFHB 2YHUA 4ZVTA 4TWJA 5FUQA 3K0BA 5JZSA 1FNSA 1E1QA 2JL1A 1VYUA 4FN5A 1AHIA 4J0GA 1L1EA 3LOUA 1PQWA 4XIYA 4YQFA 4WI1A 1J0DA 4PHGA 1E98A 1ICEA 2Z9DA 1ZOPA 1SQFA 3HCBA 2VK2A 1ZD2P 3NWPA 1X7ZB 5KNBH 1TJYA 3SC6A 1JXAA 1OREA 4M8SA 3DHYA 4LN1A 4D74A 4YCAA 4DCPA 4PYIA 1BDBA 3IDZA 1PUIA 1RADA 4F93B 3TTTA 3HXLA 1L5YA 3BREA 2FFJA 1KO4A 3QKUA 2FOIA 2KW5A 3U3OA 3ZE1B 2OHGA 3P9XA 4UPEA 4FWBA 3CG0A 4ZYWA 1EXMA 1MF7A 1H5NA 3B8EA 3IVGA 4F56A 1SVNA 3TTSA 1M0WA 4D4MA 1IUNA 3REOA 1AV6A 3EG9B 2ZULA 1QNFA 3JYOA 4HJXA 1LK5A 2BV3A 4KBFA 4O4JB 3IKLA 3SZMA 4ONEA 4KQ9A 4JBLA 1TYEB 2CBZA 3D4NA 5C46F 1E1MA 3EIQA 4B33A 1NE7A 5IEBA 2SICE 3V2UA 1J22A 3G23A 3BRCA 4R9SA 2JGJA 4BB5A 3HEAA 2O07A 2EBFX 1WABA 3CEHA 5HBGA 1L7DA 5EOVA 4WXYB 1RI2A 3PNMA 5JPDA 1D0SA 1YOVA 5T8KA 2ZRQA 2FSPA 2PM8A 5HOEA 2Z8XA 1YXMA 3ZY6A 3ZBPA 2ZCUA 1MAUA 4N48A 4ZHSA 4CM4B 3AP3A 1W35A 3AHFA 2ARKA 5HE8A 4EHHA 5DNUA 5KNBA 1UDXA 4UHHA 4KN8A 1QQ6A 3L2OB 1F38A 1OFHA 2DHDA 2JIMA 5LXTA 1M5TA 2DULA 5KHAA 1P3DA 1NBEA 5JJBA 1QVRA 2SKCA 2XWSA 4EPTA 2H1FA 2Q6TA 2Q0HA 4Q3DA 4DJAA 1BSVA 5BSTA 4X0EA 3I39X 5IARA 1SKMA 2QLLA 4MKIA 3DQQA 3DQZA 3VPSA 2XGMA 2X42A 5BN3B 5JROA 3C6KA 3EC7A 3EXHA 3L18A 4ETWA 3NBKA 4CETA 5U4XA 5E4JA 1ESMA 5I8PA 2QMZA 4DIMA 3FSRA 4MW7A 4P6VF 1T5TA 3Q8MA 2VP6A 3LDFA 1XJQA 2VNAA 2Q6LA 5BSRA 4AAYA 3EIEA 2B21A 2BEJA 4WNAB 1GAJA 4NF2A 4MHSA 3I92A 5HCIA 4CW7A 3DHEA 3UMMA 4JKOA 5SICE 1DRVA 4D3SA 3ECSA 4BWFB 2CVHA 4PC2A 5CFPA 1UAYA 5G2OA 3FTDA 1SGWA 3G2MA 1PZFA 3HDQA 1DJOA 1JL3A 2FUKA 2GN0A 4XFKA 4F6LA 1JLLA 3O31A 1G1MA 3HUEA 5GZ1A 4KGVA 1RXWA 2CZGA 4NBWA 5DN6D 5JPCA 3EGXA 2IWHA 2XMPA 3WYGA 4Q19A 3ZGOA 4L22A 1XNJA 4XVCA 4YY3B 2EZ4A 3F6PA 3MN1A 4GHWA 1UMKA 3E48A 4AUEA 2PY6A 1J0EA 4KKVA 3DP7A 4OUDB 1VGQA 2AN1A 2FVXA 2CNOA 2BLNA 3WB0A 3EUAA 3SQDA 3IOCA 1G5RA 1VJRA 1QG0A 1I2AA 1B15A 2NACA 1PL7A 2O5VA 3OTQA 1JYFA 5DI3A 1N2IA 1VLQA 2OPBA 2Q1UA 5A4FS 4DBZA 1XMQB 3HL4A 4X71A 3ZQJA 1O96A 2HK6A 3F98A 3QY9A 1K9SA 3L9WA 3Q2KA 5DULA 1JDBC 3BJRA 4GKBA 4FBGA 3HDVA 2G7ZA 3DCYA 1T2CA 3QX9A 2CXNA 3PXAA 4GEGA 3VR6H 4B3TB 4FZ5A 3AGPA 1QZ3A 3BFKA 3V2IA 3ONEA 5B30A 1Z6PA 2GCGA 5ICSA 1N6KA 2VAWA 2BBSA 1CFZA 2HBQA 3VUFA 1NJ6A 1JYSA 2HSEA 4HDNA 5EL0A 4EEKA 3AX6A 2UU9B 4WERA 1E9CA 2ZW9A 3JWJA 1DTWA 1UT8A 4MYDA 5JMPA 4EHAA 1PZXA 4J0HA 1OJ7A 1ES9A 3AB8A 3RF7A 2JLSA 4RMGA 5JZ9A 1E89A 1EGHA 4ZVVA 3QXGA 4WFJA 1TYDE 2YIMA 1L9XA 2VF5X 2WEKA 3PUXA 4NFSA 3CY6A 4F9TA 4A8HA 3VPHA 1KZ4A 1V3UA 4MVJP 1OKKA 4G1UC 5L53A 1HLGA 2ZYIA 3HA7A 4RJ2A 2A9QA 1QONA 4HLQB 3OD1A 4KYTA 5IZCA 1E5VA 1XXHE 2ZRDA 3RH0A 3E9YA 3M81A 4HLCA 2HJ9A 2ZITA 3I5YA 4DLYA 1ESNA 4DCUA 3PGMA 1W87A 4YJHB 4DQLA 5EC8A 4U5XA 3A6KA 3B48A 4RF3A 1VYTA 4EBFA 1ISHA 3PC7A 5JV5A 1HE1C 3QFTA 2YX1A 5EXSA 1FDSA 1WUHS 4I81A 4XRGA 1P4RA 1X39A 4HL6A 9LDTA 5INTA 5ADUS 3MRXA 4V1CI 4DQUA 4LDQA 1KKMA 4F5DA 2E4WA 4IYJA 3C6MA 4UAJA 2QZSA 4CJXA 4ZP1A 1E0SA 4UXJA 3LHSA 3N0RA 3OUZA 1NXWA 3VNQA 3ZY4A 3OEED 4CR8A 4CM4A 3AO0B 4B1FA 3QBJA 1A76A 3U39A 1A1VA 3DLAA 1P62B 1ZMOA 1NRXA 2VJLA 1M6NA 3PT5A 4QPZA 3ORHA 3FTEA 3BB4A 3GGJA 1PVDA 2BM1A 5F1KA 4GQBA 3D1LA 5FUBA 1Z45A 2D1FA 4TRJA 1C30B 3D2CA 1ST3A 3TMKA 1HG0A 1ZA2A 4N6OA 1TE2A 3TM4A 4FIDA 3NWEA 2WIAA 4JUIA 1NP3A 3T7EA 1E1RD 4FFVA 3U7QB 4N0EA 3ZHUA 3ADPA 3QEMA 1ZD1A 4YJHA 2E37A 4JL5A 3NH9A 3GJ0A 3D3JA 2JFHA 1C7RA 2PL5A 4FONA 1ZL2A 4G0MA 1TYCA 1AN9A 4RNCA 2IPNA 2AF4C 4WJKB 5HQTA 4EB8A 1CXZA 1LA2A 2H4WA 2I5PO 2SNIE 4V0OA 4R2XA 1YZFA 3SJAA 4LYHA 3TQTA 3WK7A 3E5MA 5IC5A 2BDTA 5CX1A 2JJMA 5JCOC 1KO5A 5DBOA 4IUDS 4RQTA 1RKUA 1H65A 4N5LA 5L7WA 1P2GA 4Q4AB 1TYAE 4UTZA 5REQA 2EHDA 3JCZA 2GM9A 4HX5A 2ZANA 1V16A 3E1KA 3LK7A 1JAXA 1RSZA 3VNSA 4M37A 3QU7A 1D7AA 3EDRA 1IEVA 4INAA 1YGPA 1G8PA 1QH8B 1SO8A 4NESA 5SZJA 4G5GA 1R5OA 3P96A 4I1SA 3REQB 4MZDA 1IZ0A 2E18A 5TMPA 3K73O 4JQYA 2WIBA 5JSYA 5KSOA 4U00A 3VR2A 3C39A 4R71A 1Z4JA 1IBSA 3A3NA 1MB0A 2IOFA 1I7PA 1ZD4A 2LWIA 2IYYA 1DTSA 2ZETA 3DB1A 1KQFA 5ICCA 3VSAA 2OOSA 3UJ6A 5B5SA 2ZIZA 3ZVKA 1P80A 3ZVRA 3CZAA 2Y4NA 1W0CA 5IM4F 5KJ6A 3U4DA 3LQ1A 4BUCA 1EVIA 1OCEA 3U3ZA 3MS7A 2COEA 3VKUA 1NVBA 2Y1GA 3F5DA 5ICMA 2V7VA 1DVRA 2VXCA 2Y1CA 4Q1VA 4HAXA 2EGHA 3GUZA 3OOSA 2XCRB 4UXIA 3VNRA 2Q7OE 5I48A 1BE1A 1MABA 1T1IA 3BXHA 2IZOA 2HA5A 4G4SO 1XEWY 2WD8A 3AT1A 1NFQA 1T5BA 1KNQA 1PG5A 2ORED 2P2DA 4GPBA 3HXPA 3QELB 1SQ0A 5TEWA 2FA9A 2G3YA 1T6BY 2AK2A 2J4CA 4ALLA 4WHMA 2ZAOA 2WWYA 5D5PA 5GWXA 3ZCVA 2X7HA 5JG7A 3M6FA 1QF6A 1UXJA 4ER3A 1ZQ1A 2CVZA 1IK6A 4MS1A 2FVYA 1UUFA 5AKGA 2GPAA 1WSAA 1POXA 4MSUA 4UCWA 2QGNA 3TR5A 4RC9A 5ALRA 3A4IA 2DWOA 4D8XA 3ZXYA 1CY7A 4J49A 2XT9A 1BDMA 4HF7A 1THZA 4HAIA 4D02A 1KU6A 2HHLA 3OCCA 4HAUA 4Q93A 2W6OA 4M53A 4PLYA 2Q3JA 2EDCA 4TXLA 1ZSVA 4L57A 4HUTA 1Z47A 3LLSA 1QWOA 4RELA 2OD2A 3I72A 3PVSA 5E6SA 3WLFA 2AEEA 1X14A 5KC8A 2PA0A 2ISSD 3DVQX 1QKKA 2QVCA 3OZXA 4ZOBA 4CQNA 2G4LA 1KFEB 3EISA 1JBKA 3Q8KA 5IEJA 2AFHE 1PGQA 2EKQA 4NDZA 3W77A 3MUNA 1EAMA 3BWCA 3D8NA 4DJJA 2O0JA 1JWLA 3G9QA 3RUPA 4MGKR 3PXGA 3CU5A 5E3JA 5DN6A 2RHRA 3HB4X 1EX7A 2Q28A 1UL1X 3KP1A 3NX4A 4IHKA 3IX7A 4J2HA 4MO2A 2CFRA 5FLYA 4KIUA 2GCEA 3GOHA 2CDNA 4O8CA 4CTKA 3OFKA 1FYXA 1LLCA 1MT3A 2VNKA 5HF9A 1GLGA 3W9SA 2B4RO 1KGDA 1E0KA 3FNBA 4ZO7A 5FEUA 1TTTA 4MV6A 5DYWA 4TV8A 4ASUA 5BNZA 2QN3A 2X15A 2IVFA 2ZS9A 1OB2A 2QMUA 4TQGA 1YRWA 2RGEA 2BZ0A 3L40A 3ZBTA 4NBVA 1OX6A 4YJFA 1NT4A 3E05A 1DBVO 3GRAA 1AMUA 2K2WA 2R8OA 1BFUA 2WJWA 2ZIXB 3VPFA 5BYAA 1U99A 4DWWA 1Z74A 5HMLA 4ENQA 2FN3A 3CNHA 4M9QA 4QDZA 3EOAI 1YKFA 3B36A 4QLOA 4BZWA 4CLEA 5I4BA 5F98A 2ZWOA 3SYTA 5JMOA 4P0PB 1ZN7A 2HMVA 1O97D 4FBLA 2PYDA 1M2WA 4Y9TA 4Z6KA 4UZEA 1WULS 4NMXB 4JXKA 3ZVNA