1HE1C

Crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
176
structure length
176
Chain Sequence
b'PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOENZYME S
publication title How the Pseudomonas Aeruginosa Exos Toxin Downregulates Rac
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 60
structure length 176
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he1C00
3IO5A 2WWHA 5CITA 3O47A 2ZYUX 1Z0IA 4UNPA 2YJTD 2XTNA 5FL7A 1K5DA 4JT4A 5L3QB 1II8A 1XRJA 4LJ9A 1XPUA 4RD0A 4NCHA 1MO5A 1TQDA 3BRWD 1JI0A 4ARZB 2IT1A 4DLSA 2R6CA 1DPFA 1KSJA 3CX7A 2RGAA 5HE9A 1JEEA 1KOFA 4NYIQ 4TT3A 3WHKA 2ZM5A 2P5SA 5KSOA 5JBQA 2JDID 2VP0A 2ZI9A 2EWVA 3PJRA 1ZM7A 4QM6A 2OILA 4G5RA 3AP1A 4L15A 2W2XA 1BIFA 3SJCA 4ITRC 4XOIA 1Q12A 1OIVA 3C5CA 3NEYA 4ERNA 3RAPR 2V7QA 1KI2A 4F4IA 4LYAA 4RVCA 3B8HA 2LCFA 5IF9A 3PIRA 3KB2A 3F0TA 4G5SA 4ESVA 2FN4A 2OLJA 2YC4C 1KI6A 1TQ4A 4WAUA 3K0CC 1Z83A 4TLDA 2O8CA 1G8HA 3ONWA 4CIDA 4KU4A 4W5JA 5KUTA 1F2UA 3WBKA 1HV8A 2VF8A 4DJTA 1SVKA 1RIFA 3IQWA 4L8GA 2NGRA 1ZNYA 1QVRA 4Q1EA 4PQYA 3QXXA 4A2WA 4ZDIA 3KQLA 2EYUA 1AQYA 2NPFA 1M1YE 2FPKA 1OIXA 1LS1A 2B8TA 2FSHA 2OCYC 3GLHB 1ZM2A 4C0LA 4A92A 1M6NA 5BXQC 3K8YA 4TSFA 2A5DA 5H8WA 5CM8B 4CW7A 1KJZA 4MQBA 3BFXA 3CH4B 3T06B 4MUAA 2Z6VA 4FMCB 4BWYA 4EQ6A 3CONA 4DIEA 3I8SA 2O8DB 2VHJA 1Q1EA 4IVRA 1R7RA 2Z4SA 3DEFA 4OJQA 3SOPA 3B85A 2RMKA 4MGIR 1ESNA 3CRW1 3ZIAA 4FN5A 3ECCA 1KAGA 1OYYA 1N6OA 3P26A 1XD8A 4Q7MB 4BGDA 2CHGA 3KZ1E 3HP1A 4IOJA 5FL7D 1YHNA 1E2GA 5FTNA 3FVQA 4TMTA 1Z22A 1G7RA 3C16C 4M1TA 5JWHA 1Q1ZA 4FINA 1FZQA 4TYYA 2IUSA 1Z2CA 3CWZA 2XXAA 1TL7C 5FI1B 4PPQA 4B71A 3LLMA 2BBWA 1QDEA 4OK3A 4Q9HA 4A6XA 2FF7A 4ZKEA 4P31A 1CR1A 4M21A 4DXAA 3BORA 4IRUB 4NZYA 3AVVA 4TT3D 2XAUA 4Z51A 2WTUA 5JJLA 2QM8A 4FI3C 3AKYA 2NOAA 4QHTA 5AK0A 3X1DA 2WICA 2ZS9A 1S8FA 1XJQA 2QENA 3SQXA 3A4LA 1HY3A 1QHSA 4LJYA 1Q22A 1W36D 2AKYA 5FOVA 3VR2A 2QPAA 5AUNB 1ZNWA 3WMEA 4Q66C 5EE1A 4I1SA 5EQTA 3X1WA 5DISB 2QG6A 2H92A 4HAUA 2HCBA 4FMCF 3UIEA 1OXSC 1XB2A 3FDIA 4A0FA 4XJXA 3QXHA 1NN3A 4HATA 1JALA 2YOGA 1E79A 3VKWA 5KPDA 3B7GA 1QRAA 5LD2B 2V8OA 4HB3A 4TLEA 3UMFA 4B3XA 2R6DA 4NONA 1JJ7A 3QI2A 2NO7A 4O25A 1FX0B 1MO4A 3TVTA 2JLQA 1UJ2A 4PQFA 2CL6X 2H1LA 4GNKA 1T0HB 4GMXA 2ORIA 4LV5B 4K81B 5LB4A 3ASZA 1J8YF 4L9WA 3UKDA 1DAMA 1P61B 5FI0B 2UKDA 4KVAA 4FW9A 4ZKDA 1PJRA 2CL7X 2UZ3A 2ZEJA 1JQLB 2J46A 2ZU6A 1YE8A 2JJ1A 2X2EA 4WZ6A 4CEJB 3TUZC 2OBNA 2PLRA 1E3MA 4Q4LA 2F6RA 2HJVA 1SQ5A 1XD2A 1OH5A 1W44A 2RGDA 1SZPA 1SVWA 4LPKA 5E7JA 1WBDA 3QENA 1O3YA 1R10A 2CCGA 3LNCA 3R7WA 4BRUA 3U4QB 2IS6A 2B6HA 1MOZA 2VSOA 5FBVB 4BFWA 3P4YA 5B58C 3Q72A 3K0AA 2CMKA 2JGNA 1S4QA 4M9XA 3RS2A 4HEJA 4HUTA 1NIPA 2C77A 2JLSA 5C4GB 1MRNA 1GNQA 2ZSDA 3OIVA 1ZD9A 4LJ7A 2QEQA 5J4VA 1RC8A 1E9EA 4AYXA 4IDHA 4OI4A 4F4JA 1E9CA 3RSOA 1NIJA 4A15A 1SXJC 2AXPA 2X19A 4LV6A 5TY0A 4G5GA 4B2PA 2DYKA 1J7KA 3GJXC 4Q9KA 4DLTA 4X8MA 1UEJA 4IW3B 3UANA 4MGZR 2QP3A 3SYKA 1OF1A 2AWOA 4GI7A 1DO2A 4KJZA 1N6LA 5EZ6B 4BLQA 1W4AA 3LQRA 2QGNA 1JAIA 1RKBA 1YR8A 4JLPA 4QL3A 5LPNA 4ZCIA 3TR5A 3A6PC 1U9IC 4IDNA 4OQNA 3RRZA 4A2QA 1LF5A 3A4NA 4RD3A 3C14C 1VIAA 1R5NA 2EFDB 3MCAA 4GPTA 3THXA 2JIZD 3HDTA 1VYUA 3QXSA 4Y0AA 3AVWA 1XCPA 1P62B 1VHTA 2IYUA 4TN1A 4DCSA 3CF0A 2NPIA 3AVOA 2HT1A 1NJGA 1VCIA 4DT1B 1H8HA 4PR0A 4B3GA 3WNBA 4NL4H 4HB2A 3OHMA 4Q4HA 4EJSA 1US8A 4EFLA 1SHKA 2WWWA 521PA 4V0LA 2X2FA 2CEAA 4YDHB 2QU8A 2ZR7A 4DCTA 4ASUA 2H17A 2ZUBA 2ERYA 1OFUX 2FNAA 1G17A 2RGNA 2ZRHA 3DOEA 3LVQE 2IXFA 2J5XA 1XEXA 1LY1A 2I3BA 2OXRA 2OFWA 2PZGA 1W5SA 2FFHA 1DG1G 1X6VA 1TADA 3LA6A 4AC9A 4GT1A 4ON9A 2QUZA 3BJIC 3QSYA 5AJVB 3G5UA 3EZ6A 4B33A 3T1QA 1DE0A 2GF9A 2JASA 1FP7A 2QMHA 2VHTA 3CZQA 3S1AA 2BBOA 4US2R 1KO4A 4CF7A 5B64A 1GZSA 4G5OA 2GZHA 1KI8A 2BBTA 4NPHA 3PUWA 4YMVA 1F5NA 5HCNA 6Q21A 3K0EA 1E2DA 1LW7A 1Z28A 4Z1MA 2ANCA 5DE3A 4LCBA 3T34A 3CPEA 5K8UA 1E2IA 2AK3A 4ZPXA 1R8QA 3VU9B 3LFUA 1X8JA 1OFIA 1P9RA 4JS0A 2GVZC 4M1YA 4ZIRB 2C96A 2WKRA 5JEDA 1N6NA 3HPQA 821PA 1KDRA 2ORWA 3CB4A 4O2RA 2OSBA 2VO1A 4II7A 1ZC3A 4LX0A 5KTYA 2O8EA 2ZJZA 3CIOA 3MRSA 3TAUA 1T9HA 3BH0A 3OEEA 3U44A 2P6UA 3U7FB 5JRJA 4TLAA 1RRCA 1AKYA 4URYR 4Q1DA 1G1MA 5EE3A 1E2HA 3TIFA 2FZLA 3BFVA 4DKXA 1GRNA 2QAGA 4Q19A 1QVAA 2ZUDA 2BBSA 4DUGA 2YWHA 4B6EA 2HEIA 3AUYA 4B75A 3NVAA 2OXCA 5L3SB 1S3SA 1UDWA 2FFAA 1W46A 2ZR9A 1HT2E 1H8HD 1OLOA 3MFYA 1XTSA 1SULA 3VR4A 3CW2A 2EYQA 2C9OA 5F3WB 1G3MA 3K09C 3NC0C 4JKYA 3PQCA 4ASUD 4OK6A 4ZCMA 5ELXA 3H0KA 3RWOA 4A8JC 2YNMA 1BYUA 2VP2A 2FZ4A 3KX2A 4ZI3A 4RD1A 3KL4A 1KSFX 2B8WA 3PEVA 3VKHA 5FR1A 4E5UA 1IJFA 3GMTA 2GCNA 3AGPA 1U81A 5KPJA 2H18A 3JVVA 4IKEA 2ATVA 4DDUA 3SZRA 5A5GA 1N0WA 2VQSA 3KXKA 4CEIA 2RB4A 3WMFA 1IAQA 1ESMA 2WHXA 4YXWA 2ZANA 3EZ9A 3IPYA 1OXTA 3E2IA 4OI2A 1LV7A 1S1CA 4E07A 5TXGA 4RFSA 3KJIA 2I1QA 2GJKA 4B35A 4KITB 2GTPA 1WA5A 4F93B 2D7DA 2H7VA 3HWSA 1M34E 2GZDA 1U8ZA 2RH5A 1OPXA 4Z1MD 3E1SA 1XXHB 2LWIA 3BXZA 1R0YA 1U90A 3GLIE 4C3ZA 1X3SA 1RE0A 2WMNB 5CM9C 1G18A 1WP9A 5EZ5A 2FSGA 3ADBA 3M4YA 4C30A 1KI4A 1C1YA 1M7HA 4OHZA 2FPMA 5IK2A 1KO1A 2DBYA 1W4CA 2A5GA 3HPRA 5CK4A 4B73A 1P60A 4YMTA 2JLUA 1OH8A 3OEED 2XZLA 3BH7A 2IUUA 2PMKA 1X1SA 1FPMA 1KO5A 3FGNA 1QHNA 4Q4AB 3F5FA 1JR6A 2XZPA 4Q9IA 2IYQA 2GJ8A 4R9UC 4J0QA 4Z8XA 5E4FA 3SU8A 3R9XA 2D06A 2V6JA 3Q3JB 4LJAA 2WKPA 4DUGD 5CJPA 4HUQB 4P4SB 4MKIA 4GBMA 1QBKC 1F2TB 1S96A 3QVVA 3BB1A 3X1YA 3MWLA 4XD7D 1A82A 1G4UR 2XSZD 1Q57A 2A7QA 2CCJA 3U7EB 2FG5A 2XTZA 3KKMA 2ZS8A 3VFDA 3ZGXA 2F1JA 2J0UB 3LVRE 5JRZA 3RC3A 1G5PA 2G0TA 2A5JA 1H8ED 3ZZUA 2DR3A 1KHTA 3U61B 4MGYR 2DPXA 4UJ3A 3Q7QA 2WPDD 3IO3A 4EDHA 3DZ8A 2A5FA 1Z2AA 3QVUA 2CK3D 2IW3A 2QE7A 2WWXA 3GLGE 2D2EA 2V4ZA 4PO1A 1RPZA 3AF3A 4NCIA 3GJ8A 1CS4C 3DVLA 4M1KA 3QKRB 2OLKA 2WJIA 4GZLA 1SKYE 4HAYA 1TU3A 4LHWA 3SC3A 1OH7A 4EPVA 4YXWD 3ZS8A 4RFVA 2FE4A 3MWYW 4LSGA 3PUVA 3ZVMA 1KDPA 2GILA 3Q9LA 4M1OA 3A1TA 1SVOA 4D2IA 1E69A 1AKEA 5CJ2A 3EPJA 2ODEA 3NXSA 1GM5A 4LK2A 1R5OA 4QBGB 1CJTC 1W0KD 3NWJA 3T1VA 5C2JB 4Q7LA 2ZRDA 3SFZA 4BECA 3K70D 4N1AA 2ZYWX 1U0LA 4HZUB 4Y0VA 3CUEF 1RJ9A 2D4HA 4HZIA 5KU1A 1IONA 2GJ9A 1LB1B 3RSLA 2C95A 1F60A 4A0RA 3CWQA 2IL1A 2WIBA 3I5YA 2V9PA 1B0UA 3VR3A 3B1XA 4LJ8A 2V54A 4NBSA 3IEUA 4URZR 3N70A 5FBQB 4B6FA 5DSZA 3MAAC 1IJEA 4WA7A 1C9KA 4AWXA 3GLIA 2WJYA 1V5WA 4NYJR 2G83A 3SJZA 5JZVA 1CU1A 3GJ5A 3LXRA 4NHOA 1OB2A 1J99A 3DDCA 4PZZA 4QFMA 3NH9A 3B2EA 4GOXA 1R6BX 4KFUA 2ZSBA 4LJ6A 1R0WA 5CK5A 4D80A 5B57C 3WYGA 2JA1A 2CCKA 2G1JA 2H16A 2GHIA 1HH4A 1VCNA 1CJKC 1J8MF 5FOUA 2WWGA 3HJNA 1M74A 4HSEA 3F3YA 4OQMA 2JAQA 1LNZA 5FPSA 4FWTA 1RW4A 3M1IA 4X8OA 1AN0A 4LYJA 1N6KA 2ZRBA 4P3YA 1TQ6A 3L0PA 1SXJD 1P2VA 2ZRLA 4UKDA 1KK3A 2CJWA 1EFRD 1II8B 1WDTA 1U8AA 2EWWA 1HURA 2IS2A 1GKYA 1G16A 3GJ3A 4Q02A 4EPTA 1FL9A 2GCOA 5HCIA 2QE7D 2X8AA 3KTAA 4QBIA 2PH1A 4IXMA 3DZDA 4WW0A 4HLUC 2P5TB 3ADDA 1FP6A 2RGEA 2QN6A 4EPRA 1OV4A 4PX9A 1HE1C 1A2KC 4RKEA 5KNCA 5TMPA 4AKIA 3H2YA 2ONKA 4CVNA 1MO6A 1RZ3A 4JLVA 4P32A 3P20A 3R8FA 2ZYTX 4EFNA 2BHRA 4A36A 4OHYA 2XJ9A 2I1VB 1KI6B 2HXSA 2ZAMA 2OAQ1 4JYCA 3TLXA 2O8CB 1N5IA 2ZE5A 1OKKD 2FSFA 1N0UA 4JVSB 4KAXA 4U7DA 4EIWA 2BEJA 2WOJA 1F2UB 4M4SA 1DELA 4MYCA 4PANA 1CXZA 3R20A 1AS2A 3L0OA 1LTQA 2BEKA 3VNVA 1E2KA 1G20E 4MRPA 3OFNA 3DPUA 4Q9JA 4BEJA 1NVVQ 1SGWA 2VEDA 5EUMA 1VCOA 4YONB 3THOA 1E2QA 4MUBA 1TUEA 2QM7A 2DHRA 2FGKA 3N2EA 1EGAA 4JLDA 5UKDA 2J3EA 1ZM9A 8OHMA 2WWIA 2J7PD 3OIUA 4DLXA 3I32A 1XX6A 4MDEA 3IHWA 1WE2A 2A3RA 3RC8A 1A5TA 2VYFA 4QJ5A 3ZQ6A 4TQ9A 5DNYB 4HAVA 1AZSC 1XDBA 3MGCA 2J7KA 4DRZA 1E0JA 1ZM3A 3NEJA 1IN6A 2QPOA 2ZJYA 1G3QA 3QPVA 4PHGA 4TTQA 1E99A 1AGRA 1OFTA 1QG2A 2W2TA 3B9PA 3EZ7A 4A82A 1XMVA 3A1VA 4KLNA 2N42A 2P67A 4LOAA 2ZSAA 5E7IA 3BD9A 3Q85A 2ZRGA 1ZNZA 4NMMA 2ZAOA 3U2QA 1GRQA 2QP9X 4HDOB 1MO3A 4JL8A 121PA 3JVUA 4HYYA 3DL0A 2Z0MA 4Q21A 4X8HA 3T35A 5KNDA 3UG7A 3QEOA 4QNRA 4YMUA 3UG6A 1VG1A 3PUYA 3LX8A 5DLQC 1OHHD 3RS7A 2I4IA 5FTMA 1WB9A 1UKZA 4OL0A 3GP8A 4HAWA 5D3QA 2ZRMA 2WWYA 1T8TA 2NZJA 2WAXA 4MKHA 5EE5B 3TSOA 4TL9A 4UXJA 4TZ6A 1G8GA 5GVRA 1GUAA 2PJRA 3THYA 4ILEA 3AF4A 1KZ7B 4WIAA 3SDZA 4Q9LA 3SHWA 1COWD 4BQSA 5CB8A 1TF2A 2Q3FA 1G7TA 3PITA 4R71A 4F4CA 4G0NA 1M2OB 2AN9A 3OESA 5LD2C 3LW7A 4RZ3A 5HTKA 4MYTA 4R98A 4BFZA 4EPXA 4BLTA 5JJIA 2PZEA 2VSFA 4MA4A 2J0VA 3I3SR 1Q44A 3OFND 4IOKA 5EXTA 1AA9A 2DCUA 2HYDA 3VHLB 2MSEB 4QGHA 2O8BB 1T6NA 1TF7A 3HU3A 3FMOB 3W34A 4IDPA 1GP2A 4L4UA 4URVR 2IS4A 4RD4A 2SHKA 1DBSA 1XJCA 3A36A 1KJYA 2VHCA 3H84A 4HLCA 2GBLC 4V0NA 3TKLA 4QHYA 4H9GA 4DCNA 2ZSEA 4D4LA 1OB5A 3SQWA 1Q0UA 4B3BA 4Z8YA 3EARA 3EIQA 3D6TB 3SS8A 4MYUA 1FQKA 1DAGA 2GDJA 5LBIA 2CLSA 3CX8A 3TAHA 1XD2B 3UATA 4R2HA 4AKEA 5J4KA 4OI1A 3G0HA 2OE2A 2C9CA 2ZRIA 2WAYA 3R7WB 3CZPA 2OUKA 3GLHE 1QHGA 1Z6TA 3U6KA 1W4BA 4BLOA 3CRRA 1G291 2KWIA 2WSMA 2XJ4A 2ERXA 4Q5IA 4JBYA 2IWRA 4DCUA 1QHXA 5TDHA 3B13B 3IQXA 1N6HA 1P3JA 2XX3A 3FB4A 3QXCA 2NO6A 3OZXA 3WY9A 3UWOA 4XWOA 1GNPA 4XSGA 4NYMR 4B2IA 1IXRC 2D62A 3LLUA 4KFTA 4KHZA 1MV5A 2IYSA 3R9IA 2C78A 1UBCA 4I1OA 2XB2A 4DCVA 4I99A 3RRNA 1W1WA 4PSAA 2NG1A 1JEDA 1UADA 4PO9A 2B92A 2Y8EA 4GOJA 3TNFA 1Z06A 2LKDA 3CLVA 2P6NA 1K6MA 5AR1A 1N6IA 3FMIA 5G3YA 2WBLC 2HJGA 3WHLA 2KI5A 3B82A 3PEWA 5KDDA 2C9YA 2H8KA 2IEYA 3LAWA 2GF0A 2BM0A 1OE0A 2PEYA 2W83A 4WZAE 5L3QA 3THXB 1WRBA 4Q1BA 1H65A 2YV5A 2D2FA 4GOKA 1VHLA 2VHUA 3H1TA 4LBYA 1KK0A 2N1BA 4LRWA 4E22A 3NBXX 4TMVA 4ARZA 5ANRB 4NYIR 1ZIPA 1J2JA 4US1R 1G5TA 2JIZA 3TUJC 4Q4HB 3MLEA 4PTLA 4TZ0A 4EJSB 3EZFA 1ZD1A 4EFMA 1Z63A 4OK5A 4XSHA 2BVNA 4IDOA 1EFUA 1ZUNB 2ZI4A 1QG4A 4P4UA 5CLQA 3I92A 3K0FB 3PFIA 1KNXA 4BZQA 4QM7A 2IS1A 2W2VA 1Z6XA 4KXFB 5SZIA 1XEXB 3QG5A 4BFUA 1TQ2A 4TL8A 4RKFA 2ZJOA 4AYTA 2JLZA 4M0LA 1NF3A 4ZDJA 2C2HA 3ZD6A 2IXEA 2ZJ8A 3NG1A 1FMJA 3OE7A 3ZVRA 5FOWA 3CO5A 3HU1A 1Z0FA 3KUCA 4MRNA 3U5ZB 1D9ZA 2FFQA 2F3RA 2REOA 1A4RA 3S1AB 1D2MA 3CX6A 1ODFA 3U3MA 3X1ZA 3AVXA 2E9SA 1N0VC 1E2NA 2NTYC 4H1UA 1ANKA 5IRCD 1NRJB 5FR2A 2QTHA 4OBEA 4OQLA 3I62A 4JYBA 1VYTA 3A4MA 2AFIE 3FHOA 4F91B 2BWJA 4OQFA 4PC7A 5GJBA 4UJ5A 3AF1A 3SEAA 1AK2A 1RRFA 3LRPA 3TJZA 4KFSA 1N5JA 4R2IA 3RDPA 1W0JA 2QY9A 3NTUA 4JLKA 1X86B 4TYPA 2O8EB 1XU4A 1ZP6A 2O8DA 1NI3A 1J70A 1K5GA 2PMDA 3ETLA 2CXXA 1GL6A 3U44B 2QMEA 221PA 5G53C 5B2ZA 4OHVA 3T5DA 3U6BA 4KLZA 2V3CC 1F3OA 1GDDA 2PEZA 3BOSA 3C4JA 1AQUA 4TL6A 4D25A 3T61A 1EWQA 3U3OA 5HE8A 1ZNXA 2QAGB 1EWRA 3KJGA 1U99A 3PUZA 3A1UA 3ADKA 4DLUA 4C2UA 2GJSA 1GL7A 2XTMA 3AF2A 2HF8A 1DO0A 1QZXA 1E2PA 5EJEA 4FIDA 1RRGA 2UZIR 1U2RA 4QXAA 2W00A 4KYIB 3K9LA 4JLOA 1OT3A 1U8YA 2BCGY 1P4SA 3SJAA 5EXSA 1R4AA 3VX3A 4G01B 3BWDD 2HXYA 1N6RA 3ND9A 4PC1A 2GK6A 3LBIA 5H68A 1YR9A 1J90A 4IOLA 2R2AA 5J47A 4AY2A 2WWFA 1LFDB 2FEMA 2IYVA 4S2EA 1O87A 5M04A 5DHAA 3ZZ0A 5G41A 1IXSB 3AH8A 2ZRPA 3FTQA 3NDPA 4KSBA 4CEIB 2ORVA 3D8BA 5IHPA 4TTPA 4DB2A 3IKJA 4AD8A 3IBYA 3EC1A 1MABA 4B34A 1KSHA 3OE7D 1TF5A 2PL3A 1YJ5A 2GVDC 2KJQA 2VSXA 3K9NA 1GRRA 3RWMB 1IN7A 1M7BA 4EAQA 4RFSB 3D31A 5FTKA 4B2LA 3K0CA 4M53A 4DIDA 4C0AC 1IN4A 3SYNA 1FUUA 3M0EA 4LUCA 5DYGA 1W47A 2ZI5A 5J5CA 4JLAA 2FA9A 3BC1A 3K70B 5TVKA 3B1WA 3MWKA 5KDOA 2PBRA 5JCPA 4YC7A 1L4UA 3AV0B 4OHXA 2ZETA 2V55B 3JZAA 2Q21A 1SKQA 1YZGA 1W0JD 4QOSA 4PSKA 1ZYUA 5FOSA 4DSNA 1NSTA 2J9RA 3EW9A 2G3YA 1CR2A 3CKLA 5HKKD 2R6FA 1AGPA 3T5GA 2EFCB 1WMSA 1CULC 2DFKB 2XB4A 4LBVA 4W5WA 2PX3A 1JBKA 4V03A 2YOHA 5EXXA 3T1OA 2OFOA 3KQUA 2QROA 3EC2A 5BN3A 3GLFE 2DFLA 5C46F 2YHSA 4JBXA 4A1FA 5KOYA 4B48A 4BASA 1ZC4A 3GJ4A 3P4XA 2VH5R 3EIHA 1ZINA 3DHWC 4LJ4A 3REGA 1ELOA 4GMDA 4B32A 1DAKA 3CR8A 3AUXA 4C0SA 4FWIB 4I1VA 5A4JA 1DAEA 2FX3A 3V9PA 1EFHA 3PEYA 2VHQA 3WP1B 5D3MA 3W5IA 1SXJE 2VP5A 2VRWA 4LBWA 4LWZA 1AS0A 1KI3A 4Q00A 2ASEA 4KODA 1T0JB 1CR4A 1XMJA 2QGZA 3AP2A 3IIMA 3L0IB 4HAZA 4XD7A 3GQBA 4MRVA 2XSZA 5FTLA 3LY5A 2CBZA 4D4MA 1GVNB 4PSVA 4LC1A 4KVGA 2EFEB 4DEXA 3TE6A 5J4HA 4G5QA 4BPBA 4M8NE 3UWKA 5HZKA 2B21A 1H8EA 3DM9B 2XOKA 3W90A 3IUYA 2YKGA 1Z8FA 2Q3MA 2BKUA 3TBKA 1UPTA 2JLRA 2G1KA 1VG8A 4Q4JA 1DAIA 2WPDA 1GKUB 3I73A 5JLJA 2VF7A 2C98A 3VAAA 4AG6A 4PFSA 1G21E 2Q9AA 2XITA 3MWJA 1Z0DA 2WVJA 4AI6A 2CK3A 4TLCA 4CEHA 1VIYA 1T91A 3ZLJA 1P7CA 4M22A 1S2MA 1R8SA 3G82C 2CL0X 4QC2A 4MDFA 2KBEA 2EU8A 4MRRA 3KXLA 3RRYA 2W58A 3MG9A 1DTSA 3GEEA 3C41J 3K1JA 3GJ7A 4HLQB 4C0BA 1XTRA 2XZOA 4PAMA 1KO7A 2QTFA 1JR3E 4B44A 1G4AE 4EUNA 3AVPA 3QIAA 3EPLA 1YZQA 2ZRJA 4UNSA 1G8YA 2IYWA 2WV9A 3FHCB 1NN1A 4RZXA 2AWNA 3LW8A 2O8FA 3LD9A 4GL2A 1W0KA 1M8PA 2QORA 3QOFA 2J45A 5FBWB 3NHBA 3TSWA 1II9A 1SVSA 2EVWX 2GEVA 2GWHA 3NKVA 3GLIB 2ZYVX 4RCZA 5C18A 1Y63A 2KBFA 2QL6A 4PQRA 4S35A 2BKEA 5G40A 1KKMA 2BMFA 1KYIA 1BMFD 2NMVA 1OXVA 1XXHE 3FE2A 5CDFE 1G9XA 1XJ0A 3WRYC 3MSXA 3RYTC 4N0DA 3IIKA 2VP4A 2WJJA 5P21A 2JATA 5JSZA 1JPNA 4A9AA 3IPXA 3AP3A 2WSSD 2O0HA 3U60B 1VDZA 3AF0A 1E0KA 1FW6A 1XTQA 3AVYA 3CRMA 3ZD7A 2O0JA 2X77A 4JSYA 5K8TA 1E4YA 4D6PA 3P1JA 3DMNA 3VR5A 4CT4B 3GLFA 5B30A 4KBFA 2FEOA 1ZU5A 1X8LA 2JEOA 1YVDA 4US0R 1E1RD 1F48A 1KTVA 3QEJA 1YZUA 4ESHA 1XZPA 3OAAA 3RRMA 1WXQA 4OYHA 3IDQA 3QF7A 3MMPA 3DO6A 2F55A 1Z29A 2RKOA 2RHDA 2XOKD 1SXJA 2GCOB 2IYZA 4QNMA 5FUYA 1PLLA 1EFRA 3KTAB 4TWZA 4TQUS 2EW1A 4DSOA 4BUJA 1WBBA 1ZVQA 2Q6TA 2KB0A 1Z07A 3GJ0A 1XCMA 3BS4A 2EFGA 4WZBE 4RY2A 1KY3A 5FPHA 5IDVA 4D26A 3FHTA 1UF9A 1TUIA 5AJWA 3UXMA 3U7GA 1Y3AA 2IA5A 3WNDA 3BERA 3LO5A 2OZEA 5EP1A 1W4RA 3AB3A 2IYLD 3RS4A 4CRWB 2MSDB 1E4VA 1KMQA 1U9IA 2GXUA 3TSZA 1LVGA 3THWA 1BS1A 4KFRA 1SKYB 1NY5A 4URWR 3WYFA 2QBYA 3MD0A 3VKGA 4B3DA 1DS6A 1JNYA 4NKRA 2F43B 4AYWA 4P33A 2ZQ5A 5AJXA 4LPSA 1BO6A 3KJEA 1KI7A 2VLIA 2OHFA 3CRQA 3CPHA 3I8XA 3N5CA 1E9SA 4LY6A 1GL9B 1OW3B 2W0MA 2DWOA 4GZMA 4JLMA 2G0NA 2GAOA 3AKCA 3GFOA 2WIAA 3B1ZA 4E03A 1A1VA 1OKKA 3C7KA 4B3FX 1UFQA 1X1RA 1KKLA 4TYNA 1XPRA 2R44A 4P0TA 4CT5A 1PLJA 1NL3A 2MMGA 1XBTA 1D8TA 3AVUA 4WVFA 2FDCA 5EE0A 1D9XA 3RS3A 4Q1AA 5C1BA 4AKHA 3SBDA 3OIWA 5KSZA 3VR6A 3LBNA 3EIEA 3EPKA 2FGJA 2Q0HA 4AK9A 4M9ZA 2JJ2A 4LHYA 2J0SA 4M1WA 4H1VA 2BIFA 2GRJA 2YINC 1VG0B 1GAJA 4DZZA 5BN4A 1EX6A 1AZTA 1ZJ6A 2J7PA 2ZVQX 1XXHA 5CDFA 3ICQB 4GP6A 4KBGA 4LZZA 1HA3A 4HB0A 3W3AA 3QNUA 2OFXA 4BFTA 5BWMA 2ZXUA 4UNQA 5FBLB 2OO7A 2BMDA 4ACBA 3KQNA 4ZCLA 1G6HA 3FOZA 2ZIAA 1E9BA 3QG1A 3P27A 5AUQA 3OAAD 2ZR0A 1KK1A 4LGMA 5L3VA 1AJEA 4DSTA 4MH0R 4B43A 1E2JA 4HI0E 1XFAA 2R8RA 1E2LA 3KFVA 3T15A 1B23P 2Z43A 3QKSA 4A0GA 4IXNA 1EX7A 1NNEA 5FBRB 2E1RA 2GXSA 1KDOA 2ONJA 3WNCA 4PAOA 5EE9A 3J81k 3ZVLA 4N3NA 3FMPB 3EG5A 1SVLA 3BB3A 3TUIC 1L2TA 1OHHA 5LB2A 4C4PA 3GCGA 1FUKA 5F2EA 1XEFA 4FMDB 1KK2A 1F2TA 5DHFA 1U98A 4F7WA 621PA 3THYB 4GRAA 3W6NA 2JCSA 4YQFA 1G3UA 4IFEA 4TL7A 3TW8B 3FKSD 2ZU0C 4YMWA 1EXMA 1Z3IX 4WOPA 2HUPA 3GLGA 3SN6A 1W36B 1RYFA 1G5RA 1Q20A 2ZITA 2QNRA 2JLYA 3Q5EA 4MGKR 1COWA 4M1MA 2V1UA 1QF9A 3NBZC 1S0UA 2FOLA 3PR1A 2AR7A 1P2TA 2R6AA 3PG5A 3FFAA 1BYIA 4PHTA 5JWRA 3K09A 1QHHA 4BZPA 5CB6A 1JB1A 1T5LA 3LQQA 1JR3D 4HLDA 4D81A 2IYYA 1BKDR 4PXAA 1TEXA 1E9FA 1JJVA 2P6RA 5C4MA 2IHBA 4XTRA 4A8JA 4DDVA 5GADl 2O5VA 1VMAA 4V02A 2WJVA 4A0HA 2FJUA 3PEUA 4XTCS 2NQ2C 3CH5A 3KKOA 4K46A 4CGZA 5DYIA 4TMKA 2PZFA 2WJHA 1JECA 3ZH9B 2ZRNA 2JJ2D 3SHFA 2RHMA 2F9MA 2NIPA 1P9WA 3E70C 3EX7C 1UKYA 2PT5A 2W6JA 4AURA 3SE0A 3H4MA 1Q1BA 1E6CA 1EFTA 4UXHA 4EQ6B 4QG7A 2C8VA 2IHYA 2FSIA 1G8FA 2G6BA 3B1VA 1XF9A 4FMDF 4DDWA 5KNBA 1LF0A 1HQYE 4JVNA 3RNLA 3WXMA 3A37A 4JL6A 4KCGA 2OCBA 4LBZA 1DAHA 4QRHA 4BFYA 4EKDA 1NMYA 5JHGB 2AHOA 5CYOA 5FUWA 4JKIA 2OAP1 1V43A 3AVQA 2ZUCA 1KI9A 1BH2A 1Z6YA 1ZUHA 2GK7A 3M6AA 1NG1A 3SYLA 4PAQA 2XXAB 3IGFA 1QHIA 1Z0KA 1ZD8A 4Q48A 4QJ4A 1NKSA 3TVDA 1FNNA 4RJLA 1HUQA 2BV3A 4A4DA 2PCLA 4JBWA 1E9DA 4NCKA 1GSIA 1CTQA 1OFHA 1MRSA 1A2BA 3LV8A 2YWFA 3CF6R 3QY0A 3T12A 2IF2A 3ZZTA 4XVUA 1DG3A 3F8TA 4TLBA 1I2DA 4NH0A 2CHVA 3A8TA 1NN5A 5FH9A 2W0SA 2B7BA 2V6IA 4K8OA 3A1WA 3UK6A 2OCAA 1PLKA 2HCJB 2OBMA 4LJ5A 1MH1A 4Q7KA 3RS0A 4BRWA 1S1MA 3NBYC 2PJZA 3NBFA 4RD2A 1UBEA 3TQFA 2ECKA 3LBHA 1OYWA 2XNDD 1ZMXA 3BIFA 3FWYA 5JS7A 3A1SA 3EASA 2YC2C 1RYHA 1TPZA 3KB1A 3TR0A 1TEVA 4KYUA 4PZLA 1UEIA 4ZDKA 3PVSA 4XWKA 4IFBA 2QT0A 2F3TA 4URUR 5DI3A 3W3ZB 5J4YA 3W5JA 4D0GA 1XCGB 5FPKA 5LDDC 1PV4A 3GEIA 4EJSC 2FPLA 3IIJA 2ATXA 3SNHA 3TH5A 1RFLA 1XEWX 2IK8A 4C9BA 2ZS7A 1NN0A 3KKPA 5BQ5A 3U7HB 3WBJA 1KSGA 2RGNC 2ZI3A 1ZW6A 3EA5A 3CPJB 3OEHD 2GESA 1IN8A 3ZYCA 1P73A 2EQBA 2HLDD 1ZRHA 2W6JD 3C15C 3GFTA 4IVPA 2DB3A 2A2ZA 2FV8A 1P2UA 4HDCA 4ABYA 4KSCA 2JLVA 1NBME 3W9YA 2RGXA 3HYTA 3ZS9A 3P32A 4PC6A 5H70A 3LWNA 2PLFA 4DEYA 3SI7A 1KMHA 1Z08A 2QA5A 4U02A 1CRPA 2QI9C 4FCVA 2R65A 1Z5ZA 2Q3HA 3IEVA 2BJWA 2F1HA 3QJYA 4C7OA 1OXUA 1NVVR 1OXXK 4PZYA 4Q18A 3U3KA 4C0QC 5SZKB 2Q9BA 2P3SA 2J1LA 1N6PA 2VP9A 3I61A 2BMEA 3K0AB 1OJLA 1GWNA 4QJ3A 4QKQA 1SVMA 3IBGA 3NH6A 3BB4A 5FTJA 4GDFA 3I1FA 2IYXA 5GJWC 4XWAA 1M7GA 3C8UA 3QF4A 4F38A 3FYHA 2CE7A 2WJGA 4EPYA 1VECA 3VNUA 2BC9A 1NSFA 4GFDA 2IF0A 2A30A 1L4YA 2NO9A 2FU5C 3EPHA 4TYWA 1CRQA 4B74A 2ZTSA 4E09A 4TMWA 3EWAA 4ZI2A 3FMFA 5TV2A 2VPPA 2QAGC 2G9NA 1E0SA 4DVGA 1ZIOA 2C04A 1T5IA 1VKJA 1Q3TA 1NLZA 1XMSA 4LC0A 2MSCB 4M9QA 2F1IA 1TNDA 2OT3B 1YKSA 2ZRKA 1R5BA 4M9SA 3RANA 1U94A 1IQPA 2A78A 2F7SA 4UNNA 1UAAA 3E5HA 1W48A 1NLYA 1CIPA 1P5ZB 1FQJA 2D74A 1UBGA 4UQOA 5KSPA 1EK0A 2R6GA 2OG2A 3CM0A 4HLUA 4JLNA 3U3JA 2V7QD 1US8B 5KYKA 1LS6A 4DLVA 1NG9A 4C2TA 1JAHA 2J87A 3CF2A 4L9SA 3I5XA 4YLGA 3HU2A 5AWFC 2AD1A 4FMBB 4JSTA 5TB5A 2EFHB 1YU9A 5FPTA 1SVIA 2WOOA 5L3RA 1E98A 2IWHA 1MABB 4OQXA 4QBHA 4MITA 2GXAA 2F9LA 1R2QA 2AK2A 4IEEA 1E94E 5BW8A 4DLYA 2QRZA 4G1UC 3X1XA 4NCNA 1U0HC 4JJZA 1NBMA 3DM5A 2C99A 5KDLA 1XWIA 3L8ZA 4N0EA 3RLFA 1P6XA 3V4RA 3PENA 2ZE8A 3KKQA 3BH6A 2BOVA 5DGXA 2FWRA 1II0A 3K70C 1G41A 1S9DA 1YRBA 1Z0JA 3Q5DA 4Q03A 4C0HA 4KI0A 2NO1A 4TSFD 3VMFA 3WP0A 2ZRAA 2YOFA 1RVDA 1VYVA 1VCMA 2IUTA 1IY0A 1HT1E 3GLHA 3ICEA 1ZU4A 4RSGA 2GCPA 1GIAA 4QHSA 3I72A 5E95A 4PPGA 3ZIAD 2ZRFA 1T3SA 1XEWY 2JLXA 4PC2A 1R0XA 3CR7A 4D82A 2R62A 5HKKA 2JJ8A 3TGPA 2IYRA 1EG7A 3KKNA 4D0LB 2QQEA 2RGGA 3ND8A 4OKSA 1R0ZA 4Z54A 4IJMA 5EUQB 2BJVA 1E2FA 1G64A 1KI1A 3HR8A 1NJFA 3A58B 2C03A 5CIWA 3Q7PA 4ZO4A 4D0NA 4Q7JB 5D3MB 4D4JA 1GG2A 1UDXA 2IX3A 2KE5A 2Z5FA 5E7MA 2ZE7A 4YMSA 1KDTA 4D4KA 2Z4RA 1GFIA 2IYTA 2VL7A 2CVHA 2VP6A 2FMXA 3BBPA 4URXR 4QGFA 4RZ2A 4DHEA 2QP4A 4Q4JB 1KAOA 1XZQA 2J0QA 4V0KA 1NVUQ 2AX4A 3HYRA 1FTSA 2PT7A 3PCRB 5L8VA 3VX4A 1ZAKA 4CEHB 4PPFA 4V0OA 2R9VA 1E79D 3QBTA 3UPUA 4LHZA 4JLJA 3AVTA 4LI0A 1KJWA 1RRPA 4O2LA 1I4LD 3DMDA 1NBMD 1PZNA 2H57A 3AKDA 1UBFA 3WMGA 1GILA 4YDSA 5JS8A 1G3RA 5F9HA 1KNQA 3TMKA 4UNRA 5BYKA 1CR0A 3L82B 2VBCA 1ZCAA 1FX0A 2ZI7A 2Q9CA 3KUDA 3LXXA 2O8FB 2F1RA 1AM4D 2ODNA 5GVSA 2WZQA 2ZJBA 3K0FA 4IDQA 3UMRA 5JEEA 5JHHB 2L0XA 2JJ1D 5EXPA 1FTNA 1NLFA 2B7CA 2GBLA 1DARA 3X2SA 2AL7A 1E0AA 1G6OA 1KY2A 1P75A 4CZ2A 4JLBA 3EZ2A 2DWPA 4R7ZA 3QE0A 1VG9B 2QSZA 3D7MA 1TTTA 2FH5B 3OIYA 3QKUA 4CEJA 4IOMA 4B76A 3NDBB 3KJHA 2VA8A 5H1YA 5JSZB 2OBLA 4I4LA 4DB4A 1BMFA 1IXZA 3FPAA 1W7AA 2REXB 3AM1A 2DFNA 2DWQA 3RHFA 3U4QA 3L8YA 2VTKA 3CNOA 4IHQA 4JT2A 1WCV1 1I4TD 2ODBA 4JL5A 4HDQB 5EP3A 3GLFB 1DOAA 3T1TA 2WSSA 1JXMA 2UVQA 4B3CA 4XIGS 2GXQA 3AKEA 4QGAA 5DI9A 3R8CA 2E87A 4W7SA 4JIMA 3KQKA 4JZKA 3NC1C 4C0KA 3L43A 2OESA 5HPYB 3W6OA 3REFA 4KO8A 2QZ4A 1E1RA 4NTZA 1SXJB 3FKQA 3VHXA 1XP8A 3BGWA 1N5KA 4FCTA 3O8CA 4WXPA 5BYJA 3K53A 3WRXC 1CLUA 2YYZA 5JECA 1ZBDA 2BMJA 421PA 4NCJA 4O0MA 1YR7A 3TQCA 4MKGA 2GZAA 3TRFA 4NE2A 2BM1A 2IXGA 3SR0A 1NY6A 1VPLA 1NP6A 1GTVA 3B6EA 3THWB 2QTVB 2K5UA 4BEBA 2QBYB 3V4FA 3ZQJA 2AXNA 1D6JA 4IVQA 5FL3A 3QKTA 3N2IA 3C5HA 5FPYA 5A0FA 3AEZA 1FMLA 4MYHA 4DT1A 5TARA 4DBLC 5JFGA 2H5EA 3D3QA 5F98A 1NMXA 2ZJ5A 1RJ9B 3GD7A 1XMIA 4FXPA 2CVFA 4QGGA 2OV2A 2QMUA 2HDNB 1YQTA 1W5TA 3BE4A 4G3XA 5G3ZA 1KGDA 5HZHA 2ANBA 1SHZA 1XTKA 4PPNA 4RZUA 1NKTA 1IM2A 3VR1A 2GJAA 2OM2A 2CDNA 4FCWA 4RCYA 3H86A 1CEEA 1K8RA 1JXOA 2GNOA 1G8PA 1JPJA 1L8QA 1N25A 2ZI6A 3GPLA 2QQ0A 4NYJQ 4BLSA 2GA8A 4NDZA 5DIFA 1PVOA 5DH9A 3TK1A 3SFVA 4BE7B 3MJHA 4MKFA 2BDTA 1IY1A 1HQCA 2ZE6A 4AG5A 3QUSA 1XD9A 1CJVC 3L2OB 4EPWA 2TMKA 1X8KA 2C5LA 3QPWA 1T3LA 3LX5A 2RGBA 1P72A 1N5LA 3W8RA 1NVWQ 4AKGA 4GP7A 1I2MA 1XTIA 3RS5A 2YWEA 2ZPTX 4PHFA 1CP2A 2IEZA 2QRNA 1PUIA 2A5YB 4L5BA 3L0SA 3VU9A 4ZIRA 2CJWB 1F6BA 3B1YA 1TAGA 2GEDA 2GKSA 1CBUA 3QKSB 2VIIA 2HT6A 4FD2A 2IBMA 4BFVA 3OF5A 2HYIC 2XGJA 2HF9A 1VTKA 4AIIA 5SZJA 5AUPB 3SBEA 4NP6A 1Q1QA 5FOXA 2P65A 4U5XA 1G7SA 3O8RA 4NU0A 2PX0A 3GEHA 5FOTA 2ZJAA 5BN5A 5J40A 1MT0A 2P0EA 3DOFA 4ACAA 1T8UA 4L16A 4PO8A 1DADA 4JJKA 1E2MA 3DKPA 4P4TA 3RVBA 3U3RA 3GLGB 1NMZA 2QAJA 2G77B 3QXJA 3CNNA 4ZDWA 1W36C 5L3SA 1N3BA 4HB4A 2CNWA 3FFBA 1YZLA 3B60A 4TMZA 1DEKA 5JI2E 5JWOA 3FKSA 3LDAA 1WQ1R 2AFHE 2QPTA 1HE8B 2GEUA 3B5JA 4I81A 4A6PA 5JJKA 1FOEB 4O3MA 2QMOA 1T4GA 1QHHB 2ZREA 1E32A 4DLWA 3K9HA 1D5CA 1KZGB 3I4LA 2WM9B 2XNSA 2J59A 4BZXA 3ZVNA 2JLWA 5HR5A 2HV8A 1MKYA 4A8JB 1HEIA 3NHAA 5K8IA 4XH9B 3PXGA 3HR7A 1JR3A 2GAAA 3AGQA 1GKIA 3W8NA 4W5HA 3K0SA 3R9WA 2KSQA 2X1VA 5DO9A 4DLRA 4Q01A 4POAA 4CDGA 5SZHB 3AQ4A 1IHUA 3Q8XB 2ODWA 1DVRA 4IEIA 3WYAA 2BCJQ 4W9MC 1Q3HA 1U0JA 4BFXA 2W6IA 4M1SA 721PA 1AIPA 3W6PA 2YVUA 3ASYA 2CE2X 4HAXA 1TX4B 1N2CE 2WMOB 1AS3A 4X8LA 3JZMA 2GETA 1TMKA 5IK2D 1P2SA 2CHQA 5IT5A 1Z47A 2ZVPX 5DN6A 3MJRA 3ADCA 2D3WA 3VTKA 1E1QA 4WXRA 1OIWA 1IOZA 1QHYA 5KSYA 1OH6A 1HYQA 4V0ME 3B9QA 4DWJA 3V00A 2DFTA 2QT1A 3KXIA 2AD5A 3KFXA 4U00A 1S9HA 5KHOC 1EESA 4ZV4A 4Q47A 1YZTA 4Q4AA 5FUXA 2OCPA 4I1UA 1Z0AA 5E3HA 1FFHA 2RGCA 3VQTA 2CLCX 4CYMA 1EFCA 3KDSE 4A2PA 4DLZA 3MUFA 4DDTA 3IHLA 1Q21A 4HUQA 1G19A 4P4SA 1Z6GA 2YWGA 1IY2A 1IBRA 4GSYA 2CNWD 3BK7A 5EP2A 3IILA 4BFSA 5JCZA 5JI3E 1YZNA 4OI0A 2LKCA 2WKQA 1ZCBA 2NZ8A 2RCNA 1E96A 1ZM4A 1P9NA 2D7CA 2O52A 2Z83A 4OJKA 3EXAA 2J0UA 1G7CA 4JVLA 4Q1CA 4BLRA 1CJMA 3O8BA 3QPUA 1D2EA 4TMXA 5GJCA 4B47A 1IN5A 5DI3B 4F92B 1ZUIA 2XNDA 4TTRA 4PC3A 4Q1FA 1TU4A 2IC5A 1XNJA 1L7VC 1CJUC 1PUJA 4OHWA 1W2HA 1CKEA 2NO0A 1S3GA 3BAFA 5CLLA 4KV9A 1UM8A 3TW4A 1MR3F 2ZSFA 4RD6A 4DC9A 2ZJ2A 4DSUA 2O8BA 3QKRA 4JMPA 5CIQA 2G88A 1YZKA 3EAQA 2JDIA 4TYQA 1HTWA 5AUOB 3QQ5A 1GITA 3PUXA 3ZDQA 1UKEA 1T3HA 4PHHA 3CBQA 2F43A 3OEHA 1I4DD 1W2GA 5EP4A 1ONBA 2W6ID 1W49A 2HLDA 1XPOA 1G3IA 2MMCA 3CNLA 5KO2A 5F9FA 3SJBA 1KMHB 5AJZA 2P2LA 2O0KA 2ZROA 1UKVY 1CF4A 2YZ2A 4LHVA 1WF3A 1D2NA 2AKAB 3B78A 1YR6A 2PCJA 1ETUA 4HZUA 5DN6D 4C7OB 1OSNA 1KO8A 2OEPA 3LH5A 3CRVA 3NIBA 5FFMA 1E1QD 4LHXA 4MRSA 3BFKA 5FUVA 4TQAA 1E9RA 2N46A 3GFPA 4LDJA 4XVQA 1YRAA 1GOTA 5GJVC 2REBA 3GJ6A 3K9GA 4XVRA 5JMTA 2V1XA 4UXIA 3RABA 5K8LA 4LV8B 3QBVA 1GNRA 4LYHA 3UMSA 3QF4B 2CLDX 2RAPA 3O8DA 4M2LA 4C0JA 2ZRCA 2DY1A 3EA0A 5CYPA 4V0MA 5AJYA 3ZJYA 1FNMA 4LYFA 4WBSA 1NVXQ 1BOFA 2QSYA 4NYMQ 1E2EA 2J41A 3DKVA 3PV0A 2XEXA 1KIMA 1E9AA 3EWSA 4QBFA 1C4OA 2A9KA 3KQHA 1DAFA 2FFBA 4JVMA 1A7JA 1JQJC 5J4LA 1Z6AA 4BLPA 1XTJA
chains in the Genus database with same CATH superfamily
5JAZA 5KOJB 3IO5A 3FPEA 1CY6A 4URFA 4RE6A 2ZYUX 1Z0IA 3ICWA 2DT8A 4FOTA 4MRAA 2ID7A 2XTNA 5FL7A 3W5AA 3W4IA 3FTEA 3JATA 1XRJA 4J16A 1H1DA 1YIAA 3ZWCA 3O1JC 3TTWA 4E08A 5FXMA 1JI0A 4X20B 4ARZB 1G2PA 4ZCSA 4ZP1A 4DLSA 3HKBA 1YMQA 3SF8B 2IUFA 3G7UA 2O2HA 4WINA 1USGA 2AMVA 4YJHA 1BE1A 3I04M 4Z1OA 1ZJYA 3KU1A 3ONDA 5HE9A 3ILXA 1U3FA 1JEEA 1X2BA 4ZO8A 5PNTA 1JZSA 1U8XX 2Z1DA 4WPGA 4D8WA 3ROXA 1BMTA 3OX4A 2FXIA 3F9RA 3LZ6A 4H7EA 5ALSA 4QM6A 2RSLA 1ZM7A 4GC5A 4QUGA 2Z2XA 4G5RA 3O21A 1GAXA 4LE2A 4X65B 5KJEA 1WOYA 4ITRC 4GXQA 4J0DA 1HTTA 1GARA 3H9GA 4Z9XA 2V7QA 1FFBA 1MOSA 4F4IA 3IE1A 3TPZA 4E5VA 4FE7A 3QJ5A 1GRCA 2Q2OA 4ZOEA 4RYDA 1JQEA 3IUQA 2WG0A 1EVKA 3F1KA 4OTZA 2F8TA 2QX7A 2ZT5A 2I9PA 1TQ4A 2EX1A 3C5VA 2XR1A 4RIHA 3RODA 1BWQA 3L4JA 4P7BA 1G8KA 4HF7A 1M67A 5ENDA 5IM4A 2D5AA 4FGJA 5I9BA 1QH8B 4GEKA 4ND3A 3I58A 5KUTA 3KSUA 4CQLB 2EIHA 4I55A 1SVKA 3OSZA 4UEJA 2ESRA 1P45A 3G85A 3IQWA 4G9GA 3KWLA 1WZNA 2H8GA 3TIGA 1QVRA 5ICCA 5KB3A 3OUZA 2DF8A 1PHRA 1Y7LA 2H0QA 3O4JA 4G86A 5C3UA 2EYUA 1AQYA 2NPFA 1KP9A 1M1YE 3NAGA 1PTKA 2OCYC 1D04A 5LL6P 1ZM2A 3GUCA 4FYXA 1NE2A 2PL5A 4IS3A 5IC6A 1M6NA 2G4CA 4C0LA 5BQPA 4F6LA 2PSEA 1LQ2A 4D9HA 1ZZGA 1EJBA 2I2DA 3H9JA 4JGIA 5H82A 5J2UB 2BZSA 2E5FA 1O89A 3BFXA 3MQFA 4MQBA 3BDVA 3TI9A 3ZK8A 3IB6A 4EQ6A 4FMCB 1ZH6A 2AFRA 1DIGA 3CNHA 3CONA 3Q15C 3JQDA 4ZQGA 3PGXA 3M6VA 3FVTA 4DIEA 3D3KA 1Q1EA 4DR3B 2O8DB 3G2PA 1XMPA 4OJQA 1RFGE 5HQ3A 3EVFA 4K9LA 3SOPA 4F6RA 2WF8A 3HJHA 1DQSA 3CRW1 1K7EB 4FN5A 3ECCA 1EHCA 1N6OA 2A58A 2I6FA 3HXLA 1XD8A 3N8KA 1EPUA 1HEYA 1T0UA 2XI4A 1PG5A 3B6IA 1TYBE 4Q7MB 4V2IA 3ZV5A 1ODKA 3ZCPA 5CT9A 3RUDA 1I5RA 4QUDA 5FTNA 1FJXA 5JASA 1DDGA 3EQ9A 3U7QA 2AVNA 1XDUA 3Q7EA 5FI1B 3KBBA 2HUNA 4HWGA 3HE3A 4RHCA 3O9VA 5LCXA 1DWQA 2GK3A 1NJ1A 1KJ8A 4XA8A 4TSKA 3MWFA 3PQ4A 2VYQA 4OMFG 4XXHA 3AVVA 2OV4A 4WZAB 5D5HA 3DMPA 1CR6A 4MW9A 4Z51A 2NSLA 2GBIA 5JZSA 4AO6A 1UMCB 2QM8A 2WFZA 1JDPA 1SZJG 2DP4E 3MTGA 4QU5A 1BXGA 5AK0A 1X7YB 2JNWA 3C3CA 1Z5VA 1S8FA 1Z62A 1KQNA 1XJQA 3FOCA 2ZIZA 1F8XA 3H6GA 1CNMA 2Y0DA 4NG5A 3VNBA 4AJNA 5FOVA 3VR2A 4A8TA 3GIDA 1Z2EA 2PRYA 4OSPA 4Q66C 3WMEA 5EE1A 2QVZX 3X1WA 1CF9A 1D4ZA 1ZJZA 2OV3A 3M6FA 2QRVB 3U31A 3R6GA 4MV6A 2VTBA 1Q7EA 2IE0A 2PXCA 5TGDA 4CM4B 4OJTA 4XJXA 1OUMA 2YOGA 3N2YA 3P7MA 1E79A 2A4KA 1GAQA 1ZGZA 2ZBQA 1PP4A 1TW2A 5D7NA 1W85B 3QI2A 3I6MA 2ZG6A 4O25A 3BIXA 1G5QA 1YE5A 2JLQA 3DDOA 4M89A 2AZMA 4J94A 4GPZA 4PQFA 4MQ6A 5IASA 3GAAA 3WHPA 3INGA 2R84A 4GMXA 9ATCA 2W2KA 3QW4B 1UOPA 3HDJA 3SICE 4BGEA 4LV5B 1DC7A 1MPTA 1YQUA 3BJMA 2X4GA 1J8YF 1SURA 1Z17A 3AFIA 1U5BA 1DAMA 1P61B 1UPCA 3CG0A 4L9WA 5E2AA 4ZKDA 4JASB 2VSYA 3E15A 2FUKA 5AHWA 2Y67A 3K5WA 2C88A 2QTLA 5BR4A 4I4NA 2QV7A 4D8VA 3QWIA 5JMWA 1KL7A 3T38A 3UFXB 1R0BA 1E3IA 1FFDA 2EC5A 3TUZC 1AOXA 3UB2A 3CKYA 1H05A 3CUTA 1L3IA 3NRCA 4NU5A 5TMEA 1Z7GA 2W71A 3PRJA 1L5HB 4X9XA 1F17A 1J0CA 4B0OA 4IJQA 1IAVA 2ETXA 2RGDA 1SZPA 1SVWA 3CEJA 3OWHA 4X6XA 2YVLA 3QENA 5K3BA 4PG8A 3GPIA 3LNCA 3OJOA 2IS6A 1Q15A 3D59A 2B6HA 2VSOA 3M5DA 2YJGA 1O8BA 2OHHA 5EESA 5BSHA 2PPLA 3CE9A 1O95A 2V3VA 4OAQA 2A0UA 3Q72A 4L7QA 4MDYA 4RF3A 5DJ5A 5JMPA 1XE3A 3LP5A 2CMKA 3VNRA 3NVDA 4D9FA 4M9XA 3RS2A 4HUTA 3Q3VA 1N5MA 4JJGA 5K8CA 3GRFA 3D6HA 3GRRA 3HB7A 5CAEA 4QG3A 3CJTA 3OIVA 3DMTC 1ZD9A 1SRQA 3VRHA 4YRKA 5AW1A 1E9EA 3M70A 2GM4A 1SD5A 1WW2A 1E9CA 3IKMB 1N1EA 1YQXA 2WFAA 2BSXA 4IMJB 1TCCA 4RIIA 3S2ZA 3STHA 1TA0A 1B15A 2VPTA 1C3JA 3QU4A 3H8WA 4LV6A 2B9VA 2DYKA 1J7KA 2B2NA 2H59A 2JFNA 2AZTA 1X15A 3KYJB 4WH0A 1K8YB 2J5KA 4IW3B 3UANA 1THTA 3SYKA 4B7ZA 1OF1A 5ENVA 5DKFA 3DJFA 4GPAA 4LTDA 3ES9A 5IP5A 1RM4A 3SQMA 3T3NA 4DCOA 1ZK0A 4B7AA 2C0PA 1JAIA 1DDOA 1YR8A 2VJBA 4Q3CA 4QL3A 5LPNA 2HK7A 2OENG 3C2QA 3NI2A 5SYMA 2CLIB 4OQNA 2QM3A 1PJSA 3UMJA 5KTOA 5REQA 4G0UA 1LF5A 1YQ9A 2FMKA 2XMZA 4RD3A 2EFDB 3UTDA 1ZEJA 2YZMA 1I4WA 3HDTA 3QXSA 3NWEA 4Y0AA 3QYJA 1XCPA 4BNHA 1QMGA 3WWPA 4TN1A 2NUAA 3CF0A 1SIBE 1PR2A 2PRJA 5IBPA 4BC1A 1PD0A 4KO2S 2A9FA 4YYZA 5K0ZA 4V2UA 1ZLXA 1PSDA 5E6RB 4B3GA 3WNBA 3H04A 5B3LA 4Q4HA 1UPFA 2PSHA 4CQNA 2Q1XA 3S2UA 4EJSA 5FPPA 5KYYB 2FR8C 3EY4A 2WWWA 1YASA 3FPFA 521PA 4OLFA 5FCDA 5DK4A 1Q17A 2CEAA 1U1GA 1QH1B 2ET6A 2RHOA 1A4IA 2H17A 2R7KA 2ZUBA 3L8DA 3MZ0A 1OFUX 3UWSA 2FNAA 3V8PA 4AICA 1QB7A 5SICE 3LVQE 2IXFA 2WFLB 2OXRA 1XEXA 2IDJA 3EMVA 3G88A 3L4EA 5LQUA 1W5SA 2ECPA 4HNSA 1X6VA 2MCFA 1LPAB 4LXTA 4L78A 3T7DA 1TADA 1ESZA 3LA6A 1ULZA 4AC9A 2AMFA 3EGIA 1M6EX 4RK4A 3BJIC 3DMRA 2JFGA 3EZ6A 4B33A 5AESA 4CT0A 4ZAVA 3T95A 2PGAA 3CZQA 2IYEA 3NYRA 4RETA 1I7LA 3H5WA 4G4SO 4RGQA 1GZSA 3CUUA 4G5OA 4ER0A 5TT1A 4P7GA 3BQ9A 5F7OA 2JIDA 5HCNA 1LW7A 2DECA 2ANCA 1QAQA 2MINB 3IVGA 4L75A 3WGYA 2OK8A 5EMMA 4PM4A 3GVHA 4DSAA 1S01A 1X8JA 3G68A 4JS0A 2GVZC 4QGSA 4ZIRB 1HK7A 4TXMA 4NE7A 1THGA 2II6A 4I8XA 1PNRA 3DXZA 3F5MA 4DJEC 4C5AA 4B8YA 3VU8A 2ZJZA 4I14A 5JXIA 2LIVA 1VA4A 3CIOA 3JQAB 3AEQA 3U7FB 1M6YA 1Z8NA 3IQIX 2FQQA 3P9KA 1UKBA 3NUZA 4JD5A 5EIFA 5JANA 1AKYA 4JA0A 4B84A 4IP0A 5EE3A 2I4NA 1KIAA 1BWSA 1XYYA 2AEJA 2QTCA 1DRVA 1GRNA 2QAGA 1FDOA 4RLSA 2PWPA 4Y1GA 1O4VA 3WWOA 2VJLA 4EELA 4DTCA 5L7WA 4MHOA 2O3RA 3RYIB 3R6LA 4HWPA 5T4FA 4DILA 3USZA 1TMGE 2OXCA 1HMYA 1IFXA 1ZJ4A 2B94A 2HMWA 1JLMA 4Y0NA 5HK8A 4YAGA 5L3SB 4O3FA 1XL0A 3IVCA 3LT1A 2LDXA 1H8HD 3I42A 4JFRA 5CD1A 4Z3OA 2VDUE 3LKBA 2PLNA 1ML3A 1PU2A 4D3FA 3F7MA 3KOUA 4BMYA 1U28A 1N2BA 1MDFA 3BL6A 4UDXX 1QGED 1G3MA 3K09C 3SG0A 3AZPA 1XC7A 1ORRA 3VNAA 3DD5A 3L6CA 5C5CA 3MTIA 4OK6A 1VKRA 1O1YA 2YFHA 4XDYA 3GNLA 5E8JA 1Y98A 3VPHA 1ZD2P 4BVKA 3H0KA 4ND6A 3B48A 4FN4A 4FX2A 4K88A 4PLWA 3S27A 4ENVA 1NOKA 2B9EA 4KAAA 1FTYA 1KSFX 4RD1A 5FORA 5IDYA 1L9KA 1V45E 5FR1A 2ZRQA 3CA8A 3OZBA 1IJFA 1LVHA 2GCNA 1FY2A 1HDYA 1RWXA 1U81A 2HSDA 4IKEA 2ATVA 4XX0B 4Y2UA 4PLYA 3SZRA 3EH1A 3VC1A 2H11A 4CEIA 1RJFA 1DJPA 1ML4A 3C7TA 4QASA 4EHFA 2WB2A 2WHXA 2ZANA 3EZ9A 2I6TA 4I1YA 1Q5PA 5F1KA 3E2IA 3KYDA 5I5GA 4F3YA 3MMZA 2YZKA 1P0CA 3JWHA 1S1CA 2QTBA 5HJ2A 5TXGA 3CY6A 4UD2A 2C2MA 3FHJA 5F1PA 5T4HA 5EEGA 2I7TA 4CKEB 4F93B 1GLNA 1IZ7A 2PVSA 3ZHRA 1M34E 3K8ZA 4R0MA 1DRJA 3PXBA 4Z1MD 2J3MA 3FRJA 4P81A 1R0YA 4CLOB 4C3ZA 1X3SA 2OA0A 3RTAA 1G18A 2RHCA 5ULLA 2PQ0A 3D7SA 5E1DA 1IUKA 2JANA 4X97A 1MQ9A 4WKOA 1KI4A 1C1YA 3CZ9A 4N47A 2FPMA 4QYMA 4F71A 1XRLA 5MF6A 2FEWB 3EGOA 1TVMA 4JELA 5AJTA 4W5OA 1BS2A 2OTCA 3LTEA 5CK4A 4B73A 3S8YA 1SWVA 2JLUA 2I5PO 4NS1A 4QYIA 2XUDA 2XZLA 4GPIB 2FAXA 2D5BA 3V8BA 1DKMA 3I53A 5AXCA 3Q7SA 1NC1A 1SBQA 1JUDA 2IYQA 2P7HA 1N78A 2FPGB 4F12A 2QTWB 3SU8A 3Q3JB 5T4EA 5A4KA 4CCYA 2H5JA 2LV8A 4DUGD 4RX1A 3WGLA 1ONSA 1IC6A 1C7RA 1F2TB 1SUFA 1S96A 3D43A 4D46A 3KKEA 3BB1A 3O2QB 3MWLA 5G4KA 1A82A 1G4UR 3OZSA 1NKVA 4IBOA 3ROEA 3VR4D 4EA7A 3TQTA 2WM2A 2HQOA 3RC3A 3LWBA 2BRUC 3DG9A 4EX7A 1VKOA 3CJRA 4GYWA 3A9VA 4YV1A 3KSMA 5KMGA 4DWVA 5DN9A 1CYDA 3R3UA 4GKKB 3AX6A 2WYWA 2WPDD 4C1BA 3SAJA 4EDHA 2YNMD 1GPLA 3RR2A 3AR5A 5FNZA 3DEKA 1X7WA 2YMPA 2RJ3A 3QVUA 1NWCA 2NYAA 4YV0A 4CIAA 2IW3A 3BM5A 2WWXA 3RT7A 3HDVA 3GLGE 2NUPB 1Y6ZA 3GJ8A 4NI5A 1YS7A 2WJIA 1JFFA 4GZLA 3L7YA 4HN4B 2WPNA 1MNQA 1JG1A 2XUKA 3SC3A 1H2ZA 1OH7A 1QYCA 3KOXA 2G09A 1P9LA 3MELA 1LUAA 1WUKS 4TVOA 3IJEB 4UUOA 4YY3B 1JHUA 1JVNA 3KVOA 3RSFA 2FE4A 3WWZA 5ALVA 4HDSA 5K03A 1R6XA 2A86A 2OZLB 2QG9A 4LSGA 3U81A 2R8ZA 3D4NA 3PUVA 2GILA 3Q9LA 4RORA 5DHTA 3W2GA 2QX6A 2ZAYA 2DHQA 2IJGX 2WNHA 3UGQA 1GD1O 1ZOIA 5BSUA 1GU7A 3EVNA 4EYQA 1UODA 2OQIA 3ABRB 2RAFA 4UBJA 1TO1E 2H6EA 3GD5A 3NWJA 5C2JB 2ZRDA 4BECA 4Y0VA 5KU1A 1LKZA 1AN9A 2Q5LA 2IGBA 5LQSA 1F60A 2FVYA 2NXCA 1MMFB 3CWQA 2IL1A 4J07A 1Y89A 5IVHA 3TL6A 4EVIA 3K16A 1UDRA 1HZZC 1L4BA 5AI0A 4ZO9A 3IEUA 4O63O 4URZR 3K32A 3N70A 5FBQB 2BHTA 1FJ2A 2GPYA 4I5IA 5DRYA 4HDMA 4AWXA 4LOJA 2WJYA 1SUPA 5EPEA 3PKIA 5JD6A 3D8RA 3O8NA 3AOEA 1X19A 3DGFC 3RTBA 3LXRA 5JFOA 2Q99A 3GL9A 5CB4A 3NYIA 4FDTA 4KBYA 4JUBA 1YB5A 4R2XA 5KVAA 3X2EA 1JR2A 1NP3A 3RU2A 2ZSBA 2OMEA 3CN9A 1MQAA 4LJ6A 4RA9A 4DNFA 2L19A 4FFNA 5I3ZA 4J03A 3KXPA 3LJKA 3ORFA 4D80A 3HNPA 3WYGA 1B74A 2JA1A 5KYXA 3QVOA 3PQ3A 1M66A 2GHIA 1TOAA 1ZRNA 3HJNA 3B6ZA 4EY4A 3B51X 2WMDA 4L27A 2G82A 2JAQA 3GLRA 4CR8A 5JCOC 3CCBA 1RKUA 3OMWA 3FPCA 1RW4A 4X8OA 4XD2A 2ZZNA 1N6KA 4P3YA 1Q7CA 2XW6A 3H1BA 3R5JA 1Y9EA 5BRNA 3L0PA 1P2VA 2ZRLA 2QRKA 3NHLA 3ZKAA 1R00A 2V96A 4FFLA 3JATB 1MB3A 2C82A 3CH7A 5GWXA 1DDIA 2EHJA 3FPLA 5E3JA 2X5JO 4NQZA 3R3JA 1HURA 1P5RA 1TE2A 1Z4QA 2CGEA 2HWXA 5JAMA 4YCNA 4RHUA 1FL9A 2GCOA 2C4MA 5IAJA 1SCDA 2QE7D 2X8AA 4YJHB 1RJEA 4QBIA 3JQFA 2YHUA 1HE4A 4HWOA 1U0FA 2Q2QA 2Z2ZA 5CTAA 2P5TB 3KWMA 5ESXA 2QN6A 3WX0A 1HE1C 4LECA 1TDJA 3D4PA 1TU0A 3E03A 2R8YA 3DOCA 3H2YA 3IDAA 1H9AA 2NU9A 3KS9A 5TMPA 3V1TC 5LQJA 3IPRA 4JLVA 3WAGA 1C9YA 2ISQA 3ITNA 3R41A 2KYRA 2Q3CA 2ZYTX 4EFNA 5KQMA 1I0IA 4OMCA 3Q8KA 3V7YA 3BL5A 4GE3A 4EO7A 5CCXA 2FFJA 4JYCA 3PD1A 1QR2A 3V8MA 3JYQA 1N5IA 2ZE5A 1OKKD 2IPMA 5D1NA 4XZ3A 3IRUA 4KAXA 2EAUA 4FZ3A 1AO3A 5JSQA 4ZRNA 5COBA 3T5CA 4AJPA 4I55B 1FP1D 5ILGA 3I2JA 4MYRA 3FNIA 4QWMA 1AS2A 3L0OA 3VR3D 2QTGA 3Q12A 2GZ2A 1XZKA 4GVXA 1G20E 4PLTA 4YI3A 3DPUA 1YB4A 3HCCA 2IEGA 3DKRA 2YJZA 2JFPA 2KLHA 4KOAA 3WBBA 2AQ8A 2VEDA 4B40A 1EFPA 1VCOA 3GG2A 3THOA 4MUBA 4KPUB 4HEHA 4N5NA 3FYUA 3O1LA 4OHBA 1FYFA 3JAWA 2D3TA 4BC0A 4DCGA 5UKDA 2OC4A 5FV7A 1JYSA 1NJSA 1ZM9A 8OHMA 2FN8A 4BYMA 1MJ5A 1PI3A 2XNKA 1EJ2A 3A1DA 3R7FA 1SCAA 5ER9A 3A3OA 3I0NA 3I32A 1FA9A 1NNUA 1XX6A 2Y6VA 3OJLA 3SZMA 4EVQA 1RACA 4KN8A 3ROPA 3RC8A 2DHCA 4M76B 5HQ3B 1A5TA 4F6RB 5C35A 3LY7A 3R1IA 5JAIA 1LPSA 5HKLA 5IVIA 3MGCA 4UCWA 4V1CA 4NCAA 2J9YB 1VL0A 2X58A 4RPIA 3USCS 2CBXA 2Y2VA 4HX5A 2AH5A 4Y2RA 2UZ1A 3IA2A 4G0ZA 1E99A 4PHGA 4A82A 3BZWA 3PQFA 4AMBA 1U0OC 4L5AA 1XMVA 3C70A 4TXHA 2N42A 4CM9D 3IDSA 4PN3A 5E7IA 3BD9A 3RV3A 2ZRGA 3U7QB 4M0EA 1ZITA 1Y8QA 1ZNZA 4NMMA 5K51A 5A5VA 5LOVB 1UPAA 2B6NA 2YN0A 4O33A 2Q8QA 3CLHA 3QMWA 4HDOB 4TMYA 121PA 1UOOA 1Q74A 4Z0TA 3DL0A 3B12A 2Z0MA 3OTWA 3QU7A 3N05A 2YYSA 3LG2A 4Q21A 1WV1A 4PWZA 4IJWA 3LTNC 2ECOA 4Q0MA 3ORQA 4LJLA 1EXWA 4YMUA 2FQXA 4P3XA 3UG6A 4PYKA 1NJ8A 1ADJA 4YWHA 2IP4A 2SCUA 1DZ3A 3RS7A 5AI9A 4DV5B 1B76A 1BXGB 4OU4A 1FFGA 1PHPA 2PKQP 4MKHA 1WXFA 2GD1O 4JT9A 4UXJA 1H3NA 1G8GA 3JWEA 4RHYA 4WXEA 1VFPA 3GRKA 2PJRA 3DTYA 3THYA 1N1GA 3WHIA 4OM7A 2E6UX 3EODA 2RHJA 4NU8X 3SDZA 2Q4RA 1J8QA 4IGEA 2VAXA 3B6MA 1VFNA 1TF2A 2WG1A 4KXVA 4I6EA 3Q9SA 4H16A 1CUSA 2GZMA 3O1IC 4J1TA 3PITA 2ZR8A 1EEHA 4V24A 5AW9A 3FBTA 3H9QA 3ZCTA 3E0QA 2ADOA 2R97A 2WT4A 9LDTA 3TGWA 2QMYA 5I4CA 3BMQA 4RZ3A 2UYHA 5BUCA 4J6FA 1Y3HA 5JJIA 2V6BA 1T2CA 4QLBA 2IZ5A 2QR3A 2VSFA 2AJCA 3EIFA 1XQ6A 4DEVA 1MJHA 2B7LA 3H99A 3R3VA 4J2OA 2VF4X 4IQ4A 4MA4A 4LXIA 1J97A 3EWIA 4IOKA 3FVWA 2HYDA 1X42A 2WB4A 4QGHA 3AOGA 2W2KB 3HYNA 4AO8A 1T6NA 1ZPDA 2E49A 2IS4A 1IUNA 1UT6A 4GH5A 4M36A 3FM9A 4QQ8A 4ZT6A 4BV3A 2CF5A 1U8UA 1PO7A 1XJCA 2SHKA 1U5BB 2W9XA 2N3ZA 1LPNA 2ZWIA 3AR2A 3CWCA 3D0KA 5HGXA 5CPFA 4JGBA 1PFWA 1Z7YA 3G79A 4Y2QA 3UWPA 3M82A 1XIVA 4DC0A 5IDXA 4BCDA 1Q0UA 2BMAA 2EZUA 2VJYA 3PRKE 3GP3A 5FADA 4B3BA 5ITZA 4S05A 3D6TB 2B20A 2CMFA 3HSYA 4H6PA 5BPHA 2WYIA 5BSWA 2Q5QA 5I7VA 3OQMA 3L06A 3A6GA 1TIPA 5HFNA 3SS8A 2H0AA 2EJBA 4HJRA 4BUCA 4NPAA 4MPDA 1JT2A 4R2HA 1JA9A 4LX8A 2Z2JA 5JXWA 1ZSYA 7MHTA 1I1QB 1HPLA 4YRDA 4N7RA 3CGGA 1RXCA 3C0KA 4W5TA 4BLOA 2KWIA 2HPHA 2XJ4A 2ZYRA 3H1PA 4TKMA 3O6VA 4ZO7A 2AEMA 2DPMA 4HPXB 3H19A 1QHXA 2WJWA 3B13B 5LQKA 3SCZA 3FB4A 4L6AA 3AHHA 5CAEB 3HVHA 2RK6A 1Z6PA 3HABA 2OB2A 3OZXA 3EUFA 1IM5A 4XSGA 3ACBA 1OYVA 4OAOA 1A04A 4RMHA 1C9EA 3S29A 5ADUS 5DMXA 2D62A 4D79A 1XWFA 1MORA 2IYSA 3EISA 4B31A 1CT9A 1WL8A 3I1IA 3KO8A 2JH8A 3LKVA 3Q3IA 4ND5A 2OP0A 2NG1A 1D7AA 1JEDA 3QMVA 4JNKA 4PO9A 2UUCB 1HL7A 3ABZA 2Y8EA 2BGJA 5HXAA 4COOA 4CKCA 2OGZA 4GOJA 1RQ7A 3FN4A 2LKDA 1IHDA 1HO3A 1T26A 4BDSA 3P2OA 4F9EA 1G0OA 1K6MA 3GA0A 2RGRA 4MP8A 3HZZA 4RY0A 3TKAA 3W5UA 1W29A 2WBLC 3NJ8A 2HJGA 3B82A 4PGFA 2JGLA 2C9YA 3LUBA 3O84A 5REQB 3LAWA 3RHZA 4WZAE 2PEYA 3VSCA 4LF5B 1H65A 1J2TA 2I7VA 2YV5A 4UUMA 1C1HA 1Y3CE 3PC4A 1VHLA 5B1SA 3IKTA 4LZNA 1KK0A 5EYPA 1Y6FA 1IH8A 4KR7A 2H48A 1JHYA 1EP9A 4FLFA 2NQTA 3O2SB 4NYIR 5EXEA 4RVFA 2IYNA 5BSEA 5AJUA 4KE8A 1JG3A 2PH3A 1WUHS 4L72A 4Q4HB 2ADMA 2XMRA 1UC8A 4MIEA 3LGSA 4EJSB 1C50A 1JJAA 1ZD1A 1E1MA 3FCYA 3C3KA 1JN0A 4TS3A 4M87A 4FGLA 3GMIA 1U7PA 2W6OA 4IDOA 2IEAA 1Z7BA 3EPRA 1KRXA 2ZI4A 3C1UA 2FK7A 1XSEA 1KNXA 3PB3A 4TSRA 1I32A 2IS1A 1CHDA 4KXFB 1Z37A 4HBZA 3O3CA 4BNUA 4E2WA 1AU9A 1XEXB 3WE7A 3O74A 3ZY2A 3PJFA 3W3AH 2HJ9A 5NLLA 4K6MA 4AYTA 5CDSA 1NF3A 2HH9A 1FB5A 2ENUA 2C2HA 4TVSA 3ZD6A 3OZGA 3A3KA 2GHRA 2IXEA 3RF6A 3KDPA 3ML1A 3WLMA 1SZDA 1CUYA 5LZ8A 5IKMA 3ZVRA 4R6XA 1AA6A 3SGLA 1DJNA 3CO5A 3EXEA 3SD7A 1D9ZA 2F3RA 2REOA 4GWLA 1PQ4A 5CEEA 1D2MA 3CX6A 4RU1A 1Z4JA 2JCVA 2G7MC 3U3MA 3X1ZA 4MWCA 4EKNB 5IWCA 3RNOA 1TVCA 3DBLA 3OKCA 4JI5B 3OU7A 5FR2A 3H1EA 3ROZA 3I62A 3JQEA 5BMVF 4AMVA 3TRIA 4JYBA 2CHEA 2RHLA 4HQ6A 3KCQA 5CYFA 4IINA 3ZDXB 1YVEI 3SEAA 3PYLA 2HLNA 2IOFA 1FXWF 1TC2A 4KQWA 1K7FB 2H51A 4KFSA 2JLBA 9GPBA 1IE3A 3ZTWA 1VKHA 3JYLA 1A2OA 1W0JA 2GN0A 3NTUA 2QTTA 1G5HA 2XT6A 4JLSA 1I0LA 4JV5B 2IOHA 1GL6A 3AEQB 4L2IA 3PI6A 4RXMA 3C87A 1HX7A 3MSCA 2QMEA 221PA 3T5DA 2VWQA 3A26A 4MV8A 4IQ8A 1RWBA 1A5BB 1AQUA 2FSUA 1Y6RA 4D25A 3T61A 3U3OA 2UZ4A 2Z8ZA 3GEBA 2QAGB 4OIFA 4BP9A 4CI0B 2P0AA 1YKGA 2GJSA 1GL7A 2XTMA 3KLOA 3GRYA 1G42A 3OO1A 1E60A 3BILA 5SY9A 5JXGA 4FYYA 4ZPJA 4LCJA 3EOAI 4C1NA 4K86A 3HEAA 4FIDA 2ZUFA 2B99A 2EBFX 2W00A 2OPBA 1IG3A 3ENZA 3GH1A 3K9LA 4MVJP 2C07A 4MUMA 3A1EA 2WIKA 4WI1A 2Q3BA 2IYOA 3SJAA 2GN9A 1DC6A 1PG0A 3FYTA 3EG9A 4D8TA 1NW5A 3PR2B 3HB1A 4ZQFA 5K0FA 1V3UA 3N75A 4UASA 5KWJA 5MGBA 2JGDA 1N6RA 4PC1A 3KVRA 5A9TA 1J25A 1Y9AA 1FLVA 3QIVA 4LKOA 1QFYA 4GMGA 4HPJB 4I46A 5HMLA 3KSBC 3A9RA 1P17A 3JWGA 4XUEA 4AY2A 2JKYA 2FEMA 3FJOA 1V1JA 2Z5GA 4U2FA 5DHAA 4DY6A 2HHCA 3GB9A 4KWTA 4EECA 2AEFA 5FJJA 5BRAA 4CEIB 2ORVA 3R40A 4D0RA 5C4IA 5IHPA 3L1UA 2VI5A 1DIRA 4FR5A 3IKJA 3OJ0A 1SC4A 4AD8A 4DB2A 4RHXA 3ELUA 3CF4G 3NT4A 1LNSA 2GVDC 2VSXA 1LSJA 4OJMX 1WSWA 1DCTA 1IN7A 3D31A 4D3DA 4WKNA 3N0RA 1UXIA 4LHEA 1DRWA 2MHCA 4GUAA 1I2ZA 3WADA 5JZOA 1FUUA 3M0EA 5DXJA 4C4RA 2HLPA 4LUCA 1NUPA 5FNVF 2O54A 5LIRA 2XQIA 1VKZA 3OQ1A 5BORA 2ZI5A 3OTGA 5CCDA 2AB0A 3D64A 1XDDA 2XTAA 3MWKA 5KDOA 3B89A 4OHXA 3N0XA 1C0EA 2ZETA 4KGXA 5LZ9A 1P1KA 3JZAA 3H9UA 4KO3S 2Q21A 3MOSA 3S1LA 4J91A 1YFJA 2BMVA 3LZDA 3ITDA 4E1BA 4OXQA 3ILHA 1ZS9A 4Z4HA 3KOWA 4R41A 4G0XA 2QMZA 3DR3A 4I9HA 1EI9A 1ZG3A 3TIVA 3K1ZA 3ZK9A 1U8CB 5CT6A 3OT1B 3WGQA 3EN0A 1AGPA 1TCAA 1K9VF 1W4LA 5ALNA 3RRBA 5CBKA 1D6NA 1VPVA 4W5WA 3HA3A 2PX3A 2P35A 1IK4A 3FRIA 1DCMA 3BWYA 4HX9A 4PCVA 3ZUGA 1ULUA 4MV4A 3KQUA 4ZVKA 2QROA 3EC2A 3DHEA 2FN7A 4LGCA 1T2VA 1KZ6A 4HOYA 4AZSA 2GO7A 5C46F 1N36B 4MZXA 4PZCA 4EY5A 4EA8A 3UA4A 1NQOA 2VATA 1H6AA 4WESA 4LJ4A 4D8YA 5BVHB 1GPH1 3AUUA 5G4KB 3CR8A 3AUXA 3BSYA 1OXBB 4EEXA 4C0SA 4K6CA 4DPKA 2FX3A 1EFHA 2VHQA 1BNCA 4EKYA 2VRWA 4LBWA 4ENWA 4LWZA 4Q00A 4PZ0A 1DGQA 3JQ8A 3E18A 2D59A 2QGZA 1AE1A 3L0IB 5SY6A 1H3FA 4DF3A 3GQBA 4MRVA 1NATA 1NQUA 2PS0A 2DWUA 3WFJA 4PSVA 3T9FA 4LC1A 3QE2A 4KVGA 3DZKA 3R8XA 4C01A 2QYSA 2Q1WA 3GFVA 1QM5A 2CUNA 3CV3A 4G5QA 5K0BA 3S0JA 2HMVA 3SC2A 4W1PA 3R75A 3FCUB 5F1OA 4D8XA 1MAHA 5HZKA 1X7WB 1Q2UA 2XOKA 3DM9B 2XY4A 4RS4A 4EJ2A 4RDHA 2Q3MA 1YVUA 3BF8A 3TBKA 1UPTA 2VDQB 2CBGA 2G1KA 2OV6A 5DEIA 3ZVNA 1DAIA 4RZSA 2WPDA 1GKUB 3I73A 4I6GA 4N40A 2VF7A 2C98A 4RKYA 1JFFB 4ZU3A 5FKJA 5JYCA 3NWBA 4C78A 2V9CA 5HRUA 1Z0DA 1GG9A 1OAKA 2Y0PA 3FR7A 3FIUA 3QU5A 2AR9A 2ACKA 2X23A 3ZLJA 4HDSB 4M22A 3KZOA 3PXCX 4QX6A 5TF0A 4E2XA 2HL6A 2XE6A 4ZVPA 3G82C 3WYEA 2CL0X 3I01A 1NJ2A 1YSCA 3EVEA 3TRDA 4DJJA 4RHTA 4MDFA 1WULS 4DDMA 2VDNB 2LRHA 1DTSA 1K9SA 2QV0A 3L8GA 3C41J 1BX1A 1J2EA 3K1JA 1YMVA 1Q7BA 3C98A 2VYND 4PAMA 2JZNA 3VVCA 4EF5A 2VJQA 3DXFA 4BX8A 3RFUA 5BN1A 3KV1A 1JI3A 1TZBA 3RIMA 5A5FA 2HRCA 1NN1A 3FHCB 5YASA 2AOTB 3WBFA 5IM5A 3NOOA 4GBED 4PLHA 3AM5A 1L1EA 1JS1X 2WI8A 3BWVA 3NX4A 5FBWB 4HDMB 3NHBA 3TSWA 2GEVA 2EVWX 3EOZA 3CU5A 2X41A 4MWBA 5E1BA 4LHSA 2V9ZA 1Y63A 1ZK1A 2CJYA 3P2EA 4H1HA 4CG2A 5IVKA 3IJ5A 5G1NA 5G40A 4IILA 5CB4B 4YUAA 2D5CA 1OXVA 1N4DA 2VCHA 4KK3A 5CDFE 1SUIA 1A72A 3KAQA 2ZDQA 3OO0A 3LF1A 3MSXA 4PZPA 4RA9B 4CMCA 4ID3A 1YR2A 2R7NA 4CWAA 4EG6A 1OU4A 5KYXB 4Q3BA 1BGXT 2O0HA 2R4TA 2WSSD 1VDZA 2Z04A 3AM4A 1UBJS 4IDAA 5ALYA 4Z99A 2E6KA 4WN9A 3MERA 4IWXA 1SUBA 3ZD7A 1QNLA 2EL7A 3LUHA 1WUJS 1LBHA 3OZIA 3ETHA 3P1JA 4GKVA 1ZMOA 5ICGA 1IEXA 3IS3A 3DMNA 3WGVA 3GLFA 3UHFA 1DOHA 3BICA 3NPMA 2ZVJA 2FEOA 3DUFA 4IRXA 4TRJA 4ALKA 1E1RD 1F48A 3QEJA 3TWOA 1YZUA 4ARCA 4GR9A 2CV2A 1J5PA 3DMTA 4WOKA 4EMUA 1PFYA 4OYHA 3IDQA 3QF7A 1WUIS 3TGLA 3TXYA 5F1YA 3I2FA 4PN7A 1SK9A 5FUYA 2GCOB 2EGGA 1PLLA 2VQDA 3D8SA 4TWZA 3P0HA 4BJ3A 3CLRC 3PTLA 1J56A 2XCIA 4BUJA 2IEBA 4LIPD 3SWWA 2O23A 4H1TA 1Y8ZA 3I1YA 4ZAXA 3FW1A 3SR3A 5FPHA 3P9XA 5IJAA 1C14A 2JD2A 4PTZA 2X0RA 3AY3A 4KI7A 2OCXA 1E5VA 2NU9B 1VE5A 1Y3AA 3WNDA 4Y3UA 5DU2A 4ALJA 3H18A 1OC4A 1W4RA 5DNAA 5JC1A 3JQCA 3W9UA 3OOEA 1M1NA 3OF3A 2VHYA 3T7SA 2GXUA 2OPHA 3TSZA 3U48A 2NSDA 1BS1A 1J07A 2YMLA 4BKQA 1OROA 1SKYB 1IEWA 3MCVA 3WYFA 3GLTA 3H9CA 1JNYA 3D6JA 1YDHA 1HDRA 4NKRA 4P33A 4B4VA 4MRMB 4AYWA 1HNXB 3SS9X 5JAOA 2FPRA 2E2WA 4LPSA 4W99A 2AI1A 3U6KA 5DNUA 2OHFA 2YJ5A 2ES4A 3CRQA 3I8XA 3N5CA 3OZEA 3WJ7A 5HWSA 2XOEA 4Z49A 3PC6A 2FP4B 1GL9B 1GY8A 1B7GO 2DWOA 1MB2A 2JI7A 2ZJ7A 4GZMA 4IF4A 1QZZA 3AHCA 4UBKA 4BPRA 1JIJA 4M7WA 2WIGA 2FR8A 3BWMA 1OKKA 1RHMA 3WO0A 1KKLA 3UUFA 1XPRA 4BX2A 5K3OA 2XUHA 4KJXA 3RV4A 1YNSA 3VHRA 1NL3A 1XBTA 2WJPA 1D8TA 5L45A 2GFQA 4I1RA 3ID6C 3AVUA 2NSJA 2J6CA 1U7XA 1EFPB 3F6YA 4C4ZA 1TM2A 1W2WB 1ORIA 1FJHA 3W06A 3FYUB 3ZDCA 3W9SA 3JAWB 3SBDA 2B8EA 3LBNA 4UHHA 5FBHA 1CZKA 1XRSB 2NVUA 3BCUA 1MXHA 2FGJA 2FW6A 2Q0HA 3EIEA 4FYWA 4K03A 2BR3A 4LHYA 4WY2A 4NENA 3MJCA 2GTIA 3PFHA 4M1WA 2C4WA 1DHRA 4LVNA