1HE8B

Ras g12v - pi 3-kinase gamma complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT, GAMMA ISOFO
publication title Crystal Structure and Functional Analysis of Ras Binding to its Effector Phosphoinositide 3-Kinase Gamma
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase/hydrolase
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he8B00
2W58A 3CRQA 5FUYA 2HLDD 2WJYA 2AFHE 4IDOA 3KL4A 1E2MA 1K6MA 2V54A 3K0EA 2UKDA 4PC6A 2AL7A 3QPUA 1OYWA 4H1UA 2YINC 4NYMR 5GJBA 1G16A 1F48A 2GNOA 3QBVA 2W6JA 2HT1A 1E2IA 4CEIA 4IRUB 4A8JB 3MD0A 1G4AE 1VPLA 1ZD9A 2E9SA 4RKEA 2GZAA 3IIJA 3U7HB 4DXAA 3HYTA 2K5UA 3CRRA 2D7DA 1DO2A 2QM8A 2RCNA 1ZYUA 3CO5A 3LDAA 3NBFA 2FF7A 2V55B 2XZLA 4N3NA 2G1JA 2HXYA 1TNDA 3KKPA 2XB2A 1O87A 2BBSA 4EFLA 1JQLB 1SKYB 2PMKA 3AF1A 3VX3A 4MDEA 4KHZA 1T91A 3KXLA 2F55A 2JLSA 1ZRHA 2JLRA 2YOGA 2CHGA 4HLUC 4Q03A 4UNQA 1AA9A 5FI0B 5CYOA 821PA 4DDVA 2VLIA 1RRPA 4M2LA 5JWRA 2R8RA 1UPTA 2A7QA 2G6BA 2GJ8A 4YMWA 3PQCA 1CJTC 1W2HA 3PIRA 1XTKA 3Q9LA 3QI2A 2GTPA 1GRQA 4RCZA 2F1IA 2GXSA 4ZDJA 1NF3A 2DPXA 4W5WA 4QNMA 1OIVA 4JLAA 1IM2A 2BMJA 3B8HA 4JKIA 3H84A 4HB3A 1OXVA 1P5ZB 1ZIOA 2JJ1A 4ACAA 2ODBA 4FMCF 1GAJA 2ZR0A 4TSFA 1W44A 3OFND 2WKQA 2JIZA 5IHPA 1UM8A 5FBQB 2V7QD 1NG9A 1Z22A 5JFGA 2VL7A 4TT3D 2D2FA 4KAXA 1CRPA 1G5RA 1TPZA 1NI3A 2BBOA 1A5TA 3B78A 3SU8A 4OQLA 3EA0A 1L4YA 3DPUA 4GOJA 4BLOA 1DG1G 3QJYA 1S3SA 2QUZA 2QRNA 5DGXA 4EPVA 1VG1A 3VNUA 1XB2A 3NH9A 5JWHA 3LFUA 1KI4A 3V4FA 2FH5B 5C1BA 4DLSA 1W36C 4AKGA 4A9AA 4BFVA 3QF4B 3QXHA 5CYPA 4YDSA 5FUVA 3BAFA 4YMTA 4YMUA 1GILA 3GCGA 4ARZB 4JLKA 5DN6A 4QM6A 3R20A 4DCSA 3QEJA 2P6UA 4B6EA 2BMFA 4JLVA 2RHDA 3B9QA 3M1IA 3S1AA 3M0EA 4G5SA 5DI3B 1DELA 2BMEA 3JZAA 4Z1MA 1E98A 1CP2A 1JJVA 1R8SA 2EYUA 1S1CA 5TXGA 1KO7A 1JR3D 1XJCA 5FTNA 5EXPA 3FMPB 2Z83A 2OHFA 1A2KC 3V9PA 5BXQC 1E1QD 2FU5C 1R2QA 2VH5R 2ZRBA 2EWVA 1F3OA 1GWNA 2J7PA 1WBDA 4WZAE 5A4JA 4XJXA 4KVAA 1XF9A 2IYLD 2XNDD 3NBXX 3P27A 2ZRHA 1AIPA 3DZ8A 3PG5A 4G01B 4KSBA 1RE0A 1JB1A 1BOFA 3D6TB 3SNHA 5LDDC 2IYYA 4KU4A 3B7GA 3BS4A 1G64A 1GL7A 1XEXB 3LVQE 5FBWB 5H8WA 2OCYC 2DFKB 3CRW1 3TRFA 1G4UR 1LS1A 1MOZA 1NKTA 2PEYA 3QKSB 4PSAA 3LH5A 2A78A 3A1TA 1ZNZA 4TMTA 5JLJA 1KYIA 3IIKA 3Q7QA 2GCOA 4OQNA 4KCGA 2R6DA 5CLLA 4JLMA 2OBMA 3RHFA 5LD2B 5FOXA 5SZHB 3CH4B 1E2QA 4IVQA 1K5DA 4Q21A 2YWGA 4Q7KA 3VQTA 4UXJA 1KZ7B 3K0AB 2NO0A 3QSYA 2JCSA 1HE1C 4D4MA 2IS1A 3X1YA 2G0NA 2XJ4A 4OK6A 4BFWA 1CULC 2WVJA 3BFVA 1G3UA 2CJWB 2WSSA 1PLJA 2EYQA 521PA 1N6NA 4MRPA 3GFOA 3SJCA 2IXGA 2V1UA 4XD7A 3BWDD 3SHWA 3THWB 1MO4A 3VR5A 2O0KA 3EX7C 3GLFE 2FDCA 1N6KA 1SXJA 1I4TD 2HT6A 1UFQA 4URVR 1P6XA 2IXEA 1BYIA 3PUVA 4C0HA 1NLZA 2J0UA 1OB5A 5DIFA 1GIAA 3LO5A 3MMPA 4GOXA 2VPPA 2NZJA 2YOHA 3OEHD 1VYVA 3SQWA 1OV4A 3BJIC 1E2HA 4DEXA 1E9SA 3WNBA 1Z0IA 1W36D 5D3QA 4Q1EA 4HAVA 3TH5A 3U3JA 4CEJA 3KDSE 3WYGA 4DLZA 2O8FA 4JL5A 5BYJA 1VMAA 4FMCB 2J59A 1ELOA 3O8BA 1PV4A 1OFTA 2QN6A 3KTAA 2W83A 3LLUA 1QG2A 1SXJE 2A3RA 2D3WA 1OYYA 3UPUA 4M9XA 1R8QA 2GZDA 1I2DA 3GP8A 3ASZA 4PSVA 3QXJA 3I72A 3LBIA 1SVLA 2ZR9A 2AX4A 5E7IA 1EGAA 2ZVQX 2MSDB 4C30A 2O8CA 2O8BB 2EQBA 3T15A 2ORWA 1G8YA 1HEIA 2CMKA 4HB2A 1DTSA 3RDPA 3PUWA 4AY2A 1I4LD 1SHZA 3SBDA 1KJZA 4A2WA 3BRWD 4EQ6A 2JATA 3ZJYA 2DY1A 3LWNA 2UVQA 4OHWA 1KHTA 4N0DA 4ZCMA 4U5XA 1N2CE 1CJVC 4QBIA 5KU1A 5JS8A 2VP9A 4D4LA 3VR4A 1S4QA 3FGNA 2G88A 1FW6A 1X8LA 1G1MA 5KDLA 4M1SA 1CS4C 1W0KA 3GJ4A 4BLSA 4MYCA 3RRYA 3KXKA 2ZUCA 1QHYA 3K0FB 3W6NA 1E1RD 1WDTA 4JLBA 2RGCA 3T35A 5E95A 4OBEA 2F43B 2BCGY 1S9DA 3QOFA 4FWTA 1GUAA 2FN4A 3K0CA 1JBKA 2CNWA 2AKYA 3R9IA 2PJRA 2CL6X 4OQMA 3VX4A 2G1KA 1XD9A 4YMVA 3ZH9B 1EX6A 2BC9A 1M7GA 2GXQA 1EXMA 1FQKA 2QMEA 5AJVB 4OQFA 1E9RA 2QRZA 3HU3A 4LJ4A 3FDIA 4BPBA 3EW9A 1LNZA 2CCJA 4OHZA 4DLYA 2GEDA 3AF2A 3FKQA 2GK7A 4TSFD 1AGPA 5GJWC 2B92A 2JIZD 1F5NA 3ZDQA 3ZVRA 4KYIB 2H92A 2D4HA 4LPKA 1T8TA 4C9BA 2XXAA 2GRJA 2H57A 2J0QA 4NYIQ 1VCIA 4PFSA 1W4RA 1EFRA 2FGJA 4PZZA 3EZ9A 1TEXA 5L3RA 3A58B 2ZXUA 2OUKA 1YZUA 2AR7A 4LYHA 3FMOB 2ZM5A 3ND8A 4HLQB 3VR3A 4QBGB 2YKGA 4UJ5A 4RY2A 4IEIA 1RJ9A 1IBRA 2CLSA 2CVFA 1LFDB 3BGWA 3DEFA 1X3SA 1XXHB 3G82C 3LNCA 1OHHD 1D8TA 2ZETA 4D6PA 1TU4A 1S96A 1U98A 2ZRJA 2WAXA 1W46A 2F6RA 3W8RA 2W6IA 2AKAB 4OKSA 1VCOA 2P5TB 2EFDB 4KFUA 5DN6D 4R9UC 3U44A 1OIXA 2JLXA 1KAGA 3GLIB 1QHGA 1Z47A 1ONBA 4DB2A 2JLQA 1T4GA 1CR2A 4IW3B 1E2PA 1U0HC 2FGKA 4E09A 2GK6A 5C46F 4PPGA 1J2JA 2WJGA 4D0NA 3UIEA 4NZYA 4BQSA 4LHVA 4EDHA 2QSZA 2FSHA 2JJ2A 4RCYA 4ERNA 2DFLA 3THXB 3GJXC 4OI1A 3LLMA 4GSYA 3BERA 4M0LA 3V4RA 1X6VA 3QEOA 4UNPA 2CK3D 4XVQA 4LJ5A 2XSZD 2QP4A 1CF4A 2QAGA 1SKYE 5LBIA 2GVZC 1CJMA 1WE2A 4KV9A 4EJSC 3QG1A 3HYRA 2OSBA 1JALA 2YC4C 3RLFA 2ODNA 2JLVA 4D0GA 3PENA 1GG2A 4RZXA 2QQEA 4V0ME 5DHAA 4H1VA 4TMXA 4K81B 1FX0B 2IYQA 3ADDA 2EWWA 2GJAA 5J5CA 3DO6A 1EFTA 3Q5EA 3KZ1E 2AHOA 4ZIRB 1J7KA 2CHVA 3ZIAD 4NPHA 1TQDA 4B47A 4NONA 4DRZA 2HF9A 1N6PA 5C4MA 2PLRA 4CIDA 4MYTA 4LI0A 4TLDA 1DO0A 3R9WA 3CONA 2CLCX 4TTQA 4DHEA 4A2QA 4D26A 3RYTC 3AP2A 4HAWA 3SDZA 2XNSA 4US2R 3PEYA 5KNDA 3LX5A 4I99A 1ZM2A 3FMIA 4BE7B 2C8VA 2ZJYA 4K46A 2WWGA 4V0NA 1G18A 2IYTA 2JLYA 2Z4SA 4Y0VA 5KTYA 1D2NA 3LV8A 4B35A 1G3MA 3KJIA 3MAAC 3MCAA 4MRRA 2QPOA 4OI2A 3I8SA 4DWJA 3QBTA 5BQ5A 2A30A 5JCZA 2JA1A 3EC2A 2ZRCA 2HLDA 1T3SA 4JLNA 1KI7A 4TQAA 2QM7A 1JXMA 2D7CA 3CX8A 1E2DA 1LVGA 2R2AA 2NQ2C 1Z0JA 4A8JC 5AJXA 1KO8A 2RGXA 4B2IA 4OHYA 1N5JA 2EFHB 2H8KA 3KFXA 4HAZA 5L8VA 1DEKA 3M6AA 1E4VA 1NVXQ 3QUSA 3WMFA 4TYWA 2ZE6A 4GPTA 4MUBA 1DPFA 4OHVA 4BFSA 5K8IA 3SJZA 4IOLA 4PO1A 3IO3A 3DMDA 4DT1B 4V0KA 4UNSA 1OH8A 3QKSA 1G5PA 2DR3A 3QY0A 1XEWY 5JS7A 1P60A 1Z3IX 5P21A 1NN1A 5DISB 1E2FA 3GFTA 1LV7A 2ZR7A 4L15A 1AM4D 3NBYC 1W4CA 1N6RA 1G8HA 1U9IC 2R6CA 1J8MF 3WRXC 1QHXA 3W9YA 4A6XA 3NDPA 4DVGA 4V03A 5F98A 4YLGA 1A4RA 3I3SR 4QGFA 4CEHB 2ZITA 4ZDIA 3DM5A 1IN4A 4IHQA 3KQKA 1RZ3A 2IYRA 1XEFA 2FJUA 3WYFA 2GAOA 1RFLA 3C7KA 4JMPA 4NE2A 2YC2C 2PCLA 4M8NE 2A5JA 1G3QA 2PCJA 2VSXA 3EIQA 3U7EB 2O52A 1AQYA 1G41A 4EPYA 3K70B 1VDZA 4W7SA 1L4UA 1XX6A 1Z6XA 1S1MA 4CDGA 4OI0A 1S8FA 4RFSB 3IQWA 2ZSBA 3CF2A 4EFMA 3P20A 4DBLC 1W5SA 5SZJA 3OFNA 3CF6R 2V7QA 4J0QA 4I1UA 2IC5A 2ORVA 2Q3HA 4JVSB 3Q3JB 3L8YA 3AKDA 1NJGA 5B57C 5LB4A 3DL0A 2H5EA 3ZS8A 4P3YA 3QE0A 5EP2A 2BV3A 1E0SA 1KI3A 4TL7A 1NNEA 1SHKA 4BZXA 3KB2A 3FHTA 1OXXK 1Q1QA 2IHYA 2ZU0C 5EP3A 3WRYC 2KB0A 2ZSEA 2ZRGA 1FTNA 1SZPA 1ZCBA 4NKRA 4B43A 3CIOA 1EFRD 2XAUA 5E4FA 1ZC4A 4LBWA 1TU3A 1DG3A 3EXAA 3BD9A 1YZGA 2P67A 4TTPA 2JAQA 4IDHA 4DJTA 2GF9A 2ZRPA 1UAAA 4HSEA 1QHNA 4B3CA 2ODEA 1IN7A 3UKDA 1W4AA 5DYIA 1I4DD 3MWKA 4P0TA 4LV8B 4NYIR 4PZYA 2HYIC 2IT1A 4JBXA 3GJ3A 5DI9A 1M6NA 1RRGA 3TLXA 3BH7A 4CW7A 1XEWX 4JL6A 1Z06A 3AEZA 2XZOA 1GSIA 4QC2A 1FNNA 2X2FA 1KI9A 1E1QA 1ZM3A 3UXMA 5A5GA 1H8ED 2XOKD 3GQBA 5HPYB 1MABB 1KI8A 4Q9HA 1RKBA 4B74A 4RZ2A 5JEEA 4AURA 3PEWA 3IUYA 2ZUBA 2XNDA 1GKYA 1HT2E 4PHFA 4LSGA 4HUTA 1D2EA 1MRSA 1WXQA 1DAGA 1DS6A 3FB4A 3WNCA 4AYWA 3U61B 2GILA 5LD2C 1LY1A 4LK2A 1E9AA 4IFBA 4XVRA 4D81A 1CIPA 1R5BA 3KQNA 1WBBA 3AB3A 3PFIA 3MWJA 1M1YE 1EFUA 3K1JA 3B1VA 5EE0A 3BOSA 4TWZA 5BN4A 2IYSA 1LW7A 1Z0FA 3UMSA 4POAA 4ZDKA 3EARA 1XRJA 4KVGA 1MRNA 4A0RA 1Z63A 2F7SA 3H1TA 4OHXA 4NHOA 5B64A 5EP4A 1IAQA 4UJ3A 4QJ5A 1Z08A 3SQXA 1I2MA 4OI4A 2HEIA 1XD2B 4HDQB 2BBTA 1M34E 1VECA 4R2HA 1G7TA 1P9NA 4A1FA 3P1JA 1XWIA 1SVSA 4M1WA 1KJWA 3FKSD 4Q9IA 1YR6A 1WF3A 4Q4HB 1P72A 4QFMA 1WP9A 4F7WA 3O8RA 3KKNA 2ERXA 2QPTA 4QGAA 4URYR 1ZUIA 5CK4A 4DLTA 1XXHA 1A2BA 3RC3A 2O8EA 2IS6A 2GBLA 4KBFA 2Q9BA 5FR2A 5DSZA 1RRCA 4QHSA 3D31A 4BZQA 4II7A 1CJUC 3THYA 1NRJB 1RC8A 2EFGA 4RZ3A 4UQOA 1QHHA 3DMNA 4GFDA 2P6NA 3W5JA 5KNCA 5IRCD 2OEPA 1V43A 3N5CA 4BGDA 2JGNA 3A8TA 1KO5A 1NVVQ 4QM7A 4LUCA 1ETUA 3KB1A 3AVQA 1ANKA 5J4VA 3I61A 2REXB 1FL9A 1FMJA 2ZVPX 1W47A 1XXHE 1G20E 3ZYCA 4AC9A 3SEAA 1KKMA 5L3QA 3QXCA 4A0FA 5KSPA 1CU1A 2J0SA 1YZKA 2OXRA 3ZQ6A 2R65A 3UANA 4AG5A 1R5NA 1E9FA 2GJ9A 3L0PA 2YOFA 1AS3A 2NOAA 2P3SA 3ZZTA 5JRJA 2CE7A 5FL3A 2CCGA 2WJIA 1QVRA 4NBSA 3N2EA 5D3MB 2O5VA 4DCUA 3TQCA 2Y8EA 4QHYA 4Z8XA 1TQ6A 3LW7A 4FMDF 2VTKA 4MDFA 3VR1A 5CJPA 1OT3A 2ERYA 4PPQA 2RGEA 3OE7D 1TADA 5B2ZA 4MKFA 5TV2A 1P2SA 5J4KA 1T5IA 4JT4A 1N6LA 4URUR 5BWMA 3TUZC 1II8B 1E1RA 5HTKA 3LA6A 2ZSAA 5DE3A 3HPQA 4B3BA 1D6JA 3NEJA 5K8TA 1F6BA 2PX3A 3M4YA 3KQLA 5CDFA 1RPZA 3IEVA 1GL6A 2X19A 3Q5DA 1D2MA 5HE8A 4B75A 4B71A 3W34A 3CH5A 4MGKR 3SJAA 2X2EA 5CJ2A 2VIIA 4OYHA 1IJEA 1CKEA 2Z0MA 1YZQA 5AJYA 3PITA 5FOVA 1PUIA 1SULA 5JECA 1CJKC 3KJGA 1E94E 1FP6A 1F2TA 3P4XA 3LXRA 3TW8B 4EIWA 2QMUA 2VHCA 1UBEA 1DAMA 2QT0A 4C2TA 1KK3A 1M7BA 4ACBA 2C03A 1OSNA 2DB3A 5FBVB 2XX3A 1J70A 2FZ4A 4BFZA 2ZUDA 2KJQA 1G8GA 1ZINA 4D80A 1G5TA 4EFNA 5CDFE 3TGPA 3THOA 3AVOA 1JEEA 2AFIE 3C8UA 2GBLC 1YR9A 1N0UA 1FQJA 1NMZA 2IK8A 2PH1A 5JRZA 2IYXA 3IKJA 2IF0A 2BIFA 2YJTD 4PSKA 3REFA 1YKSA 2QZ4A 1OHHA 4HLDA 2JEOA 4WW0A 2ECKA 2GA8A 4DT1A 3QVUA 3IHWA 2C95A 4QHTA 3H0KA 3VKGA 3I5YA 2J1LA 5KUTA 2JASA 3LD9A 5EQTA 5IDVA 1FUKA 3SR0A 3P26A 3ICQB 1CR1A 1Z0DA 2IS2A 3NXSA 4M1TA 4ITRC 1W4BA 3RRMA 3DOEA 4LHXA 1XPRA 4L4UA 4JS0A 4LGMA 1U0JA 2QI9C 4KFTA 3WMGA 3BK7A 4AKIA 1X1SA 4LJYA 4B32A 1KAOA 2ZPTX 2ZI9A 4HEJA 5C18A 5EUMA 5L3SA 1TTTA 1VG0B 1D9ZA 4O2RA 1PVOA 1O3YA 5B58C 4MRVA 3U4QA 2ZSDA 2IWRA 2WV9A 1UKVY 2CK3A 4C4PA 2J7KA 2FPKA 2XSZA 4BWYA 1OH7A 3EPHA 2QNRA 4MGZR 3AP1A 3CW2A 1NY5A 1VCNA 4XOIA 621PA 1S2MA 2QG6A 2P2LA 4GBMA 2FOLA 4LPSA 2NG1A 2ATVA 2A2ZA 3NBZC 1ZCAA 4URXR 3QXSA 4PHHA 2R62A 1OH5A 2J9RA 4F91B 1EX7A 1PJRA 4C2UA 1ESMA 1IN6A 1VTKA 2AD1A 4KSCA 1FNMA 1Z28A 2ZS8A 4Q01A 2QBYB 3GLFA 5EP1A 3ZIAA 4PAMA 1NJFA 3KJHA 2WIBA 4B73A 2JLZA 5EXTA 4FMDB 4C0JA 5ANRB 4M1YA 3HPRA 2R9VA 3K53A 1Z5ZA 4U02A 5FL7D 3IO5A 1DAKA 2ZS7A 4KFRA 4LX0A 4TMKA 2A5YB 5AJWA 2DFNA 4US0R 1N5IA 4CZ2A 1OXUA 2C04A 4DSUA 4LV6A 3UMFA 3AVVA 3HDTA 1XCMA 1J90A 1OE0A 4UXIA 5KPDA 5JBQA 4B3FX 1Q57A 4Q5IA 3T1OA 1JXOA 3H4MA 2QMOA 1MR3F 4XH9B 3GEEA 2XB4A 3G5UA 4IOMA 1UADA 4QL3A 4KI0A 5M04A 3T06B 3K0SA 1IN5A 1KK0A 5EE9A 3AF4A 1T0HB 3EG5A 4V02A 4LDJA 3TMKA 2CEAA 2MMGA 2WWXA 1ZBDA 1S3GA 2ZSFA 3B1XA 1X8KA 4X8LA 3C14C 2BWJA 4DLVA 4Q4LA 2BEJA 1OXSC 4PC2A 4A92A 5FOSA 4G3XA 5AUQA 2VYFA 3SOPA 4NCIA 3AV0B 1EFHA 4EPWA 5C4GB 4MH0R 4TL6A 1VHTA 4JYCA 2RMKA 3EZ2A 1UDWA 2VP6A 2IW3A 4I1SA 4PHTA 4TQUS 1NVVR 3BC1A 2YWFA 3N2IA 3IILA 4M1KA 4JYBA 4UNNA 3TUJC 3NH6A 3TVTA 3CNOA 5FTKA 3GLHA 3CPEA 3VNVA 1AN0A 2I1QA 3QQ5A 3TK1A 3IPXA 4A36A 5EJEA 1P2VA 4LYFA 4O25A 2GDJA 3FE2A 1P9WA 4ABYA 4HUQB 1KI6A 2PBRA 3LVRE 4US1R 3SYNA 2LCFA 4EJSA 2ASEA 1G6HA 1KI1A 3IBYA 3ICEA 3K70C 1YR7A 2V8OA 1CR4A 1IXSB 2QEQA 4R2IA 1E9BA 4Q4AB 1OFIA 3GLHE 4A0HA 3PV0A 1ZP6A 3TR0A 5JHHB 4M53A 3ZD7A 2ZAOA 1KOFA 4MYHA 3T61A 1SVWA 3AVWA 1CRQA 4Q1DA 4Q4JB 1U8AA 4DSOA 3JZMA 3VU9A 4TL9A 3PJRA 1E2JA 2UZ3A 4GMDA 4P4TA 1JQJC 4P4UA 4JIMA 3CB4A 5HKKA 2D62A 2OV2A 4LWZA 2G77B 5FOTA 4C7OB 4WA7A 5JWOA 3CX7A 2WJVA 4B3XA 1W2GA 3TSZA 1VG9B 2XTNA 4LCBA 4WZBE 3WHKA 3U6BA 4AYTA 2IF2A 4Q19A 1XD8A 1UBCA 4LV5B 1R7RA 4TMZA 2WJJA 3PEVA 3PCRB 5BN5A 1SVIA 3RWOA 1IJFA 2BCJQ 4PAQA 3AUXA 3NEYA 2NMVA 3TAHA 3CR7A 3VTKA 1L8QA 1U81A 1COWA 1KMHB 1EFCA 4IJMA 3WMEA 4Z51A 2VP5A 5JJKA 4Y0AA 4DDWA 3GJ6A 3GLGB 4C0LA 3W3ZB 1FFHA 5JI3E 5GADl 1LF0A 3TW4A 3TSOA 2G9NA 2CVHA 4PX9A 3OIYA 4D2IA 2C9OA 4XTRA 3R7WB 1GKUB 2GEUA 4A8JA 5FBLB 4D0LB 5D3MA 4W5HA 4Z8YA 2GZHA 2NO1A 1MKYA 2BMDA 2RHMA 2OLKA 2F1JA 4EPRA 4Q9JA 1Z0AA 4AIIA 5CB6A 1TX4B 3PR1A 4HYYA 4WXRA 4WIAA 3WXMA 3AQ4A 4M21A 5AUOB 2N46A 4JBYA 3HU2A 3VFDA 1H8HD 4YDHB 1X86B 4ZV4A 1P9RA 1Z6AA 1PLKA 1H8EA 2XOKA 2DWOA 4IOJA 4DSTA 2AN9A 3KX2A 1HTWA 2VBCA 2O8DB 4A82A 1NY6A 1J99A 3FOZA 1II8A 4JLJA 1TUIA 2ZQ5A 1ZU5A 3FHOA 1U9IA 4BFUA 2WOJA 2B8WA 1R0YA 721PA 4UXHA 4V0MA 2ZI5A 2OFOA 2RH5A 3SFZA 4A2PA 4AD8A 4BEJA 4MRSA 1T3LA 2WZQA 1YRAA 2VA8A 3SYLA 3RSOA 1A82A 2FEMA 3LQQA 4DB4A 1SVOA 2V4ZA 5H70A 1SKQA 2JLWA 4Q1CA 3K70D 1II9A 3ZS9A 2Q3MA 4HZIA 2XZPA 1YZTA 4S2EA 4NYJQ 4MKHA 5FPTA 1KJYA 1XTIA 2G0TA 1GZSA 3I5XA 4MYUA 3A36A 1JNYA 5IK2A 2Q3FA 1KNXA 1C1YA 3I73A 1HQCA 3T5GA 2I1VB 1E0JA 3K09A 3RS3A 2WWFA 3FKSA 3KKMA 2OAP1 4TYYA 2Q6TA 3RS4A 2BM0A 4CEIB 2J3EA 3DHWC 5TB5A 2BKUA 1NP6A 2QU8A 3GFPA 1R0XA 2B7CA 4N1AA 5H68A 3SS8A 5F3WB 1NSFA 1QBKC 4NCJA 2UZIR 3QF4A 3BH0A 2HJGA 1P7CA 3WBKA 4ARZA 1YZNA 3MWYW 1FTSA 4HZUB 4WBSA 1G7CA 3JVUA 4BFXA 4BLTA 2BDTA 5FOWA 1G9XA 3WP0A 4MGIR 5FI1B 4C3ZA 1TQ2A 2J46A 2WM9B 5DI3A 3SFVA 1NVWQ 1P75A 3EIEA 3C5HA 1Z07A 4TL8A 2Z43A 3U60B 2ZJOA 1Q3HA 1YU9A 4QGHA 4ZDWA 4KLZA 1P62B 4NU0A 3P4YA 2R6AA 3EZFA 2FMXA 2NGRA 3WHLA 3X1XA 3LX8A 4LY6A 121PA 4K8OA 4B76A 1DARA 3RABA 3B1YA 3AF3A 3L2OB 1CEEA 1KSFX 4RFVA 2BJVA 5EXXA 5KDDA 2E87A 2YVUA 1XEXA 2FA9A 2OFWA 3GJ5A 3PEUA 5EXSA 1N6OA 4XSHA 3X1ZA 1B23P 5IT5A 1Z2AA 2VHQA 4YXWA 1E3MA 4PHGA 4M1OA 3IGFA 1Z2CA 5FUWA 2REBA 3RS7A 1XBTA 1AGRA 2XJ9A 1NN0A 3OE7A 4RD4A 4A0GA 2RAPA 4LHZA 2QBYA 2WBLC 5TY0A 4CVNA 1S0UA 1FP7A 4LJ7A 5HR5A 3K0AA 1XJQA 4MQBA 1KNQA 2AWOA 1T3HA 3O8DA 1DVRA 3BB4A 1MH1A 1D5CA 2OBLA 3PUZA 5DH9A 2W2TA 2IX3A 1LB1B 1ZNWA 1YRBA 4XWAA 2CJWA 1RVDA 1W7AA 3ZVMA 2XTZA 4L9SA 3U7GA 2IL1A 2CBZA 3ZLJA 2Z4RA 1EESA 4RKFA 4URWR 3THWA 3C15C 1GTVA 2QGZA 2REOA 3H2YA 3OF5A 3W90A 1R10A 3VKHA 1K8RA 3EPLA 3S1AB 1GDDA 5EZ6B 3B85A 2ZEJA 3RVBA 4LRWA 4KYUA 2I3BA 5L3VA 5FR1A 2IHBA 1QRAA 3K09C 1GNRA 4OJQA 1KDOA 2ZI7A 1VIYA 5HKKD 1G7SA 2DBYA 1W0JD 3F8TA 4Q9KA 3VHLB 1RRFA 3QKRB 5J4HA 1FOEB 2WWYA 1NKSA 2NO7A 1BIFA 4ESHA 3NTUA 1XZQA 4X8HA 2G83A 5DNYB 5G40A 1G8PA 1UKYA 2QROA 2NO6A 4Q9LA 2ZE7A 3RS0A 2WICA 1NVUQ 2RGGA 2O8BA 1E0AA 1ZMXA 4M9ZA 1COWD 2OZEA 2IUSA 2OCAA 1IXZA 1M8PA 2GCOB 4QKQA 4MUAA 2VSOA 1RYHA 3LAWA 4OK3A 4X8MA 3ADKA 3CUEF 1XPOA 1TL7C 2QORA 2PMDA 3J81k 1Z83A 3RAPR 4V0OA 2YWEA 5AK0A 5CIWA 5KSOA 2ZE8A 2TMKA 4DIDA 1MT0A 3B9PA 1JAHA 3CPHA 4BEBA 4O2LA 1KDRA 2HUPA 3RANA 3A1VA 3OIVA 3UWOA 2WHXA 2I4IA 2EFEB 1BMFD 2P5SA 3EA5A 4G5RA 2NPFA 2FFQA 1HE8B 4B33A 1KIMA 1KSGA 3Q7PA 5CLQA 3OEEA 3U3OA 2GHIA 4Q7MB 3RSLA 5DYGA 1IXRC 4KBGA 3ZVLA 3K0FA 1P3JA 1NLFA 1SXJB 2ZJ5A 5A0FA 4R71A 3O8CA 2F43A 2ZRLA 1IY2A 1KTVA 4P31A 1OKKD 1ZAKA 4EAQA 2J0UB 1ZM9A 2QTFA 2FSFA 1OFHA 4DDUA 4IDQA 2WKPA 1WCV1 4Q00A 1N5KA 4IOKA 2CHQA 1YHNA 2FZLA 4PPFA 2D06A 2ZI4A 5TDHA 4CEJB 3IDQA 1QHIA 4NH0A 4C7OA 1W48A 5HCNA 1KZGB 1UF9A 2O8FB 4FW9A 1VHLA 1E79D 2L0XA 2ZRDA 3U5ZB 2ZYWX 2B6HA 4GP7A 1SGWA 4XWOA 2XGJA 4CGZA 3KKQA 4JJZA 5LPNA 2RGAA 1P73A 2F3RA 3A4MA 2WKRA 1OFUX 4B48A 4PO9A 5IK2D 2QY9A 1UDXA 5FL7A 4NP6A 5JEDA 1OW3B 1HYQA 5JMTA 2O8CB 2FNAA 3TUIC 2F9MA 2V6JA 4YQFA 3RS2A 4ASUD 2GVDC 5E7JA 3SJBA 3ZGXA 3AM1A 2BM1A 2FX3A 2P0EA 2GXUA 3CZPA 4NYJR 1T6NA 4EQ6B 1JAIA 1GP2A 2GF0A 4G5OA 1Z0KA 4HLCA 2B8TA 4DUGD 5HE9A 2DYKA 3KJEA 2PT7A 4KO8A 3X1DA 3C5CA 3L82B 1KY3A 1E6CA 3U3RA 4FMBB 1T5LA 3I92A 4ZCLA 3GLIA 3B1WA 3A1UA 1KSJA 3CZQA 1QZXA 3ETLA 1KKLA 4IVPA 2FFAA 3B60A 2IA5A 3RS5A 2XITA 4G5GA 221PA 1AQUA 2A5DA 4A4DA 2LKDA 2XTMA 1CLUA 2FEOA 5JJLA 5JSZB 3LBHA 1Z29A 1L7VC 4M9QA 5J4LA 2BHRA 3C16C 2DWQA 4ZPXA 1JR6A 3THXA 4G0NA 3CRVA 1FPMA 5GJCA 2WWHA 3KFVA 2NPIA 1KDPA 4MRNA 1EWRA 1RW4A 3GLIE 3QG5A 4TMWA 2KBEA 3ZZ0A 5TARA 1Z6YA 3EZ7A 4C0BA 1G6OA 3UG6A 2EW1A 2X8AA 3R8FA 4CF7A 4LOAA 1XNJA 2QTVB 5FPSA 4D4JA 3TAUA 2F9LA 2FPLA 4JLPA 4JKYA 5FFMA 2XXAB 2F1HA 3L8ZA 2EVWX 3FHCB 1ZD1A 4YXWD 2H18A 4IXNA 3T1TA 1D9XA 5CM9C 1KY2A 1TUEA 3TIFA 1FX0A 3B5JA 1NBME 3CM0A 4OJKA 2QMHA 5TMPA 2R6GA 5KSZA 1G7RA 2JDIA 2PT5A 4ZIRA 1RJ9B 2QGNA 3QKUA 1HUQA 2PJZA 2VP4A 3WNDA 1XTJA 1FUUA 1TEVA 2GCPA 4L5BA 4QGGA 3EPJA 4Z54A 1HV8A 3W6OA 1VKJA 1GFIA 4IVRA 3D3QA 4IDPA 4O0MA 3SHFA 2BOVA 3H86A 1JEDA 2IYZA 4Q47A 1DAIA 3LY5A 3F3YA 3U44B 4HZUA 2BJWA 4G5QA 4PQRA 1Q1ZA 1QF9A 2GWHA 1E0KA 4E03A 3ND9A 1YZLA 1N6IA 1ZM4A 3K8YA 1ZJ6A 4UNRA 1E2GA 3N70A 4M1MA 2GAAA 2V9PA 5AJZA 4PAOA 1C9KA 4NCHA 3CWZA 1Z6GA 1IQPA 3DDCA 3RWMB 3BBPA 2WPDA 4XWKA 3CNLA 4R98A 1XCPA 2DHRA 3KQHA 4O3MA 4L9WA 4LBYA 3R8CA 1CR0A 2ZRFA 3I8XA 3L0OA 1XFAA 1F2UB 3SZRA 4OQXA 4PZLA 5EE1A 4LC1A 3GMTA 5BW8A 4JVMA 3IHLA 1XMSA 2WMNB 1ZC3A 4RVCA 3BB3A 2QAGB 1T9HA 4LBVA 5C2JB 3DKVA 5CM8B 5HZHA 2N1BA 2CL7X 1U99A 4FD2A 4PO8A 1K5GA 4LZZA 3NHAA 3W6PA 3E1SA 5CB8A 4QRHA 1NG1A 4I1VA 3HU1A 2QL6A 4BLPA 2XEXA 3JVVA 1MV5A 3SYKA 1UBGA 1Q22A 3PUYA 2FFBA 1E9DA 1H8HA 1SVKA 4B2PA 3U3MA 1TF5A 4AI6A 1P61B 2OFXA 1EWQA 1E9CA 4P33A 5FTJA 3CX6A 1CXZA 2H1LA 4S35A 421PA 3GPLA 2V3CC 3IBGA 2WWWA 5LB2A 4CEHA 2OCPA 2OXCA 2F1RA 3CRMA 2GJSA 1OJLA 2Q9AA 1NIPA 1Q1EA 3LRPA 2IS4A 1N0VC 1G3IA 1QDEA 1YE8A 4FIDA 1TMKA 3B82A 3OEED 2NO9A 4PXAA 1PLLA 2BVNA 2ZJZA 3DM9B 3HR7A 4PR0A 1AKYA 2IUTA 2ZU6A 1S9HA 1F60A 2R44A 3DOFA 4GRAA 3VAAA 3B2EA 4RFSA 4JSYA 4C0SA 3U6KA 3AVUA 2GESA 4ON9A 1ZNYA 1ZIPA 5JI2E 3K9NA 1GOTA 1OIWA 4NL4H 2OO7A 4KODA 3RRZA 4BZPA 2H16A 4D4KA 5FPYA 2ZYVX 4RD6A 2PZFA 2DWPA 3WY9A 1A1VA 1R4AA 1IY0A 4HB4A 5EE3A 1U94A 3QKRA 1PZNA 1DE0A 4RD0A 3VMFA 3AGQA 3X1WA 3E5HA 4MKIA 3ZVNA 2ZYTX 3Q72A 2KSQA 2QTHA 5AUNB 4TYPA 2KE5A 5J47A 4M22A 3L0IB 1NIJA 2YV5A 2VO1A 3MWLA 3T1QA 1FMLA 5BN3A 1TAGA 3V00A 3QF7A 2IBMA 2AD5A 1US8B 2AWNA 3GEIA 1T8UA 1KDTA 3FTQA 3K9HA 4KJZA 2J0VA 3WYAA 4LC0A 2GCNA 4BLQA 2HF8A 2BKEA 2FV8A 3FFBA 3IEUA 5G3ZA 3U3KA 2GXAA 2KBFA 3AVTA 2W0SA 3U2QA 2OCBA 3PUXA 4UKDA 2VF7A 1Q1BA 1W49A 3NHBA 2GKSA 3B13B 4JT2A 5CK5A 2ZRNA 3C4JA 2QENA 3MSXA 4EKDA 4CYMA 4C0KA 4DCTA 1MABA 1TQ4A 1XTSA 2ZANA 1X8JA 1NMXA 5DO9A 4W9MC 1XDBA 3TR5A 3EASA 1G8FA 1ZU4A 3FYHA 3AP3A 1AS2A 3IQXA 1Z6TA 5F9FA 4JVLA 2ZIAA 4LJ6A 3FWYA 1NBMD 1UBFA 4Q1AA 3KUCA 4HAYA 3EIHA 2YZ2A 5K8LA 1KK2A 3T12A 3CPJB 3SC3A 4ZKEA 1T0JB 4XTCS 4WAUA 4PC3A 1X1RA 2GEVA 2YHSA 1TF7A 1OXTA 3ASYA 4LYAA 4TMVA 2PEZA 2C96A 3I1FA 3OIUA 2V6IA 2ANBA 2RGDA 3AVPA 1AS0A 1UKZA 2D74A 3A37A 3F5FA 4Q66C 1BYUA 3VHXA 4ZI2A 4GDFA 2B7BA 3TQFA 1XD2A 2IEZA 2RGBA 2QP3A 1KO4A 2A5FA 2CDNA 3VR6A 1OLOA 3UWKA 3MJRA 4IDNA 4WVFA 2JDID 5GVRA 1YR8A 1XP8A 4Q4HA 3W8NA 4JL8A 5HZKA 2W6JD 3KKOA 4TYQA 2C77A 2YYZA 3O47A 3Q85A 5EE5B 5E3HA 4AK9A 3CF0A 3QPWA 1ZD8A 4DDTA 1UKEA 3ZQJA 1JECA 2VHTA 4CT4B 3QIAA 4GZMA 2WOOA 2P6RA 1AKEA 4KXFB 4P32A 4TTRA 1Y3AA 2QSYA 3BIFA 3WP1B 5E7MA 4ZKDA 5AUPB 1N5LA 1W0JA 2H17A 1AJEA 1ZUHA 3HP1A 2RB4A 2ANCA 3NC0C 1VYTA 2ZI3A 4JSTA 4IKEA 1XTRA 5JHGB 4DZZA 5CITA 1IHUA 2OESA 2MMCA 2VRWA 2WPDD 1KO1A 1Y63A 3DZDA 1IONA 5JSZA 3PXGA 1P2TA 2OT3B 2CE2X 2C5LA 2ONJA 3TSWA 1TF2A 4OK5A 5TVKA 4I4LA 1E2EA 2HCBA 3KQUA 1NN3A 4EPXA 2AK2A 4XVUA 1WRBA 3UATA 2JJ1D 3IIMA 1GL9B 3HR8A 4YMSA 3WBJA 1QVAA 1U90A 1H65A 2GETA 3A6PC 3FVQA 3R9XA 2QE7A 4QXAA 1N25A 2PL3A 2VQSA 2QP9X 3EWAA 2WJHA 3T5DA 1BMFA 1Q0UA 2NZ8A 3PVSA 2Q0HA 4ESVA 1SXJC 2ODWA 4M4SA 3T1VA 4AWXA 5ELXA 3CLVA 3MRSA 3FPAA 1R6BX 5KOYA 2QQ0A 3KUDA 1G3RA 4I1OA 4F4CA 4WXPA 4TLBA 2O8EB 3GEHA 4DCVA 3RC8A 3A4LA 1OPXA 3EPKA 1G17A 2HJVA 5SZKB 4JJKA 1DOAA 1OKKA 4LJAA 1II0A 3THYB 4NCNA 2WAYA 5EUQB 2QAJA 3SI7A 4U00A 4KITB 1EG7A 4KLNA 1QHHB 3AF0A 4BFYA 2ZRMA 1W36B 2WMOB 2HCJB 1QHSA 3GD7A 2IYUA 4PANA 4IXMA 2YWHA 1GRNA 4FWIB 1Q44A 4DLRA 1E69A 1M74A 2QPAA 4EUNA 1E79A 5FTMA 4Z1MD 2AXPA 4BASA 8OHMA 5JCPA 1JI0A 3P32A 4P4SB 2GJKA 3HJNA 3W5IA 1NLYA 1KSHA 3SN6A 3MG9A 4A6PA 5L3QB 2N42A 4FN5A 1U8ZA 3X2SA 4F93B 1E99A 2C9CA 1W5TA 1FZQA 2J7PD 3UG7A 5BYKA 4U7DA 1BKDR 4ASUA 1F2UA 1E4YA 3OAAA 2RGNA 2VEDA 1A7JA 2OILA 2ZRIA 1GRRA 2F3TA 4AG6A 2FPMA 4DEYA 2FE4A 2FFHA 1ZUNB 4LYJA 4MGYR 2Q9CA 4F4JA 1E2NA 2IWHA 2C9YA 2W2XA 4FINA 4TLAA 5GJVC 2H7VA 4DUGA 2CXXA 4NTZA 1M2OB 4Q18A 5FPHA 2J45A 3ADCA 4JBWA 3FMFA 4C0AC 1XJ0A 3DVLA 3K9GA 3IPYA 1M7HA 4YONB 1VYUA 1WB9A 2CLDX 5FBRB 2VHUA 3D7MA 2YNMA 1VCMA 4JLOA 4WOPA 3REGA 5FH9A 5KNBA 2HDNB 2OBNA 4HDCA 1Q3TA 1ZW6A 4LJ8A 3TNFA 4F38A 5JJIA 5FOUA 3K0CC 3MGCA 2PZEA 4IEEA 1XPUA 3FFAA 3MUFA 4FI3C 5F9HA 5KYKA 4V0LA 3I32A 2NIPA 3QNUA 1VG8A 4JZKA 3BH6A 5J40A 3VR2A 4GNKA 2LKCA 2J41A 3GJ0A 3ONWA 4GP6A 4TN1A 5H1YA 2WSSD 1E96A 4GOKA 1ZNXA 3NC1C 4MITA 1E2KA 4XD7D 1HURA 1Q20A 3MLEA 2J5XA 4Q48A 3SBEA 4ZCIA 1HA3A 3F0TA 4HAXA 3OIWA 1SXJD 4RD1A 1XTQA 4X8OA 3NKVA 1F2TB 1P2UA 4NYMQ 4QNRA 2ZJ8A 1G21E 2FWRA 1ZM7A 1AZTA 3LW8A 3NVAA 1MO5A 4DSNA 2OG2A 2IUUA 3TBKA 4LJ9A 2P65A 5KO2A 4HAUA 2WTUA 4PQFA 2Z5FA 3I62A 5J4YA 2HXSA 1HT1E 1B0UA 2Q21A 2ZJBA 1GITA 2KI5A 4TZ6A 4I81A 4HDOB 2FSIA 2LWIA 4Q7LA 1J8YF 1VIAA 1GNQA 5G41A 2NTYC 3QENA 5CIQA 1R0WA 5B30A 2ZREA 3RNLA 4BUJA 4WZ6A 1YQTA 2ZJAA 1R0ZA 4GT1A 3AKCA 3E70C 4YC7A 4R7ZA 4W5JA 1CBUA 4CRWB 2C2HA 1CTQA 4QOSA 1MO6A 4PPNA 3L0SA 2X77A 4LHYA 4DC9A 4LBZA 3ADBA 3QPVA 4TLCA 5G3YA 4BRWA 1GKIA 1GVNB 1PUJA 4L16A 3B6EA 2ZAMA 3TE6A 1WA5A 4B3GA 1V5WA 4FXPA 1G291 1US8A 2SHKA 3AUYA 3AVYA 3OESA 4XIGS 3U7FB 1HY3A 3B1ZA 3T34A 4E07A 1KK1A 2QT1A 1ODFA 2VSFA 4LHWA 2CCKA 1N6HA 2R6FA 4XSGA 3DKPA 1YJ5A 2RGNC 2ZS9A 4L8GA 5SZIA 4QJ3A 1JPJA 3AKYA 5L3SB 2QAGC 3BB1A 2OE2A 1JPNA 1W0KD 2AXNA 3G0HA 5AWFC 3CKLA 2WSMA 1WQ1R 2EFCB 3U4QB 1RIFA 4FCVA 3EC1A 4H9GA 4TLEA 2ZYUX 4JVNA 1U8YA 5GVSA 4D25A 3EAQA 4QJ4A 3OZXA 4URZR 1DAEA 1LF5A 5G53C 3UK6A 1W1WA 4RZUA 4E22A 2CNWD 2A5GA 1ESNA 2ZRAA 3E2IA 3BE4A 1DAFA 4TT3A 2HV8A 3QXXA 1UEIA 4M9SA 1KMQA 2Z6VA 4HATA 5DHFA 1NSTA 3GLFB 2IXFA 1C4OA 4MA4A 3CNNA 3TJZA 1N3BA 1NN5A 5FPKA 3BFXA 4C0QC 4AKHA 2OAQ1 2BBWA 1Q21A 1IOZA 2QE7D 2ZRKA 6Q21A 3AH8A 4HUQA 2MSCB 4DIEA 4Q1FA 4B44A 3CBQA 3ZD6A 4HB0A 1BS1A 4B2LA 4PC7A 2CL0X 3A1SA 4BLRA 4D82A 4IFEA 1U2RA 4CT5A 1UEJA 3L43A 2PZGA 1HQYE 1KI2A 3GJ7A 1IY1A 4GMXA 3GJ8A 3HWSA 3NIBA 3EWSA 4GI7A 4Q4AA 2A9KA 1BH2A 2RKOA 3TVDA 4EPTA 1NL3A 1YVDA 4Q7JB 1EK0A 2DCUA 4PC1A 2ORIA 5FUXA 1BO6A 4RD2A 2V1XA 1ZVQA 5F2EA 1KGDA 2W6ID 4Q4JA 3A1WA 1XZPA 4AYXA 3UMRA 1JR3A 5JZVA 3BXZA 5AR1A 1UJ2A 1XU4A 2O0JA 3KXIA 4DCNA 1QG4A 3QKTA 5FTLA 3TKLA 3MFYA 4B3DA 1U0LA 2B21A 4A15A 4DLXA 4RSGA 5DLQC 4ZO4A 4F4IA 2OM2A 1GNPA 2ZROA 4G1UC 5IF9A 4GL2A 4NMMA 3AGPA 1IN8A 2ONKA 2ZJ2A 4Q1BA 1XMIA 2PLFA 3C41J 3KTAB 4FCTA 1XMVA 4NDZA 5K8UA 4JLDA 5UKDA 4PQYA 4MKGA 1HH4A 2X1VA 3W3AA 5KPJA 4F92B 2VP0A 4HLUA 1XCGB 2JJ2D 2PX0A 2KWIA 3SE0A 3ECCA 5KHOC 1KMHA 1JR3E 2IYWA 5EZ5A 3BFKA 2IEYA 3NG1A 3OHMA 3OAAD 4NCKA 1OH6A 3GLGA 1MO3A 2EU8A 1R5OA 2W00A 3GLHB 1SVMA 2E1RA 3LBNA 3LQRA 1LS6A 4DLUA 1RYFA 1SQ5A 3BORA 3R7WA 2WWIA 3ZZUA 4BECA 1LTQA 2VF8A 3NWJA 1Z8FA 1JJ7A 2C98A 2JJ8A 3QVVA 4PTLA 1OB2A 2W0MA 3CWQA 1KI6B 1DAHA 4QBFA 2J87A 2WIAA 2VHJA 3AKEA 2IYVA 1E2LA 2FSGA 4TYNA 4EJSB 1P4SA 4BFTA 2C78A 3NDBB 2W2VA 1AZSC 3K9LA 4ZI3A 5HCIA 3VKWA 3Q8XB 4N0EA 3RRNA 2BEKA 4DLWA 3GLGE 2FG5A 2O8DA 4AKEA 1DBSA 1N0WA 1DADA 4DKXA 3A4NA 1GM5A 1AK2A 2C99A 4QBHA 2D2EA 4B34A 1WMSA 2QA5A 1Q12A 1E9EA 2HYDA 2OLJA 3EZ6A 4KFSA 5KDOA 1XMJA 2O0HA 4RJLA 4BRUA 2G3YA 3I4LA 4HI0E 4GZLA 4RD3A 2VP2A 1NBMA 1OF1A 2ZE5A 3CR8A 3OEHA 3MJHA 2ATXA 2ZI6A 3VU9B 1L2TA 2AK3A 2ZTSA 4TZ0A 4B6FA 3D8BA 2JLUA 5KSYA 2MSEB 3LXXA 2DFTA 1G19A 4QG7A 4ILEA 4OL0A 4Q02A 4FCWA 4P4SA 1NMYA 4TQ9A 4E5UA 1E32A 3AVXA
chains in the Genus database with same CATH superfamily
1QX4A 3CRQA 2XCSB 3QLVA 2OC9A 2QUAA 2ZIFA 4PYIA 2HF7A 2VSYA 2WFLA 1VQ1A 1NW8A 4HF7A 5FYDA 4CMBA 3RE1A 1O4WA 5K0LA 1ULSA 5H82A 2G8LA 2XMZA 3KTOA 3DEHA 2UKDA 4PC6A 4LFAB 4J4TA 5LQSA 1RTTA 1OYWA 3OLVA 4DOMA 1E7YA 3M1AA 5BWOA 3FHTA 4TVOA 3HBJA 1H66A 2HT1A 5EJ9A 1E9VA 1O77A 3Q9UA 3UFXB 4IGAA 1WM1A 4TM7A 4ZI7F 4WEQA 2FZVA 1LI7A 1ZBQA 4G1CA 2UZAA 1JL3A 4RKEA 3E7XA 1NULA 3MB5A 1JHVA 3HYTA 3CRRA 3DF7A 5HVNA 2R8PA 1EXNA 4YYZA 2RCNA 1V1RA 1U31A 2QW1A 3LDAA 1YTUA 5JXWA 1E3DA 3W8EA 3FDJA 3HCWA 1PYGA 4H16A 4H1TA 2Y1FA 3BL5A 4R1LA 3ZV6A 5ENDA 2VT7A 3L8GA 1PI3A 2FE1A 2GM4A 1YRQA 1ZG3A 3OA0A 1H85A 4N03A 3T4UA 2IHNA 3VKUA 3OFJA 5K2OA 1UMDB 5JNVA 3VX3A 4P54A 4YQYA 1QAOA 5TEVA 4C2AA 1ZRHA 2JLRA 2YOGA 2IUEA 1QO9A 3HV0A 4NCAA 4PZDA 5EJ7A 2VLIA 3G2KA 3DR5A 4M2LA 4KQWA 4NENB 5JWRA 2R47A 5KS2A 2IH4A 3RC1A 4L6AA 2GJ8A 4FHCA 2AR9A 3ZKAA 1NPYA 4A8PA 4JOCA 4BNVA 3WA6A 1K4MA 1Y1PA 3MBKA 1J1ZA 1XTKA 3QI2A 2GEFA 1JKXA 2FOIA 3IMFA 4PBRA 1NUTA 1QHFA 2F1IA 2PQ0A 2ODAA 4MYRA 3UGKA 4ZDJA 1NF3A 1BH6A 3VU1A 2JFWA 3FCUB 3EXG1 2AVNA 2BMJA 3B8HA 4JI3B 4CTJA 2WM8A 3SC2A 1I3OA 1P5ZB 1GZ7A 2JJ1A 4ACAA 1ZGJA 1D4FA 3AEQB 1GAJA 3L6OO 2NUTB 3JD0A 5I9SA 5I9MA 4LYYA 4HMPA 1UM8A 4YCAA 2V7QD 1V6SA 1Z22A 4GNRA 5COAA 5AICA 5I7AA 5CTJA 2GN4A 4IHJA 2VL7A 2D2FA 3AZOA 4RQBA 2RK4A 1BQ3A 4F3CA 1OC2A 2BBOA 1NI3A 3DL7A 3KVRA 1A5TA 2P1DA 1V16A 4ZYXA 3FOFC 2YYYA 2W4QA 3VVMA 1W85B 3ZDCA 4ALNA 1AU9A 2XD4A 2HNKA 4K6CA 1N2OA 4GOJA 4D0SA 5BVHA 1S3SA 1UPXA 2E85A 2HTEA 2ZUUA 4OFWA 4PG7A 4XFJA 3RBXA 1Y8ZA 4EPVA 1VG1A 3VNUA 1RXYA 3F6YA 5JWHA 3K7EA 1CY8A 2FAXA 1SK9A 2BGIA 2J5RA 1V7PC 1YJQA 3EYAA 3N59A 3UF0A 3V4FA 3F5QA 1U7ZA 1V7QA 2Y0PA 3EIFA 2HGZA 3L1UA 3VU3A 2NZYA 1R88A 2C4MA 2YHUA 3KCQA 3OJFA 4WK2B 4XDHA 3RRFA 1NQTA 2QNIA 3SHQA 4Q0MA 5AVQA 2QKYA 5FUVA 4GGOA 2GBFA 4YLEA 3RVRA 4QM6A 2IJGX 2RSLA 4DCSA 2P6UA 4QYWA 4EW2A 2CHUA 2BMFA 3ISVA 4O4LA 2P4QA 5LXTB 5IUNC 3A10A 3RK0A 4B9EA 5LQCA 1JDTA 2BL4A 3U13A 2BGGA 3CH7A 3GAZA 4X1KB 2OB1A 4G5SA 3CXRA 2BT4A 5CU7A 2V5AA 4HRYA 5GWXA 1Y3BE 4OGFA 5J3JA 3FNHA 1NTRA 1JJVA 1Q77A 4UAUA 1SKBA 1S1CA 5E2AA 4B6PA 4D9FA 5BRJA 3UTCA 5FTNA 2HBQA 3T0FA 3HC7A 1FYXA 2JKYA 2OHFA 2XZDA 5ELLA 2B30A 5F51A 3V9PA 4CGYA 5BXQC 1R2QA 2VH5R 3HUEA 1KAEA 4EW3A 5DGCA 4DXHA 3ZK7A 3I52A 2J7PA 3WXBA 4WZAE 5A4JA 4FBGA 3USCS 1QIMA 4RVFA 4KVAA 4LSZA 4XJXA 3DBRB 4HQLA 2NVUA 3TF5A 3I09A 5B5SA 1TE2A 1UXHA 4D6YA 2ZRHA 3BICA 5EZQA 4DR6B 2GAFA 2E55A 3DZ8A 3PG5A 4FZJA 4G01B 3VAZA 1RE0A 1IVYA 1JB1A 1CS0A 1BOFA 1KETA 2BELA 4GO1A 3MA0A 2IYYA 4OP3A 4UBJA 3B7GA 4KH1A 1G64A 3DCNA 1DP4A 5FBWB 4P08A 4ZYYA 2PYIA 1H0SA 2EKZA 3AIOA 1HNWB 3ELWA 2PEYA 3QKSB 4TS1A 3L4JA 4UTPA 4MGEA 3EEOA 3O4JA 1LJLA 3Q7QA 2QK4A 4RA6B 4PINA 7REQA 2H4YA 2QIPA 2R6DA 1FFAA 2GA9A 5FOXA 1E2QA 5HGXA 1EGVB 1C1HA 3WIDA 1NRXA 4YP6A 1KZ7B 4MUKA 4F5DA 3L79A 2JCSA 2HMWA 4KYTA 2IU0A 5F3RA 5CLJA 1HE1C 3OI7A 3TM4A 4HNTA 1XYVA 5LM3A 4I50B 3TX2A 3HGMA 3A6HA 3T5MA 1NXPA 1Z4OA 4C0SA 1G3UA 2CJWB 4AF8A 4CMEC 2WSSA 2EYQA 3UY4A 1N6NA 5FHRA 2V1UA 2IXGA 3GH1A 5A2QA 5GV7A 3TN7A 3K9FC 1MO4A 1AHPA 3HP4A 5B1EA 1D7OA 3IPLA 3SM9A 3TQQA 2JCVA 2HT6A 1UFQA 1HSOA 2R5FA 3FOAA 3RLIA 4XVHA 5KYWB 1FDVA 4YBRA 2C4UA 5KSWB 1NLZA 4FYVA 1OB5A 3JQEA 5GOZA 2YZMA 2VPPA 4L4XA 5H83A 1DC7A 1OX4A 1YR2A 3P0RA 1OV4A 2QRPA 3DMTA 3EQ7A 1MVOA 3WNBA 1OXMA 3IULA 1D6SA 2Z30A 1PGOA 2NM0A 4YAEA 2QI9F 5BOVA 3SHOA 4D8VA 2RHBA 4CEJA 5ADVA 3WYGA 1XMXA 2R0QC 3LUGA 3DLPX 3I04A 5KJFA 2XYHA 4PYQA 4WK6A 1XLUA 4JJAA 1XRMA 5EZYB 2Q0XA 3D6HA 4FMCB 3RJ9A 4QUIA 1S2LA 1OFTA 1N2CA 2XVZA 2Y27A 2DULA 1SXJE 3MF4A 4NOMA 3ZNNA 2D3WA 1OYYA 4F7DA 3UPUA 4WGGA 3GP8A 3ASZA 1XCJA 3OOEA 3LBIA 3QXJA 4PSVA 2HSEA 3RIXA 1YIOA 2WD7A 1BEUB 1EE9A 2VDKB 2ZVQX 4C30A 2EQBA 1G8YA 4QPZA 5M3BA 4LJRA 2LE0A 5ICCA 1PHRA 1JQAA 2NT3A 1JVSA 2WJZB 3RIEA 2QLBA 5JH7A 3KOZA 5AKIA 1XA3A 3JZIA 1KJZA 2VXBA 3Q8WA 5GM2A 1CUYA 1TZBA 3BRWD 3DMHA 3GHHA 1U3TA 3ZJYA 3ZCVA 2DY1A 3LWNA 3S1SA 3LX6A 4BP8A 1WU7A 1KRWA 1PZGA 3IP5A 4G0WA 3FMGA 3GN1A 3PVCA 3L6UA 1T13A 5IMBA 3OTQA 4C08A 2NSLA 4FC6A 3GDOA 2JVJA 2A0XA 3PWSA 1BJRE 4DRYA 4D4LA 1NVDA 1FW6A 2G88A 2Q4BA 3ZLTA 1QAMA 1M1YB 1X8LA 3E8XA 4MTLA 4M1SA 2RIPA 2RE8A 2JH8A 2PK3A 1EJBA 3PXXA 1ZKDA 2VJKA 4RHEA 4U5QA 2ZWIA 3HVHA 1U5BA 1P7YA 1WDTA 3W6NA 3JV7A 4UPEA 4P92A 2VAXA 3K3PA 3PQ5A 4ZO8A 3MLAA 4HX9A 3WGYA 3FVVA 3QOFA 1GUAA 3AJ8A 4YQZA 1BXRA 2XGSA 1JBKA 3C43A 3T7RA 1C9DB 4NQRA 4BO2A 2PJRA 1O9GA 5FNZA 1IM5A 1WIWA 3IAHA 2EFYA 3SJUA 3V8VA 4KGDA 4D8TA 2H1OA 1XD9A 1EX6A 1M7GA 5TPZA 2EJUA 1FQKA 2C1ZA 4OQFA 1U02A 1W52X 3HU3A 2DLDA 4EHBA 2Z58A 2UZ4A 3U40A 5JQGB 4YMHA 3ZU3A 2FUEA 1IRXA 1J00A 2CNDA 2JZNA 4TSFD 1EK6A 2B92A 2JIZD 3N6XA 1WPGA 4KYIB 3WV4A 4HTAA 4C9BA 3PQ2A 2GRJA 1TXGA 2H57A 4JUIA 1IULA 4LMAA 3KVVA 4LJSA 1RC0A 4NMXB 1VCIA 2QSJA 4PFSA 1PJ3A 1QFJA 4EUKA 3L1KA 3ICVA 4AJ4A 2QYSA 3FMOB 5FA5A 1NF2A 3NDRA 1RP1A 4X97A 3VR3A 1UT6A 4BO7A 2W37A 1BW9A 4HDRA 2P2NA 4RY2A 4HS4A 1RJ9A 2CLSA 3PGXA 4WWHA 3ROGA 1V9SA 1JZTA 5KX5A 2KYRA 5CFRA 2J09A 2A35A 5I9BA 5FTWA 4IJKA 4UOQA 3ZHCA 2CB9A 4OHCA 2VYQA 3AO0B 1G63A 1TU4A 1X7GA 1OASA 3DTVB 3MGKA 4HGZA 3HXKA 2LP4Y 3EQ8A 2VDMB 1KU0A 2ZRJA 2F6RA 1QV9A 5F64A 4CI0B 2IZ5A 5TQ0A 2CNKA 3ASUA 3EVGA 4II3A 3R3VA 5DN6D 3GGJA 3QMPA 4I6JA 3CEJA 2JLXA 3EGDA 1NLUA 1BDHA 1FW8A 2GPYA 3DFKA 2A84A 4OQ4A 4C4ZA 1T4GA 4DPMA 4E5DA 4IW3B 4TRRA 5E6RB 2C5EA 4XYEA 1U0HC 2WE7A 3CLTD 3NTOA 2X1MA 4OJYA 4RDXA 1HE2A 3KHKA 3UJHA 5DM70 1HL3A 4OB8A 1WMBA 4D0NA 3KJNA 3QVOA 1KERA 2PWPA 2YS7A 3UIEA 1Z36A 4DV0B 3I5UA 4F46A 1IBSA 2WT9A 4BXOB 1Q92A 4A8TA 1EDDA 2WU1A 3AERB 2O3RA 1R0CA 1OILA 3IP6A 2H3EA 3BERA 3V4RA 2OB2A 4ZZ3A 5IEJA 4XVQA 3B2QA 3QEOA 1NNI1 4UNPA 5FQNA 2XSZD 2NUAB 3V46A 1PDVA 1SKYE 2R1TA 4GDMA 4HQFA 3OZFA 4BNFA 3KHUA 3L6CA 3ZHQA 2Q7XA 4UUNA 2NU9A 2I7CA 1ISGA 3QG1A 1ESDA 1P4GA 2HREA 4QDZA 3IUPA 5AH0A 2EJVA 1LPMA 1RMTA 2X2PA 1JALA 2BISA 4HRAA 4D3DA 2HA0A 5ARBA 1KJQA 2VNHA 3PENA 4JU8A 1EHIA 1GG2A 3FTDA 1D8AA 4KN6A 4RZXA 1QHEA 1FX0B 4G81A 1XJ5A 2ILTA 3P0IA 4PSCA 1IC6A 3BK2A 3C6BA 1YF3A 3DEIA 1DBIA 5HF5A 3KZ1E 1CEQA 4YQEA 1J7KA 1MRZA 3ZIAD 2CD7A 1E18A 1NYRA 2RBKA 4F2PA 4RJTA 4I9FA 2HF9A 3NALA 1NUAA 2BFDB 2DLNA 2OAGA 3Q5GA 1L7NA 3AEYA 4DQVA 1SR8A 3D3WA 5L40A 1WAMA 3R9WA 4V24A 2CLCX 1VA5A 3DUFB 3ULKA 2GOYA 5LYJB 2XVXA 2Y66A 3L6DA 3AP2A 3H87A 3PDIA 1TKBA 1A9PA 3BRQA 1BE1A 3H9QA 4XJSA 2QX9A 2YZGA 4US2R 4MSUA 3KQSA 4KPUA 1Q7TA 4IDBA 4HWSA 3DQPA 4ZICA 2PBLA 1RZRA 4OXYA 2C8VA 2ZJYA 4R83A 2WWGA 5AK3A 2IYTA 4BE7B 2Z4SA 3HDYA 5KTYA 1X38A 4BTLA 1QOZA 1CT9A 1Y3CE 2J3QA 2YHIB 1A9TA 4U6QA 1XRSB 2BP7A 3UGTA 2JARA 2JGJA 3KJIA 3W5VA 5HFJA 3VYTB 1F6DA 2QPOA 3NTRA 3I8SA 4OI2A 2HQ1A 3TTWA 3L7LA 2JA1A 3JQAA 2ZRCA 3Q8KA 1XZHA 2HLDA 4JLNA 1TTPB 3R7LA 2QM7A 3EIXA 4Y7DA 3RF6A 2QVZX 1M1UA 6PFKA 1LVGA 1SCAA 3TZKA 3DONA 4MHOA 4A8JC 5AJXA 4N18A 5D6NA 1KO8A 1VBFA 2VK2A 3ZBQA 4Z5XA 4OHYA 3A6GA 4K03A 4HAZA 1C9JA 5HKOA 4BB9A 1OR8A 3FYUB 4C4SA 4YRMA 2CFCA 4DNXA 5CAEB 1YVEI 1E4VA 2PTHA 3QUSA 2VNKA 1MIOB 3AHFA 1X1QA 4WXYB 3FUCA 4BFSA 4C0XA 3BMCA 4IOLA 3VKFA 1C50A 3MWGA 1VMIA 1O1YA 4Q15A 3G02A 3HBNA 5JS7A 3JYPA 5FCDA 1GJRA 1NN1A 1P81A 3UK0A 2HFKA 3GXOA 2QD1A 2Y9PB 1HWYA 1VRVA 3ZZMA 4L15A 4KQGA 1MZPA 1GAQA 1AM4D 3CBGA 2VDVE 3WRXC 1JEOA 4Q6WA 3H5WA 3NETA 1QYVA 3TLBA 3KC2A 4UM8B 3TL2A 5IC6A 4DVGA 4QX6A 5AM5A 2GFIA 4X7MA 5F98A 2HRDA 3IJ5A 5KHAA 2C1EA 2NXWA 3E3AA 4ZRNA 1U7HA 2A0KA 5H5JA 5BQ3A 4OLJA 4FFBA 3DAGA 1Z39A 2JFXA 4FFMA 4ILKA 4O4JF 3VDRA 5ABPA 1W87A 3VR4D 1RZ3A 5I3CA 3KQKA 4J03A 5LMNB 1EUDB 3GRAA 2ORED 3G8BA 5K3FA 4NE2A 2R1VB 4K3UA 4ZZIA 4EB6B 5DGTA 5G0VA 1GD1O 2ROQA 3UOAB 5K3OA 2A5JA 2X2OA 2XCOA 2PCJA 3SS9X 2ZGVA 4OBXA 4D7AA 4E14A 2FW0A 1G41A 4UULA 3O3CA 1WZ2A 5H80A 5A5VA 3ZDAA 2GARA 2V0NA 1CE8A 3AEUB 3DW3X 1C1XA 4O5OA 3OX2A 2W4IA 2ZSBA 3CF2A 4EFMA 1KARA 3PC7A 4B1FA 4G23A 4YT8A 1LDMA 5JYEA 1RAEA 1ADJA 4CQLA 5BW5A 2ORVA 2Q3HA 4JVSB 1D07A 5K01A 3KOUA 5FOQA 5AKEA 1NJGA 1FJGB 4LYEA 2AHRA 4E30A 2GLUA 3R74A 4EELA 1FP1D 4NZNA 1EVIA 3K0HA 1I4EB 3QE0A 2W8ZA 3AR4A 3NYWA 5AJTA 4P7JA 3WLPA 4F9EA 5TE9A 1U7UA 4H6WA 1BE6A 5BNWA 1XMOB 1VHJA 1D4OA 1P8JA 4P3NA 4YDRA 1BXGA 3QWFA 3WOVA 4IIDA 4B6QA 4BZXA 3RYCB 4PM4A 3TQHA 4C76A 4CT0A 5KVAA 1FNDA 3EGXB 3WRYC 3U39A 1J09A 4MV8A 2Q0SA 3I58A 4D9MA 5FUQA 4Y6LA 3JVDA 4E5NA 3BQ9A 4HDAA 4M0UA 1RYZA 3CIOA 1EFRD 4HK4A 5EY5B 1ZD3A 4EP1A 5EGSA 1DG3A 2AE2A 3W78A 2JAQA 1C0IA 3GVPA 3KKEA 4IDHA 4IXDA 4DJTA 3L7MA 4W8GA 2P78A 4P36A 2OPBA 4JYMA 5LLDA 3K5IA 1L1RA 2WI8A 3QK7A 4OOEA 4TXNA 1J1IA 2D54A 4YO8A 4F9TA 1MGPA 5DYIA 1NA5A 1U2GA 4LOHA 4P0TA 4QE3A 1JH9A 1NJ8A 4W8HA 4BDSA 4KK4A 1F12A 3GJ3A 3HN6A 3Q8MA 3OQIA 4K1XA 1UC9A 4M8LA 4V38A 3SYMA 2HKIA 4G8CA 3RRXA 5HQJA 1YWGO 1GSIA 1VE6A 2SICE 4QC2A 3PQ6A 3SLRA 5DBHX 1SBZA 5CLFA 3V2HA 4LOKA 1E1QA 2YL2A 1P9LA 3UXMA 4ZU6X 4K6HA 1L5KA 3CSDA 5TGTA 1CY0A 1KI8A 3H16A 1J21A 2AC4A 4Q9HA 1L7PA 5CT5A 5LZ5A 3QMWA 4B74A 5EWLA 2PH5A 4ZYTA 1GKYA 3BDAA 3A1DA 4LSGA 4JASB 1YDMA 3A4TA 4J49A 4MP8A 2VDRB 1D4AA 4R5MA 1QMPA 1SWVA 3FPKA 2UVDA 1Y5LA 2YIVX 2EKPA 2FCAA 3OSZA 3PA6A 5FWAA 4QOJA 1RI5A 3F1LA 4AYWA 1QGAA 5LD2C 3T8YA 3FBGA 4LK2A 5AJUA 1LDEA 1ODCA 4HHEA 1CIPA 5L4NA 1C1DA 5IH3A 4EF4A 2FK7A 3RFVA 5FWYA 1WBBA 3CUTA 1RMYA 3BDVA 3MWJA 1EFUA 2BGLA 4AJEA 1DCKA 2ZPUA 3L8FA 1RBZA 3JALB 2V5UA 2IYSA 4JH0A 1LW7A 4ZDKA 4POAA 5GV8A 2Z3ZA 1H1DA 1LPOA 4KVGA 5GGXA 5B1SA 4A0RA 2F7SA 3H1TA 4UDXX 2APJA 2VYCA 3O95A 3REQB 3HSYA 1N2ZA 3HP7A 1PR9A 3BZBA 3BWBA 4KO4S 1U2ZA 3FJ1A 3IVRA 5I7VA 1YB2A 2LDBA 2OV8A 5JD3A 5LKAA 3AFIA 1J5EB 1MEOA 2QRKA 1OLXB 4YMLA 3PX7A 2D2IA 4FGSA 1RHUA 2DLCX 1TYZA 1KAQA 1XWIA 2ZUVA 4M1WA 5IT4A 3PNYA 1BGXT 1B2RA 1U7XA 4Q9IA 1YHYA 2BUAA 4JLWA 1Z4IA 4Q4HB 3T38A 4AUNA 1P72A 4JGIA 1Q7EA 3WL3A 4F7WA 1WP9A 4EYSA 2ERXA 1Z4MA 2CMGA 1OU4A 2F48A 2I6TA 1VZ3A 1ZUIA 2QPTA 2YTZA 4I5EA 1XXHA 4J1TC 5CK4A 1XV5A 4WL0A 3RC3A 4ZHQF 4KBFA 1G20A 1ZMBA 1O5OA 2Q9BA 1NVMB 3KUXA 4J16C 5CFZA 3DG9A 3W5CA 1SIUA 1MJ5A 3F7MA 1A8SA 2H85A 3S7ZA 4BZQA 2RK3A 5BOSB 3HMQA 2Q28A 1GGNA 1QIFA 2WFMA 4Z7OB 2F8MA 3B53X 4INPA 4Z0TA 2BCEA 3DWIA 3LC0A 2P6NA 4LGYA 3W5JA 4NCBA 1MBZA 3DVQX 1CRZA 4Y9DA 4IWNA 5ADUS 2X6QA 5KNDD 4HH1A 1T5SA 3WGLA 2E4VA 1UKBA 5I4BA 1CEYA 4HVLA 4RKRA 4CIBA 2QTAA 4PRLA 4BVHA 1LGYA 1D03A 3PUJA 1OWNA 4YRZA 4QM7A 3HB4X 4CKEB 1Y9AA 3ETNA 2V7GA 1L1QA 2M98A 1EI9A 4L2IA 3SKYA 3R7BA 4A5SA 1I3MA 1YCFA 4CLDA 3C1UA 4X44A 1GG8A 3IURA 2W2PA 2CUTA 3G88A 4A0FA 1F1JA 1U2SA 2B8NA 5AVYA 2AIRA 4ARCA 1UMKA 2RI6A 1WPXA 2IW1A 4MMZB 2CLHB 3CEHA 4ISBA 4MS4A 4MWSA 1E9FA 2MTBA 4JB3A 2F3UA 2GJ9A 3L0PA 1L8LA 4YR9A 2TMGA 2YWRA 3B2NA 3DBIA 3Q7TA 3IJEB 2MYTA 4N7RA 1UFVA 3LGAA 4KXWA 5FL3A 3GBPA 2CCGA 2X8LA 3S7TA 4M0EA 2VTBA 1VLMA 5ALXA 2PD3A 1W34A 3IQHX 3TQCA 2Y8EA 2QRHA 3OCYA 1YUMA 4Z8XA 4XUDA 5K9ZA 1IATA 3LW7A 3MGGA 3R9XB 3IPCA 4A2QA 2PXXA 3QX9A 1YR3A 4H0CA 3N74A 3OD1A 3UMMA 1DNPA 3O4HA 4G0PA 4N3BA 4B6GA 3RVNA 4PPQA 4KO2S 5TLSA 5TV2A 2ACEA 1RJFA 3EZYA 5ARCA 3LXUX 5C1PA 4PQGA 1FA9A 1N6LA 1EVYA 3LK6A 1KE2A 1X7WB 2Q6KA 4Q6BA 2TYSB 3TUZC 2BGKA 1II8B 2VPIA 1E1RA 1D0IA 3EXFB 4X20A 1THTA 1T8PA 2LV8A 3TTTA 2ZSAA 2C31A 2RAFA 2ZWPA 3PFGA 2IKQA 4U7JA 1D6JA 1W29A 2B8JA 2X42A 4L85A 4ZAXA 4B3BA 1F6BA 4N40A 5DWQA 5K03A 3RKRA 2PX3A 1DJPA 4LDRA 4RSRA 3UV6A 3KQLA 3G8YA 4L8VA 1DQPA 1DV2A 3Q5DA 1BQEA 3HCAA 1OU0A 4KXLA 4DHWA 3W34A 3R5HA 5CJ2A 2VA9A 3MWFA 3OKFA 4E5MA 3IE1A 5AJYA 4ETNA 5FOVA 3LP5A 5JECA 4LSMA 2PUVA 2WDPA 3DBLB 4F3TA 1A4XA 3HZRA 4CG3A 4EIWA 4B40A 3L8MA 2HF2A 3BGSA 1DAMA 4CIAA 3N6RA 2DPMA 1EGQA 2H2AA 1GT6A 2QUJA 3M4ZA 2VJMB 4KYVA 3RU7A 1OQAA 2OV3A 3OT4A 4FFRA 5HYVA 1JYEA 1J70A 2XX3A 2VEOA 1COZA 2FZ4A 4NBNA 4AMBA 4BFZA 2ZUDA 2KJQA 3U16A 3WAJA 1VBMA 5DYYA 3PXAA 3SF8B 4MEAA 1H42A 4KWTA 1KYWA 1V4BA 2Y6UA 4YRQA 4V1CB 1N0UA 1UCFA 4QU8A 1FQJA 3NHWA 2IK8A 2YMQA 4F97A 2IF0A 2KPOA 4NNJA 3U80A 1E1KA 4HNHA 4YRNA 5CEFA 5FT9A 1VL0A 3EIUA 4XGIA 1QUFA 1W4ZA 5TC4A 4DV5B 3AJ9A 4M89A 5K45A 2ZT5A 4WW0A 2HK6A 3QU4A 3WI7A 5LA6B 3SICE 4DT1A 1Z33A 2H9YA 4H31A 3LS2A 3QKIA 1IZ8A 4QHTA 3T1NA 1FXWA 5J2UF 3H0KA 1HXHA 2JZOA 4TKLA 3A4IA 4FYPA 4Y6SA 1KVQA 3EGIA 3ILXA 3GFRA 3PKZA 2J1LA 3QA9A 1RHKA 3ZI4A 2JI8A 2QZSA 3ICQB 1YTLA 3P26A 1CR1A 1ZOPA 1Z0DA 2IS2A 2W48A 1LK5A 4P58A 6GPBA 1U2TA 3RRMA 3DOEA 1K06A 1P3DA 4JS0A 3TZBA 1XZJA 4E33A 1U0JA 4KFTA 2VRBA 5B3LA 1RVV1 2EJWA 2ZYHA 3WMGA 3BK7A 1WZUA 2GCEA 3OWXA 2ICAA 4CN8A 2ZI9A 3KSZO 1XTBA 4J29A 1SBQA 1NQ5A 4O2RA 2H7YA 2Y0BA 4WX2B 4PFKA 2E21A 1F51E 1UFRA 1XZGA 5D3KA 1XTVA 4CIYA 5CD9A 3JAKA 4MRVA 1GFWA 1UPCA 3U4QA 2MR6A 4NMHA 5EMMA 5HOEA 2WV9A 4CM6A 4YAFA 3QMMA 3J7TA 4N41A 4Y2HA 2J7KA 3WLTA 2PSEA 1AF7A 3OUTA 3NBQA 1WDWB 3AP1A 3E9RA 3HEAA 3I39X 4KEAA 3WK7A 4AX4A 4BU0A 3MXTA 5DCWA 1S2MA 4CQMA 2QG6A 2IOQA 4EI8A 4MJXA 4B17A 3VYRB 1QTRA 3FJYA 2NG1A 3M83A 4R31A 4Z9YA 4AN4A 4JBHA 3I9MA 4PG5A 4PHHA 2H2WA 3QYPA 4XQGA 1NU6A 5A4FS 2J9RA 2Q4OA 4ZQGA 3EA4A 2A1UB 4N6NA 5KJEA 2AD1A 1RQ7A 3C74A 2HQOA 4KSCA 1AVTA 1Z28A 2I2WA 2ZS8A 3PU6A 1V3UA 4BQNA 2QBYB 4RENA 2NTVA 5EP1A 2Q49A 2OKCA 4BGEA 3KJHA 2I76A 5JPCA 2W11A 3FIUA 3DP7A 5EXTA 4DARA 2GBCA 3NV7A 4FMDB 3D59A 4ZVUA 1YDEA 3OZBA 2SKCA 9ATCA 3ZX5A 4EJ0A 5C5DA 3WZ2A 2FEPA 1NQOA 4N6OA 4S05A 3P9CA 3UV7A 3UJ6A 4BWFB 2VUSA 2DFNA 2BHLA 3GU3A 1OXUA 2C04A 1M0EA 2C5AA 4O4IA 3AVVA 4IIJF 1RBQA 2HMAA 5KPDA 5AKGA 3F7NA 4AW9A 4EENA 4LFBB 4MWTA 2QMOA 1GQYA 2XB4A 1ITZA 1Y1SA 4UASA 1N9ZA 1WHSA 3CZ9A 1G42A 1IN5A 4QOHA 5JDCC 3ROZA 4QUHA 1VZ2A 4UVIA 5HZHA 3I1YA 3KSBC 3ZE9A 4XB1A 1ATIA 1TZ2A 2YJNA 4LDJA 1E63A 3I2FA 1UBKS 3N8NA 2GM9A 3HEBA 4XKJA 1S2NA 2G1PA 2WWXA 3CY6A 3IR5A 4ZQBA 1LJUA 1X7ZB 2LIVA 4OMCA 1S3GA 1RADA 1ESCA 4MIOA 2GYUA 1PGPA 1E3WA 3TOVA 1ABFA 3JD3A 2SCUB 1KRXA 3C14C 2BWJA 3WTBA 3ONNA 1K66A 3SS7X 2BEJA 2FETA 3AETB 2A57A 4G3XA 4ZMSA 1PR4A 1SCUA 2CXNA 5F52A 4EY8A 5REQB 1DKRA 1CYDA 2HRQA 3JQBC 4S04A 5HRUA 1J23A 1FLNA 3D4IA 2WDZA 5NLLA 2HIAA 3R77A 3OTWA 4JY7A 1UK8A 4PHTA 2CN1A 1SPBS 3BC1A 3IVGA 4KR6A 3UUWA 4HG2A 3N2KB 5ITWA 4X9XA 1I4OA 4JYBA 1O03A 4M1KA 3LCRA 4L51A 4DA8A 1A7UA 2AI1A 1LC0A 1JMYA 1JVNA 2OMKA 4R2XA 1EWTA 3OF2A 4BNXA 2QQ5A 5HNKA 2QVXX 1USKA 3TK1A 1FUYB 5EIOA 4LYFA 3U48A 4O25A 2QTBA 5D3ZA 1P9WA 1G8JA 1U1GA 1R18A 1NBAA 3IAEA 2P9QA 3H6GA 5C4IA 5C52B 4IILA 2G70A 2IHUA 1KI1A 4IP0A 1OI3A 1VMEA 1M5TA 2R79A 2ZBGA 4FHZA 5D85A 3WGVA 3VKVA 1Z0SA 4XCVA 1H22A 3UB3A 4EG3A 1DXQA 1IXSB 2QEQA 1O89A 1AY0A 4E2FA 3ZZ1A 3OP1A 1AKVA 3GLHE 4LDAA 4L8FA 4M53A 1RWBA 4EI2A 2FWMX 5MDHA 2H5IA 2E5LB 3ZD7A 4H7JA 1KOFA 2D5AA 4L5IA 1LWOA 5DM60 5A4AA 2VDWB 3D1JA 2Y05A 3B12A 2OHVA 1CRQA 2EL9A 3ITNA 3JQDA 5LDGA 3BF8A 4DEYA 1U8AA 5H0IA 4E4TA 3JZMA 3OQ6A 1DX4A 1TGYA 1Y3HA 3VU9A 5I51A 4TL9A 1JHMA 1E2JA 1BKYA 4P4TA 3EEBA 1JQJC 1ZONA 2BFBA 2D1QA 3CB4A 1Q14A 4JIMA 4QFBA 1K08A 2YY6A 5JAHA 5JCOC 1QK3A 2J31A 2JFOA 4NAHA 4RU1A 4DNFA 5HK8A 4AJJA 5A04A 4NQZA 2ODQA 5JWOA 4R16A 1SIBE 4KFCA 1SFRA 3U6BA 2CW5A 1DXYA 3LFHA 1EUCB 3NKFA 1CZUA 2A9PA 4LCBA 4WZBE 4BO5A 2E4ZA 4TMZA 4C89A 5A4MS 3WGKA 2XUOA 1R12A 1O4VA 2BGUA 2IOHA 4K9OA 2X6TA 3AUXA 4B80A 1NJ1A 1E60A 2PKWA 1Z34A 2I2BA 4IHJF 3BEOA 5K3CA 1L8QA 3DB2A 4J0KA 3VTKA 3HJRA 5L51A 3M6VA 1KMHB 5KOJA 1VSUA 1R66A 1ISFA 3MB8A 4Y9TA 2BPOA 4CTNA 4AJLA 4DDWA 3WJ1A 5DHSA 1FFHA 4BBAA 5ILOA 1QQAA 1XE3A 5FULA 3S6JA 2G9NA 3MJCA 2C3PA 4M87A 4PX9A 3O1HB 1NBHA 5AHWA 2A14A 1BKSB 3UFXA 1XMPA 4J0HA 3UWMA 4J7CA 4D0LB 5D3MA 3P19A 4IR7A 4W5HA 1Y4UA 3ZWDA 3QPBA 2D5IA 5B36A 4Q9JA 4YNBA 4C6SA 2GGSA 4W7IA 3SQLA 2JA2A 1TX4B 1NSYA 1ZHHA 4HYYA 3NT2A 3FTPA 4WIAA 2R87A 4WXRA 3WXMA 3RU9A 4M21A 3ND5A 4E5VA 5CG2A 1HFKA 3KQYA 4RACA 3IAS6 4YDHB 4IDCA 1X86B 2MINB 5LDHA 1NC3A 1SWWA 2W6QA 4JFRA 1WL8A 3IJPA 4DL9A 3C3KA 1U0OC 1UMDA 4FOPA 4HH0A 4IOJA 4QDKA 3PRJA 4O4LF 1MVLA 3KALA 4H4EA 4JLJA 3FOZA 1Q7GA 1KOLA 2V9ZA 2AOVA 4E88A 1ZU5A 4F9FA 4DF3A 4PBSA 3P9NA 4BKUA 4G0MA 3CJQA 3AL0C 5IABA 3RD5A 4BKRA 2EZTA 2OFOA 2XCQA 3VDXA 4JGGA 5IAOA 1TM3E 1L7AA 3PJFA 4D41A 5C81A 3AY3A 2WHEA 4KSYA 1UEXC 2WZQA 4PTYA 1HLFA 5DXFA 4ZAZA 3SYLA 2GD6A 1A82A 3IPRA 4DB4A 1JSRA 1YS9A 2QQFA 2V4ZA 3M8KA 1ECFA 5I3ZA 1FYEA 2JLWA 3SSMA 5I48A 1QIIA 4GQAA 4R9VA 3K70D 1II9A 1RPTA 5DASA 1RWXA 1A8HA 1V39A 2L17A 4HZIA 3Q3VA 5EESA 5HF6A 1PHPA 2HV9A 3AEQA 3QNWA 2HU8A 2NUTA 4EVIA 4CE6A 4MKHA 5B1YA 4JYZA 1B4DA 4QQKA 5EERA 1YULA 1GZSA 1Y7IA 2PSFA 3DA8A 3A36A 5IK2A 4JHXA 5IUJC 1ESZA 3AR8A 1OFGA 1TJ4A 1CUHA 1PR6A 2OVBA 1FMTA 3V97A 2I1VB 4I3FA 1JH8A 3ZOZA 1W85A 1ZR4A 3GA5A 3WV5A 2CXTA 2AN4A 4PGAA 3RS4A 3ZV5A 4DR1B 2BM0A 3I1JA 5CFPA 1I80A 2CZGA 5I8PA 3E9ZA 4CEIB 2J3EA 1VSTA 3DHWC 3MNFA 1D6MA 3IR6A 3WL5A 3IYLW 4IGEA 2NXJA 3GFPA 4MYSA 4W1PA 3RFFA 5MFPA 2B7CA 3A05A 1JJAA 3BF7A 1A8PA 3LZ6A 4CF6A 5H68A 1EIWA 1L5GB 4FSDA 4UDNA 1N5DA 2O14A 3KWJA 2JBAB 2HJGA 1DWPA 3PWZA 5LIRA 2CLFB 3TI9A 4MQMA 1LBEA 2P9EA 5K3AA 4R9NA 1M2VB 2PO5A 3MWYW 4BJ6A 4GVXA 1G7CA 4BLTA 1DJNA 3GL9A 2CDRA 3NHZA 2V7TA 4N82A 5LXTA 1W36C 1G8AA 1AZWA 3DTYA 4C3ZA 3L0YA 2H0QA 4BNJA 3U4AA 5JTUA 2C0CA 1UWLA 3FWNA 4FJ2A 3R0QA 3R3XA 4JROA 3VXKA 1R4ZA 2O8NA 1CEXA 1ND6A 1B2LA 1YU9A 3GLTA 3HA5A 3PFKA 4JR0A 4O4HB 4QGHA 5CVVA 1DTWB 3KXDA 1HF3A 4ZDWA 2WWRA 3PDCA 1W25A 3IT2A 1P62B 1BROA 3Q7IA 4BWGA 4X6UA 3P4YA 3PFBA 2R6AA 4RJKA 3MQ2A 4XDGA 4MHSA 2BZ1A 4G0QA 4RYDA 1MXHA 2IDMA 2VHVA 5HXAA 1TU0A 4FBLA 1L8XA 3DBRA 1Y6GA 1PJ4A 3T9CA 2QMYA 1R9GA 1B0ZA 2QOEA 4WN9A 3AF3A 1NPDA 3KPWA 2RGYA 4CHGA 3B1JA 3E5NA 3QKWA 3RUIA 4ID9A 1YDFA 2X4GA 2X8WA 4IXWA 3KKKA 4ZT5A 3NOQA 3TXYA 1K9SA 2C2XA 5KDDA 2YVUA 3UH1A 4B7AA 1RC1A 3TB4A 1ZMRA 3SY8A 4TWIA 4GX5A 1E3MA 1HI9A 3CW9A 1PQWA 2AJTA 5FUWA 5HMMA 4TS9A 3RNOA 5IFKA 4RA6A 1XBTA 1MAVA 2XJ9A 4RD4A 4RVUA 5M5BA 2F3QA 1GZ5A 2QJTA 3GG2A 4RH0A 3T5BA 4CVNA 4P81A 4YUYA 1BGVA 5JH7F 5LR6A 1FP7A 5HP4A 4NZ9A 3F5DA 3R3YA 1XJQA 1WULS 1Y8RA 4MQBA 1KNQA 1VKRA 2B5VA 4LHEA 2C7GA 1CUZA 1DVRA 1HOTA 1YIAA 3GEBA 4M9CA 5JO0A 4UARA 1D5WA 4EUSA 2B4TO 1D5CA 2W2NA 4I50A 3ZD9A 1LSJA