1HE1C

Crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
176
structure length
176
Chain Sequence
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the Pseudomonas Aeruginosa Exos Toxin Downregulates Rac
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords EXOENZYME S
total genus 60
structure length 176
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he1C00
4XWKA 3W3AA 1T4GA 1P62B 3RSOA 2P6RA 4M1OA 4GP6A 3VHXA 2GTPA 4LJ8A 4LX0A 1GIAA 1SHZA 1TUIA 3QVUA 4FMBB 5C46F 1S0UA 2GK6A 4XVUA 4MDEA 4NPHA 1R4AA 621PA 3NBFA 5C4MA 2IYQA 4CEJA 5CK4A 2OXRA 2VP6A 3Q8XB 3AM1A 2J9RA 3BFKA 3SYKA 1CJTC 3GJ8A 1V43A 3BIFA 4TL6A 1A82A 2ZITA 1Z63A 4E07A 1XU4A 1GDDA 4KXFB 4JLJA 3C41J 5FBWB 3FKQA 1S96A 3I73A 4LZZA 1H8HD 1T0HB 5E7JA 4M4SA 1CEEA 1CJUC 2QA5A 3OEEA 3DM9B 2ZRMA 1GNRA 1XD2A 2QQEA 2R65A 2NZ8A 4IDHA 4QNRA 4WVFA 3UXMA 4DLWA 1Z47A 3ZVLA 1FNMA 2A3RA 1U99A 3GJ0A 2QPAA 3OE7A 1CS4C 4US1R 1GSIA 2IYYA 4QC2A 3RS0A 4QRHA 1FQKA 3OHMA 3KQKA 4ESVA 4A2WA 4DLZA 1UBEA 2PBRA 3IIMA 1K8RA 4FD2A 1OKKA 1DAEA 1G20E 4HUQA 3UMFA 4UKDA 3JZAA 3QXXA 3ZYCA 1G41A 4PC7A 5CJ2A 1VPLA 2LKCA 4DB4A 5JJLA 2BEJA 4JSTA 4Q9HA 1WMSA 3PUWA 2ZM5A 3QNUA 2REXB 4LBVA 1L4UA 5LDDC 1OSNA 2OV2A 2P0EA 4GBMA 3NHBA 4Z54A 1UDXA 1D8TA 1G19A 1HE8B 3D31A 2ZSEA 1QG2A 4HAUA 2ZYTX 5FPTA 2JAQA 4PC3A 2ZRKA 3RANA 2OSBA 3N2EA 1U8ZA 4AYXA 3R9WA 2F9MA 2ZYUX 5EE3A 3F5FA 3HU1A 4P31A 4FI3C 3FHTA 2Q3HA 1NMZA 2YKGA 1GVNB 2VP4A 1RFLA 2NGRA 1KI9A 1VMAA 3Q5EA 4B75A 1EXMA 3WMFA 4UXIA 3HR8A 1W49A 4RFSA 4ZIRA 2X77A 1P7CA 2QMUA 4LC1A 2IYWA 4PC2A 4UJ5A 1YZTA 3KJGA 4NYMR 4EJSA 1VYVA 3ZD6A 1Q1QA 2V1XA 1KK0A 2XB4A 4NCNA 4UXJA 5GJCA 4KO8A 4V0ME 4KJZA 3QKRA 1ZM2A 3THXA 2E9SA 2PJRA 2GJAA 3T15A 1CXZA 5HPYB 3B9PA 1N6OA 1E4YA 1QBKC 1IY2A 1OJLA 1YZKA 4Q01A 1NNEA 3AVXA 2G0TA 1NKTA 3X2SA 2XSZD 2NTYC 721PA 4URYR 2RH5A 1HQYE 3O47A 3CF2A 1EGAA 3T1TA 5K8UA 4C0QC 2GBLA 1NL3A 1ZM4A 4FCTA 1E79A 2G3YA 4XH9B 2W58A 4MUBA 1KMHB 1XMSA 2CK3D 2MMGA 5GJWC 1OYWA 5AJWA 3CR8A 4IRUB 5FPSA 2EFEB 4DIEA 1LTQA 4N0DA 4KBGA 3W5JA 4US2R 2B8WA 4A82A 4G5RA 4MGYR 1GM5A 2DR3A 2Q9BA 3ADDA 2DB3A 4EQ6A 5JRZA 2G88A 4L4UA 3OEED 3DEFA 4E5UA 3GFTA 1H8ED 2BWJA 2ZR0A 2KI5A 3H0KA 3UIEA 3FOZA 5KUTA 3GLGE 3TSZA 2R2AA 3U60B 5H70A 4TYNA 5JBQA 3QIAA 3L0IB 2OCPA 4F38A 5FPKA 4XVRA 3L0SA 2UZIR 2BMJA 1S9DA 4BZQA 4DCTA 3IHLA 5FI1B 1Q1ZA 4C2UA 1OKKD 1E99A 1TU4A 4JBYA 1R8QA 1XXHE 1WQ1R 3SEAA 3TQFA 2VYFA 5C1BA 3OZXA 4OHZA 5AR1A 5HE8A 4KU4A 3UWKA 3ZVMA 4V03A 1II8A 1TL7C 2JLQA 2O8CB 4RFSB 3FDIA 3I92A 3RHFA 3TLXA 1M7GA 4NH0A 2AK2A 1XCPA 1KYIA 3CB4A 1TF7A 3IIKA 4TL8A 3IQXA 3UWOA 1P2TA 1QHHB 1E94E 2G1KA 2QE7D 3E5HA 5KTYA 4YMSA 2R62A 2C9OA 3BH0A 1DG1G 1KSJA 1W4RA 4EQ6B 1QVAA 4M1WA 3GFOA 1BO6A 3OIUA 3LBIA 4JVMA 1FL9A 1YZNA 1W47A 4HZIA 4UXHA 3VR4A 3QKSB 5JSZA 1A1VA 4XJXA 3M6AA 1E2FA 3NKVA 2VHTA 1JXMA 4Q21A 5EJEA 4HSEA 1RRGA 4KAXA 1X1RA 2ZQ5A 3M1IA 1ZNXA 1F3OA 1KO1A 1XD2B 3CF0A 4OQNA 4TMTA 5CB8A 2ZRPA 1E2HA 1R2QA 3DZ8A 4E22A 5HZKA 4MGKR 3NXSA 3QE0A 2B7CA 3T5GA 2QTHA 1G8GA 5JCPA 1IN4A 2EW1A 1XPUA 2IYRA 4LSGA 1SXJC 2FPMA 2E87A 4FCVA 2B8TA 2ZRAA 3NH9A 3KTAA 2J3EA 3A37A 1KI1A 2W6IA 3J81k 1JAHA 2QPOA 3LBHA 4WZBE 1ODFA 1FUUA 2F1RA 1IHUA 3VU9B 1N6RA 3W34A 3QSYA 1Q44A 1IXSB 1OV4A 5JS7A 3EX7C 3LVRE 2A5GA 4V0NA 4YMUA 3U3RA 3QF7A 1NJGA 4M22A 3A4MA 3GLFB 3CRMA 2A5YB 1XJQA 3BBPA 2O8CA 4D4MA 3ZQ6A 3PR1A 2WWGA 4DJTA 1UBGA 4G01B 4YQFA 1P9WA 4IFEA 2EFCB 3SJBA 3LW7A 4HAWA 4HZUA 4Z1MD 4H9GA 2BMFA 2XJ9A 2JCSA 3K0FB 2QPTA 5TY0A 1LY1A 2DFKB 3LY5A 8OHMA 4HDQB 1NN3A 4KFTA 1NG9A 2A5JA 4PQFA 1G17A 1KI6A 3OFNA 3NEJA 4D25A 1AM4D 4LJ6A 1W5TA 1OW3B 1FX0B 4GOXA 3WYFA 1KI3A 4A6XA 2F9LA 1NMYA 3H4MA 2VTKA 2V8OA 4NHOA 4Q1FA 3JZMA 1W4AA 3RS5A 2A30A 1M6NA 3QF4A 1IBRA 3B60A 4QBHA 2OFOA 4TWZA 1XXHA 2ZRLA 1GKYA 2V3CC 2BEKA 5EXXA 4B33A 4MYCA 1U0HC 5E7MA 2DWOA 4TTRA 1KDOA 1WP9A 1N0UA 1ZP6A 4GSYA 2KBEA 4JLAA 4QJ3A 5KDOA 1EFTA 5CJPA 4W5HA 2R6DA 5E3HA 1M7HA 4Q4HB 1QHSA 3G5UA 5C18A 2XTNA 3AVQA 1GNPA 3U7EB 1E0KA 5KPJA 2O8DB 3MJHA 4EFLA 3BOSA 3WXMA 3VU9A 1O3YA 1F2UA 3SJAA 2GESA 1E2DA 2OCAA 2ODNA 2K5UA 3L8ZA 1U98A 2H17A 4OHVA 1RJ9A 3SI7A 2ZJYA 1E2KA 4TQ9A 1KY2A 1G7SA 3ASYA 1SZPA 1DO0A 3VKWA 3SQXA 2BOVA 2WIBA 4LYAA 5HCNA 1PV4A 4ZDWA 2CDNA 3IUYA 3AVUA 4KI0A 4Z8YA 2V54A 2A9KA 3K70D 4QHTA 3A4NA 4AY2A 2FOLA 4YXWD 4JBXA 2IYLD 3TE6A 4M0LA 4QBGB 4JLMA 1P75A 2ZRFA 2ZUBA 3CF6R 1GAJA 1ZW6A 1G5PA 3R9XA 4MKGA 3SBEA 2J7KA 2BBOA 2O0KA 1QG4A 5AJYA 3Q7PA 4DLUA 1W1WA 4QFMA 1UKZA 3VR6A 4TSFD 2AR7A 3RC3A 3UG6A 3TQCA 3MD0A 1Q1EA 1T8UA 4HLUC 3G82C 5AJZA 4CEIA 4X8MA 2DFNA 1JPJA 3L2OB 4JLOA 2EFGA 3T1VA 3V00A 1NG1A 1R10A 5EP2A 2EYUA 2RGXA 2FFQA 3SDZA 4IDOA 1G8PA 5ELXA 4HI0E 4NYIQ 1M7BA 2ZRBA 2FV8A 3U7GA 3FFBA 2AD1A 3BORA 5HTKA 1CRPA 3BB4A 2J1LA 4Z8XA 1NBMA 4R2IA 3CWQA 2AK3A 2FDCA 2J0UA 2HXSA 1T5LA 2WJYA 3IHWA 4BFVA 1P2VA 1KMQA 5KSPA 2ZSFA 4GMDA 1TQ2A 1RRFA 3ZZUA 3F8TA 4HLDA 3SHWA 3VX3A 4QJ4A 1ZC3A 1UBFA 2B21A 1R0YA 2IYXA 2ZU0C 4TMZA 4DDUA 3T06B 1AQYA 1A2KC 1UKEA 2GAOA 3UKDA 2EU8A 1G7RA 4TQUS 5KO2A 3EXAA 2KSQA 3GJ4A 3NWJA 2IWHA 3U61B 1P2SA 5AK0A 3LD9A 1SGWA 4IJMA 3WBKA 2O8EB 2EFHB 3DOFA 5C4GB 4QBIA 4HAVA 2G9NA 3FMFA 3HP1A 1HV8A 3BGWA 2PCLA 2RGAA 4POAA 2D7CA 3SBDA 4A15A 3GLGB 1ZM3A 2GAAA 3NDBB 2WWXA 1XTQA 3BJIC 2ERXA 4EFNA 2RGEA 2Y8EA 2ZSBA 3KZ1E 4LK2A 3SFVA 1E9EA 4Y0VA 1AIPA 5FFMA 3ZD7A 2ZE7A 4DSUA 1Q12A 3LX8A 1E0JA 4D80A 1JR3A 1XNJA 4B2IA 4CEIB 2VO1A 5AWFC 4ZKEA 1G5TA 2GEUA 4H1VA 4BFTA 3ND9A 3DO6A 4MRRA 5LD2C 1LV7A 3TSOA 3LXRA 1J8MF 1XEXA 4OBEA 3GFPA 4Q1EA 1DADA 4CF7A 4IHQA 2BMEA 5SZKB 4L16A 1FUKA 2CNWD 4KHZA 4M21A 2E1RA 3P4XA 3TAHA 3GEIA 3VKGA 1JR3D 4Q1CA 4R98A 5LPNA 3GPLA 2X19A 2FSFA 4NYJR 2QENA 4B2PA 1G9XA 1G3QA 2YV5A 1NN5A 5GVSA 2WSSA 3PQCA 3PEYA 1QHNA 4NE2A 1MR3F 4UJ3A 4Q4LA 1VHLA 3KXLA 2J59A 3GJ6A 3HR7A 1P73A 1P6XA 2H8KA 2BCGY 3QKTA 3EZFA 5H68A 2C5LA 4M2LA 1AZSC 2ZRCA 1DG3A 2F43B 4PPGA 1ZU4A 3EIQA 1YZGA 1F6BA 1E69A 1Z83A 2GNOA 3MGCA 1KY3A 2F3RA 2GJSA 3BS4A 1UM8A 4MRPA 5UKDA 4RZ3A 4BLRA 2D7DA 3KJHA 3CZQA 1FX0A 2D3WA 4M53A 1M1YE 3GJ7A 1QDEA 4A2QA 3X1WA 4TZ6A 4P3YA 1J7KA 2G6BA 1E9RA 1TEXA 2AX4A 1Z0JA 2ZS7A 5ANRB 3WRXC 2CHGA 1JJ7A 1KAGA 2QNRA 5F9FA 2JASA 1VTKA 2Z83A 2OFXA 5G41A 1SULA 2BIFA 2FX3A 1CIPA 2QRZA 4ACAA 5J4LA 4PTLA 1KK2A 1KZGB 1UPTA 2QUZA 1KSGA 4DT1B 3IBGA 2CLSA 3CPJB 4I1VA 2XZOA 2ZR7A 1N25A 3CUEF 4TT3D 4BRWA 3CX7A 3VKHA 1VKJA 1YR6A 4KYUA 2RAPA 2C9CA 1E2MA 4OI4A 2JLYA 1N5KA 3AVTA 3VR1A 2Q0HA 3SE0A 1XCMA 2WOOA 4DCUA 1G7CA 2W2XA 2NG1A 3EZ7A 5CM9C 221PA 2Q3FA 1OXVA 1X6VA 4CEJB 3I1FA 2HXYA 2BJVA 3CNOA 2HF9A 1UEJA 3D7MA 4DZZA 3AH8A 4Q4HA 1FTNA 1G4AE 1S1MA 1IJEA 4S2EA 4X8HA 2R44A 1SVWA 1IOZA 3NIBA 5KSOA 4JKIA 4HLQB 2QSYA 2BHRA 5FOSA 3IPYA 1JQLB 2IT1A 3CX8A 3MFYA 4C30A 2YHSA 3W8RA 3DMNA 4GMXA 5C2JB 4N1AA 3K1JA 4FWIB 5DSZA 3HYTA 3EZ6A 4QL3A 3K0CC 2ONJA 4C0BA 4DT1A 2O8EA 2AN9A 2QM8A 1IN7A 3T61A 2IHYA 5K8LA 5FOUA 1PZNA 4EFMA 3TW8B 3FPAA 4TT3A 4OHWA 3T35A 2ZUCA 4BWYA 1G8FA 1GWNA 1IN5A 1U0JA 2XXAB 1IM2A 1Q21A 2KJQA 5EXPA 5JJIA 1SXJE 4TN1A 5AUOB 3EPKA 2D06A 3HPQA 3PENA 3TUZC 1OH7A 2G77B 2WPDD 1D2EA 5J4YA 2CHVA 1OHHA 2WWFA 1QHYA 1SKYE 3MWJA 1U9IA 4Z51A 2WWHA 4PZLA 2VHCA 4NL4H 4NCKA 4V0MA 3WP1B 3HU3A 1SVSA 2RKOA 4JLKA 1TTTA 4HAYA 1HT2E 5JLJA 5BXQC 1CR4A 2REBA 3ETLA 4BLPA 2DFTA 1QHHA 5GADl 1JB1A 4X8LA 1S9HA 4LBZA 4P4SA 5FOVA 3D6TB 4QGAA 4E09A 5FL7D 2CEAA 1EG7A 4AD8A 4G5GA 1ZNZA 3ND8A 2HF8A 5KYKA 4EPRA 3SU8A 3HJNA 1A2BA 3SN6A 5DNYB 1F48A 1IQPA 1SHKA 2GDJA 1X86B 1CULC 3B1WA 3B6EA 3QPVA 4L9WA 4LHVA 4NCJA 2NPFA 3R7WB 2OT3B 2NO9A 2ZRIA 2NO6A 4IVRA 4JKYA 2OLJA 4NYJQ 3PFIA 4ERNA 2ZYWX 4XTRA 4JLDA 4RZXA 4PC6A 4L9SA 1CJMA 3LXXA 5TMPA 2BM1A 2PT7A 2ANBA 2JLVA 2C9YA 2ZE8A 4L15A 5FTLA 2HT6A 1A7JA 2NZJA 2A5DA 1XEWX 1BMFD 5CDFE 3AVOA 3GQBA 2IXEA 4NMMA 1K5GA 4PO9A 4XWOA 4P4SB 4DB2A 4Q48A 1EX7A 3PEWA 3RS3A 4BASA 4HLCA 1OFIA 3T12A 1DPFA 3BAFA 3GLFA 2QMEA 2FPKA 1VYUA 1SXJD 4C4PA 1XD9A 2VHQA 1YRBA 5EE9A 4QM6A 1YVDA 2OE2A 1ZIPA 1TAGA 1E2QA 4QGHA 4QGFA 3WYAA 1ZD9A 3O8RA 2P6UA 4BECA 1DAMA 2XEXA 1NLFA 3VMFA 1TF2A 2QMOA 3KFVA 4J0QA 4DCVA 1D9ZA 2W2TA 3ICQB 1GNQA 4BEJA 3KUCA 2OHFA 2GWHA 2XITA 3BE4A 4X8OA 4DC9A 2JLSA 2DBYA 1E9FA 1G18A 4QBFA 2PX3A 3CKLA 2V7QA 2RGCA 4QXAA 1YQTA 2AKYA 5AJVB 1Z6YA 4D81A 4KBFA 3LDAA 1OLOA 1N6IA 4U5XA 1WRBA 4EKDA 4IOJA 1DEKA 3B85A 1GL9B 4PQYA 3B1VA 3FMOB 2YINC 4PO8A 2CCJA 4OK3A 5EE1A 2NMVA 4MYUA 4MYTA 3VR3A 3WYGA 3LLUA 3K70C 1RKBA 3SC3A 2IYSA 2ODEA 3GJXC 5DI3B 1EFRD 4B73A 1NIPA 1G6OA 4AI6A 5LB4A 4A8JC 3I62A 4PXAA 4AC9A 1VHTA 1W36B 2RGBA 2DYKA 2KWIA 5EXSA 4XD7D 1PLKA 1UKVY 1KO8A 1KKMA 4I81A 3KB2A 3MG9A 5JWRA 2WM9B 4AG5A 1XMIA 3AP3A 4BFWA 5JEEA 2QGNA 2WICA 4F4IA 4B34A 1W0KA 3AVPA 2QRNA 3CO5A 5SZHB 3KXIA 3LV8A 2BVNA 2ORWA 4JVLA 2DPXA 4CW7A 2WKPA 4EUNA 5E95A 4KVAA 2ONKA 3CNLA 2WSMA 1GRNA 1OIVA 2XOKD 1MOZA 3AF3A 3MAAC 2CJWB 5DHAA 4RD1A 2GZHA 1W4BA 3OEHD 4PHGA 4PQRA 4W5WA 1VG0B 1KI4A 4OHXA 3T1QA 1LS1A 1TU3A 1UBCA 2WPDA 4OYHA 1G291 3RSLA 2VLIA 2ZUDA 3B13B 5CDFA 3QBVA 3T1OA 3P27A 1J2JA 3UMRA 1XEFA 4NDZA 5FL3A 1W4CA 4XD7A 4ZCIA 3CRRA 4B6FA 2HLDA 2OZEA 1EFHA 4IDQA 1E2GA 3TVTA 3SOPA 3ZH9B 1TADA 5FTKA 1E1QD 2CE2X 2WWIA 3IIJA 3EC2A 1Z3IX 1LS6A 2V6JA 3U2QA 4MQBA 1E9BA 1L2TA 2RHDA 2OEPA 2V4ZA 3IBYA 1VG9B 1T9HA 5FBLB 4D4JA 3GLHB 4DDTA 3U7HB 2ZI7A 3DZDA 4OQLA 3U6KA 1US8A 2DWQA 5G40A 3BK7A 5DN6D 5KSYA 2HEIA 1HTWA 2WSSD 4M1TA 1PUJA 2J0UB 4PHHA 1NVUQ 2AXPA 5FBQB 2ZU6A 4AKGA 1KKLA 1BS1A 1H65A 3C5HA 3B2EA 1E2JA 3QY0A 4DVGA 4LCBA 1MRNA 3B1ZA 2VSXA 4HDOB 3TR0A 2VP2A 4Q47A 5F9HA 1KDTA 2QROA 3QPUA 4RD4A 4F93B 1SKQA 2CL0X 3GP8A 5FUYA 3I61A 4F7WA 2G1JA 1RRPA 2FFBA 2QTVB 3AEZA 2H5EA 1YKSA 5CK5A 2QP4A 5HE9A 2I3BA 2JEOA 4AKIA 2FN4A 4YXWA 2CLDX 4CZ2A 1UAAA 1Z2AA 3N5CA 4BEBA 1OPXA 1XX6A 1COWD 2LKDA 4BE7B 2NO7A 3ZDQA 4A92A 4KITB 4IDNA 4PPFA 4Q7JB 3AGQA 4K81B 3GLHA 4UNRA 2C78A 2JJ1A 2F3TA 3KB1A 4PX9A 2C96A 2BC9A 3BH7A 3I8XA 1F60A 1AGRA 3N2IA 4B32A 2H1LA 2GEVA 2VL7A 1Y3AA 3M4YA 1XMVA 3VR2A 1YJ5A 2ZJBA 2WHXA 4B3XA 3HYRA 4DSNA 3R8FA 2AFHE 4RD6A 1OHHD 3A1SA 2Q9AA 3OE7D 1GRQA 3T5DA 3KDSE 1NVXQ 1IJFA 1YZUA 3SNHA 5JECA 3DKPA 3EPJA 2YWHA 4GOJA 3Q5DA 5FL7A 4ZDIA 2XZPA 1A4RA 2PLFA 2OXCA 2PCJA 2ZJOA 2D2EA 2IUSA 4TL7A 4NZYA 2J7PD 3RS2A 1YRAA 5H8WA 2IS1A 2IXFA 1J70A 3QXJA 3OIVA 3HU2A 4B3BA 3FKSD 3SJCA 5IHPA 3OF5A 3Q3JB 3W6NA 1X3SA 2ZRJA 3RS4A 3SYLA 3ZZ0A 2JIZA 2CCGA 4N0EA 1IXRC 2H92A 1F2TA 3FYHA 1YZQA 5EUMA 3WBJA 5IDVA 2HDNB 5G3ZA 4OKSA 1CR0A 3LLMA 3RRMA 3SYNA 2ZI4A 2H16A 3K09A 3MWLA 3K9HA 3EAQA 1F5NA 1MABB 2IUTA 1X1SA 3QKUA 5SZJA 2PL3A 3K53A 1XZQA 2YZ2A 4FMDF 4M1YA 1PUIA 4LBYA 1AS2A 2YC2C 4Q7LA 1R0XA 3KKNA 4OJQA 5TXGA 2FGJA 3CRQA 1Q57A 3BFXA 3LRPA 3AVVA 3RDPA 1PLJA 5JCZA 4KFUA 3UMSA 4A9AA 4DDWA 1E79D 3C5CA 2R6CA 3UATA 2ZTSA 2V9PA 3A1TA 4CRWB 4LJYA 2OO7A 4DSTA 2PEZA 3FMPB 3NDPA 2MSEB 4IOMA 3A4LA 1NN1A 2C8VA 2GJ8A 3A1WA 4MKIA 4O25A 1G1MA 3QXSA 2HJVA 3DOEA 3RLFA 1E0SA 2O0JA 1ZCAA 3WY9A 3CH5A 2R6FA 3ZIAD 2DY1A 3GMTA 3CRW1 4YMTA 1LNZA 4V02A 1NRJB 4UNQA 1BKDR 3REFA 1T6NA 1HUQA 2QAGA 2XNDA 3I3SR 4FMCF 4KLNA 5DYGA 3PXGA 3SZRA 3ZS9A 3THXB 3FFAA 1T3SA 2HJGA 1MABA 4C0KA 5KSZA 4B43A 1SKYB 2A7QA 5M04A 3GLGA 2Z0MA 4OI1A 1H8EA 4O0MA 1AN0A 4G5QA 1OH6A 1SXJB 3TMKA 3K0EA 3ZJYA 4CDGA 2JATA 2XX3A 3RAPR 4PAQA 4GP7A 5FUVA 4Q02A 1NVVQ 2OUKA 1RVDA 3TBKA 2J46A 2QI9C 2RGNC 1Z06A 2AL7A 3REGA 3A58B 5KPDA 3TJZA 3GLIA 1T3LA 2Z4SA 5BN3A 1N6HA 2IS2A 4CGZA 3WNDA 5KDDA 4WW0A 2GZDA 3EA0A 4O3MA 3R8CA 1HURA 4LV5B 1E9AA 4XVQA 1YHNA 1G5RA 3THYA 2C2HA 1G8HA 4QHYA 2GCOB 4PO1A 2GVZC 2O8FA 3P32A 1OIWA 1E9CA 2FZLA 4M8NE 4YLGA 3QJYA 2ZIAA 3VHLB 2ZREA 1RE0A 1ZYUA 1JEDA 1VCIA 3BB3A 3QEJA 1C1YA 4AYWA 1EWRA 1KK3A 1Z6AA 4FIDA 1IY1A 2ECKA 4BUJA 1LB1B 1ZU5A 3TVDA 5GVRA 2MSCB 3FVQA 1NY5A 4KFRA 1T3HA 1ZUIA 4Q4JA 1SXJA 5B64A 4C2TA 5FTJA 4P33A 2H57A 4BLQA 3B8HA 1FNNA 2OCBA 4Q1AA 4PANA 4F4CA 1RIFA 4CYMA 2CNWA 1NN0A 4LHZA 5DO9A 4M1KA 2ZYVX 5TV2A 3VTKA 2FE4A 4D82A 4DXAA 3NH6A 3B82A 1LF5A 5DIFA 5JHGB 1Z07A 3K0FA 2BJWA 4MA4A 4DBLC 3ZVNA 5J40A 2P6NA 3EWAA 4GI7A 2EWVA 2AD5A 2C95A 3OIWA 2VP9A 2KBFA 4QGGA 3TUIC 2ZAMA 2ZI6A 3AKYA 3MLEA 4D0GA 5FUXA 1C4OA 1XTIA 3IQWA 2B6HA 2OCYC 3SS8A 2C03A 1U94A 2B7BA 1UFQA 2PMKA 3QG1A 1VCNA 4M1SA 3AKEA 1OXXK 1GILA 3B1XA 4WOPA 3CONA 3PCRB 1VG1A 1UJ2A 2CHQA 3KUDA 2QAGC 2N1BA 3Q72A 1OXSC 2V55B 4JLVA 4YDHB 1D2NA 1A5TA 4A1FA 1E1QA 1F2TB 1TPZA 3RWOA 2PZEA 1X8KA 2GHIA 3TRFA 1KGDA 3HDTA 1NVVR 5TVKA 5GJBA 5FR2A 2QAJA 1GUAA 4URWR 1SVIA 3EWSA 3B1YA 2HCBA 2XSZA 4II7A 4URZR 2GF0A 2GXSA 2Z43A 1P72A 1UDWA 4PHTA 1ZJ6A 3PEVA 4RCYA 3U4QA 2XNDD 2GF9A 2WAYA 1WCV1 1XBTA 3TSWA 4D0LB 2OAP1 4Q4AB 3K9GA 1U81A 4OK5A 2JLWA 4B6EA 5IT5A 3NC0C 1W2HA 1P2UA 3OFND 5L3SB 4TLDA 3PUYA 3SHFA 3EG5A 3FKSA 2F55A 4RY2A 3UPUA 3F0TA 4HYYA 2AWNA 4WZAE 4GNKA 3LFUA 1HEIA 4WIAA 2FJUA 2QY9A 2XJ4A 3AF2A 5KNCA 3I5YA 3EIEA 5DLQC 4IEEA 2CBZA 4ZDJA 1KI7A 1ZNWA 3L43A 2GJKA 2JA1A 1V5WA 2GK7A 5KHOC 1Z0DA 3H86A 3NBZC 1NF3A 1KTVA 4JLPA 5A5GA 3CM0A 3P4YA 4Q7KA 5H1YA 2RCNA 4KODA 1N5LA 3MWKA 3O8DA 3WP0A 1D5CA 3CNNA 3EASA 3GEHA 2BDTA 4HB2A 4LRWA 4YONB 4DLRA 4JVNA 2BBWA 3U3MA 4AG6A 2XXAA 2BCJQ 3AB3A 3FWYA 5G3YA 3TH5A 1L4YA 1E1RA 5FOWA 2VF8A 1Z5ZA 3KQLA 1LF0A 1KDRA 3B5JA 4EJSB 2YC4C 3GD7A 4XSHA 1XF9A 1XTKA 5FI0B 2YWGA 3JVVA 1NSTA 1AQUA 1VIYA 4B3FX 5EZ6B 1E6CA 1UF9A 4A36A 4BFXA 1WA5A 4BFYA 5AUNB 1BYIA 4C3ZA 2GKSA 1U8AA 4DLTA 1US8B 2WJJA 4PSKA 4QHSA 5FTMA 2UVQA 1RC8A 1PVOA 4NYIR 4LOAA 2ZPTX 4R71A 1MO5A 2ZJ5A 1I4LD 1R5NA 5E4FA 2BMDA 2ZJ8A 1EFUA 2CK3A 1Q20A 3AKCA 5IK2D 3A8TA 2ZJZA 1KO5A 4MRVA 3EA5A 4RSGA 2GCPA 2Z6VA 1CJKC 2RGNA 4ZPXA 3HWSA 4TLBA 1JR3E 1NVWQ 4OI0A 2P5SA 2MSDB 2IHBA 3AUYA 1OE0A 4ITRC 5EXTA 2I1QA 3KTAB 4C0SA 4GPTA 1M74A 1N6PA 1JECA 3CX6A 1E9DA 4IOKA 4AYTA 4BFSA 4TLAA 3FGNA 2IA5A 1KZ7B 1KI2A 1QRAA 3NEYA 5AUQA 3SQWA 2ATXA 3D8BA 4LGMA 4Q9JA 4EDHA 4P32A 1L7VC 4EIWA 3AF1A 4Z1MA 4FCWA 4XWAA 5EUQB 3PUZA 1VECA 2FEMA 1JALA 5DI9A 2VRWA 2Q21A 2CMKA 2ZS8A 4R2HA 4UNSA 4TYYA 1RYFA 3HPRA 3RNLA 4TL9A 4FINA 4AURA 4JSYA 4PFSA 2IBMA 2GBLC 3WRYC 1M8PA 3LH5A 3U7FB 4IXMA 3ZGXA 4C7OA 2CVFA 3EPHA 2C99A 5JWHA 3QG5A 5FOXA 1XEXB 4HEJA 2J0SA 2PJZA 1IY0A 1FFHA 1KJZA 1ZCBA 1MRSA 3K9NA 4MRNA 5A0FA 1RW4A 4JT4A 1Q22A 2O5VA 2N42A 4GRAA 4QNMA 5EE5B 4LJ9A 3H84A 1ZD1A 2W2VA 3P26A 4Q4AA 1DAHA 2GCNA 4US0R 3KXKA 4NU0A 5P21A 5JEDA 2JGNA 1OH8A 4EPVA 4BQSA 1E0AA 2FSGA 3AP2A 2QEQA 4Q1DA 3LO5A 3QKRB 1JI0A 4MKFA 4ZKDA 4HLUA 2ZRGA 5AJXA 4RD2A 1I4TD 4B35A 1ELOA 2FA9A 4RJLA 3WNCA 3NTUA 4FWTA 2CL6X 1VYTA 2F1HA 1AA9A 2IYVA 2VH5R 4HB0A 1W7AA 4MKHA 2O8DA 4LUCA 2C04A 1T8TA 1UEIA 5SZIA 4NCHA 3CPHA 3WHKA 1DTSA 4KVGA 4PR0A 3GLHE 1XZPA 3L8YA 2X2EA 2A5FA 1KSHA 3ADCA 4B47A 3U44B 4D4KA 3W3ZB 5JMTA 4CEHA 1N6NA 4C7OB 4KFSA 1N2CE 3ADKA 4RFVA 3BRWD 4LPSA 2F1JA 4TMWA 3QXCA 2AFIE 2OFWA 3KQNA 3U5ZB 4IKEA 3C8UA 2J41A 3LNCA 4ZO4A 1DAGA 3OESA 3RS7A 3TUJC 3THWA 2JLZA 1O87A 1VDZA 4JLBA 5TDHA 3CIOA 3CW2A 5IK2A 3RABA 4M9XA 1M34E 1P9NA 4EJSC 2J5XA 1Z6XA 2R8RA 1W36D 3RRZA 5LB2A 2OESA 3MCAA 2NO1A 1KIMA 2QU8A 4RD3A 4LPKA 3KX2A 2PZGA 1EX6A 3QPWA 6Q21A 2ZE6A 1W0JD 3U4QB 2WTUA 4V0LA 4I4LA 3PITA 1N5IA 2XGJA 2SHKA 3X1XA 1GITA 3FHOA 1MT0A 4FXPA 1D6JA 1AS0A 2FSHA 4URVR 1EFRA 2R6AA 1RPZA 2RGDA 1N3BA 5BN4A 1JR6A 2WWYA 2ATVA 1TQ4A 4LHYA 4WA7A 1XCGB 2IXGA 4LHXA 2AXNA 1QZXA 4EPYA 1R7RA 1NJFA 1E9SA 4BGDA 1GOTA 3KKPA 3OEHA 1CU1A 5J5CA 3DL0A 5KU1A 2PEYA 1PLLA 1QVRA 2ZROA 3NG1A 1YR7A 2IF0A 2QORA 1K5DA 3AVYA 2P67A 1KDPA 4Q9LA 5JWOA 3QKSA 5CIWA 4TYWA 1W5SA 2AHOA 1D2MA 4MRSA 3UK6A 5EQTA 4FN5A 5FPHA 3ZS8A 1GTVA 2P5TB 3QENA 1MO6A 2PMDA 5FBVB 1WB9A 1W0JA 1KAOA 1MO3A 3GEEA 3K0AA 4DSOA 4DUGD 4FMCB 5F3WB 1MH1A 3CPEA 2GVDC 3MWYW 3CRVA 1S4QA 3X1YA 1WBBA 4M9ZA 1ZMXA 2RGGA 4B3CA 4JYBA 4IFBA 4TMKA 1R6BX 4G5SA 2H7VA 4KYIB 1XEWY 5B30A 2LCFA 3WMGA 4LV6A 1CTQA 1N0VC 2P3SA 2X8AA 4V0KA 1XMJA 2QGZA 1ETUA 1IN8A 2F6RA 2W00A 4KLZA 1JNYA 2QAGB 2GXUA 1D9XA 3I5XA 1EESA 2QM7A 3KKOA 4I1UA 4JJKA 4RZUA 5JZVA 1FMLA 2R9VA 1UADA 3FE2A 2N46A 3A36A 4DUGA 1CF4A 3ASZA 4LI0A 1J90A 1ZUHA 2JDIA 1P61B 3KL4A 2P65A 3AV0B 1II8B 3ZVRA 1G7TA 4G1UC 5EE0A 1U9IC 1BOFA 1XFAA 1MO4A 1MKYA 2JIZD 3AQ4A 4HATA 3T34A 2ZVQX 5J4HA 1QHXA 1DAIA 4IEIA 1KOFA 5DN6A 4DRZA 3GLIB 1CBUA 2YWEA 4TTPA 4M9QA 2V1UA 1R5OA 5CYOA 3R9IA 4B3DA 4BFZA 5JRJA 3LQRA 5DYIA 5J4KA 1I4DD 3NBYC 1P60A 3QBTA 4Q5IA 4BZXA 2VP5A 4D0NA 2WKQA 2PX0A 3IILA 4OK6A 2ASEA 2RMKA 5IRCD 1G3IA 1ZIOA 3EZ2A 1SVKA 4QM7A 1FP7A 4NBSA 4MUAA 3ADBA 3WHLA 2ZANA 4TMVA 3IKJA 4HB4A 4DLSA 2OLKA 1Z0KA 4DEYA 2IEYA 1FPMA 4DIDA 4UNPA 2CJWA 3BD9A 4LY6A 3RC8A 3LVQE 4NYMQ 5L3QA 3V4FA 1Y63A 4HUQB 1TX4B 3C16C 5DI3A 5CB6A 2FEOA 1HY3A 2GCOA 3QXHA 4I1SA 1TQDA 2ZRHA 4O2RA 5DISB 3VAAA 3FHCB 1BMFA 1XB2A 3AP1A 2WOJA 3MRSA 4GOKA 3M0EA 4S35A 3VX4A 1KHTA 4LV8B 3EZ9A 3GLFE 4K8OA 3KKQA 3A1UA 1G21E 2J7PA 4Q03A 5TB5A 4F92B 3CBQA 2GA8A 2DWPA 4WBSA 1WBDA 4Q00A 2VPPA 2FFHA 4HB3A 3THWB 2XAUA 2QTFA 2VBCA 1GZSA 2C98A 1HH4A 3W6PA 4YC7A 4ESHA 5K8IA 3X1ZA 1E3MA 2QMHA 4U00A 1JJVA 2Q9CA 5CLQA 4ASUD 2Z5FA 2I1VB 3VFDA 2YOHA 2O0HA 3ZZTA 1XDBA 1G6HA 3SJZA 2QT0A 3KQUA 2CCKA 2V6IA 4AIIA 4Q66C 2YJTD 5L3QB 3RYTC 2ZRDA 2JJ2D 3UG7A 3GJ3A 5A4JA 2BKUA 3PUVA 1E4VA 5CLLA 1DAFA 3EC1A 1CKEA 4DDVA 5B58C 4EAQA 1KJYA 3NVAA 1DVRA 4QOSA 1OB5A 4MDFA 1GL7A 2VSFA 3QOFA 4B76A 1TQ6A 2WWWA 4JMPA 3TR5A 1KO7A 3PEUA 2ERYA 3JVUA 2EWWA 1E98A 1DS6A 1SVOA 1II0A 1W48A 4JYCA 1VCMA 2UZ3A 3EW9A 3THOA 2QP3A 4IW3B 2QBYB 4LYHA 2JJ8A 2EVWX 3DVLA 1R5BA 2NIPA 1OT3A 1JQJC 2D4HA 4AKHA 5HCIA 1WXQA 2J0QA 4PZYA 1E2LA 4LJ4A 4HZUB 2QE7A 1SVLA 2ZEJA 2VF7A 2ZETA 3DKVA 1G16A 5FR1A 1WF3A 3IGFA 4Q9IA 1B0UA 5DGXA 4OL0A 2IUUA 3AF0A 2O8FB 1ESMA 3QI2A 3GLIE 3V4RA 2W83A 1HYQA 3I4LA 5JJKA 1OFHA 4AK9A 2IK8A 3ONWA 1RJ9B 3C15C 2W0MA 2ZI5A 3C7KA 4G0NA 4ZCMA 3VNVA 4G3XA 3EARA 3BH6A 1E32A 2OILA 1ZBDA 1E96A 2IYTA 5HZHA 3EPLA 1LW7A 5DH9A 5L3RA 1NBME 2VSOA 2F7SA 4GFDA 5BYKA 2JLRA 3IDQA 4EPWA 4FW9A 4TZ0A 3E70C 4XTCS 3QQ5A 1GRRA 2NOAA 4NP6A 3KKMA 4LJ5A 3RRYA 2J0VA 5JFGA 4GZLA 1G8YA 4F4JA 1Q3HA 2HUPA 3AGPA 1CLUA 1TNDA 1K6MA 5EP1A 4NKRA 3VR5A 2JJ1D 2YOGA 3TK1A 2HYDA 1AGPA 1G64A 2OG2A 2VA8A 4N3NA 1T91A 2ZVPX 4JLNA 1F2UB 1AJEA 2ZSAA 4Q18A 2XOKA 1P9RA 2CL7X 3I32A 3S1AB 1KSFX 1QHIA 3K70B 4A0FA 1FP6A 4B3GA 1VG8A 2HT1A 2UKDA 3U6BA 4NCIA 1RZ3A 2GZAA 2BM0A 4JIMA 4BLTA 3BWDD 2WVJA 2H18A 1KI6B 4MYHA 1W36C 2GXQA 1R0ZA 2Q6TA 4UNNA 1ZM9A 2XTZA 3Q9LA 4B71A 1YZLA 1X8JA 1Z2CA 3WMEA 4HDCA 2QSZA 1G3RA 4U02A 4ZDKA 2MMCA 1S1CA 1Q1BA 1AKEA 2FG5A 2IYZA 3QF4B 4B44A 3BC1A 1KNQA 3MJRA 4XIGS 4OQXA 4ABYA 3NC1C 2WMOB 2WBLC 2IW3A 5L3SA 4P4UA 4A8JA 4TYPA 4DWJA 1HA3A 4MH0R 4GL2A 1LFDB 2QBYA 5BWMA 5FPYA 3I72A 1ZD8A 1ZC4A 2QQ0A 1GG2A 1HQCA 1W46A 3OAAD 4HUTA 4LJ7A 4WXRA 2GEDA 4KCGA 4B74A 2NPIA 4CVNA 2FZ4A 3S1AA 2GILA 4URUR 2VHUA 2IF2A 2OAQ1 1R8SA 3IEUA 1P3JA 2QZ4A 5AUPB 4I99A 2F43A 4M9SA 1Z29A 1ZRHA 3CR7A 1CP2A 4A4DA 3CWZA 1WE2A 1OYYA 2YYZA 4YMVA 2ANCA 5BQ5A 3LX5A 1NBMD 2A2ZA 1ESNA 3BB1A 2QP9X 1S8FA 3IPXA 2ORVA 3OAAA 4JL8A 1Z6GA 2FFAA 3CH4B 3KFXA 2FMXA 1JBKA 1ZINA 4LC0A 1AKYA 3TIFA 4A6PA 4DLXA 3DHWC 4W5JA 4PHFA 5BN5A 2JLUA 4LYJA 3TKLA 3LA6A 5G53C 2AWOA 1IXZA 4LDJA 5IF9A 2ZE5A 1BYUA 2W0SA 4Q4JB 2GXAA 1DBSA 1AK2A 1LVGA 4TTQA 4I1OA 1GFIA 2FPLA 2ODWA 2HLDD 1KK1A 1I2DA 2P2LA 1FTSA 3E2IA 3K0CA 2G83A 3LAWA 4RKEA 1XP8A 3A6PC 2JJ2A 2FNAA 4NONA 2WJHA 3KQHA 4QKQA 3N70A 1W44A 1QF9A 4Q7MB 4DCNA 5JI3E 2CXXA 3E1SA 4OI2A 4PSAA 1FOEB 3PUXA 5J4VA 4QG7A 5KDLA 1C9KA 2FSIA 4PPNA 4C0LA 1ZVQA 4R7ZA 4A8JB 1OF1A 1IN6A 1TUEA 3DPUA 4K46A 2GETA 4TLEA 4PC1A 1IONA 1Z0AA 1AS3A 1CR2A 4KSCA 3G0HA 5HKKA 4CIDA 1E2NA 1NKSA 2W6JD 4JVSB 1YU9A 4W7SA 1HT1E 1J8YF 4YDSA 4P0TA 2IS4A 3EIHA 3F3YA 1GL6A 1Z08A 4Q19A 4DCSA 2VHJA 5FUWA 2XZLA 2YVUA 5FTNA 3QEOA 4RD0A 5CITA 4U7DA 3AKDA 1FZQA 1S2MA 4B2LA 2EYQA 2VP0A 4C0AC 2VEDA 4GDFA 1N6KA 3D3QA 2ZAOA 1DE0A 1UKYA 3NHAA 4URXR 3AVWA 3SFZA 1DO2A 1FQJA 2CVHA 2ZRNA 4DLYA 3Q85A 2ZI9A 4IVPA 4ON9A 4JZKA 5DE3A 4PAOA 2RB4A 2BV3A 4DLVA 3TGPA 1CR1A 1Q0UA 3I8SA 1XWIA 2G0NA 1CJVC 3Q7QA 2REOA 4Y0AA 2FH5B 4MGIR 4V0OA 3DM5A 1N0WA 1BH2A 3TNFA 2OM2A 4Q9KA 2HYIC 2WJIA 3AF4A 5KNDA 5DHFA 5B2ZA 2DHRA 1NP6A 3UANA 2VQSA 2YOFA 2O8BB 1H8HA 2ZJ2A 4A2PA 1S3SA 1S3GA 3WNBA 2AKAB 2QG6A 4Q1BA 4RCZA 3FB4A 1YR9A 5JSZB 4E03A 1NLYA 2GRJA 5D3MA 3FMIA 4PAMA 1XRJA 1ZNYA 1DELA 5HR5A 4RKFA 2ORIA 1TF5A 4ZCLA 4BRUA 2ZXUA 3FTQA 4A0HA 1XTSA 1XJCA 3IEVA 3W6OA 1QHGA 2OBNA 4W9MC 1T5IA 1NI3A 2CE7A 5EP3A 5EP4A 5JI2E 2IC5A 2D74A 3PVSA 4GT1A 3U3JA 1AZTA 2DFLA 5B57C 2JDID 1W0KD 5F2EA 1GKUB 1OFUX 4OHYA 1E1RD 2YNMA 4C0JA 5TARA 3K09C 1XTJA 1Z22A 3DDCA 4WAUA 3O8BA 1U90A 2PLRA 1WDTA 1JXOA 1TMKA 1Z0IA 1KJWA 4IXNA 4XSGA 1NY6A 1EFCA 4BLSA 3MUFA 4HAZA 1TEVA 1NIJA 4OJKA 4ASUA 2ODBA 3PG5A 3W9YA 1G3MA 1SQ5A 1Z6TA 4D2IA 2QL6A 3U3OA 1XD8A 3BERA 1U8YA 2ZJAA 2Z4RA 1G3UA 1P4SA 3LBNA 2PH1A 3NBXX 4M1MA 4ZI3A 4YMWA 2RHMA 2WJVA 3PIRA 4C0HA 2YWFA 1DAKA 1VIAA 1HE1C 2D2FA 5GJVC 821PA 5HKKD 2IS6A 1XXHB 1U2RA 521PA 1U0LA 2O52A 2W6JA 2WKRA 1XPRA 5CYPA 3P1JA 1W2GA 3GCGA 1P5ZB 4JJZA 2FF7A 1T0JB 3ICEA 1Z0FA 4MGZR 3THYB 3QUSA 4LBWA 2NO0A 4TYQA 5L8VA 4LJAA 3B78A 4ACBA 2FGKA 1OB2A 4B48A 3ZQJA 1CRQA 3BXZA 2ZR9A 3R20A 4A0GA 4CT5A 1X8LA 2LWIA 3IO3A 4ARZB 3W90A 2OBMA 2XB2A 4PZZA 5JHHB 2WJGA 4HAXA 4L5BA 2WAXA 2J45A 1KO4A 4MITA 2C77A 3A1VA 1R0WA 4BFUA 3X1DA 2R6GA 4TQAA 1RYHA 3H1TA 4F91B 1KNXA 2HCJB 1NLZA 2NQ2C 4GZMA 1JAIA 2BBTA 1MV5A 4L8GA 1Z28A 3TAUA 4XOIA 3W8NA 1YE8A 4AKEA 4BZPA 1OH5A 2W6ID 4JL6A 421PA 1IAQA 4PPQA 2JLXA 4DKXA 2B92A 4TMXA 2BKEA 4ZV4A 3GJ5A 5K8TA 5D3MB 2HV8A 3ZLJA 5LD2B 2XNSA 2VIIA 3CLVA 5JS8A 1KMHA 3U44A 3KJIA 3LQQA 4CEHB 1B23P 2PT5A 4WXPA 2KB0A 4LWZA 4D26A 2X1VA 5KNBA 5EZ5A 2ZS9A 1BIFA 1OXUA 3PV0A 3LWNA 2OBLA 2PZFA 3SR0A 3BFVA 4P4TA 4JBWA 4D4LA 3H2YA 4BLOA 2BBSA 1Q3TA 1N6LA 5CM8B 3RRNA 5FBRB 4ILEA 4RVCA 4JL5A 3RWMB 3VNUA 2GJ9A 2WZQA 4OQMA 4DEXA 4ZI2A 1M2OB 1OIXA 1E2IA 4C9BA 3KJEA 4O2LA 1XTRA 4JS0A 2FWRA 3RVBA 2QN6A 5J47A 1G4UR 1ZAKA 1JEEA 2EFDB 4RZ2A 3LW8A 1ZM7A 3TW4A 1EWQA 3VQTA 1NMXA 1Z8FA 2TMKA 4IVQA 4AWXA 4D6PA 1DARA 2WMNB 3ECCA 3QVVA 2O8BA 1XPOA 1ANKA 4A0RA 4ARZA 5LBIA 4IOLA 5FH9A 3IO5A 2X2FA 3K8YA 1GKIA 4FMDB 5KOYA 5L3VA 2ZI3A 2FU5C 1XJ0A 2D62A 3L82B 4KV9A 4TSFA 4CT4B 2KE5A 5BYJA 3AUXA 121PA 4R9UC 1NSFA 1FMJA 4JT2A 4LYFA 4LHWA 2L0XA 3OIYA 3MSXA 5BW8A 5F98A 1VCOA 3DMDA 1II9A 1L8QA 1COWA 1GP2A 3O8CA 4BPBA 2XTMA 2ZSDA 1ZUNB 3C4JA 4DHEA 2I4IA 2IWRA 3K9LA 1OXTA 2IEZA 1J99A 3C14C 3L0PA 4TLCA 4H1UA 3V9PA 4OQFA 4UQOA 1E2EA 3K0SA 3R7WA 2V7QD 4G5OA 1EK0A 3K0AB 4KSBA 4QJ5A 4EPXA 5FOTA 3MMPA 2WIAA 2A78A 2WV9A 2EQBA 1PJRA 1KI8A 1OFTA 2DCUA 2Q3MA 5CIQA 4EPTA 4WZ6A 1RRCA 1DOAA 2CLCX 3L0OA 4PSVA 2F1IA 1SVMA 3W5IA 4NTZA 4ZIRB 5D3QA 1YR8A 1E2PA 2QT1A 3B9QA 3CZPA 3B7GA 1I2MA 2IYUA 4IDPA 5E7IA 3U3KA 3ZIAA 2IX3A 3PJRA 1N5JA 1FW6A 1JPNA 2IL1A 3P20A 2J87A 1ONBA
chains in the Genus database with same CATH superfamily
4XWKA 1C8KA 1T4GA 1YRWA 2FLKA 2P9JA 4MGHA 3NI2A 3QBDA 3OX2A 4QQ8A 4AY3A 2WA2A 1P91A 1L5VA 4NZPA 2JLBA 1LQTA 3O1JC 4LJ8A 4NOMA 4D74A 1GIAA 1L4MA 1RJDA 1TUIA 1SNYA 3ASVA 1S0UA 1K7EB 3EN0A 3Q11A 4BKMA 5KTSA 3JAMA 3B3JA 3I1IA 2FJ0A 4CGYA 4NXMB 1R4AA 1J33A 5KWSA 3TLXA 4LRTB 5C4MA 2ZUEA 2IYQA 1UJBA 3TE7A 4AN4A 3FH0A 4BVAA 1WQ3A 2WDPA 2OXRA 3JARB 2I7VA 2BGMA 2VP6A 4D3SA 2HHLA 1A77A 3OMLA 4O2BF 5IAEA 4DDMA 2QIPA 4WKBA 3M9XA 1YVUA 4DHWA 3SYKA 4HNAA 1W87A 2XCIA 4NZOA 5KTOA 5BPFA 2W6PA 5HNKA 1XRQA 1Z63A 4NOLA 3BICA 4OLFA 3F71A 4M9RA 4AMVA 3EAGA 5AP9A 3BAZA 4I4NA 3NGXA 4LZZA 3ZCRA 1D2AA 2PVSA 3K1AA 3OEEA 1NUQA 1VFPA 1UXKA 2ZRMA 4JGIA 3AZPA 4UMEA 2QQEA 4DCJA 2R65A 4IHKA 2IS4A 4ZOLF 1UUFA 3SZLA 3UXMA 1RYDA 1EFDN 3IXMA 4D7AA 4MV5A 4O4HF 5BW4A 3L8FA 4UHDA 3RS0A 1UKAA 1A4XA 1SUAA 2F67A 3OHMA 3UJ6A 3T1YB 4DLZA 3GAFA 3IIMA 1KFJB 4EM6A 1K8RA 5AVXA 1EUCA 4FD2A 1OKKA 5C1OA 1QYXA 4H08A 3UMFA 4EGQA 1ZMTA 4NZZA 1VKHA 2F3SA 3JZAA 1U0NA 3RHSA 5CJ2A 2EJWA 2FUEA 4Z7JA 5JJLA 4M8SA 2YFKA 1Y9AA 3TD6A 3BL5A 3JASA 3ZWDA 1NM5C 1QFMA 1HKHA 3FPSA 3EZNA 1N3LA 2OD7A 3E4DA 2QNBA 2WVAA 4LECA 3JD0A 2ZM5A 1UJNA 3GIDA 4LFCB 1KPGA 3ZWKA 3Q2IA 4ZI7F 1SAYA 1ES9A 2CYCA 3U3DA 1O6ZA 1CRWG 3AW8A 1HE8B 4MQEB 1CYEA 1HF3A 3EHEA 4BVJA 4MWCA 3ZY3A 2PGLA 4PG5A 2PWZA 3RANA 3G5MA 1U8ZA 1BRTA 4YX9A 5A4DA 4LC9A 3HU1A 4P31A 1TDJA 4FI3C 4V0RA 1FP4A 3RRBA 1K92A 3S99A 3OPMA 4DA6A 1NBIA 1RI4A 4TKUB 3TQIA 1PFKA 2WR8A 1KI9A 3BIJA 3Q5EA 4CKYA 2KLBA 3VPDA 1X0VA 3WMFA 3HR8A 1HDOA 4JIGA 4RFSA 4YFVA 2FSSA 5TJHA 3G2NA 1M6VA 2BEUB 2GMWA 3HNRA 4BQNA 2AIRA 3LCMA 2IYWA 4PC2A 1L6IA 4N0MA 4UJ5A 2O0MA 5ED0A 4AP5A 1BCRA 4EJSA 1UK7A 4L85A 3ZD6A 1IIRA 4NCNA 3PJDA 1CUEA 1I1NA 3HVHA 4O2AF 4MUFA 1UANA 1Z56C 5GJCA 1EHYA 2QL7A 3P0FA 4NXNB 3T15A 5JR3A 2XMPA 4E15A 3B9PA 1N6OA 1ISRA 3E8SA 1OJLA 3L46A 4P7BA 4CM5A 1GGVA 3OQ1A 3H9CA 1NNEA 1KPIA 2OBFA 2XRMA 5AOCA 3QWFA 5AKZA 3MRVA 3N0VA 3VO8A 3EEIA 1WDLA 721PA 2C3MA 1IJBA 5IAGA 3ZCQA 5MFPA 1EWTA 5J2UF 1ZOLA 3CF2A 1EGAA 5AM4A 3A6KA 3VC1A 4C0QC 3T1TA 3WRYA 1NL3A 3HZHA 1Y6ZA 4W63A 4ZTZB 2I7CA 2W58A 2RC5A 3CZ4A 2CK3D 4F1KA 2MMGA 2XAAA 3VTFA 2G6TA 5AJWA 3CR8A 3H42B 4PN7A 4IVNA 1V6SA 2V6FA 3GP5A 4REMA 1E9VA 1Z5NA 3OIFA 3VR5D 3WNZA 4JJ6A 1LD3A 3D1LA 4UU8A 5H4HA 4C87A 2DB3A 4EQ6A 5AVWA 4E5UA 3T9AA 1GT91 3BGSA 4N7MA 1LDNA 3M6LA 1M83A 3UIEA 1YAJA 3FOZA 4BNGA 1FU7A 2L82A 5KOJB 2QD2A 2V3WA 5JADA 3D8NA 1SVUA 5H70A 3UJDA 1HZJA 5FPKA 3DZJA 4QVGA 3OCCA 4H1TA 4HX2A 1S9DA 2GPWA 2O2YA 3PHBE 5FI1B 3AY3A 4C2UA 3P9SA 1OKKD 2R96A 3M5DA 3O4GA 3R3HA 5DP1A 1Z35A 2VJNA 3RVJA 1WQ1R 2XKKA 2B61A 1JWAB 2PH7A 2YXLA 3EUWA 1T1JA 2ABWA 3F5SA 3RRFA 5HE8A 3U7IA 4KU4A 5C1BA 4EGSA 3OE5A 1TL7C 3NAQA 4GZ5A 3WGNA 2AC4A 2OV3A 3AX6A 3FDIA 3V7FA 1F0NA 1TM7E 2WE8A 2Y76A 3OO0A 3V4OA 3FWHA 1MU0A 3CB4A 5FAXA 1VJ5A 3GRCA 3WX0A 3A3YA 3IQXA 4PWZA 2HA0A 1QHHB 4JH0A 1OR8A 1V45E 2UXCB 5IH3A 4HADA 5C34B 2EXXA 1ZK4A 1KSJA 1Y3CE 3QUTA 4IO1A 1W4RA 5I7HA 4R2XA 4M1WA 3N58A 1D2GA 3LBIA 1FL9A 4PBSA 4HZIA 4KAJA 3QKSB 4BIMA 1DDIA 3CNBA 1K5PA 5B6PA 3NKVA 4YT8A 2PD4A 2IYAA 1TKBA 3PQEA 4Q21A 3V8NA 4WD3A 5EJEA 4KAXA 3EGDB 3LFHA 5J2TB 1F3OA 4ARUA 1ZG3A 1C3OA 2D1YA 5JSHA 4L2IB 4C3OB 3N7AA 1E2HA 1R2QA 2B35A 3DZ8A 5BVGA 2FQXA 1F8XA 2CVQA 2NU8B 3Q7TA 2C94A 4HC4A 4IIJB 4OQZA 1EUZA 3CH6A 3ZWMA 5JCPA 3BZUA 3C24A 5FTWA 4DV6B 1P5HA 1QOPB 1X0XA 1CF9A 2IY9A 3DZGA 1MA0A 2JI8A 4LSGA 5DWDA 1T5SA 1W88A 3HB0A 2AOXA 1OASA 3KUUA 4NWIA 4I1IA 3UNXA 3HVJA 2UVPA 1Q6ZA 5IVPA 2ZRAA 2J3EA 3B2QA 5JCJA 4YAFA 1Q3KA 3NX4A 4X1IB 2LXNA 1FUUA 2RGWA 5J5VA 1IHUA 1QR6A 1N6RA 4JYPA 5EJ6A 4XQEA 5EGSA 1F4LA 4L8FA 4QG3A 2FSUA 7GPBA 3LVRE 4OY3A 4V0NA 1Q95A 3JD2A 3S29A 1NJ2A 5ITSA 3GLFB 1YMQA 3OJWA 2FEKA 1CUYA 3NXKA 4R4JA 2YNMD 4ATNA 1WZ2A 3CRMA 5BW5A 3HB7A 3SBOA 4ENVA 2EFYA 3BBPA 1FRFS 2CBXA 2QG9A 4D4MA 2LUOA 2W93A 2UXBB 3VI4B 4NZMA 4ZAYA 3ZQ6A 1IVSA 1PJLA 4NEGA 1UBGA 1A5BB 3MJTA 4Q3KA 2O48X 3LW7A 1T1EA 4YHHB 2NVUA 4HAWA 4HZUA 1ZJ5A 1G20A 4H9GA 4MV0A 2BMFA 2XJ9A 1THGA 1CZKA 2DFKB 1YVRA 3NTQA 2A1UA 1DFGA 4HDQB 2YBDA 1KYYA 4LQ4A 3O7MA 1OI3A 4OP3A 4HAOA 5DHRA 5E4YA 4IS3A 1WZCA 1KI6A 2JFZA 1O95D 3OFNA 1SMKA 3OWHA 3VUFA 4BCDA 3VNQA 3IEIA 4LJ6A 1W5TA 1HLGA 2D7JA 3KU4A 4N82A 1OW3B 1WX1A 2HR1A 3OM1A 4WDQA 3CLSC 2ERCA 4L5YA 1ZGGA 1MOSA 1N4AA 2DT8A 2QVLA 3FYUA 3UUFA 4NHOA 3JQ8B 2WJAA 4GUDA 5BSRA 2A30A 3QF4A 3WS7A 4UUNA 3B60A 4RABA 2OFOA 5JY6A 2PUFA 3CUVA 4HGOA 1UXIA 1XXLA 5KS2A 5JTUA 2ZRLA 1SD2A 1A9YA 2EF1A 5HWSA 3C98A 4RACA 1WUKS 4B33A 2BGIA 4BNUA 1GYQA 2PSDA 1WP9A 4M83A 4GSYA 2C57A 5C1DA 2AYZA 1EM6A 1W8DA 3DTVB 1EFTA 4AMGA 4F4HA 2VWPA 4HMQA 2HU8A 3R3ZA 1QHSA 2QVXX 3OBBA 3R75A 2FHPA 3LT4A 4HBZA 1TT5A 2D5CA 2PIDA 1BDIA 4RV9A 1MX5A 3LA8A 2QVYX 4HFRA 3R44A 5C7OO 4WKPA 1LV8A 1GUFA 2DF8A 1NPTO 4YJFA 4FSXA 5FI5A 3WXMA 3ZEAA 1SBYA 4Y0NA 3O9VA 2CNLA 1E2DA 2GESA 2QLLA 1C7FA 3F6RA 3OCYA 3M34A 1Q7RA 4C5BA 5T64A 1QDUA 4YRZA 2OHGA 3DO5A 1FZTA 4EYQA 3PA6A 4CETA 1XK7A 4S04A 2ZWIA 3UC5A 4K3VA 2ZJYA 5CEEA 1E2KA 5B7QA 2HO4A 3LQYA 1RLOA 2HPHA 4BFCA 1G7SA 1SZPA 1DO0A 1C1DB 1HC7A 3IKLA 3V42A 4DARA 2BOVA 2FN9A 4UMDA 1YUNA 3G5TA 3PHLA 5HCNA 3AERB 2GZ2A 3TLBA 1RZRD 1L7RA 4KI0A 1C2YA 5BT9A 2V54A 4BDSA 2CBGA 2OZLB 3RJMA 3A2NA 5CFQA 3O3MB 3HN6A 3I23A 1KXJA 3EMKA 2HWWA 3ACBA 2PIAA 5CIYA 4UOQA 2HY7A 4QBGB 1R6UA 3LSYA 4JLMA 3GLUA 2ZRFA 2ZUBA 5AKYA 5E2AA 3C7DB 4GEGA 5T57A 3IRUA 2XMBA 4UEKA 2BBOA 2O0KA 4FS8A 5AJYA 3LZ6A 4PYQA 3K9QO 1QIJA 1J49A 1TKAA 2OZKA 1X42A 1W1WA 2VN8A 1DFIA 2XYPA 3D5TA 4GVPA 2B5OA 4JODA 3LUCA 5K6TA 4TSFD 1T25A 4XZ3A 4U9UA 1A8HA 2Q5FA 2QVCA 4P35A 1T8UA 4HLUC 4A23A 5JJBA 3G82C 2AJDA 2IZ5A 1U7DA 5I9IA 2P2CA 1I6KA 1YS1X 3DAHA 2VF2A 3A4YA 1T3GA 1YV9A 4G37A 5DTIA 5EP2A 2EYUA 4OM7A 2JVIA 4DCOA 5D3KA 1X13A 4CKZA 3PPXA 1QIMA 2FV8A 2FWJA 4XB1A 1TLLA 5HTKA 4KR6A 1C1XB 3BB4A 4BVLA 2J1LA 5EZYA 4YRAA 3DWFA 4Z8XA 1D1QA 2IU3A 4C4OA 2AK3A 3VH3A 3LUFA 3U48A 2J0UA 1JMVA 2KQUA 3OX3A 5CNKA 1KMQA 2GZ1A 1LX6A 3ZZUA 2B4QA 3F8TA 4IXDA 1XZLA 1ZC3A 4OKNA 3PCTA 1M0TA 3B1JA 1R0YA 4Q9NA 3IBTA 3WADA 2XCRB 5DM70 2RKWA 4ZCRA 4RVUA 1JHYA 1PWYE 1STOA 3CRNA 1K8QA 1OTYA 4ME6A 3WYDA 1PDWA 3IULA 4GMGA 1BCSA 5CTAA 1M0SA 1D3AA 3NP7A 1UKEA 1IYZA 3LLCA 2WVGA 3UENA 1MH9A 1G7RA 1U0GA 1LVHA 1WUJS 1XSEA 2KSQA 2Q4RA 3PWTA 2ZG6A 4KGXA 4MVJH 3IODA 2IWHA 5AK0A 1IXKA 1GQYA 4IJMA 5IC5A 3TLCA 2O8EB 2P0AA 2G9NA 3FRIA 4YGXB 1MJ5A 1VE9A 2L17A 3C3PA 3HP1A 4RTJA 4PU0A 2HF2A 3AI2A 3HI6A 3SBDA 4WSOA 1SM4A 3CT6A 5ICSA 1Y80A 2XKAA 5IJWA 4UD2A 3P4UA 1NBEA 4KPEC 4JP8A 2ZSBA 2Y8EA 3KZ1E 2ATCA 4H7PA 2Q45A 4QPNA 1B0ZA 1R8JA 4X7BA 1JXQA 3UC9A 1MDBA 3FLMA 3IUJA 2CYAA 1IPFA 1EB9A 2QV0A 1MB2A 1Q12A 1FLVA 5BOSB 4MQ4A 2BPOA 4B2IA 2VO1A 1OVMA 1QQTA 4GPBA 4NENB 4CEIB 1M6VB 2BEUA 3TR6A 3ZGZA 4RXTA 3STVA 3WE7A 2CFRA 4UFNA 3T3IA 1FFAA 3NEPX 4A3SA 3MWGA 4HQ6A 3ZOKA 1BSVA 2JCYA 2EQ5A 1LPAB 4UQLA 4MAFA 5FFNA 1XR3A 3L8GA 1R4MB 1XEXA 4OBEA 3WJAA 2R8PA 2UZ4A 3WKBA 5TPWB 1HPLA 2DVMA 5CR9A 2G9RA 4M21A 2X22A 2Q6KA 3AHFA 3GFQA 1VJRA 2PRYA 4Q37A 5FP0A 5CH3A 4BU0A 3VKGA 4FJ2A 4UEJA 3C3BA 3DBRA 2HK7A 1XQYA 3MN1A 4OXQA 4B2PA 5ALLA 3PXDA 2XVXA 3ORSA 4RBNA 2GZRA 3G9UA 2QYSA 3IE0A 1T43A 4ZCSA 3IUMA 2JAHA 3W8DA 1EE1A 1R4NA 1XU7A 3D4BA 1JVSA 1RXEA 1MR3F 3JYPA 4IS2A 1DQZA 2ADOA 3UMBA 1BXRA 3C5WP 3LT1A 2QUHA 1P3DA 1VHLA 1VL6A 1YQDA 2H1SA 3DFIA 1GNLA 4KNWA 2H8KA 4RPHA 5H68A 1ZXXA 3T8YA 3OCWA 1XMPA 2C5LA 3G2JA 1AZSC 3MK31 1PTJC 1X7YA 3WYNA 4HOYA 1ZU4A 2Y92A 3D7KA 1YZGA 2V7PA 4HGPA 1FE8A 1F6BA 4L27A 4R84A 3SEQA 1VJCA 1SURA 3MGCA 1KY3A 2B4RO 4BLRA 3BS4A 3H83A 2QTGA 3IVCA 4GI1A 4M53A 4AZ0B 4A2QA 4XJSA 1DQYA 4C6SA 2N9UA 3U4IA 2CMHA 3FYUB 3RNOA 4DN6A 5BVHA 2AX4A 2G9VA 1MMFB 1UJ4A 2JJQA 2JZCA 2ZS7A 1JHOA 3P0JA 5ANRB 3WRXC 5F9FA 3P52A 1QB8A 3K96A 1VTKA 5LP6C 1VKZA 1ZVMA 2NV0A 2OFXA 3DV2A 5BOSA 5H9WA 2XCTB 2AUTA 1K4YA 1M2HA 1TYBE 3ETEA 1ZBQA 4IQFA 3KV3O 3AL0C 1JIKA 1SUWA 1X74A 3FMGA 5EMNA 3IBGA 1LTKA 1X38A 4M1QA 4IGIA 1G21B 3BXFA 3HNPA 3W9BA 3KQPA 3E35A 3CNQS 3CX7A 1YZVA 1PZMA 1W59A 1VKJA 1YR6A 1DSSG 2RAPA 3ANTA 3GGPA 4M76B 3OHSX 4UOZA 5CFLA 6PFKA 1GGKA 1B2LA 3ANXA 3AI7A 1XCMA 2BL4A 3HDYA 1V39A 2WOOA 1NW3A 4HGZA 4NDNE 5EZYB 3UM9A 5B58T 5JVDA 2IUYA 3E61A 3IVAA 2HC9A 2C9MA 1EFKA 4RKYA 4FVTA 1QWOA 4UBNA 1MO2A 5CXUA 5BSKA 2QRKA 1OXVA 1SQSA 1X6VA 3KIPA 2NYUA 3WGJA 1CY4A 1CUVA 3ROQA 5HFAA 1J5EB 4C0WA 2DKFA 5HG0A 3Q0IA 4Q4HA 1G4AE 3GP3A 4X8HA 1T1SA 3TL2A 3V80A 3FUVA 2R44A 5E8JA 2SCUB 3ZUPA 1DV2A 2EC5A 2R68A 2PUTA 2QSYA 1EAYA 5JS6A 5FOSA 4E46A 4MUGA 2QXUA 2WJPA 2ZTUA 3W8RA 4C30A 2O3SA 2Z2XA 1QZZA 1DJMA 4IHJB 2UYCA 3O83A 5K0FA 3K20A 1FMCA 3K1JA 3U1BA 3G7NA 4M6WB 4DT1A 3WMRA 4UC0A 2QM8A 3ZJUA 1IN7A 3HJTA 3U4HA 4J0GA 5K8LA 4EFMA 2WYWA 4TM8A 4Y2RA 3TW8B 1IWBB 3T35A 2A9QA 2ZUCA 4CV3A 1IM2A 1I0LA 3W1WA 3LUHA 2MDTA 4KIJA 4NX2A 4G4SP 1SXJE 4B9AA 4BMNA 1IBLB 3BIWA 3PENA 4MUXA 4QREA 3DL7A 4TROA 4X1KA 4F5WA 3BMOA 2CHVA 1OHHA 2WWFA 2AW5A 1ZK1A 1LDYA 2VHCA 4FE4A 5EWJA 4MPTA 4HAYA 1HT2E 4ZJPA 3GPIA 5JLJA 2REBA 2O7SA 2PHZA 2VZEA 3I0NA 1QHHA 1R15A 3O82A 4KN8A 3TZ6A 2NZ2A 2D5IA 4Q6WA 4BO3A 1JPVA 3D6TB 1JFVA 4C6HA 4E09A 5IUNC 3A9WA 1N77A 2D0IA 3I6BA 3ZK8A 4DV2B 5HS6A 3AHIA 4WACA 4M46A 1KEZA 2I2FA 3E48A 4JXXA 4UPEA 3VU0A 4G5GA 3K15A 3ND8A 2HF8A 4INPA 4X97A 3WISA 3RYCB 1F5SA 1VLZA 4F2DA 3LT5A 1FXSA 4L9RA 1IQPA 3QPVA 3G7UA 1X86B 3B1WA 4NCJA 5C51B 3N53A 3CX4A 3JCZA 1Q7CA 2OT3B 5FEMA 2LR0A 3CVYA 1X7DA 2NO9A 3KEGA 2PKQO 5IAOA 1Z4LA 2ZRIA 4IVRA 4KTTE 5EIXA 1W8IA 1NU6A 4XIIA 4ERNA 3DBRB 4PLPA 2DHCA 4TMFA 3N6VA 3P9XA 5B3JC 2FK8A 1CJMA 3AUSA 4HH4A 4AZTA 3ZBPA 1JHPA 2WTMA 5TMPA 1D04A 5DHPA 1X1CA 2XT6A 4MRMA 1NQOA 1IWPB 1MENA 2XRFA 4R0MA 3HP7A 5FTLA 4Q3BA 4FBGA 3KZVA 4YJKA 2CWDA 1K5GA 1PJ2A 4XWOA 3WB0A 3NAMA 2E4YA 5BUCA 2GD0A 1K8XB 1VGVA 3A05A 2ZBDA 3BD8A 4MA5A 4P81A 3T4EA 1T4BA 3FDXA 4BASA 1TM2A 2NSLA 3GLKA 5M34A 1AMOA 2A67A 1L5SA 5DLDA 1P1JA 1DPFA 1JKFA 1XI2A 1BD3A 6Q21A 2IH4A 3LWDA 2Z3ZA 1F17A 4BXOA 1VYUA 1SXJD 5HGJA 2VHQA 4ZRMA 4BO4A 4DR2B 4G67A 3F49S 4N3CA 1YVDA 5EPUA 2E5FA 4R54A 1ZIPA 1TAGA 2P78A 3HHEA 1SK9A 4Q39A 3LKZA 4BVEA 1ZD9A 2XH8A 1GQQA 2H0AA 1JHUA 3ETDA 2XEXA 5DOZA 1NQTA 3KFVA 3WGVA 1D9ZA 2W2TA 2P40A 1XF1A 1GNQA 4UUMA 4BEJA 3RFTA 3ELDA 5LYJB 4WNIA 2EZ8A 3NANA 2JKVA 2H0QA 2DBYA 1E9FA 1G18A 3GJRA 4QBFA 2YNMC 4CM6A 3SAJA 4AMUA 3HKEB 1WOMA 4U2KA 5AJVB 3T7RA 4DG8A 1M34B 3NAZA 4BAGA 3H2JA 3INTA 2M6KA 5EHQA 3FZGA 1CS0B 2BMVA 3LDAA 4JC5A 4KBFA 3ZE6A 4F96A 3T9FA 4MVJD 3A1CA 1ORVA 2O2XA 2WAOA 3K5PA 1UBUS 3JWIA 4U8HA 5E3IA 5GGXA 2WQZA 4B5KA 3AJEA 3GRFA 3ITNA 3HJBA 4CQMB 1X1DA 2AGVA 2YINC 1L4GA 2CCJA 3NHWA 4OK3A 4QGSA 4YRIA 3OZAA 4BBAA 1DTWB 3IP3A 3KAPA 3DYIA 1IH8A 1MGOA 4JI0B 2QJRA 4P84A 1GEGA 1NXVA 4WFIA 4ZN6A 1E3TA 4GL4A 1PKXA 4KQ6A 2PDAA 3RUAA 1NIPA 4HV4A 1P6QA 3LUBA 1U9ZA 4Y2YA 1IMJA 2C2OA 2RK6A 3KVOA 1T15A 1B8UA 3R3JA 4YASA 3RQSA 3WK7A 4AI6A 4A8JC 4PXAA 4AC9A 2PBLA 3O03A 2N75A 1VOTA 1W36B 4N3GA 5I8PA 3L5KA 5F64A 3M3HA 5DNAA 2KWIA 4HHEA 4X00A 4WXEA 5D01A 4Q93A 5BWCA 2UYQA 3F6SA 1KO8A 4I81A 1TIKA 2WM9B 4AG5A 4MR8A 3AP3A 4JXJA 4UVIA 5ILQA 4BFWA 5IVKA 4GPIB 3IJEB 4H7FA 3W2GA 1WPRA 4I7EA 2A1TS 1W0KA 2VDMB 4OFBA 1TJYA 3NKLA 2ONYA 3LU1A 1GU1A 1LBIA 2V3VA 3LV8A 3S8EA 3RG8A 5DMXA 1A9ZA 6YASA 4CW7A 2WKPA 4GEKA 3U7RA 5IBCA 1UKBA 2P7IA 1BCRB 2X9LA 4KVAA 1P18A 5LP1A 1P17A 2WSMA 1GRNA 3FZNA 3RSQA 4BO1A 3H9BA 2QK4A 2HA5A 1F20A 2XOKD 1IRIA 3MRTA 3PSAA 2JANA 4HVAA 3W2HA 3PPWA 1QS0B 1V6AA 2J6HA 3SKVA 5KNBD 2CJWB 3C4QA 4YJ3F 3UJCA 4X24A 4ZI7B 2RH9B 1DEXA 2GZHA 2XTAA 3I42A 4AJ9A 4D99A 4JUDX 1VG0B 1YRQA 3DLTA 4OYHA 4LVUA 1ADJA 2VLIA 2WM3A 2HPZA 1ND6A 3I6IA 4IDGA 1B74A 5CDFA 2Y1KA 3T1OA 3P27A 4JGGA 1TPYA 2G80A 4R69A 4TWAA 4NDZA 4LDQA 1P5RA 3ABQB 5HFNA 2PZJA 2XV1A 4MHSA 1BN7A 4YP7A 1MFPA 2D54A 2W6CX 4LJKA 4RESA 2WF5A 4BQRA 4CQMA 1GGFA 1GLNA 1DKRA 3FJ1A 1FYXA 1E1QD 2CE2X 2ZGVA 2C5SA 3Q2KA 5L53A 1E63A 4EMUA 7AT1A 3MHPA 5B1IA 3VSDA 3ERCA 3LFTA 2WFLA 1ZGZA 1E5DA 3LT0A 5J63A 3VR6D 1EQAA 4KO1S 1KEWA 4DDTA 1T9HA 4ZOQI 4BN4A 1XJWA 3JQGB 2EJBA 3DZDA 4Q4CA 2GAJA 4AKSA 3U6KA 3PLAE 4OBBA 4DLPA 2QDXA 2M1XA 1EJ6A 2Q0QA 4PYRA 3BK7A 5G40A 5KOJA 4D8XA 4IV0A 2DH6A 4LF4B 3LKDA 3GEBA 3IC5A 4EBFA 1JF8A 5JDIA 1E6WA 1LPNA 3AUAA 2UU9B 4YI3A 2GAIA 2VJCA 2I2CA 2QW1A 3RIHA 2AXPA 1I7NA 1RAHA 1JHDA 5G4LA 2ZU6A 3LCCA 4B0PA 4DC1A 1K7FB 4WJKB 3A06A 4BV8A 4J6FA 3OF3A 5BN3B 2IDJA 4IINA 5ERGB 3TR0A 1OC4A 5EMJA 3DDUA 1ZA1A 5PNTA 5F9HA 2QROA 5JNVA 5HJEA 2ZUSA 4D9MA 1SQ6A 4F93B 4Q1VA 1SKQA 5FXMA 2AXEA 1N8NA 2G1JA 2FFBA 3L9WA 3FX2A 4F7WA 1NW8A 2H5EA 3ACDA 1U3GA 3W9SA 4G8CA 5FUQA 1BXRB 1QGED 4Z7OB 2I3BA 2FN4A 2CLDX 1VIVA 2BT4A 2GYWA 1OPXA 1XX6A 1COWD 1TCVA 2LKDA 2NO7A 3CINA 1L8AA 1H85A 4DR4B 4KITB 4FR2A 4IDNA 1UOQA 4F2PA 2AX3A 4Q7JB 4GSLA 3MBIA 2RD2A 1O4VA 2ZTMA 2AYYA 3BILA 1XWWA 4P4LA 4PZPA 4DTIA 2AQIA 3KB1A 4HG2A 3V3KA 1K8YB 2BC9A 1RQRA 2CHFA 2WF8A 3E15A 5K6RA 3N2IA 3PC8C 3UT5A 3DDSA 2E48A 2VL7A 2X7HA 1HTBA 1YJ5A 4QU9A 4AB1A 4BNZA 2MJLA 4EGJA 4Q7QA 5KU7A 3PGA1 2AFHE 2XQJA 3I04A 3PNBA 1LQUA 4HXFB 4LSWA 3WK5A 4P2GA 3NVKI 4I1RA 1UPFA 1OHHD 1U1EA 2O1XA 2P11A 2Q9AA 3G1TA 3MERA 3OE7D 4FLFA 5I45A 3VH1A 2CV1A 3BWXA 3AOEA 1SQGA 3M2PA 2W5UA 3EISA 1K97A 1XQXA 1IJFA 3WDKA 5BVHB 2VWGA 3M5PA 3LKVA 3DPSA 3SHOA 3X1KA 1M8JA 3DFFA 2PV7A 4BBPA 2J9FB 2I4NA 2Z56A 1QR2A 2OXCA 3SXJA 5A7FA 2RK3A 3UW3A 4MVJP 3ZI0A 1YT5A 3IVMA 3ZNPA 3OCVA 3WKDA 2LTAA 1J70A 1L3CA 3K7EA 4B46A 5K99A 3OIVA 1R0CA 3CEHA 2VJBA 3OF5A 3VAYA 4EMTA 1I2CA 1XTUA 3A9SA 3NOQA 4LOIA 1A69A 5BN5B 4N9WA 2Q8NA 2CCGA 3IQGX 4LOHA 5AXBA 2CC2A 1WP4A 3FPGA 4NARA 2ZUFA 2YN4A 1RWMA 1X7XB 1FXUA 2GLTA 2DR2A 2HDNB 4ZAWA 5G3ZA 4I3FA 1CR0A 4OKSA 3RRMA 5LOVA 4QFCA 2ILVA 3K09A 3K9HA 4I66A 4MEJA 2GTHA 3AR7A 3QKUA 4LSMA 3K53A 5LQAA 4FMDF 4DWVA 2UUAB 4P0QB 3WDSA 5EIBC 2C4HA 1X15A 1IATA 1ZUNA 4CR6A 4D0SA 2P6OA 1Z8HA 1QCYA 4A8TA 5TXGA 4FYYA 2C7OA 4KLAA 5IMSA 3NGLA 4DV0B 2XT9A 3HCNA 1IBSA 1XG5A 4DJ5X 4EELA 4GF5A 5E0KB 2GAFA 4L1KA 4I55F 3L7IA 3UATA 5KSWB 2X9QA 1USUA 4LJYA 4DSTA 3M6WA 3NDPA 4LMPA 5DYYA 1N33B 3HYLA 2CVOA 3A4LA 1QIEA 2VWQA 3X3HA 1NN1A 5IM5A 2C8VA 2XUQA 4QOFA 5K4HA 4CQNA 3T5CA 1U1GA 1XQ6A 1RQ2A 1XMQB 3ITDA 1S2IA 2QTBA 3RLFA 3ROTA 1J0BA 3WYBA 2O0JA 2O4CA 4EG1A 3WY9A 2XVMA 4NPAA 3ZIAD 4YMTA 3BMOB 3GJQA 3MCUA 4JBLA 1EQUA 3ONEA 3P2MA 5ALOA 4UULA 4C7MA 2EATA 4UNQA 1CUIA 1BKDR 1TTHA 4EB3A 4O5OA 3I3SR 1DU4A 1JPUA 5A5VA 4B7CA 4EARA 3NR2A 3IP8A 1PS8A 2DJIA 1W6UA 1YULA 3W4JA 4C78A 1ORTA 4TVKA 3VU8A 3PRJA 2POQX 4U0JA 1UP7A 2P9HA 4OI1A 2A88A 1XU9A 3DBHA 4O0MA 2YCBA 2BYTA 3KSRA 1SXJB 3TMKA 4JR0A 1KQGA 4N3BA 1NTRA 1W85B 3PDIB 3MTJA 5G1NA 4CDGA 4Y2QA 4J2HA 2PUDA 3D64A 4NS4A 4EJ2A 2QMYA 5FUVA 4CL2A 3CLSD 2OUKA 3IR7A 1QIHA 2ZB3A 1RVDA 1Z4MA 3I2IA 2O2CA 4MWBA 3PD7A 4FZJA 4DREA 1QIFA 4FR0A 1PT6A 3FMVA 2J46A 1RWPA 1CQJB 3KAJA 1MBZA 3A58B 3FA2A 2G82A 4GLLA 1DWPA 1T3LA 4PYJA 2EP7A 4JDUA 1WCIB 3THRA 4P58A 3O4HA 5F73A 4FWBA 3CQ9A 5KDDA 2DWUA 4WW0A 4AQDA 1H2RS 1WNTA 2IPNA 3RKRA 4FYWA 1EK5A 4W6ZA 4GWGA 4XVQA 3AB7A 3DA8A 4BZZA 1U8TA 1YHNA 3D59A 1NXOA 1ZWLA 6AT1A 2Q49A 1G8HA 3THYA 4GPD1 1Z16A 2GCOB 2CKDA 2IHNA 4RDCA 4PO1A 3WC4A 2O8FA 1UXOA 4J29A 2JLAA 2C9DA 4YCBA 4HH0A 4YLGA 2ZIAA 5IBRA 5DP2A 3RUPA 3S0JA 3VSEA 1ZYUA 3O7WA 2TS1A 1MOPA 1KK3A 3M6VA 1Z6AA 5AI9A 1IY1A 3PNKA 3G89A 1ZSYA 3H4IA 3RM3A 2V5UA 3ENKA 1VBMA 3OC6A 5F7XA 1T3HA 2K2QB 1OBCA 4Q4JA 1J0AA 2VDQB 2H57A 2XWQA 2XGGA 2PZAA 2QXTA 4G63A 4UPVA 3U3XA 3UOWA 2QN1A 4BLQA 5DXJA 3EDMA 5K3SA 1RIFA 4CYMA 5JXGA 2IV3A 4ZMSA 5DO9A 4M1KA 1Y98A 2C2GA 2JJYA 2ZYVX 4XPIB 3S2UA 3JQ6A 3LK6A 4AS2A 1U11A 1CRLA 3NTRA 4XDGA 5DBOA 4MUJA 3SYMA 1GT6A 5JHGB 1Z07A 3O0TA 2BJWA 1LK7A 4MZDA 2BFEB 5IKEA 3IB6A 2PO7A 2QLJA 2EWVA 4ZVNA 2VP9A 5JSQA 5MF6A 1RQXA 5BNZA 1EVZA 1Z62A 5CLIA 3EQ6A 3MLEA 2R11A 3IE2A 4FLMA 1XTIA 2W8BA 3IQWA 4K6GA 2OCYC 1QX3A 3X44A 1QTRA 4CF5A 1U94A 3QG1A 1RC1A 1UFQA 3RWBA 3S8YA 1P1FA 4WNYA 1CVLA 1GILA 2GRUA 3B1XA 5FWXA 3UGTA 4F5ZA 4ND4A 4EYEA 3PCRB 3AESA 1JT2A 2CHQA 2FHSA 3DTTA 4JBNA 4TX1A 2N1BA 2AMJA 3MWDA 2OM6A 2PFKA 4JLVA 4JR2A 4U2CA 2P75A 4YDHB 4MWEA 1E1QA 4KYVA 1F2TB 1TPZA 4FFPA 2O6HA 3FF1A 2PZEA 3IQIX 4KE8A 5JO9A 3RWOA 3RREA 4FILA 4URWR 3HFGA 4MWDA 4YREA 4II7A 1XEAA 3JY6A 3GX1A 2FZEA 2UZAA 1UDWA 4UHBA 3PEVA 4HQFA 4W5OA 4S1VA 3OHPA 2HU5A 4ESOA 3L7AA 3FYUC 4EB0A 1KRWA 4X93A 4LDNA 3G5AA 4QSMA 4WLOA 4EX7A 3G0OA 5JARA 2PXHA 4WL0A 1V48A 4PLVA 2JFUA 2HUNA 1Y4UA 3SQLA 1CC1S 2C2ZA 1Y8ZA 3K9GA 1U81A 1LC3A 4M54A 2D5LA 4EY4A 4YJHA 1L7AA 5CT8A 4AAYA 3CURA 2P8SA 1P2UA 2MINA 2CUNA 3PUYA 2Q41A 2AJTA 3EG5A 3FYTA 3ILVA 1ZVJA 4QTXA 3UPUA 1CUZA 2F55A 2AWNA 3KB6A 3UO8B 4GNKA 3FR7A 1GDHA 2J4DA 1HEIA 4XE5A 2H1IA 3AR5A 3ZHXA 4FP9A 5F5LA 4OHPA 1U7TA 2R6JA 3UHOA 2HIHA 4P98A 3OPYI 2X9VA 5KNCA 4N3AA 4EH1A 2P9BA 3JD3A 3V48A 2BUCA 4NBRA 4ZDJA 1KI7A 2GJKA 1FSGA 2JA1A 2ZIZA 3PHCA 3R7AA 3S2YA 1Z0DA 4IICA 4BNMA 3ZE0B 5KHOC 1UR5A 4R31A 3O3NB 1X1EA 4DLAA 3LC7O 2O3RA 4JLPA 2VJQA 4KODA 4E70A 5K8CA 1L3IA 3L8EA 2Z3VA 2RCYA 1P0QA 1PJSA 2XB8A 4PCVA 2R6HA 2FMKA 1E7YA 3MVEA 4R1SA 4Z3KA 3WZMA 3G17A 4YLYA 3OZGA 3RGGA 4EGAA 3E7DA 3JWPA 2BBWA 4PXSA 3DWGA 4BMPB 4ETMA 3FWYA 1DC5A 5G3YA 3TH5A 5FHRA 3WIUA 1ESDA 3V2GA 3KQLA 2R4QA 3KYCA 3B5JA 4C6RA 3JU3A 4YUXA 2NXEA 5F3DA 2HGZA 2YC4C 4LJRA 4EL5A 1HL3A 1XF9A 4JJ4A 4FU0A 3FLEA 5ETJA 5K7SA 3WHPA 4BNIA 1F6DA 1KL7A 4P4GA 1JSRA 3TBFA 1NVTA 2A6PA 5JPCA 2DQKA 1CB0A 2Q3LA 1UF9A 4HQOA 1P77A 3DEHA 5DM0A 3NJRA 3T38A 5K05A 1CEXA 3B48A 1SO8A 4NABA 3RIGA 5SICE 2GKSA 2XVYA 3OOWA 1C8VB 2Q2WA 3H6HA 4RJKA 1YNOA 2VR1A 1FY2A 4YTEA 4DLTA 1C9EA 1T26A 4QHSA 1U4NA 1YTUA 1N1GA 1RC8A 1CR6A 1FTQA 2GN9A 2ZPTX 1XNGA 3E1KA 1MO5A 1A27A 5KTMA 2ZJ5A 2ZKLA 2HHAA 4P53A 2GOYA 4L4ZA 1WWKA 5M2QA 3CV3A 3UJBA 4KJXA 3GBPA 1Q20A 3T3DA 5DF1A 5T7BA 3GBSA 1GPWB 3RFUA 5JO0A 3NP9A 5I3ZA 2FRXA 3IL2A 5AJUA 1CJKC 2H85A 4QUEA 1GUBA 3QE4A 4ZPXA 5A3VA 2QN9A 1WXEA 4LVOA 3MQ4A 1J00A 1V8ZA 2VNKA 3V7WA 5LQSA 1ZESA 1SB9A