1HE1C

Crystal structure of the complex between the gap domain of the pseudomonas aeruginosa exos toxin and human rac
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
176
structure length
176
Chain Sequence
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXOENZYME S
publication title How the Pseudomonas Aeruginosa Exos Toxin Downregulates Rac
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 60
structure length 176
sequence length 176
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he1C00
4TL9A 4A6XA 2IYXA 3KX2A 3AH8A 4MRSA 5KPJA 5AJYA 1Z0KA 3VKWA 3IQWA 3IILA 2JASA 4ITRC 821PA 4UXHA 1QRAA 1QHXA 4IOLA 5HE9A 2F1HA 2CMKA 3QF7A 1E9BA 2CK3D 3NKVA 2GVZC 3QBTA 3FMPB 2ORWA 1U8YA 1WE2A 4D0GA 5DN6D 3U5ZB 1RRCA 1QG4A 1KNQA 1E96A 4NYIR 3K0FA 2Z43A 2FGJA 3G0HA 2J46A 3M4YA 1ZIPA 4FXPA 2IXEA 1E1QA 1G7CA 2DPXA 4EJSC 5G53C 4JVLA 1ZMXA 4WIAA 1SKYE 1DEKA 3EPJA 2AXPA 3GEIA 2NO1A 3EPLA 4V0MA 4OK5A 1D8TA 1XRJA 2WJVA 3L8YA 1G291 3R8CA 3U2QA 1XTSA 2GJKA 3RS7A 2WJYA 1G4AE 3A1UA 3LQQA 4Q9KA 1E3MA 5DGXA 2BMDA 2VL7A 3GJ4A 3TVDA 1W2GA 1DTSA 1O87A 5A4JA 1CXZA 2JLYA 4KYIB 4B44A 1YZLA 2CXXA 2MSDB 3L82B 1ZJ6A 2DCUA 3U4QA 2RGEA 1KDOA 4LGMA 5CM9C 4DSOA 3SDZA 3K0EA 3P27A 1KO7A 1FUKA 2JLRA 5EXXA 2R6AA 1P72A 1OFHA 2OESA 2Q9CA 4BLSA 5FTNA 1AIPA 2J0SA 3SFVA 4QJ5A 4Z54A 1F3OA 2GEDA 4MRNA 5C46F 1EK0A 1EX6A 1MO4A 3BH6A 5K8UA 1SXJE 1T0JB 2EYQA 5ELXA 2J87A 3EG5A 3Q85A 3K0SA 2IS6A 4TQAA 4G0NA 4E07A 2IYVA 1S1MA 2AD5A 1MO5A 4TTPA 3I5YA 1GL6A 5JWHA 1R10A 3OIWA 1I2MA 2OO7A 3K0CC 1IBRA 2B7BA 2VF7A 3RRZA 1ZNZA 3WRXC 2ZS7A 4BECA 4CDGA 1E2PA 2C98A 1GRQA 3BERA 2QN6A 2QE7D 3OAAA 1KTVA 2W58A 1HQCA 1E1RD 4WA7A 621PA 2B6HA 4B2PA 4QJ3A 3M1IA 1II0A 2FE4A 3QPWA 4Q1DA 3GEEA 3GLHB 3EZ9A 4B3GA 2ZUBA 2ZR0A 1AN0A 3CRMA 1ANKA 3ND9A 4L4UA 3LLMA 4TYYA 4J0QA 4HZUB 1N0VC 2NZJA 2BMJA 2HT6A 5FR2A 2WKQA 1G3UA 1E2IA 4BGDA 3EZFA 4Q1EA 3B8HA 1KJWA 1R0ZA 1KYIA 2QU8A 1TEVA 1TEXA 2G1JA 1P73A 2MMGA 4KO8A 3ZZUA 4CEIA 4AKGA 2H18A 2D4HA 4IDNA 5KUTA 4JYBA 1FFHA 2H1LA 2IHYA 4GNKA 4HUQB 1LF5A 2AD1A 3NWJA 1GOTA 2GCNA 4IVPA 4O0MA 1G4UR 2AHOA 2ZRFA 2EFDB 4E03A 1P2UA 5TV2A 1TQ2A 5JSZB 1I4TD 2F3RA 1VG9B 3JZAA 3UMSA 2YOGA 4Q9HA 1NN5A 2A2ZA 5JWRA 3W8RA 1ZRHA 2ZYWX 4X8OA 2HYIC 1EFCA 1UEJA 2O0KA 1N5KA 5F2EA 5KHOC 3CH5A 1EFHA 2BOVA 2CNWA 4MKGA 2KSQA 3WP0A 1S3SA 4D0NA 2O8BB 2JJ8A 3PFIA 4H1UA 4PPGA 4XD7A 2A3RA 4PAOA 4KODA 4TT3A 1XJQA 1LB1B 2BBOA 4WXRA 3I72A 4U7DA 4HLDA 2J5XA 2VQSA 3UMFA 1BIFA 4Q03A 1G1MA 1S0UA 4JLVA 2IYZA 4ON9A 1KZ7B 4BLTA 4AD8A 2OE2A 1VTKA 4AYWA 1FOEB 2GETA 1KAGA 4PR0A 1RYHA 4DRZA 2J0VA 5EE1A 3THWA 4BRWA 3U7HB 5D3QA 2JDID 5AJVB 3THXB 2ONKA 2W2VA 2VHUA 1P9NA 3IHWA 4M9SA 4Q21A 3D3QA 4OBEA 3CX8A 3TSOA 3KL4A 4M9ZA 3TR0A 4KV9A 3GLFA 1Q3HA 3MSXA 4MYCA 4JLOA 4B2LA 4C0HA 2NGRA 4DEYA 1Z6TA 4DLVA 2NZ8A 3P4XA 4KYUA 2D3WA 4JZKA 3TVTA 3AUXA 1M6NA 4LJ6A 4M8NE 4JLBA 4KFTA 1VDZA 3ASYA 1XPRA 2WOOA 4HLUA 2JATA 2PLFA 1NG1A 3Q9LA 4P31A 2EVWX 3I92A 3L0OA 2DFTA 2IBMA 1JEEA 3RS3A 5DE3A 2Z83A 2KBFA 2V6IA 3A1TA 3WRYC 2JLZA 2O8EB 1F6BA 2WAYA 1OLOA 2A78A 4C3ZA 3PITA 1OHHA 1VHLA 2F1RA 3TUJC 4C9BA 4TTQA 3AVTA 3ETLA 2P6RA 1ZU5A 3TSZA 2QMUA 1PUJA 2KJQA 4CEHB 1XTIA 2IK8A 3ZD7A 1II8A 2XEXA 1LFDB 3H86A 4HSEA 1D9XA 3BC1A 4IHQA 4JBYA 2I3BA 1F60A 1R8SA 1XEFA 1ZCAA 1NY5A 3LA6A 4IEIA 3EC2A 4AYXA 4DEXA 5CJPA 3QJYA 2J0QA 5CYPA 1QZXA 1N0WA 2QMOA 2H17A 5J4LA 1PUIA 3VR3A 2XITA 1RRFA 1GRRA 1VYTA 2GXAA 1N6RA 3K70C 2AL7A 3K9NA 1N3BA 3NEYA 2OFXA 3GCGA 1ZNWA 1YZTA 2B8TA 5AUPB 3AVYA 3CNOA 2QI9C 1MO6A 3T5GA 4EUNA 3QVVA 4PZZA 1YJ5A 3OEHA 3NH6A 3TUIC 2JIZD 3AB3A 4OK3A 3G82C 2FFHA 3BOSA 4ERNA 5DSZA 4QRHA 2VO1A 1N6NA 2C04A 3AF1A 3B7GA 5DI3B 3A4NA 4EPYA 2L0XA 1ZUIA 3RC3A 1JPNA 1WA5A 3A4LA 1JR3A 4MRPA 4S35A 1OPXA 3V4RA 1NN3A 4B34A 1BYUA 2GBLA 1NKSA 5KPDA 3F5FA 1QF9A 1X8LA 2J59A 3EAQA 3SZRA 5J4YA 3O8CA 4PAMA 1K5GA 4II7A 3SFZA 2R2AA 3HP1A 1J99A 1A4RA 1Y63A 1CP2A 2XOKD 1OH8A 5EP2A 3TJZA 4ZI3A 1Z6AA 3OHMA 2VP6A 2FX3A 3I32A 4IVRA 1RFLA 4NYJQ 3K09C 4E22A 4B47A 3U3OA 3BE4A 4NHOA 3WMEA 1E2QA 3QIAA 3A58B 1L4UA 5DH9A 3S1AA 1TNDA 2F1JA 4NCKA 2N46A 3RLFA 2ASEA 1KGDA 4DSNA 1DVRA 1ZYUA 2REXB 3LBHA 1VCMA 4MGKR 3PG5A 3SBEA 2W6ID 1RE0A 4D81A 2RGGA 4XJXA 2HT1A 3U6BA 4FMBB 4KBFA 2DR3A 3BH0A 2GILA 4B6FA 1IXRC 2VSFA 4RD0A 5JMTA 3DZ8A 2C2HA 2FG5A 4M1KA 4HAZA 2OILA 5FL7D 3REFA 1GIAA 5EP1A 5HKKA 2J45A 3AF0A 4CT4B 3CNLA 2JLUA 2GRJA 5CDFA 2C5LA 2N42A 3TQFA 3ZZTA 2VHJA 5FTMA 1V43A 1G8PA 1VKJA 4IW3B 4JLNA 1F5NA 2OBMA 3QE0A 2C9YA 4I1SA 1D2NA 2Q0HA 1JB1A 4ZPXA 4TYQA 1R5NA 4URXR 3IPYA 3KDSE 3IDQA 1GUAA 1JAHA 4XVRA 5G3ZA 2BWJA 1VG0B 4M22A 5JSZA 1G7SA 4GFDA 1UDWA 1TQ4A 1UBCA 2ZSFA 2RAPA 5ANRB 1AQUA 3NTUA 2XGJA 1X1SA 1XP8A 3E2IA 4UXJA 4WXPA 1GAJA 1JEDA 2CE7A 1E4VA 4GZMA 3ZS9A 2BIFA 3I8SA 4LC0A 4A82A 1L8QA 2X2FA 4B43A 5LD2C 2RGAA 1E9CA 5FH9A 4Q1CA 3T5DA 1FQKA 2ZVPX 3EW9A 1SZPA 4XWAA 1II9A 1E99A 2VP9A 5HR5A 5G41A 3H1TA 4W9MC 4M9QA 4DZZA 1CULC 1Y3AA 1IJFA 2JJ1A 1DG1G 2KE5A 2YJTD 3KKOA 4R7ZA 4XH9B 5L8VA 5KSOA 1XMSA 1FNNA 4JJZA 1NVVR 1Z8FA 4RCZA 3I73A 2DFKB 1TU3A 4Q5IA 4XTCS 4DLRA 2QT1A 3RSOA 2WICA 3THXA 4P0TA 2WJHA 2ZQ5A 3K9HA 4IOKA 5FTLA 1S8FA 4FD2A 2IF0A 4R2IA 3KJEA 1U0HC 4C7OB 2F7SA 1KO8A 1XXHE 3I1FA 4MUAA 5C18A 2JLSA 2HCBA 3LBNA 2WM9B 4ILEA 4KFUA 2IEYA 3AF2A 4ZCMA 1KI2A 2OCBA 3SJCA 4EQ6A 1ZD8A 1N6IA 5GVRA 4F92B 2P6UA 3KKNA 4OHYA 2IYYA 1R0YA 1ZCBA 3BFVA 3IO5A 1IN8A 1SXJC 2O8EA 3GPLA 3W6OA 2Q3HA 1WB9A 2WWWA 3LNCA 3QY0A 2VP0A 2A5FA 3QKTA 5D3MA 1IXSB 2XTNA 3DPUA 3U44A 2QAGC 1DBSA 4Q02A 1PVOA 1W46A 4HB0A 3TW4A 2GZAA 5JLJA 1OE0A 1WMSA 2CCGA 5AJWA 1A5TA 2EW1A 2GCPA 3THOA 3MD0A 5BN4A 4Y0VA 2Q3MA 3FFBA 5CB6A 1XPOA 4W5JA 2G0NA 4CW7A 3IKJA 5FPSA 4TQ9A 5KNDA 1Z06A 2FFQA 2WBLC 3TAUA 1KOFA 1UKYA 4A0HA 2EFHB 1UKZA 4KU4A 2BMFA 2RGNC 1RJ9A 1DE0A 1M1YE 2FH5B 2G6BA 2QPOA 2R65A 4GSYA 3EIEA 4MH0R 5HZKA 1OB5A 5BW8A 3SYNA 4HAWA 3IIJA 3VMFA 4OI2A 4DCVA 1CRPA 1DADA 1DAFA 1NP6A 1XCGB 1XFAA 3K0FB 4JSTA 4LK2A 1TX4B 4M21A 2V7QA 1LNZA 1US8B 2VPPA 2RGBA 1NLFA 3HPQA 3QG5A 4FW9A 1NVUQ 2ZREA 4WOPA 3DKPA 5K8IA 3AVWA 1FMJA 1XTRA 1OJLA 2ZRMA 4JLJA 4GOKA 4QGFA 5G3YA 2FGKA 4DDUA 2FNAA 4OI4A 4D4JA 4Z51A 2HJGA 1GL7A 2H8KA 5EXTA 1P9WA 4BPBA 3KXIA 4FCWA 3VU9B 2QTVB 5TY0A 5JRJA 4GP6A 4HAUA 3LBIA 2R6CA 3FVQA 3LDAA 2JAQA 2PZGA 1NNEA 3GLIB 4FN5A 4QGHA 1Z47A 3OIUA 4AURA 3SYLA 1WDTA 4O25A 4ZIRA 1GVNB 1SHKA 2WKPA 4C0BA 1JI0A 1ZM4A 3WBKA 3ZH9B 2REBA 2H7VA 3WXMA 3U4QB 1ZD9A 3BB4A 2C03A 3RNLA 3A1VA 3MMPA 3VKHA 2WAXA 1G5TA 1LS6A 4NL4H 1Q3TA 2OCYC 5JS8A 3G5UA 3PVSA 1CR0A 4TL6A 1SVIA 2BEJA 3CONA 1W36D 2ZROA 3WYGA 1NSFA 1WXQA 1XJCA 4RZUA 5A0FA 3PJRA 2A5GA 2D2FA 2YC2C 2VTKA 2JJ2A 4XOIA 4OJKA 3ZD6A 3D31A 3CZQA 3B1VA 1W4BA 2TMKA 421PA 3X1XA 4A8JA 2ZANA 2GZHA 3W34A 1PZNA 1SVWA 4G3XA 4FIDA 4PC6A 4RCYA 3X1ZA 2OHFA 4G5OA 4DLWA 2EFCB 2Z4SA 4I1VA 4LV5B 4A6PA 2G88A 3OAAD 3CM0A 2CEAA 1VG1A 1XU4A 2ZSEA 1BMFA 4BFYA 4FMDF 4L16A 5JJKA 1GNRA 2FEOA 2Q6TA 2H16A 2V1XA 1KJYA 2K5UA 2ZRCA 4G1UC 4YONB 5KSZA 5SZIA 1QHHA 4N1AA 4LOAA 2O5VA 3ONWA 2CL0X 1G5RA 2FPLA 2QP4A 4QM6A 4P4UA 3B9QA 1RKBA 4ZDJA 3FHTA 2E9SA 2GAAA 2QQ0A 4HB2A 5JCPA 1KY3A 1G16A 1A7JA 1ZM3A 2ZJ2A 2ZR9A 2IL1A 4LC1A 1P60A 1QG2A 3KUDA 4CZ2A 4CEIB 4EPVA 1I4DD 3BORA 3K0AB 1XPUA 2OT3B 2OLJA 1BOFA 2V4ZA 2RHDA 5DYIA 1BO6A 1T4GA 2ZRPA 5DI9A 1CRQA 2PBRA 4EJSA 5L3QB 4H9GA 2CVFA 3L8ZA 3QF4B 3REGA 1UADA 1LV7A 1NF3A 3EIHA 2VSXA 4YXWA 5BN5A 3Q72A 5IDVA 3ND8A 4KVAA 4RVCA 4XTRA 3WMFA 1OIVA 2FF7A 2GJAA 2OCAA 1KO1A 2WJIA 2A7QA 1KI1A 1AS0A 3TW8B 2GXQA 2CNWD 3GEHA 3DHWC 3KQLA 1KKMA 2OBNA 4TT3D 4JVNA 4BLPA 2VIIA 5KTYA 4BFSA 3SBDA 1FUUA 3A1WA 4A2QA 3HWSA 2F43A 1VYVA 1W5SA 4DWJA 1O3YA 5G40A 1KI4A 3AP2A 4Q9IA 4BLRA 5FUYA 1HE1C 3I61A 2DWQA 2RHMA 4LJYA 2PEYA 4IOJA 1IM2A 3T1VA 4DIDA 4ZKDA 5JEEA 3GFPA 4DXAA 3THWB 3A6PC 4KSCA 2FSGA 5FI1B 5GADl 2YZ2A 1K8RA 3VR5A 3U61B 3QOFA 2V54A 3FE2A 3CPJB 4C0JA 3GLFB 5AJXA 4R71A 3ASZA 2V55B 3UWKA 3IBGA 3SN6A 3KB2A 3BBPA 3K0CA 3PXGA 4PTLA 2XZOA 2BHRA 1FP7A 4JLMA 1RZ3A 1ZC3A 1CTQA 4HZIA 1NBMA 4Q4AB 4ASUD 4LPKA 1WCV1 4OHZA 3W6NA 2ZI5A 4QL3A 2ZJOA 4LHVA 4TWZA 1KDPA 1TQDA 1VECA 3B1ZA 4RZ2A 3R9IA 1FW6A 4Q4JB 2QEQA 3C4JA 3FWYA 5F9HA 5EXPA 1X8JA 1AZSC 1KO4A 3FKSA 2SHKA 1FX0A 4MGIR 4AYTA 1II8B 3QXXA 1EX7A 4B3DA 2BC9A 3Q5DA 2XX3A 1WF3A 1D2EA 1US8A 1DS6A 2IYLD 3CX6A 3VHXA 2V1UA 3DO6A 2W2XA 3RRNA 3GJ5A 1DO0A 3VX4A 5FPTA 3KJHA 4A9AA 1LW7A 4MRRA 5CYOA 1N6LA 1PV4A 1E69A 4HAYA 2V9PA 5IHPA 3LD9A 1P3JA 5IK2A 3VU9A 3CIOA 4DUGA 5B58C 3KJGA 3W3AA 4YMVA 4IDOA 3B78A 1XD2B 1JQLB 4G5RA 3KUCA 4KAXA 4RKEA 4OQMA 4HATA 3T34A 2A9KA 3GLIA 1IY2A 5HE8A 4RY2A 4C0AC 4D0LB 1Z0AA 1T3HA 3OEHD 2F1IA 3EIQA 1SVOA 3RWOA 4B3XA 4RD6A 4MRVA 1MH1A 4I1UA 2BDTA 3C5HA 1VCNA 5JHHB 2R6FA 4D82A 4B6EA 1G64A 2GJSA 4NMMA 5TDHA 4NYMQ 1KDTA 3OFNA 2G1KA 4PSKA 5AUNB 2XNDA 2YVUA 1JR3D 5LD2B 3NDBB 1BS1A 3A8TA 2G9NA 3WYAA 4Q19A 4RD4A 3VTKA 1Z5ZA 5UKDA 5FOTA 4EPTA 2GESA 5CLLA 4UNQA 3HU3A 2O0HA 4B32A 4MYTA 2IEZA 2RCNA 2GK7A 2YWEA 3P1JA 1KSFX 3K8YA 4A2PA 4C0SA 2ZYVX 4Q9JA 1ZC4A 2BV3A 4QBIA 2ZRHA 4C0LA 1VCOA 1TF2A 3SNHA 2WPDD 3S1AB 2PT7A 3W3ZB 4DBLC 1G19A 1WRBA 2Z5FA 5GJWC 3THYB 3BK7A 3GLHE 1OB2A 3L43A 3VFDA 5E4FA 4OHVA 2ZU6A 4M1YA 1UBGA 3EASA 2FSIA 3EC1A 1N5LA 1N6HA 2QY9A 1XMJA 2HF8A 4BFZA 2QP9X 3IEVA 4GDFA 1P2TA 1DAKA 1ZM2A 1GTVA 4V0KA 1Z22A 5CDFE 2J41A 4D4MA 1Z63A 5HKKD 5JJIA 1IONA 5F9FA 1SKQA 2KI5A 4PO1A 1E2LA 1G20E 1YZQA 3LX8A 4NYJR 3NEJA 2QT0A 2QM8A 2OM2A 1E6CA 1E2GA 2QPTA 3AEZA 3SU8A 3K9LA 4PPFA 3UXMA 4TYNA 3WMGA 5FUVA 4JSYA 5DISB 2DBYA 1JECA 1S3GA 1Z6YA 3K0AA 1H8EA 3EPKA 1H65A 2RGDA 3IQXA 3GJ0A 2BKEA 2XTMA 3BAFA 3FHOA 5F98A 5FOUA 5L3QA 1PLLA 1P9RA 1CKEA 1JJ7A 5H70A 3TRFA 2FDCA 4CRWB 3QF4A 2MSEB 4RD2A 4EIWA 1KSJA 2BVNA 2HYDA 4IJMA 1PJRA 2CE2X 3KXKA 3W9YA 3EA0A 3QKUA 2GK6A 4B71A 4D80A 5KO2A 3KQUA 1G7RA 2ZI7A 3VNVA 4ZI2A 5BWMA 2P5SA 1M7HA 4B3FX 3K1JA 4F4IA 5CK4A 2ZJYA 4QC2A 2XZLA 4HDQB 4Q48A 3DDCA 4U02A 4H1VA 2PMKA 5FPKA 2PJRA 4MKHA 5KDOA 1OIXA 4GMDA 1Z07A 5L3SA 2EWVA 1R2QA 1TADA 4LUCA 4RFVA 3MJHA 5AK0A 1Q0UA 1G41A 4E5UA 3HDTA 4HDCA 5AUQA 4KXFB 1L2TA 2ZJ8A 3MLEA 5LPNA 3RSLA 4TMKA 4O2LA 1CJKC 4LJ7A 5SZKB 1I4LD 1N5IA 4BZQA 3RRYA 2YOHA 4DCUA 1HURA 1FMLA 5EZ6B 4BFWA 5BQ5A 5JWOA 2EFEB 3CRVA 5TARA 1I2DA 1KI7A 1L4YA 4Q9LA 1YVDA 2HJVA 1T8UA 4G01B 5E95A 4Z8YA 3NBXX 3K09A 4HAVA 4YMSA 3UMRA 4ESHA 3AF3A 4MGYR 4BEJA 5EP3A 5EZ5A 1J70A 1H8HA 4L9SA 4TMVA 1TAGA 2PL3A 3PEYA 3NBZC 4C30A 4Q4AA 4EQ6B 3RDPA 2BEKA 2ANCA 4NBSA 1FPMA 1T3SA 4MUBA 1X6VA 1JAIA 2QQEA 4AWXA 4A1FA 5K8TA 1WBDA 1NSTA 4Q4JA 4A0GA 4PHTA 4DLSA 1IY0A 5D3MB 3CLVA 4JMPA 1J8YF 1IHUA 3U44B 2RGCA 3E5HA 2WWFA 2ODNA 2GDJA 3IBYA 1E79A 1UPTA 3DL0A 3WYFA 4AC9A 5FOSA 2WKRA 2IUUA 4EDHA 1W7AA 2Y8EA 5EE0A 2ERYA 1OYWA 2FN4A 2RH5A 3X2SA 2EWWA 4LWZA 2F9LA 1TUEA 4I1OA 1GNPA 3LXRA 4TMWA 1F2UA 1ZUNB 1RC8A 3LQRA 2F3TA 2P6NA 1KSGA 1RJ9B 1WBBA 2OV2A 4WZAE 2CK3A 1XCPA 4HLQB 1GG2A 3F8TA 1XWIA 1XD2A 5EE9A 2IYTA 3P32A 2OFWA 1UKEA 1Z0JA 4QGAA 3E1SA 4HAXA 3KZ1E 4V0OA 1M7BA 2V7QD 3RS5A 3SEAA 1CU1A 5BN3A 2QUZA 2ZRKA 4JKYA 1U81A 4EPWA 5DIFA 1NLYA 3KKMA 3JVUA 4CYMA 3NXSA 3ZIAA 2YKGA 1HTWA 1VMAA 4M0LA 4W7SA 1MO3A 1ETUA 2VP5A 2ZITA 3MAAC 2YINC 3NBFA 1YE8A 3NH9A 1CJUC 1XD9A 4D26A 2VBCA 2ZI4A 3MFYA 1GILA 1KK3A 4Z1MA 2NPIA 3FPAA 3DZDA 3NC0C 4IDHA 2O8FA 1UDXA 4LJ8A 3B60A 3WNBA 3TBKA 4X8LA 2QGZA 3DMNA 4OQFA 3TAHA 3ZQJA 2ZXUA 4BZPA 1OF1A 4ZIRB 2J7PD 4JBWA 5FOWA 5J4VA 4NE2A 5BXQC 2I1VB 1CR4A 3B9PA 1IAQA 1Q20A 2ZYUX 3K9GA 2P0EA 3SYKA 3C41J 3SC3A 1EG7A 3L0SA 1T0HB 2BM1A 5BYKA 2PX0A 3THYA 3SQXA 2ZRJA 4MDEA 3IIKA 4W5HA 3FFAA 4F4CA 4OHWA 3KB1A 2JJ2D 3GFTA 2W6JD 3FMFA 1ZD1A 1XEXA 1EGAA 2WIAA 1KAOA 2ZSAA 4AI6A 4QFMA 1GDDA 1SGWA 2C96A 1W0JD 2BMEA 4NZYA 3U3MA 2IT1A 3ECCA 2WIBA 1E32A 1SXJA 1U98A 4A8JB 4DCNA 1GSIA 3CRRA 1LF0A 2Z0MA 4RJLA 4A15A 1DAHA 4XSHA 1G8GA 2UKDA 4LHWA 2QAGA 3BS4A 2Q3FA 2O8DA 1OKKD 3QG1A 2ZJ5A 5JCZA 4RD1A 1R0XA 4TQUS 3ZYCA 5KSYA 2ZPTX 2W0MA 1VIYA 1DAIA 3CF0A 3PUYA 2ZRBA 4U00A 3IEUA 2JLXA 2IA5A 1NMZA 1OW3B 4RFSA 1QHHB 4LYFA 4B75A 1A2KC 2QORA 4RD3A 2AWNA 2P3SA 5FL3A 2ZE8A 5E7JA 5J40A 3QVUA 2RGNA 2V3CC 5LB2A 5FPHA 1GL9B 3AUYA 4TMXA 2QP3A 1KI6B 1CLUA 2ZR7A 4LYJA 5H8WA 3PIRA 4DLTA 1ZINA 4UNSA 3L0PA 2ERXA 2KWIA 4DSUA 4V02A 3MWYW 2AX4A 3HU1A 4EJSB 5DHAA 3AP3A 3W5IA 2H57A 2DWOA 4LYHA 1XB2A 4JLPA 5EE3A 2VH5R 1U94A 4LX0A 3LVQE 2GJ9A 4L9WA 1G3IA 2WWIA 1NL3A 4PQFA 1Z0IA 1Q22A 1AKYA 5TB5A 2KBEA 1MRNA 3L2OB 4Q7LA 3HJNA 1E2DA 3OIVA 721PA 4QGGA 1HQYE 2UZ3A 3QENA 1E2HA 2VSOA 1PLKA 1TQ6A 4NDZA 1CIPA 1KI3A 2F43B 4EKDA 2UZIR 2R6DA 2OXRA 3AGQA 3OF5A 2WOJA 2ZRDA 4I81A 1W0KA 4OHXA 1Z3IX 4EFNA 2YNMA 2YYZA 3RVBA 1R4AA 4BE7B 1T9HA 3MWKA 1XF9A 1GWNA 1UF9A 4TN1A 4YQFA 4ZDWA 2DY1A 3D7MA 2KB0A 1S4QA 4MDFA 4RKFA 4LDJA 4G5GA 4PC1A 2J3EA 2AK2A 3MCAA 1P6XA 2ZUDA 5M04A 4PC2A 3E70C 2XXAA 3QNUA 1EXMA 3CF2A 2XB2A 3UIEA 1NBME 2VEDA 4FMCF 2IS4A 3GJ7A 1YZGA 4XVQA 2Z4RA 4A0FA 3GLGB 2QBYA 2AN9A 5CIQA 1A82A 1NBMD 4CT5A 2PCJA 1XXHB 4FWIB 3UG7A 5KDDA 4QHTA 4D4LA 1V5WA 3RC8A 1B0UA 2QRZA 1G3MA 3NBYC 4M1SA 4US2R 4BLQA 3PUWA 4PX9A 2QG6A 1KHTA 3T12A 2E87A 4AIIA 4JT2A 3FOZA 3R9XA 2AK3A 1X1RA 3VR1A 1FX0B 3ZVNA 2ZRGA 1HH4A 4URWR 2YWFA 1E1QD 5FUWA 1G5PA 4V0ME 4JVSB 1G6OA 3RS4A 4LBYA 3WNDA 5FBVB 1FTSA 2ZE6A 1NG9A 1W1WA 2P67A 1TTTA 2GTPA 1XD8A 2LKCA 3AP1A 4P32A 3GLIE 4DCSA 5IK2D 1G9XA 2ZJAA 4DUGD 1Q44A 3FMOB 1MV5A 3SS8A 1ODFA 4KFRA 2OUKA 1G7TA 3W6PA 2NTYC 4QJ4A 1ZM7A 4ZKEA 2WWGA 2XNSA 4DLUA 5DHFA 3TLXA 4I4LA 2JLVA 4WAUA 5L3VA 2GA8A 3V00A 2C95A 4FCVA 1XTQA 2WJJA 3EXAA 2OSBA 1LTQA 5B2ZA 3C8UA 4A4DA 2PX3A 1MABA 3RS2A 4DVGA 2N1BA 2GCOA 3Q8XB 4URZR 2MMCA 2NO6A 4MYUA 2IS2A 3OFND 3HR8A 1XTJA 4KCGA 2XNDD 2RMKA 5FUXA 5EJEA 4KSBA 2NG1A 5AUOB 1UBFA 1DAMA 4EPRA 5JJLA 4PHFA 2VHTA 3CRW1 1KIMA 4V0LA 4QNMA 1W48A 3B85A 4PHHA 1RYFA 2WMNB 4HI0E 4R98A 4URVR 2CBZA 5FTKA 2R6GA 3VR6A 4GPTA 4C4PA 3W90A 4NONA 5DYGA 2P5TB 1M7GA 1N5JA 2CLSA 4AY2A 2IUSA 1KMHA 1E9EA 2YC4C 1IJEA 2B7CA 2XSZA 1U9IC 3U6KA 3D6TB 4JVMA 1ZP6A 2WZQA 4BQSA 2X8AA 4DSTA 3TNFA 3KQNA 5FBLB 4NYMR 3LW8A 4P4SA 4BFVA 3AKEA 5E7IA 1AJEA 2X1VA 1CR1A 5EP4A 4C0QC 5EXSA 2XTZA 4QBHA 4FI3C 1YR8A 3O8RA 2W6IA 3LO5A 5DNYB 3CR8A 1KI9A 3KJIA 5GJVC 3P4YA 4V03A 1U90A 2NIPA 1NIPA 1UJ2A 3ICQB 1E9DA 1R6BX 2WWHA 3R20A 4NU0A 3TMKA 2A5YB 4OI1A 1AQYA 1FTNA 2I4IA 5FL7A 2ZEJA 1E2JA 3B6EA 4ZDKA 1KI6A 2QTFA 2JCSA 3GFOA 4I99A 4LBVA 4WBSA 2OZEA 3TE6A 3U3RA 5FBRB 5AR1A 2C99A 5CM8B 1W4CA 1LVGA 2HF9A 3F0TA 3QKRA 1H8ED 1FZQA 1UKVY 3IGFA 4K46A 3BD9A 3UANA 2D74A 3FKQA 3SJBA 5KDLA 2GXUA 3VR4A 1Z0DA 4DDWA 1Q21A 3AVPA 3EZ6A 4D2IA 2XJ4A 3ICEA 2J0UA 1N6OA 2DB3A 3T15A 5KYKA 4NCHA 4DIEA 4XVUA 1ZNYA 4PZYA 1W44A 1HT2E 2JLWA 3L0IB 1E94E 2FOLA 2ANBA 1AGRA 4C0KA 1G21E 1OFUX 2PZEA 3K70B 3CBQA 3N2EA 4BEBA 4QOSA 2EFGA 1E0JA 3BB1A 4XD7D 4X8HA 2ZJZA 3FHCB 4NTZA 4QKQA 1OSNA 1PLJA 3PCRB 3QXJA 4ZCLA 3TQCA 5JI2E 4ESVA 5K8LA 4TLEA 2ZE5A 2IWHA 1TUIA 1XX6A 5L3SB 2PEZA 3CPHA 4Q4LA 4YMWA 1P2VA 4TMZA 5FOXA 2W83A 5CJ2A 1OV4A 4FINA 1RRGA 5JZVA 3UPUA 3VNUA 2GAOA 2GVDC 4Q1AA 2NO9A 3PUZA 3MRSA 1DELA 1M34E 2NOAA 3GLFE 2AXNA 2XZPA 5JS7A 1YR7A 4POAA 2IC5A 2R44A 4ACAA 4HB3A 3I4LA 4IOMA 4AKHA 1VCIA 2C9CA 2WJGA 4LHYA 4Q18A 2OG2A 2R62A 2QGNA 2QTHA 1CJMA 3H2YA 1TMKA 1K6MA 4BLOA 3LVRE 1COWA 2P65A 3GLGA 1S2MA 3HU2A 4DB2A 4TL8A 3FGNA 1XXHA 2FEMA 3N5CA 3IO3A 3DVLA 3C7KA 1XEWX 2R9VA 2IS1A 2C77A 1VPLA 1DARA 1NY6A 1BYIA 1SQ5A 2OAP1 4UQOA 2ZM5A 3CNNA 1N0UA 2ZVQX 1OHHD 2ORVA 1ZM9A 2FFBA 3MG9A 4NCNA 3EARA 2ZI6A 1K5DA 1RIFA 4PSVA 4LY6A 1E79D 1OXUA 2PCLA 1E0SA 2O8CA 1QHYA 2IYRA 4NCIA 2ZJBA 3KFVA 1TF7A 4Q4HA 2IW3A 3GJ3A 1T8TA 2OXCA 3ADKA 2DHRA 3EWSA 2ZRLA 1SVLA 3I62A 1T5IA 4F7WA 1F2UB 2C9OA 2X2EA 4Q7JB 4ARZA 4EAQA 5JI3E 2E1RA 5EUMA 4JLAA 4ZV4A 1N2CE 4UNNA 4ZO4A 1AS3A 1E0KA 1KMQA 4MGZR 3V9PA 2O52A 2VHQA 2ZAMA 4GT1A 4TLDA 1G17A 4OJQA 4PPQA 3CF6R 4A92A 5HPYB 4MA4A 4EFMA 3PUVA 1Z08A 4U5XA 4US1R 3C15C 4FMDB 4BUJA 4PPNA 2B21A 3BXZA 1JPJA 3IIMA 1EFRA 1LY1A 3A36A 4YC7A 3RANA 3ZIAD 1JR3E 1XZPA 4HB4A 4Y0AA 4BZXA 3WY9A 4N3NA 1SHZA 2YOFA 4LV6A 1W2HA 2H92A 4M2LA 5JRZA 3AKDA 1YZNA 2DWPA 3WBJA 3OEEA 1N6PA 1RW4A 1XEWY 3CO5A 4QBFA 4IFBA 1EESA 1HUQA 2BCJQ 3PUXA 4Z1MD 1OXVA 2GXSA 1QHNA 3AVVA 3W5JA 2C78A 4GI7A 1TF5A 5H1YA 2P2LA 4FWTA 1RPZA 1SKYB 2O8FB 1KO5A 2CJWA 2FV8A 3KQHA 3WP1B 2IUTA 4F4JA 1KJZA 3IPXA 2H5EA 4QBGB 3SHFA 4LJ9A 3AQ4A 1D5CA 2FJUA 3O47A 2EU8A 3AVQA 2ZSDA 1M74A 1ZW6A 2CDNA 1G8YA 2QMHA 4OK6A 5IF9A 1P7CA 5AWFC 1UM8A 4B2IA 2NO0A 1YR6A 3OE7A 2YWGA 1OYYA 3R7WA 1X3SA 4LPSA 3TGPA 2QSZA 4IFEA 2WSSA 3C14C 3OESA 3KKPA 2EQBA 3P26A 1Z2CA 2BKUA 1FP6A 3LY5A 3QI2A 1JNYA 1XEXB 1P62B 4B73A 5FTJA 4CF7A 3RABA 3IUYA 4Q01A 4TLAA 1X86B 4BWYA 3B13B 1U8ZA 4IXMA 4L5BA 3TK1A 2JA1A 1Z6XA 3AF4A 3R9WA 1SXJD 3ADCA 3DMDA 4R2HA 1T5LA 2ZSBA 1SXJB 2LWIA 1OXSC 2FZ4A 4HDOB 2HLDA 4LBZA 2VA8A 3MUFA 1JQJC 2ZRAA 4WW0A 1YRBA 5B30A 3VAAA 3SE0A 2O8DB 1CS4C 5JFGA 1HV8A 2QAGB 3ZGXA 2LCFA 1JXOA 2DYKA 2WWYA 3DM9B 5P21A 3TSWA 5GJBA 4ACBA 2GF0A 3ZVLA 2Q9BA 3LX5A 5C1BA 4K8OA 2R8RA 1Q57A 4RZ3A 3LLUA 5FOVA 2FA9A 5LB4A 1HEIA 4BFXA 4EFLA 2PMDA 3I8XA 3QPVA 5CITA 1JXMA 2G0TA 4RFSB 4D25A 3EWAA 3KTAA 3OZXA 1XTKA 2D62A 4OKSA 1GKYA 2V8OA 3RRMA 1KK1A 3O8BA 4B48A 1UFQA 4DJTA 3LRPA 2CHVA 3CUEF 3U7FB 1S9HA 1Z0FA 1DPFA 1C4OA 3CWQA 3MGCA 1OH6A 2NMVA 5CB8A 1N25A 1NKTA 1DG3A 1TL7C 4NKRA 2WVJA 2WHXA 3ZS8A 4WZ6A 5B64A 2BBSA 4NH0A 2QROA 2JJ1D 4IVQA 3LXXA 3Q3JB 2GEVA 2Z6VA 2GNOA 5C4MA 2W00A 1T6NA 1W5TA 4OQXA 4S2EA 1F2TB 1T91A 4TZ6A 1R5OA 4PANA 2IYWA 4B76A 3GQBA 3EPHA 4DDVA 1L7VC 2PLRA 2CVHA 1CBUA 4DLXA 3BJIC 3QXHA 1EWRA 1D9ZA 4TSFA 2IF2A 1GM5A 1GZSA 1YQTA 2A5JA 3V4FA 3DOEA 4LBWA 4CEJA 1ZU4A 1W0KD 2ZAOA 3CR7A 1KNXA 2A30A 4PAQA 1ZAKA 4Q7MB 5HCNA 3VR2A 1E9AA 1W36C 5C4GB 1A1VA 3QBVA 3VX3A 1J7KA 3ZQ6A 3QKSB 3BFKA 1NIJA 2CLCX 5LDDC 3W8NA 1KK2A 4V0NA 4KI0A 2X77A 4K81B 3Q7QA 4UJ3A 4NYIQ 2ZS8A 4DT1A 2XXAB 5EQTA 4OQNA 1TPZA 3H4MA 5JECA 1UEIA 2HDNB 4GOJA 1S9DA 1AKEA 1ZVQA 4A0RA 2QBYB 2ODWA 3JZMA 3ZJYA 4NPHA 3FB4A 4ABYA 2D06A 2G83A 1R0WA 1D6JA 4ASUA 4KFSA 2ZRIA 3WHKA 1SVKA 1XBTA 5A5GA 2EYUA 3AKCA 4JYCA 4RZXA 2XB4A 4LI0A 4URYR 1XDBA 1GRNA 4JBXA 4Z8XA 2FPMA 3EX7C 3SR0A 1VIAA 4KHZA 1YR9A 5DN6A 3BRWD 3UK6A 2J7KA 5L3RA 2ODEA 3KFXA 4MKFA 5CK5A 3KXLA 3BFXA 3CH4B 1Q1QA 4JL8A 1G6HA 2J9RA 4JLKA 1AM4D 4IEEA 4OYHA 2ZRNA 4PSAA 3RWMB 4CIDA 1S1CA 1MKYA 4MQBA 2ATVA 4W5WA 3A4MA 3GJ8A 4PO9A 3FTQA 3RAPR 4P4TA 2HCJB 1EFTA 1E0AA 3C16C 4C2TA 4D6PA 1IN4A 1E2KA 3PENA 4JS0A 4TLBA 3VHLB 2CCKA 2ZIAA 1U8AA 3SJAA 3D8BA 1KZGB 4LJAA 4TMTA 2OFOA 4WVFA 1OFTA 2YWHA 2D2EA 1E4YA 1MABB 1XCMA 3MWLA 2GCOB 4QNRA 4X8MA 5KNBA 1Q1EA 3QQ5A 1HE8B 4R9UC 4US0R 1E98A 2VHCA 1P4SA 2F9MA 1NVXQ 4UJ5A 521PA 3SOPA 2QAJA 1T3LA 3GMTA 5KNCA 2ECKA 2AWOA 5TVKA 4AK9A 1P61B 2CHQA 3T1TA 2XAUA 1A2BA 1QVRA 5BYJA 3HR7A 2CL7X 3DKVA 5KU1A 5EUQB 4BFUA 3SI7A 3TIFA 1OH5A 2XSZD 4XWKA 1KMHB 5JHGB 3QSYA 2OBLA 1DAGA 3EA5A 3QUSA 4M1MA 3PV0A 3BB3A 2D7DA 1NN0A 1J90A 2QNRA 4LJ5A 4UXIA 3AM1A 2ZS9A 2NO7A 2OAQ1 2FU5C 1G3QA 2FPKA 3QEJA 1U0LA 4DC9A 1W4RA 4HLUC 2WMOB 1NRJB 2WPDA 4PQRA 1CJTC 2VRWA 5JBQA 4MKIA 4P4SB 1BMFD 2ZI3A 5EE5B 4JL6A 2QE7A 2Q21A 3DM5A 2IYQA 4JIMA 2CLDX 3VQTA 3A37A 1E1RA 3DEFA 4F91B 2RKOA 4YDSA 5HTKA 4TYWA 3GLHA 2OCPA 1Q1BA 1IOZA 1C1YA 2GF9A 3N2IA 1ELOA 4DCTA 4HZUA 3FDIA 1TU4A 1BH2A 3H0KA 4GOXA 4PHGA 2A5DA 1IN7A 4DDTA 2FZLA 4HUTA 3PQCA 2ATXA 1KK0A 2G77B 4YLGA 1NMYA 2IX3A 3ADBA 1YRAA 1VHTA 1CJVC 3DOFA 2IXFA 2CHGA 2QENA 3LW7A 4HUQA 3U7GA 3MJRA 3QKRB 4GZLA 3B1YA 3M6AA 2ZTSA 4DKXA 2D7CA 2ODBA 1IN6A 1HA3A 2QM7A 221PA 2VF8A 4L15A 4YXWD 3ZDQA 2J0UB 3CW2A 1AGPA 1P2SA 2GWHA 4O3MA 3GD7A 1E2FA 5H68A 1ZNXA 4B74A 1R7RA 2UVQA 4F38A 1AA9A 1E2NA 2OEPA 3FMIA 3LAWA 4HLCA 3RS0A 4ZDIA 1ONBA 1IY1A 2F55A 1UAAA 3Q5EA 5TXGA 4M1OA 1F2TA 3T61A 2O8BA 4DB4A 4LJ4A 3AVUA 4AG6A 3NVAA 1IN5A 1FNMA 3TUZC 4PC3A 4HYYA 3AVXA 1OXTA 4WZBE 1CF4A 4A36A 1QDEA 3PEVA 3T1QA 3ZLJA 3PEUA 5C2JB 3FYHA 4Q1BA 1YHNA 1QHIA 2QMEA 2GBLC 4NCJA 2CL6X 4IDPA 3ADDA 2VP4A 1EFUA 1AK2A 4PO8A 1G8FA 5LBIA 1P75A 3QKSA 2HV8A 1B23P 2J1LA 4UKDA 2GHIA 3RYTC 1R8QA 4B3CA 2XJ9A 2VLIA 2JDIA 1XZQA 3GLGE 2Q9AA 3ZVMA 1SVMA 1XJ0A 3BH7A 3CZPA 3RHFA 3CB4A 1U9IA 3U60B 2O0JA 3X1DA 4ZCIA 4RSGA 2AFIE 1D2MA 2QRNA 3EZ2A 1COWD 5FBWB 2B8WA 2GJ8A 4Q1FA 5SZJA 1MOZA 1GKUB 5B57C 2BCGY 1YU9A 1G3RA 3B1XA 4KITB 5TMPA 4QM7A 2PT5A 2JEOA 2ZU0C 4PXAA 4B3BA 3CWZA 1U0JA 1E9RA 1RRPA 1XNJA 5HCIA 2W0SA 3X1YA 2NPFA 4GRAA 2QSYA 2BM0A 1Z29A 1DAEA 1NVWQ 4HEJA 3BWDD 5FBQB 1GITA 2QL6A 4G5QA 2HXYA 3FKSD 4B33A 4CEHA 5IRCD 5F3WB 2O8CB 1E9FA 5DO9A 2GKSA 4KLZA 4L8GA 2G3YA 3B2EA 1MT0A 1VG8A 2ZI9A 4Q4HB 4TL7A 4BASA 2AFHE 1YZUA 1GFIA 2JGNA 4A2WA 1LS1A 4M4SA 3LFUA 2C8VA 4AG5A 3UKDA 1NN1A 4LCBA 3GP8A 1OIWA 4MITA 4GP7A 4OL0A 4ARZB 3O8DA 3ZZ0A 3SQWA 5J5CA 1GKIA 3GJXC 3MWJA 4QHYA 4LZZA 4FCTA 3IHLA 4BRUA 2ZETA 3ZVRA 2QPAA 3H84A 3T06B 1QHSA 2X19A 4F93B 1EFRD 2IYUA 3HYTA 2CCJA 3U3JA 3CKLA 2JIZA 1E9SA 5J4HA 3OEED 5DI3A 1Z6GA 4PZLA 4LYAA 4CVNA 1WP9A 1NLZA 1XMIA 3TH5A 3T1OA 3UWOA 4DHEA 2HXSA 3HYRA 4XIGS 4IXNA 2IHBA 2CJWB 3NHBA 4GBMA 2GEUA 4P3YA 2ONJA 1DO2A 4JLDA 1AS2A 3B1WA 2RB4A 2WWXA 3M0EA 1R5BA 4BFTA 2XOKA 1DOAA 2J7PA 4G5SA 2ZYTX 3Q7PA 3I5XA 1IQPA 1XMVA 3OE7D 4LSGA 4PC7A 4QG7A 3NG1A 3C5CA 2NQ2C 3GJ6A 1KI8A 4JJKA 3R7WB 3SJZA 4GL2A 2WSSD 1MR3F 3U7EB 3F3YA 3PR1A 1AZTA 1GP2A 1ZBDA 5KOYA 1OFIA 1W36B 1N6KA 2BJWA 3AGPA 4Q00A 4Q7KA 3LH5A 3AKYA 4M1WA 3HPRA 4QXAA 2W6JA 5J4KA 1SVSA 1NJGA 1E2EA 5JEDA 1HT1E 1WQ1R 1OH7A 3P20A 3A1SA 3LV8A 3QEOA 2ZUCA 3UG6A 2HEIA 1W0JA 4AKIA 4PFSA 5DLQC 4AKEA 3J81k 1JR6A 3NDPA 1KY2A 2HLDD 3BGWA 1BKDR 5E3HA 1FL9A 1CEEA 1IXZA 4LRWA 1ESMA 5FFMA 3NC1C 4N0DA 3WHLA 1ZIOA 3CPEA 4TTRA 2FSFA 2FWRA 1E2MA 1OKKA 1W47A 3TKLA 6Q21A 2FSHA 3SHWA 1KSHA 1YKSA 3BIFA 2VYFA 5J47A 2BJVA 4M9XA 2LKDA 2JLQA 5FR1A 1HYQA 4B35A 4OI0A 4PQYA 1Q1ZA 2YV5A 1W49A 1ESNA 3VKGA 5IT5A 3KTAB 3TR5A 5GVSA 2MSCB 1NVVQ 4LHXA 1JALA 4FMCB 1FQJA 5FPYA 1J8MF 2WV9A 3K53A 5E7MA 4YDHB 4XSGA 3NHAA 3K70D 1NI3A 2PJZA 4GMXA 4TYPA 1GNQA 1RVDA 2FMXA 3KKQA 4KJZA 4KLNA 4Q47A 5CLQA 2IWRA 4TLCA 5KSPA 3AV0B 3QXSA 3CX7A 5FI0B 1SULA 3U3KA 1NJFA 1QHGA 2V6JA 3LWNA 4JL5A 2DFLA 4YMTA 4M1TA 2DFNA 3QXCA 3X1WA 4D4KA 1G8HA 5CIWA 4KVGA 4CGZA 2REOA 2VP2A 3JVVA 4KBGA 2BBWA 2QZ4A 1OXXK 2F6RA 4E09A 2AKAB 1QVAA 1Z28A 1U2RA 2PZFA 1P5ZB 1KDRA 3QPUA 2BBTA 1J2JA 3CRQA 4TZ0A 2FFAA 4LHZA 2WSMA 1MRSA 2ZE7A 2ORIA 4DLYA 4DLZA 3AVOA 1M2OB 1JJVA 1Z83A 3T35A 3UATA 3B82A 3WNCA 4LV8B 2B92A 4URUR 4EPXA 3KQKA 4TSFD 2AR7A 2HUPA 4JKIA 121PA 4QHSA 2GZDA 3B5JA 4YMUA 4C7OA 5HZHA 5AJZA 4CEJB 4O2RA 3I3SR 4UNRA 1H8HD 1JBKA 1KKLA 4NP6A 4IRUB 4N0EA 2RGXA 1OT3A 4C2UA 1X8KA 2PH1A 3OIYA 2W2TA 3EZ7A 1VYUA 4JT4A 4OQLA 1UBEA 4IKEA 2IXGA 4M53A 1C9KA 1G18A 1CR2A 1NMXA 1YZKA 1M8PA 2AKYA 4Q66C 4UNPA 5GJCA 8OHMA 4A8JC 4IDQA 1W4AA 3PEWA 1U99A 1F48A 2OLKA 2I1QA 5SZHB 2QA5A 4P33A 3N70A 4DT1B 1S96A 2WTUA 3NIBA 1Z2AA 1HY3A 1QBKC 2IYSA 4XWOA 4MYHA 3R8FA 1EWQA 1Q12A 2YHSA 1ZUHA
chains in the Genus database with same CATH superfamily
3WWZA 5D5PA 3AWDA 3BK2A 4PBTA 1DSSG 4JGBA 2QQ5A 4E88A 3VKWA 2FWJA 2CL5A 3GJYA 3IILA 4CFZA 4MAFA 1GGNA 1SCJA 4PN7A 4ITRC 3DQQA 2AJDA 821PA 1RWMA 4IOLA 1QYCA 1RQGA 4EUEA 2C5FA 3QF7A 2GK4A 3DBIA 5I3CA 2J33A 4NCAA 1E9BA 3GYBA 2GVZC 2WILA 3P9CA 2JRLA 3RJ9A 4ZO6A 5K09A 1X9GA 4HUJA 1EM8A 2O2CA 4WKBA 3VKVA 3VZBA 7MDHA 4G0WA 1TFRA 1U8YA 1WE2A 2E4WA 4RIGA 5E4YA 5DN6D 3G9ZA 3ROXA 3GCXA 3OZIA 3W5BA 2PD3A 2Z43A 4BE4A 3G0HA 4MS1B 2J46A 3BWCA 1ZIPA 3E27A 1Z2EA 3FF1A 3L7IA 2JHCA 4FXPA 4GOOD 2ZYSA 3QEBZ 3FWZA 4EJSC 1SRQA 4NESA 3V42A 3A4TA 4K0KB 3TSAA 4ZRNA 1F12A 3H1FA 3IVMA 1L4GA 1Q91A 2PJUA 3D6UA 2OQVA 4E15A 3VNAA 1G6KA 3EPJA 1P4JA 2XGMA 2BUAA 4ZOBA 1DO8A 5FA5A 1Q2UA 3BE8A 3OD1A 4QU9A 1GGJA 1D8TA 1U5BA 1YVUA 4UOZA 3CNBA 4ALKA 2RHCA 1Y4ZA 4HVAA 3R8CA 3LGAA 4M3NA 5HIJA 1G4AE 1KF0A 3FWKA 1RBZA 1XVLA 1T9ZA 2VL7A 4X93A 5JQWA 4DMUB 1B0ZA 1O87A 1JVSA 3AWIA 3E2MA 2RBEA 2QRKA 4EA9A 3ISTA 3WIVA 5JT1A 3PQ8A 1K7YA 1T3TA 3M2TA 4EELA 5KNBD 3ESBA 3EZXA 5A4FS 3U4QA 3GCZA 4D45A 2Q5LA 3SC4A 4KFCA 4BNDB 1KO7A 2QOEA 1AMOA 2DLNA 2JLRA 1QB7A 3I2YX 1EP1B 1P72A 2JW5A 2RGWA 4LRYA 2OESA 2UYOA 4A27A 4DFDA 5EFZA 4KDEA 4RQAA 4RVSA 1DQPA 1E89A 1RR6A 4O2AB 1EWVA 4Z54A 4D41A 1AHPA 4QELA 1EX6A 3GN1A 4RLQA 4H18A 1TYDE 1HMPA 5K05A 5K8UA 2UV8A 4UW9A 4E5KA 2EYQA 1H3FA 1MV8A 5IVHA 1IHDA 4X71A 5ELXA 2Z6AA 3Q85A 5ICGA 1U8TA 4GBGA 4DMHA 3IXMA 3QP9A 2AD5A 3I4CA 4U6NA 3S1LA 3UUWA 1R10A 3QEMB 1FFAA 2BGMA 2OO7A 3QFTA 3RRZA 3WRXC 4IAOA 3E9QA 4BECA 4I3HA 3RT7A 3PDCA 4KQ2A 4DPKA 4X64B 4CDGA 4EM6A 2BTOA 2C98A 3OCVA 4G0YA 4MIEA 4OMUA 3UV3A 1MGPA 4BO6A 1KTVA 2DPMA 2IHTA 4GYJA 1T29A 1HQCA 4BGVA 621PA 1SIBE 1TW3A 2AI1A 5LZ5A 4QJ3A 3PWZA 2B2CA 2YZGA 4QVKA 3MJEA 2ZYHA 4M99A 2OP0A 3QVJA 3GLHB 3PNLA 1QFJA 2XH8A 3NEAA 1EEXB 1ANKA 1RRKA 1ZJZA 3B20A 3FTCA 4YT5A 4HZUB 2HHJA 2QTWB 1JDNA 4DGQA 4GS5A 2XF2A 3FTEA 1N0HA 4PIPA 5JAUA 1R0ZA 5BRNA 1MN6A 1D1QA 1NURA 1KYTA 4RY9A 3K5PA 2DTXA 2QU8A 2Y67A 2G1JA 1TEXA 1YXMA 2XQJA 2ID7A 1JE1A 1ORVA 2YS6A 4IWYA 4KO8A 5DBIA 5FHQA 2Q28A 4IDNA 2GR9A 2PZBA 2IHYA 4HUQB 4N7RA 5CDTA 4ZVNA 2WDPA 4LDZA 1U2ZA 1U0RA 5LLDA 1POXA 1W34A 1GOTA 1LI5A 2GCNA 3IT1A 4BMZA 2IU3A 4PM4A 1JEJA 2AHOA 2O3UA 1P2UA 4R3WA 3TLGA 5LU9A 3W06A 1N3LA 3HKBA 2UUAB 2HW8A 3ZK8A 1EJBA 2QRVA 1A9OA 1GSAA 1I5OA 3PXUA 3MELA 4H7IA 4QYXA 1MC1A 4RACA 4UD2A 2V6FA 4ZRMA 3WJ7A 3W5DA 3ONVA 1E3EA 1YD7A 3SR4A 3K1AB 3ENQA 4LZJA 1DINA 1FFXA 4S2UA 3LP5A 1SKBA 3WQRA 2O0KA 3KCNA 1MT3A 1OQAA 4KMSA 2BGNA 2CNWA 1FE8A 3WP0A 1V6AA 4BC1A 1QRRA 2O8BB 4TKUA 2CEKA 4PPGA 3SSAA 5IABA 4PYKA 3BD8A 3ELUA 1K7EB 3DC2A 3PZBA 4QEKA 4TT3A 5IN5A 1KFJB 1ZI6A 4BO4A 3NHFA 4JP3A 1Y3IA 4YN3A 3IALA 4DYDA 1D0VA 1KU6A 5ALMA 2X6RA 2VQSA 2X0DA 3TNDA 4P82A 3OPYA 4J6EA 4Q03A 4Q93A 3UMFA 1P2FA 1YDGA 1L4HA 1C50A 3ODPA 1BVUA 3GMIA 3H13A 1A72A 4LG1A 5ETJA 1SKAA 4EOGA 3EDOA 3KVOA 4UAGA 4D8WA 2BFCA 4IJWA 1KU0A 2QRUA 3PPVA 1YHYA 3PT9A 3E9NA 4L2IA 5JBIA 3U7HB 4DNOA 2E4UA 1Q0PA 2FSPA 1NV8A 3EQZA 3UH1A 4JSRA 3ZK7A 4W5QA 3THXB 1TYAE 1QH8B 3EH2A 4IIFA 2NQTA 4Q21A 1M33A 1NQVA 2E2WA 3BWVA 4OBEA 1RIIA 5AM5A 5HIKA 3KL4A 3W4IA 5FPPA 1H66A 2FW7A 2IEIA 1LBIA 3MSXA 4DMRA 1V95A 2JF0A 4INJA 2NGRA 4UHCA 5GY7A 4C0HA 3L6EA 2QGFA 4DLVA 1K7FB 2P4UA 1L4MA 1DKUA 2PGDA 4JZKA 4ZVLA 3TVTA 1M6NA 2JIQA 2OZLB 1N2GA 1QG6A 3JD4A 1RHQA 2UYYA 4JLBA 4M8NE 1XPRA 2ACKA 4UULA 2JATA 1DUVG 4IUDS 4MQUA 5ALEA 5IZCA 2HQOA 1DKQA 2GFQA 3UAOA 2N1MA 3OZTA 3B48A 2QYSA 1VLMA 5HDBB 1N1EA 3CE6A 3DAYA 2V97A 1FB5A 4NAUA 4ND8A 2A78A 1K5PA 3B7PA 2F1RA 1VHLA 3D3WA 3E18A 4C9BA 4TTQA 1XMQB 1O96B 1ZU5A 3TSZA 4EY7A 1TO1E 3BMCB 4A23A 4BNVA 1JG1A 1X2BA 1RQLA 5ED4A 2BE7A 3AX6A 4G9EA 4PZAA 4YP6A 3EVTA 4HSEA 2J85A 3PICA 2BH2A 3NONA 3O03A 2I3BA 3WDLA 3ZE6A 4KAJA 5AESA 1XEFA 2IZ7A 1H5QA 2G17A 4LS3A 1NY5A 3LRXA 1F0KA 1AO3A 3FZNA 1DRVA 1FJGB 2DR2A 4MR7A 3PDHA 3QIVA 1XNRB 2J0QA 3H1EA 3PVCA 4BKUA 4CMEA 1QZXA 4AWAA 5TIIA 3KYCA 2H4XA 4MS3A 3ESAA 1YJQA 4YJ3B 3DCNA 3SPXA 1X7WA 3VR3A 2XITA 1P74A 1GRRA 1VYTA 3CRZA 4PLYA 1R9NA 2MSWA 3LSYA 4C22A 1H23A 3P0JA 2AL7A 4IPTA 3NEYA 2SBTA 3GCGA 4QAJA 1R1DA 2A35A 1Z68A 5ERGB 3K2BA 1IZ7A 4L3VA 3UC9A 2GYWA 5C31A 1GQYA 3NKFA 4FZRA 3RWBA 1BRTA 1MO6A 4WZAB 4EUNA 2L2QA 1TYBE 1WD5A 1YJ5A 3AQIA 3NH6A 2IUYA 3NUQA 4R1SA 5I9LA 1C7IA 3G82C 5JQGB 2AN5A 1NDHA 4MTLA 5AXCA 3SQOA 5B12A 5A3RA 4LKRA 3EFEA 2BDUA 5DSZA 4TV9F 1MA0A 5MFPA 1X2EA 5DI3B 3A4NA 3QMMA 2L0XA 4PYLA 2GCGA 3AIIA 1DLIA 1JR3A 1T2DA 2BMWA 4IO0A 2RC5A 1NW8A 4JHLA 1CD5A 2WAOA 2FEXA 1NKSA 5HZMA 1NPYA 1UBUS 1JIVA 2M9MA 5FQNA 2C5BA 4CTNA 3EAQA 3QWIA 3AM5A 4N7MA 4B8YA 4PAMA 1K5GA 2MJLA 3B2NA 3SFZA 4EYEA 2R2AA 3HB5X 3HP1A 3NQ41 4FD3A 2XOKD 1IJKA 4ROSA 3FGPA 5B2EA 5EP2A 1TTQB 1HOTA 4DA7A 4FFVA 4CPDA 2XAAA 3BE5A 3IP3A 3KZCA 3H4TA 2A9FA 2GERA 3JWPA 3N7TA 5E1BA 2QX7A 3BE4A 2PLWA 2ODTX 3L8MA 2UDPA 4I50F 3WMEA 5IUNC 1QR6A 5ICCA 3RTBA 5DYTA 3S1AA 1TNDA 2F1JA 4KAFA 4PRZA 1Z0SA 3RROA 4DTIA 3EMKA 5CA1A 2I1WA 1NQTA 2N46A 3FSEA 3ML1A 2OKGA 1DVRA 1ZYUA 2PA3A 3EGIA 3LBHA 3ON5A 2C8JA 4MGKR 2MTBA 2QD2A 5I51A 1MAWA 2FCRA 1RT9A 2NT3A 1CY6A 3NX4A 4TV8B 4ZYWA 3AZPA 3G0OA 3HHEA 1H2XA 4KK3A 3BH0A 4CCSA 2DSTA 4OOFA 1Q92A 4HN4B 3TTTA 4PTZA 4RD0A 1G55A 5DM2A 3TLAA 3UF0A 1ESDA 5JMTA 2B8NA 5AHWA 1UP7A 2P2SA 3QU5A 4UMVA 4HAZA 3RBZA 4EY4A 3SBOA 2VJKA 2Y27A 2JLUA 4KN6A 2GRJA 1ZVMA 1ECPA 1BVHA 2N42A 2HQRA 3ZZTA 4Q9AA 5I4IA 5AVTA 2NXCA 5EKSA 3A9UA 4WPGA 2VWPA 4MPPA 4MA0A 3WIOA 1VKJA 4IW3B 1Y1QA 1F5NA 3NHRA 1B6TA 4JLNA 4KWTA 1GAQA 5T8KA 2C9YA 3LE8A 1O5IA 4MWOA 1D2NA 4Q3NA 3L7NA 4F2PA 4TYQA 1Q6YA 4XLTA 5CNJA 5JXWA 3IDQA 5G3ZA 2OBFA 4FMPA 5KYYA 1AQNA 5ULLA 5JSZA 3LK6A 3PTAA 1UBCA 3UOWA 4OOEA 4MR9A 4WTOA 1GV0A 2AEJA 4G8BA 6ABPA 1RDFA 2XGJA 3UHOA 1X1SA 3FCYA 1F2VA 1XP8A 2FWMX 4UXJA 4WXPA 3RKSA 5IYZA 1GAJA 3T9CA 4U9UA 2BIFA 5L7TA 1J25A 1QK3A 4QXRA 4DLPA 3K8QA 4J03A 1L8QA 1NNSA 3V1UA 2QNBA 4ALJA 3HADA 4B43A 5I4CA 1QFYA 2RGAA 2ZWAA 3O83A 5LD2C 2KX7A 3QYJA 5FH9A 4F5WA 1IYZA 4G5XA 2QIPA 2ZVPX 4RSRA 4WFKA 5C5IA 1ZX1A 4MO2A 1U7HA 4AJEA 4DV6B 5HR5A 2Q29A 1NUHA 5IBRA 1ZK3A 2O1SA 2OFFA 3O75A 2G6TA 4G1CA 3GAMA 3OZEA 2KE5A 3QLUA 4CKBA 4BNXA 4XH9B 1UXHA 5L8VA 5KSOA 2P4QA 1Z2DA 1Y6RA 4LY9A 5JH7A 2PAFA 3G2QA 4DLBA 2H1WA 2WHRA 2R1VA 3I1IA 4KWEA 4LI3X 1OU4A 2WJHA 2ZQ5A 4P0TA 4GMFA 4NU8X 3K9HA 3LT0A 5FI0B 1EVZA 2FZVA 1ULSA 3OP4A 4S04A 1K7CA 3KJEA 5I8ZA 4I55B 3E4CA 2PSFA 3P2KA 4PXSA 2F7SA 4JCCA 3E22B 1KIFA 2A88A 3DAGA 4TUYB 2VZ8A 3SS9X 2OFPA 4MS4B 2IEBA 3AR6A 2COUA 3DVQX 3VH4A 4D92A 3O2NA 3AF2A 3KVYA 4CIAA 4L5CA 1KI2A 2JAOA 1RKQA 1ZD8A 1N6IA 4QREA 4Z4FA 2IXDA 1JL3A 2P6UA 4F92B 3SFTA 3FG9A 4O2BA 4ARBA 3KWMA 3WYBA 1IN8A 3UYKA 2O8EA 3JASA 3GPLA 2JGDB 4D43A 3W6OA 1WCYA 2XWQA 2RJ3A 3EUEA 3OLYA 3QY0A 4QEZA 4XIIA 4AJKA 3QY9A 2ODQA 3ENNA 3QKTA 4UE6A 1IXSB 4YRKA 1C3VA 3DPUA 1CT9A 4MVXA 2Q6LA 4YCJA 4OXQA 4ARVA 1RACA 1XNHA 3V3KA 1KY4A 1SG9A 1XGKA 4LZNA 2GZAA 1PVOA 5AJWA 1UKAA 4MV3A 4V39A 5AD1A 3BFJA 2EW1A 5BN4A 3HBJA 1R4MB 3L41A 5CB6A 3FNEA 3UFBA 2G0NA 4WK2B 2VATA 4LY0A 1P1CA 2W42A 1Y5MA 2PH3A 3OCZA 4W6QA 3RAFC 3SQDA 2ZAYA 1H0KA 1KOFA 1KVQA 2WE7A 1L7PA 3GGSA 1X13A 2BFEB 2EFHB 4KU4A 4XIJA 2ZSKA 1B7GO 2G6BA 2R65A 4GSYA 4KE7A 5JXGA 5LVAA 3PTLA 5DX8A 3X43A 5HZKA 1RM0A 1U2DC 2I91A 5ECYA 1SBCA 1EFVB 2FXIA 1MOSA 1NU8A 5DPMA 5KSWB 4DCVA 1XAHA 3MW8A 1E7MA 1DAFA 1NP6A 2ZXEA 3K0FB 1TX4B 1ZFNA 3EGXB 4OH1A 3ILXA 3RIXA 2WHYA 5FWNA 1W4LA 1M3SA 1US8B 4QG3A 1LX7A 5GONB 2RGBA 1NLFA 3EXG2 3HPQA 5MF6A 2G5TA 2ZBVA 1W0CA 2YJGA 3VTFA 2FPRA 1BGXT 1U7XA 4QGFA 1Y3CE 4GOKA 4XWWA 2FGKA 2I80A 4KIJA 3LQ2A 4U7FA 5GP1A 1EB8A 1E61A 2H8KA 3IB3A 4K6OA 4RK7A 2W2QA 2H0RA 4DCOA 3KXIA 4MW5A 1ZG3A 2BSXA 2QWXA 3VU9B 4ZO9A 5JU6A 4HAUA 5MN4A 3KHUA 3E3AA 2A94A 3CLUC 1PU2A 4NBVA 2R6CA 3VSCA 2VDMB 2JAQA 5IVPA 3UXYA 2VZ9A 1Z47A 1TD9A 2HHCA 4ZIRA 3RHTA 3P5BA 5CG2A 2X9GA 3VKFA 2IXTA 4JEMA 4ZVRA 1PL0A 1UK7A 3DB1A 3WBKA 2REBA 2H7VA 2RGUA 4Z5XA 1ZD9A 4TSKA 3V1LA 2B0CA 3JQPA 3F3SA 4AULA 3A1VA 4PVDA 1NFRA 2H1RA 1YCGA 4YP1A 4QT0A 3HZOA 2A0WA 1G5TA 3I28A 5JS8A 3OPXA 1QDUA 2BR5A 4TL6A 3GLKA 3OPQA 3GRKA 1QCYA 5BWCA 1UOPA 1Q50A 1WXQA 2H7CA 2NX2A 2O5RA 2P2YA 2ZAIA 3KAKA 1HR0B 3PJRA 1PT7A 2Q5IA 2VTKA 3KBOA 2JJ2A 3KR9A 4X61A 4OJKA 1T0IA 3ZD6A 1FTWA 3SEFA 3W8EA 4F4UA 3HYNA 4AECA 2FMHA 2VZLA 5DMHA 1DWUA 4W5TA 4G8CA 2PMWB 3V32A 2FLKA 1OOEA 3ORSA 3W05A 1AA6A 5L53A 3HNPA 1O58A 1IE3A 4GE0A 1GV1A 4MR8B 4JJ6A 421PA 4O5OA 4ZMBA 1E66A 4UBMA 3WGGA 1PZHA 2GZHA 2VYNA 1PZNA 1SVWA 2ZANA 3KJNA 3PHLA 4HQNA 2ZCJA 3B3QA 1A71A 1KXZA 4M6WB 5HWSA 2OHFA 4KPUA 3WGZA 1JEYB 2RG7A 2A4MA 3IULA 4DLWA 4A6PA 3DPSA 2HMUA 3GRUA 4LV5B 4YR7A 4HC4A 4QO8A 4I5EA 1Y48E 1VG1A 5FO1A 2F3QA 3RK4A 1QRDA 3QOYA 1CFJA 2R1UA 5CM2Z 4UEKA 2HCFA 2E6UX 3OX2A 3GY0A 2Q3EA 3L7LA 4L9RA 3L9WA 4NZMA 2C9BA 5B4VA 3T7AA 5CDGA 3VPAA 2VYVA 2O5VA 4LOAA 1DJPA 2X5KO 4QYTA 2NVWA 3NM5A 4N5IX 4UOQA 1GTG1 4XDYA 2QRPA 5AJTA 5CLFA 4R1OA 4Z4QA 1DBQA 2BFBB 2FPLA 3JARB 4QM6A 4KE6A 4IIHA 3S44A 4DMFA 3X2EA 2FPUA 1U1DA 4GH5A 5TQ0B 3TR6A 5M29A 2QQ0A 1ICIA 3HKDA 2XCSB 2FEWB 2RCYA 3KT8A 4YP5A 3RUPA 3JQ9A 1ZM3A 1IOVA 5EFOA 3WIEA 5BVGA 2QR3A 3CLHA 1P60A 1QG2A 4Y2TA 2OOKA 4KV7A 1UJBA 1XMXA 4DGSA 3AFNA 5BSGA 3V2HA 1XWFA 3VPGA 2XQKA 2ZWIA 2F3PA 3M49A 2RHDA 5DYIA 2PBRA 3I01A 2P9BA 3C24A 1SAYA 3LLVA 1ZDMA 1YK0A 2Q49A 4YXWA 4ZT3A 5BN5A 2Z8YA 2EHDA 3F96A 3ZGNA 5THXA 2FF7A 2JEYA 2GJAA 2QUAA 4TOIA 5B37A 5CVTA 1ZR2A 1KO1A 5LMZA 4N3GA 1MVLA 2Z9CA 1X1AA 2FMKA 1J5PA 1D2AA 2LPMA 4KQCA 3GEHA 1OX5A 3KQLA 1C3JA 2CXQA 4TXLA 4DAEA 3U4AA 2OBNA 2LGJA 4FDVA 4BLPA 4NV3A 1TO2E 2GLTA 4MLZA 4YJHA 2WABA 5FRDA 3SBDA 1GYRA 3LUPA 3A2MA 1KPGA 4CMBA 3OTOB 1VL2A 4CWAA 3T5BA 1TO6A 4J4TA 1G21B 4MQMA 5EWLA 2HU7A 3D1JA 3QA9A 1VYVA 2HV9A 5HJ7A 2C2OA 2B20A 4L28A 3AP2A 4Q9IA 5DHUA 5BUQA 2HBQA 1E8NA 1U4SA 1YDFA 3DLAA 4WZBA 3I9KA 2VLBA 3ONFA 4R05A 2I1LA 2C61A 2NUTB 5C35A 5KWJA 1INLA 5A9TA 4LJYA 2PEYA 4IOJA 3UAGA 1IM2A 1I4WA 2EC5A 3UHPA 4CG1A 5C52B 3IE1A 1HTBA 3AEKB 2RGRA 4FHGA 1DHTA 1W8DA 1USIA 3UZUA 4TWJA 3GFPA 1NWHA 3CT6A 3THWB 2OC9A 3A6PC 1ATZA 3BL6A 1SQSA 2Q45A 3D5QA 5HF8A 5GADl 2B1JA 1TYCA 5IP5A 3T5PA 2DQ4A 2H2FA 4YUXA 2RIRA 5GWXA 3QOFA 2UYGA 2ZUWA 4LJKA 3PVZA 4WACA 3R3JA 2Q1UA 1GZ5A 2YV2A 4AN1A 4C0JA 2Z9DA 5T6BA 5CXQA 2R5NA 5K0ZA 4Z4EA 2V55B 3U7QA 3GH1A 4EGQA 2V96A 3WL8A 3P0IA 1LZKA 4DARA 3H99A 3BXPA 1NI5A 1L8LA 1PBTA 3SD7A 4JASB 1E7YA 5EERA 3HM9A 1T43A 4OHZA 4BB9A 2IYNA 3W6NA 1MX3A 1YQUA 2WTXA 4QL3A 3STHA 4U2CA 2QN2A 3NASA 4HEQA 4LHVA 4TWZA 4U7GA 4RZ2A 2BEVB 2ZIWB 2GUGA 2CMDA 4Q4JB 1A27A 1GFZA 3C4JA 5EWJA 4N1AA 2JS7A 5F9HA 4B79A 4LTDA 4TZTA 3PTZA 2CDBA 1T4BA 2KYRA 1YBVA 1II8B 3D3KA 1EX7A 4HMQA 1PTJC 3R3YA 1DCFA 4Y8VA 1EWKA 4AP5A 3F7TA 1D2EA 1ND6A 4HDRA 2IYLD 1MTOA 1Y1KE 1Y9EA 2A7XA 3IVGA 4FJ0A 4WLOA 3VHXA 2V1UA 1NQOA 4PLTA 3F90A 4GYKA 3TX6A 1DO0A 3G0BA 1C29B 1QE0A 5CAEB 4ER3A 1OAOA 4HDAA 4MRRA 3IDFA 4GZ5A 3QLEA 4HAYA 5AVQA 1TCUA 2B4KA 3T41A 2BUBA 4YRAA 2WHPB 3CIOA 3S29A 3OT4A 5B58C 4YMVA 1M1XB 1VCHA 4I5DA 4YJDA 4G5RA 4Z9YA 4OXXA 1S5PA 3OMXA 2ISCA 1A5AB 4RIEA 1DIAA 4UAVA 1VPVA 1PT6A 3KE9A 4IY1A 3WKAA 5AXAA 1N2CB 3UK2A 3OEHD 4D0LB 4XQCA 4B3XA 2FEKA 1B4DA 4RD6A 4MRVA 4W99A 4I1UA 1XTUA 2BDTA 2FXVA 2IVZA 1O95D 3AR7A 3C5HA 1BWPA 4QPDA 5AHOA 3TRDA 3LQ4A 3T52A 4AQYB 2F4VB 1FJ2A 1XHEA 1FCJA 4CM7A 3OFNA 2G1KA 2HA5A 4IF4A 5AUNB 4RTLA 1W1IA 5M5BA 3FNIA 3OFJA 2G9VA 1TDJA 3PHCA 1TQHA 3NDBB 2GA9A 3Q0EA 3HRKA 3KEOA 1B41A 3L8CA 5AICA 1BTOA 1CC1S 4FCCA 3TKYA 4ZVUA 4RD4A 3WYAA 3VTKA 1TKCA 3D1LA 4QSHA 1P7VA 1FU8A 3LECA 5FOTA 5I5GA 1YCFA 4EPTA 2JIOA 1XAJA 1D6MA 2GARA 1GCOA 2EOAA 3JZFA 1EDZA 1NHWA 2RCNA 2YX1A 3K8YA 5CBPB 4BQRA 4BCCA 3QW2A 2MDTA 2YXLA 4FI3F 3KQMA 2BV3A 4MWTA 4MWBA 1B6GA 3BTVA 1AOXA 1WY7A 2QG9A 4QBIA 5K3BA 3IP9A 3RK0A 2L19A 1YVPA 4U7TB 2H51A 1QM5A 4C0LA 3GMDA 4BVJA 4U7HA 1TF2A 3C6XA 4PW0A 3G2KA 4V24A 4YCMA 3H7AA 3W3ZB 5EG5A 4WKCA 5GJWC 1B76A 6CHYA 3LTEA 1RSZA 4M1YA 2ZB4A 3PC6A 1T8YA 3V8QA 1A4IA 1QVZA 2HF8A 1OFUA 3JAWB 1XDZA 4X7PA 3G2HA 4GDFA 1P2TA 3EWNA 4KB5A 3UJ3X 1OX4B 1GTVA 4GKBA 2MCFA 1XTVA 1UXKA 3ZHCA 1M2GA 5FLXA 1T5SA 2Y68A 4U5QA 3DDSA 2I2DA 5HKKD 1ZN7A 4UTXA 4LVCA 1CS0B 1NDQA 1MFPA 4X6UA 5IARA 5EMKA 2M6RA 4ZO8A 1G20E 1YZQA 4PZEA 3LX8A 4RULA 1E5XA 1PW5A 4X97A 3G85A 2QM8A 4RLFA 2OM2A 1AE1A 1YMUA 4TYNA 1IK6A 3ANSA 1JEQA 3K9LA 4PPFA 2FB9A 4RC9A 4QLAA 1DV2A 4LXYA 4Q05A 5DASA 5DISB 5FUVA 3WMGA 2DBYA 4AF6A 1P33A 4GXQA 5KB3A 3TFOA 2Q2NA 2O4UX 1H65A 5JC1A 2P5YA 4WASA 5J2TA 3FHOA 3G0CA 4LZPA 3ZR4B 5F98A 2GBIA 5L3QA 5H70A 1IXKA 1YA4A 3GJQA 4J4HA 2XXBA 4G89A 2ZBPA 2PXCA 3RVSA 2BKXA 1NVGA 1PJRA 2QRLA 2WT4A 1UT5A 3KQPA 1J4AA 3R9KA 4RBNA 3EA0A 1SB8A 3AUSA 3SX2A 2GK6A 4D8UA 4DR4B 2PBFA 1G7RA 2FY8A 5B1EA 2E82A 4JDPA 1S7GA 2ZI7A 1KOLA 2AJLI 4KR0A 2I3DA 3K0KA 2X4DA 3CFYA 3K1JA 4IV0A 5E6RA 2XZLA 4YREA 1RWNA 2JL1A 1MNAA 3T3PB 3IOCA 3TLBA 2GZRA 2J4DA 2ACVA 5T5QA 4ZCTA 2IH5A 3NT5A 3RT9A 1X8XA 5EJ6A 1ACMA 3IDAA 2VPZA 3CUKA 1J23A 3D8SA 3ONEA 4DN6A 3INYA 1PJSA 4LF9B 1W36D 1Z07A 2H54A 5L3SA 4BN5A 1CG6A 2EWVA 3T3GA 3JQAA 1G41A 4RPGA 2BD0A 1W76A 3WKDA 1L7EA 1SY7A 2CFCA 4XGRA 1V3UA 3N0WA 4OMDA 4TMKA 2X76A 3BMOA 1DMSA 2GLUA 3EC7A 1X80B 4HNRA 4U2KA 3RRYA 1PNVA 2QT9A 2YOHA 3D2LA 3G5TA 4FPXA 4HSGA 3GIWA 1E2UA 5CURA 2XOXA 3PSAA 3X1MA 5A7GA 5F5NA 2QN3A 3HV0A 1ZGGA 1HL3A 4OX9Y 9ABPA 1L4YA 1MPXA 3H5WA 4Q9LA 1RPTA 4G01B 3UMRA 1SG6A 3NBXX 2XT6A 2VPWA 1VBNA 3EIFA 1PJ3A 1DNPA 1WXIA 3GHYA 4JUDX 5EP3A 3ZWPA 5EJIA 1J70A 4L9SA 1Q17A 4TMVA 1QK5A 3D2CA 1NBIA 3HCEA 3NBZC 4D74A 4V1CA 1JG4A 1Y3DE 4KO2S 4Q4AA 4C30A 3IQZA 2OLEA 4D3ZA 5KX5F 3C6MA 3G68A 4NBSA 5LQUA 1CX9B 1JGTA 4MUBA 5FT9A 5J2UA 2PPLA 1P7PA 4HXFB 2WQZA 3GVCA 4CKWA 2P4EA 3UMMA 4IYJA 2P8SA 2W98A 3T9AA 3C3JA 3FPCA 4H17A 4J4BA 5DX0A 5LOVA 4NFYA 3I37X 3CLVA 3ZJ5A 1PT5A 2C7BA 2GYVA 2K87A 3E5HA 3ZU4A 3V4OA 1XZMA 2GDJA 2ODNA 1EHYA 1UPTA 3UJPA 1J0BA 3EXHA 4FGJA 4HXGA 1DRKA 4EDHA 4HMPA 1C7RA 1IZZA 1GXSA 4UU7A 4YRSA 2A0UA 1WZEA 2ZDHA 1I3MA 1CB7A 1GG9A 1SIOA 4ZOLB 4GLJA 1PSZA 5EE0A 4ARAA 2I2BA 1QJCA 4IHAA 1H1LA 2EWWA 4P8RA 5KVAA 3G49A 3L0YA 4RA9B 3LXRA 2OOSA 1H6CA 3DVAB 3V8RA 1ZUNB 3MS2A 1SD2A 3UBMA 2ZYDA 5C5DA 2IU0A 1NVBA 4M89A 4AZ0B 4UBKA 1WBBA 3AOEA 4KQIA 2AW3A 3GK3A 4ZA2A 3LYAA 2XB9A 2C5AA 3PJEA 4PNZA 2B4RO 2IYTA 1R15A 2PR2A 3P32A 4O0LA 3WGYA 2VDUE 4EYGA 2V7QD 3DNFA 2AH5A 2QUZA 3LF1A 2QX6A 3GWZA 3T95A 4B3SB 1U81A 2ZXFA 3KXPA 5KMGA 1X1TA 4JR2A 2VYQA 5G02A 1T5HX 3JVUA 1XTTA 5I7SA 3ZIAA 1LPSA 3WRWA 2RONA 2YKGA 1HTWA 4M0LA 1VJCA 1MO3A 1E1LA 1ETUA 2ZITA 4UHEA 1OYOA 4PPYA 3NH9A 5AI9A 5A0TA 3WTCA 4I55F 2ZR8A 3DO5A 4BO3A 1KFEB 2V65A 3VBEA 2REQB 2NP7A 2ZBEA 2I87A 4DV0B 2YHAA 3I9OA 1ZJ4A 2FEPA 2XTAA 1NNI1 4A26A 4CLDA 1QWSA 4J7UA 1O94C 4Z1MA 5BT9A 3GFVA 4FKMA 3OO1A 1U04A 2GSDA 5KVCA 3RG2A 3OFVA 4X8LA 2IYEA 3DMNA 2G4VA 3KUXA 2FQWA 2XE6A 3TAHA 1N1DA 4FYVA 2FMTA 2J5QA 4CU2A 5JJBA 1N8SA 5FOWA 5J4VA 4NE2A 1WV1A 1QIIA 4G85A 4PZCA 1DJOA 3B9PA 3QJ5A 1IAQA 1S02A 3V4VB 4Y2RA 1CQPA 6AT1A 2H52A 4DCGA 2HBZA 5AK4A 3SC3A 1LRKA 1RAHA 2M2IA 3E7XA 2OV4A 2QN1A 3HDHA 4RESA 3THYA 1P1FA 3L8EA 2VDNB 2ZRJA 5MFZA 1EB9A 4W5HA 3DHEA 3FFAA 4OHWA 4HTAA 2FFRA 3KB1A 5IH3A 1H2RS 2HCTA 2G7MC 3IAUA 2Z58A 2O3JA 2W6JD 1VLZA 3L1KA 3PDJA 1XEXA 1EGAA 4D1YA 5IUJC 3NZEA 1VA4A 3AXTA 3NAQA 3P4UA 4AUEA 1PGPA 1U0BB 4FE7A 3FSGD 2QTNA 4IXTA 3NFYA 2EFJA 4A8JB 4L5YA 4B7UA 3X2FA 1SOVA 3I64A 2X13A 2WC1A 4LYYA 4PXYA 5DYWA 1IEXA 2XXJA 1V9CA 1X7ZB 3BFPA 2R7AA 3B3FA 3OWHA 2P2DA 2QAGA 3G9XA 4LHWA 3SKVA 3OIGA 1J9GA 3QG1A 2BISA 3PRKE 2C9ZA 5DTQA 1I7DA 5HIIA 1P0CA 4CQMB 5JNTA 4DCCA 3ACBA 5KSYA 3QYPA 1JIXA 4YAUA 5DM1A 4A8TA 1JYFA 1VIYA 2RHRA 3CF0A 2DQYA 3PNPA 5TGTA 4O4JF 1O6FA 3AJ8A 3RC2A 1B8NA 1ONSA 5CYGA 3V34A 4HO1X 1XMPA 1QHHB 2BGJA 4LYFA 4X6YA 5FAXA 2CNKA 2V7VA 2QYHA 3M6UA 1NR7A 1QIEA 3FVVA 1UZNA 1G63A 2PT6A 2ZSHA 4MVJD 3ZTTA 2V3CC 1XE3A 4LDQA 2NZVG 1EVYA 2QP3A 5CT6A 1WWKA 4MVWA 5DNWA 4E70A 2OB2A 4LYJA 3WGHA 4NVRA 1CVIA 1L5HA 2AW5A 2WU0A 4LGVA 4OHOA 5E1DA 2RHBA 4JWKA 4ZV9A 1XC7A 3T5CA 3WJAA 2PFSA 4CF6A 5JS6A 5E6SB 2W4MA 4IJ5A 4DSUA 2XGGA 4QUEA 5CNIA 1K2WA 3KKLA 1EFPB 5F77A 4PYNA 5DHAA 5KJ6A 1YRHA 5I7VA 4EHAA 4PBSA 5IJ9A 1PQYA 4YFVA 1H2WA 1E7QA 1U94A 4LX0A 5D2CA 2O54A 4L9WA 2Z1MA 3UGQA 3HFRA 4OV6B 3ZE9A 5AVWA 2I54A 1QP8A 2WWIA 1O1YA 3NBUA 4WMLA 4XSVA 1ZJ5A 3BRCA 1LPBB 4C14A 1N3IA 1AKYA 2I7DA 2W6NA 4GLBA 4HS4A 2H00A 3L2OB 4FOTA 4LNUB 2C1XA 3L18A 4WXYB 5T3UA 4NZOA 1E2DA 1XZLA 1NYLA 1BE8A 2HRBA 4QICA 4IQ4A 4D5EA 721PA 2UZ3A 3IURA 4JR1A 2DLCX 4N3BA 1E2HA 1C81A 4IIBA 1TQ6A 2PZMA 4HR7A 3E53A 1CIPA 5IVIA 4EKDA 5A4KA 1BXRB 1E60A 3JQ7B 3PGKA 4YJGA 1ZEMA 2OXRA 2G0AA 4MUNA 3OF5A 1W0KA 2XQFA 3U13A 5CFNA 3SGLA 4Y2YA 4OHXA 4D9FA 2V7GA 4AKTA 2D1YA 5IVDA 4EFNA 1NX6A 2ZTUA 2D8MA 3GHHA 3MWEA 1NVMB 4G65A 4EW6A 2YYZA 1R4AA 2IUFA 1FDSA 2XWJI 3JYQA 5BSHA 4GE3A 5HOQA 4CMEC 3C2QA 1XJWA 3MOSA 3NM4A 4UM9B 7MHTA 1NQWA 1ADGA 5GMOA 1RC1A 2X41A 5B5SA 1GZ3A 1PG0A 3EVFA 4PC1A 1PZXA 3WC4A 3UT6A 4R0VA 3WOVA 3KZXA 1HBJA 3QE4A 5ALZA 1YFKA 2AK2A 2ZUDA 5KEIA 2XXAA 2C5EA 3U9LA 4Q3LA 4DG8A 2YQZA 1N2HA 4X84A 5E1MA 4EMTA 2XB2A 1E7SA 2ALJA 5T4HA 3EFOA 2RI6A 2LDBA 5JFOA 5ITVA 2NTEA 1L5FA 2BKLA 2Z4RA 3R0QA 4YJKA 2B4TO 4M0KA 5EKTA 3SZGA 1V1JA 4EHJA 4I8IA 3GRPA 4O4LF 1T36A 4WVLA 1NBMD 5CIQA 4B5LA 1XXHB 2LE0A 1PSWA 1L9KA 4CM4A 3DV0B 1JMKC 4I7EA 4QHTA 1V5WA 3RC8A 1B0UA 2FW6A 2QRZA 3DEZA 4BN4A 1G3MA 4MCJA 2W8BA 1DKPA 1FFSA 1GLVA 1WUKS 3PUWA 3CCBA 5BVHA 2ZM6B 3S8MA 3GQVA 5ISMA 3HCFA 1KHTA 3NT2A 4Y9RA 2HHAA 3LPLA 4TWAA 5LBTA 2D5BA 3T12A 2BFNA 1VGVA 4LOKA 5AW2A 2X0JA 4AIIA 4JT2A 4LF8B 1BVYF 1X1RA 3VR1A 1FX0B 1U3FA 4HCJA 1U4NA 4R8SA 3FCAA 3VH2A 4FYKA 4RV9A 5ES4B 5TF4A 5KWEA 3ZE2B 5FUWA 4E2WA 4PU0A 5HF6A 1AT1A 2HEGA 3GRAA 3MTJA 2EATA 1FTSA 3BIOA 3V55A 2ZE6A 5L4NA 1NG9A 1W1WA 4DRXA 3FUUA 4E31A 1IUNA 2HA2A 4JXJA 1TTTA 2PZ8A 2O7QA 2Y0DA 4I36A 2ZJAA 5GPBA 1Q44A 1SG0A 4LE2A 2YXDA 3W3AD 3GOQA 4FJ2A 1EQAA 1X14A 5EEHA 1O54A 3BL8A 4QJ4A 2VFAA