1HE8B

Ras g12v - pi 3-kinase gamma complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Kinase/hydrolase
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT, GAMMA ISOFO
publication title Crystal Structure and Functional Analysis of Ras Binding to its Effector Phosphoinositide 3-Kinase Gamma
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he8B00
5DLQC 3AM1A 1ZC3A 4DCVA 3SBEA 4G5GA 1N6IA 4A8JC 4DLVA 4P3YA 5JRJA 4PPNA 4GZMA 4LUCA 3CWQA 4HEJA 3PQCA 2UVQA 1QG4A 4KO8A 1JAHA 4O0MA 4FCWA 4M4SA 1KSHA 4BZQA 1UFQA 3P27A 2V1UA 1G1MA 5CJPA 4IEIA 1NF3A 5FTNA 1JJVA 3FMPB 4BFSA 5L3QB 4KVGA 5JJKA 1ZM3A 2QMHA 1SVLA 4A8JA 5FTJA 1YKSA 4NBSA 1UJ2A 2F6RA 2VSOA 2ZI7A 3P26A 1GRQA 1G8GA 2P65A 3KTAB 4LBZA 1RRCA 1ZW6A 3GLFB 1P4SA 1X8KA 1NMZA 4ASUD 2EYQA 1E2PA 4ZCIA 3LFUA 1TMKA 1ZNYA 3A58B 3NEYA 2R65A 4EQ6B 4A6XA 1JBKA 2ZYTX 3OEHD 3U2QA 1OHHA 4QC2A 2WV9A 5CB6A 4C0KA 3V00A 3ETLA 1G6OA 4QJ3A 3MGCA 4DSOA 5AJXA 1II9A 5FL7D 4EJSB 2GTPA 2BBWA 3Q3JB 3BFVA 1W4AA 3GMTA 2GJAA 4U5XA 4HUQA 3CX8A 4PTLA 2B8WA 1XTQA 2NPFA 3WMEA 2ZI9A 3KQKA 2ZRMA 5FOSA 2CE2X 1PLJA 1CS4C 2L0XA 4K81B 4G5RA 2KB0A 1I2DA 2O8DA 2WWGA 3BK7A 5B2ZA 3O8BA 3KB2A 3QF4A 5D3QA 2BEKA 3VMFA 3DMNA 2G83A 5J5CA 1Z22A 3KJIA 4W9MC 3R9WA 1OIWA 4RJLA 3GEEA 5JZVA 2WZQA 2AX4A 3KKPA 2IYTA 4BEJA 3TVDA 1NJGA 3ASYA 4Q9JA 2AKAB 2IYRA 2J0QA 4X8OA 4JYBA 4A82A 4MGIR 4DWJA 4FWIB 3FB4A 4LYFA 4HUTA 1XMJA 3PCRB 3SS8A 4DLTA 1SHZA 1E1RD 3L0PA 1NG9A 2F1JA 2JATA 3T1TA 2IS2A 4MA4A 3A37A 2V4ZA 4NL4H 1KO4A 3FE2A 4JBYA 1E2FA 4JLBA 4PXAA 3MRSA 2VBCA 4RD1A 2IYVA 3I8SA 1PJRA 4CEJB 4Q1FA 2OXCA 5AWFC 1MOZA 3I73A 4C7OA 2BCGY 4M1MA 3REFA 1NY5A 5CYOA 2QT0A 4FMBB 4TYYA 4UXHA 3OAAA 2QI9C 4XIGS 3TIFA 1IN4A 2RGDA 2O8CB 1OXUA 4JLVA 2F9LA 3BOSA 1XWIA 4BWYA 2AXNA 1KMHB 5H1YA 4M53A 1Z08A 3LQRA 2XNDD 3PVSA 1ZM7A 3LH5A 4LY6A 1WP9A 1LFDB 1M6NA 1ZP6A 2IYUA 2EWWA 3LW7A 3UWKA 3EA0A 3PEWA 4LJ4A 3U3OA 3A6PC 2YINC 4ZI3A 3K0SA 4XVQA 4RD3A 3S1AA 2D2EA 1N6PA 4WA7A 1NI3A 4D82A 2IS6A 5H70A 3IILA 3TW8B 2QPOA 1G17A 2QSZA 4TT3D 1IONA 4NYMQ 2WJIA 1ZUIA 1MV5A 2RGBA 1GAJA 4NU0A 2QBYA 4FCTA 1I4DD 3C5HA 1P60A 2CJWA 4AKEA 2P6RA 3OFNA 4YXWA 4OK6A 4LYJA 1AJEA 5JSZA 3T1QA 4B3BA 1DAEA 3X1ZA 3QIAA 1D2MA 3P20A 2J7PD 4OKSA 2C9OA 1UEIA 1NKSA 3WY9A 4B6FA 2VSFA 3EZ7A 3R20A 2AFHE 4L5BA 4TLBA 1MABA 4P32A 4FN5A 4TMVA 1DAMA 2O8FA 1CEEA 2HT6A 3AVTA 2XXAA 3DO6A 5GJBA 4NCIA 1IJFA 4XD7D 4NZYA 4C0AC 2BWJA 4NH0A 4QXAA 2RGEA 3MWKA 2QQEA 3SEAA 4AYXA 821PA 2F1RA 5AUOB 3RRNA 1T6NA 1KZGB 1E2IA 4PZLA 1KGDA 2RGNC 4HSEA 3AVYA 3TH5A 2ZR0A 2JLSA 1HT1E 4GOXA 2ZITA 1ZM2A 4X8MA 1T3LA 3MWYW 4Q4AB 1TADA 3EWAA 1R8QA 5DSZA 1ZYUA 1LVGA 3H84A 4UNQA 4UNPA 4WW0A 1E3MA 3FYHA 3K0AA 1T4GA 3GJ4A 2QY9A 4PC2A 1FX0A 2BKEA 3QSYA 4IW3B 3I5YA 2RGNA 5HZKA 2ZVQX 1OV4A 2H1LA 4HZUA 2ZJ5A 4JLDA 2WMOB 1RPZA 1JI0A 1W44A 2XTNA 4M1YA 4TWZA 5DH9A 4DB2A 5JEDA 4D0LB 4IEEA 2ANCA 4F92B 3OHMA 4A0HA 2PEZA 1CF4A 2YHSA 3MSXA 1DO2A 2ODNA 1KMQA 2ZRKA 3EWSA 2IXFA 2VRWA 4ESVA 2AK2A 2BHRA 3F3YA 2DHRA 4JLNA 1DPFA 1GOTA 2H18A 1OE0A 2DFTA 2P5TB 3SJCA 4I1OA 4Q4LA 4OK3A 1JQJC 3T1VA 2HF9A 4JYCA 3CO5A 4PC7A 1DARA 4MGZR 1AQYA 2P67A 1UAAA 2W0SA 1Q3HA 1ZNWA 2ODBA 3DEFA 1UF9A 2J5XA 2HCJB 3LXXA 4UKDA 1KHTA 1VYVA 5C46F 1N6LA 4ZI2A 3ZVNA 5UKDA 5FOTA 4BLOA 1VTKA 2FZLA 4NMMA 5JFGA 2ZAOA 4A1FA 1F6BA 2IK8A 2F9MA 5FH9A 1LW7A 1M8PA 1E98A 3BJIC 4MUAA 1T8TA 2VF8A 1Q0UA 1R5NA 2C8VA 2OHFA 4PO8A 4Y0VA 5H68A 3W8NA 4B43A 5FUWA 2WAXA 2FV8A 3SYNA 1UKZA 1AIPA 4LJ6A 4UNNA 4B32A 4FCVA 1K6MA 1RJ9A 5EE0A 2XZPA 1KSJA 1NN1A 2A9KA 4DBLC 4EPYA 4MYTA 4LHZA 4PC6A 1LTQA 5TVKA 1KK3A 4M9QA 2ATVA 5EUMA 1ZD9A 3U61B 5CLQA 1EWRA 3A1SA 1PV4A 1XEWY 4Q4JA 2REOA 1IOZA 3LRPA 2HT1A 1E9CA 1G5PA 1W2HA 2AD1A 4XJXA 3BWDD 4NDZA 2W6JD 4U02A 3MD0A 1U8ZA 3AGPA 1IXSB 5LDDC 1D2NA 4F4JA 2WKQA 1P9RA 2WSSD 4D0GA 1TEVA 4PAQA 5CM9C 1KAGA 3HPRA 4RFVA 621PA 1VIYA 4V0KA 4S35A 1U9IC 1JQLB 2OEPA 1NBMA 4AWXA 1E2NA 2IYSA 1E6CA 5J47A 1H65A 3LLUA 1TTTA 1OB5A 1XX6A 2CEAA 2CXXA 2X19A 1XXHA 1XMSA 2A5FA 4TN1A 1NIPA 2VO1A 1DS6A 5HPYB 5F9FA 4HLDA 1GL6A 1KIMA 2CE7A 1U9IA 5BW8A 4KFRA 2IYLD 3AVQA 4QHYA 1XD2B 5CK5A 2X2EA 5LPNA 2GZAA 1TQ2A 4OJKA 1KK0A 4Z8XA 1Q57A 2J45A 3A4MA 1AS3A 2N42A 1AGPA 5L8VA 1OH5A 4B76A 2PCLA 1OHHD 2BM0A 1RRFA 2GZDA 1GRRA 3DPUA 4URXR 1KI4A 2A5YB 2IYYA 2AXPA 2VHQA 1AS0A 4DCUA 2AFIE 4OBEA 3E70C 2PMDA 3WRXC 1T9HA 3K70C 4LBYA 3LAWA 4BE7B 5EZ5A 4BLQA 1W46A 3B1ZA 3SZRA 1OFIA 2IWRA 4I99A 1QHGA 4D4KA 2B7CA 2OAQ1 1E99A 2O5VA 1KDTA 3GLIB 3QKUA 4W5WA 4CEHB 2D4HA 4Q1DA 1OJLA 3FHOA 3RANA 2IT1A 4B75A 1IN8A 4A36A 4HDQB 3TR5A 4RD2A 3ZZUA 4JLKA 1II8A 2UKDA 5AUNB 3FMOB 2FG5A 4NPHA 2C95A 1N25A 4B74A 2IS1A 2OESA 3GLHA 3GFPA 2ZEJA 3KFVA 1XF9A 3KXIA 4JL6A 5TB5A 4D0NA 1XTSA 1FFHA 4RZ3A 2WJVA 3UKDA 3Q5EA 3EIQA 3PG5A 2QMOA 2FFQA 3FKSA 3ADKA 1N5LA 1TUIA 2Z5FA 1XDBA 1OSNA 4EKDA 3VR4A 4IOKA 5HR5A 3AP3A 3TBKA 4ESHA 2Q9BA 1WF3A 3V4RA 2V6JA 3FMIA 2DWQA 5L3RA 3U3RA 1U2RA 4KU4A 5FFMA 4O2RA 2RGCA 3D7MA 2P6UA 3OESA 4E03A 2D7CA 3NBYC 3MWJA 1AKYA 5FI1B 4C4PA 4F91B 4JSYA 121PA 4Q1CA 2RGAA 3RABA 2ZR7A 3LDAA 4HDOB 4TLEA 1P2VA 2DBYA 2GBLC 3K0FB 5L3QA 3G0HA 2BOVA 3FGNA 5LB2A 2GDJA 3QQ5A 1Q22A 4YMSA 4OQMA 3KTAA 2QU8A 2ODWA 3GLFA 3OIVA 1VHLA 2IUSA 3W34A 3X2SA 2C9CA 2SHKA 3QJYA 3WNCA 1TU4A 1EX7A 2C99A 3E5HA 3BFXA 4Q9IA 1DG1G 3NEJA 5GVRA 3ECCA 3U44B 2IS4A 2GBLA 4ITRC 4EQ6A 3SC3A 4YXWD 3U7GA 3M0EA 1W0KD 1VG0B 1Y63A 2FX3A 4FMDB 4B3XA 4IOJA 3AVXA 2CL6X 1JECA 1QVAA 4F93B 3C15C 2X2FA 4P33A 4EFNA 4EJSA 1V5WA 2AHOA 2OCYC 2X8AA 3EPJA 1PUIA 4A6PA 1KO5A 1KJZA 1XJQA 1OXTA 2B7BA 2CVFA 2FZ4A 3BC1A 3C7KA 3KJGA 3IIMA 3GP8A 2EFDB 1FTNA 1JJ7A 2FN4A 4BFXA 4PX9A 3W5JA 3CONA 4LHYA 4V0OA 3ND9A 5CYPA 3JVVA 1J7KA 2PZGA 2LCFA 2ZRHA 4LBVA 2GJ8A 1W0JA 1N6OA 2JEOA 3ZYCA 2C96A 1YZKA 1L7VC 1P73A 1RKBA 1X1RA 1XD8A 4JSTA 2XZLA 2AWNA 2ZI3A 4Q1EA 4HLQB 4R98A 4DJTA 1KSFX 2WBLC 1X8LA 2EU8A 2JLZA 2C9YA 3PV0A 1GVNB 1E0JA 1QVRA 2LWIA 3HYRA 2F7SA 2W58A 2PT7A 5KDOA 3EZ9A 4B3CA 3QXJA 4TLAA 4CEIB 1GNPA 3UWOA 1E9SA 4F7WA 3BORA 3GEIA 2FNAA 2MMGA 4FW9A 5M04A 5KYKA 1S2MA 4CEJA 2GK6A 4WXPA 5A0FA 1IN6A 1COWA 2AKYA 1U90A 2QSYA 4YDHB 3B9PA 4RCZA 1BMFA 4OI2A 3Q5DA 3JZMA 4UJ5A 3IO3A 2P5SA 1KJWA 1S1MA 5JCZA 2A2ZA 4C2TA 5JJIA 2GCNA 2GWHA 3C16C 2O8CA 4URUR 2HJGA 1KMHA 1GKIA 1FP7A 3ZLJA 3VKGA 2ZSEA 2J3EA 2ANBA 2QT1A 2N1BA 1CJKC 4LX0A 1ETUA 2ZYUX 3QBVA 3P4XA 3ZH9B 4HLUC 3IGFA 1XU4A 3CRW1 2ZYWX 3LV8A 5FBQB 2IEZA 4UNRA 1UEJA 2A30A 3KL4A 2JLYA 1YRAA 2RCNA 4IFEA 2BJWA 4M1SA 2MSEB 1TQ4A 1Z47A 4PQYA 4WXRA 2P0EA 2QA5A 2ZUDA 1C4OA 1I4LD 1YR7A 3RS5A 4KITB 2G0NA 4MUBA 4RCYA 1E2DA 2EYUA 4FMCB 1UBGA 3LWNA 3LY5A 3F0TA 3THWB 5JEEA 2IEYA 3WYAA 4HLUA 4KFUA 1PZNA 5FR2A 1QHXA 3AVPA 1SKQA 3MMPA 5DN6A 2Q3FA 4QJ5A 3N2IA 2IYZA 3ND8A 4MKGA 2JIZA 3GD7A 3DM5A 4JVSB 3UMRA 4ZDJA 1IBRA 1MH1A 1YRBA 2AWOA 2QGNA 3NH6A 2XB2A 2GK7A 3PUVA 4ZDIA 2ZRNA 3TK1A 4B48A 1NRJB 1U0LA 1GTVA 3UMFA 3IQWA 4I1VA 5J4YA 1TUEA 4AYWA 2ZJ2A 2NO0A 3I3SR 1FUUA 2OILA 3P32A 1G7SA 2YYZA 4LV6A 1K5GA 4R71A 4MDFA 3ZZ0A 3NVAA 1JNYA 5P21A 4DCSA 2KJQA 5FOWA 4C0BA 1N3BA 2J87A 2VQSA 1JXMA 2IW3A 3GJ3A 1GM5A 2GCPA 1G3IA 1Q20A 4UXIA 3TQFA 3RC3A 2WWFA 1XMIA 1XNJA 4HAUA 5BYKA 2ZRJA 1W4RA 2ODEA 3BH7A 3TSOA 4RVCA 4PZYA 4L8GA 2PJRA 4CYMA 4Q4AA 1D2EA 4FINA 4RKEA 5FPYA 5E3HA 1G5TA 3QY0A 4LPSA 2R6GA 5GJVC 3GCGA 1T8UA 2AK3A 4YDSA 2K5UA 3CNNA 5JHGB 2NOAA 1GP2A 2J41A 4KBGA 4PPGA 2B21A 4NCJA 4A0GA 4QRHA 5TARA 4DIEA 1Z0AA 1F5NA 1Z6TA 3KKNA 3W9YA 4IVPA 2J0SA 3KB1A 3R9XA 1BH2A 1QHSA 1E0AA 3QXSA 3WHLA 4JVNA 1AZSC 2DFNA 2GETA 5FTMA 3VQTA 4Q02A 1DAGA 2Z4RA 5ANRB 2Z6VA 4O2LA 3IHLA 3D6TB 4C2UA 3SOPA 2ZROA 4RZXA 3VTKA 2GZHA 1W5TA 3ZS9A 1OIXA 2ZIAA 2A5DA 4KJZA 4AKHA 4NCHA 2OCPA 2ATXA 2KBEA 3O8DA 4A0RA 2GILA 4EPVA 2PEYA 3RWOA 5KSZA 4LV5B 1VMAA 3O47A 4E22A 4F38A 1UDXA 4JLPA 3VR5A 2AN9A 4UJ3A 4ZIRA 1TQ6A 2FPLA 1R2QA 2PCJA 2XSZA 4PAMA 4DCTA 1GG2A 3CWZA 2EWVA 2Q0HA 2GJSA 2HXSA 3A1UA 3EZ2A 5KUTA 1MKYA 3WBKA 1E2MA 4ZCMA 1G291 4KXFB 3IBYA 2XOKA 4PC1A 5AJWA 2QGZA 3MAAC 2BIFA 3THYB 1SULA 2CK3D 4DT1B 5DI3B 1JALA 3BGWA 2GEUA 3OEEA 4MKFA 5G3YA 4C0LA 4MGKR 1Z6XA 4ZKDA 3K70D 1IN7A 1N0VC 3X1WA 1C1YA 3SYLA 1IHUA 5KDDA 4Z1MA 3BERA 3W6PA 3QNUA 5KNDA 4RSGA 2I4IA 4LWZA 1SVKA 3W6NA 4NCKA 2NO9A 1OW3B 4PSAA 4XWOA 3W6OA 1XJCA 1Q1EA 4TL6A 1BIFA 4Q19A 1E4YA 2WKRA 3QF7A 4A92A 2LKDA 5J4KA 2OFWA 3LD9A 1T91A 1FNNA 1ZIOA 2QAGB 3CZQA 4MH0R 4N1AA 4BQSA 1UBFA 1AK2A 2G88A 2JJ2A 1CJVC 1Z83A 1WMSA 3BB4A 5CDFA 4AK9A 2ZAMA 3OIUA 5KPJA 1E2JA 4DLUA 2IHYA 4DLYA 3VHLB 1R8SA 4TYQA 3AVUA 3TJZA 2HLDD 1J70A 1JB1A 5FL3A 3B13B 3DL0A 4YONB 1P6XA 3DM9B 4HDCA 3AP1A 3CPEA 2A78A 4IVRA 4Q9HA 1FPMA 1OPXA 3Q72A 3SBDA 3SFZA 3QE0A 1G41A 4KYUA 2XB4A 1EK0A 2UZIR 4YMUA 4G5QA 1N5KA 1XEFA 1XD2A 1TX4B 3SU8A 2I1VB 1DAFA 1HV8A 2G3YA 4HAVA 1KKLA 4BFWA 521PA 2HF8A 1NVVQ 4KCGA 3CLVA 1N2CE 1YE8A 3A1TA 1ZC4A 1J2JA 1YZLA 3MWLA 1KY2A 1IXRC 3TQCA 3I62A 4LJ5A 3WP1B 5BXQC 5F3WB 1XB2A 1P61B 4QM6A 2V54A 3GLGB 1P9NA 2KSQA 1R0WA 4TQ9A 4CGZA 2DY1A 3HYTA 5FPSA 1NY6A 1NLYA 3RS0A 4JKYA 2ZVPX 1EFCA 4ZV4A 2AL7A 3CH5A 4NYIQ 1Z0KA 4MRPA 4IDHA 4US2R 3CRQA 3HP1A 4X8HA 1SVSA 1F2TB 1W0JD 2QRZA 1NMYA 3RYTC 4DUGD 3GLIA 3FOZA 4CEHA 1N6KA 4V0ME 3BB3A 1E9BA 3BRWD 3GJXC 3G82C 4BUJA 3SDZA 5AK0A 1G3RA 1ONBA 4Q01A 4XSGA 4BFZA 2IYQA 1U0JA 1XEWX 2PT5A 5LD2B 1NIJA 3AF4A 3AF0A 3EW9A 4QBFA 1UBCA 2ORWA 1WA5A 1VG8A 3N5CA 3NC0C 4V0NA 2OSBA 3CRVA 5DHAA 1T0HB 4Y0AA 4Z54A 1RW4A 3L43A 1FOEB 2CL7X 3RS2A 2DWPA 1WCV1 1YZTA 1ZNZA 3ZQJA 4D81A 3BH0A 1COWD 1II0A 3ZQ6A 3UMSA 1KJYA 1E79D 3EG5A 1BMFD 1A2KC 3IDQA 5L3SB 2VP9A 3N70A 1A4RA 1VCMA 3TNFA 2NGRA 1R0ZA 1PLLA 1RIFA 1T0JB 2JCSA 3BD9A 4G01B 1UKYA 2WM9B 3QPUA 1ZD8A 3DOEA 3RDPA 2FPMA 1WQ1R 1OH6A 1W36D 1SVWA 1KI6B 2KI5A 4JLMA 3CPJB 4R9UC 2JDID 2B6HA 3FKQA 1N6RA 2F43B 3SFVA 2OT3B 4XWAA 4XVUA 3K0FA 4JJKA 3KQNA 2BMFA 5BWMA 2GEVA 1E2HA 4G1UC 4AG6A 3MFYA 2P6NA 3U60B 1DTSA 5FI0B 3CX7A 2O0JA 4Q03A 3R8CA 2O52A 1VYTA 5DI9A 2CVHA 3PEYA 2OG2A 3CH4B 1E9EA 1UM8A 3L0SA 2ZM5A 3U44A 2QENA 4L9WA 1ZBDA 5DISB 3AKYA 3U5ZB 2Z4SA 3R9IA 5CK4A 4LDJA 4LSGA 1KZ7B 1UKVY 1T3HA 1T5LA 2ZREA 1DBSA 3DKVA 4H1VA 3UATA 2OBNA 4LI0A 2QQ0A 2JLWA 2JJ1A 1Q1BA 3KFXA 1W1WA 2YNMA 1G19A 3CF0A 5FPKA 1CRPA 3B1XA 1ZINA 5BN3A 2W6IA 1G3MA 3Q7QA 4GFDA 2BV3A 2ZYVX 3OE7D 1HEIA 4LJ9A 2IL1A 1S3SA 3B1YA 5TY0A 5AJYA 2QPAA 2VHJA 2R62A 3EX7C 4N0DA 2QM7A 3FVQA 4BLRA 5B64A 3B9QA 1AN0A 2ZS8A 1BOFA 4Q1AA 1NVXQ 1OYWA 2ZI5A 4QGGA 3QG1A 2CLSA 5FOVA 1SQ5A 5G53C 4CEIA 3SJAA 4JT4A 2JJ8A 2ZRLA 3AF3A 3LA6A 4L4UA 4N3NA 1ZM9A 1VYUA 1G21E 2DPXA 3CRRA 4RD4A 3Q9LA 2I3BA 2H92A 5K8IA 2WOJA 5KSYA 4X8LA 3H2YA 3MJRA 1TPZA 4QOSA 2OBLA 3U4QB 2RKOA 5J4LA 2ONJA 2VF7A 1IAQA 4PHGA 4Q1BA 1MO5A 2YOFA 2ZE6A 3KKMA 3L0OA 3K09C 4ZDKA 3TUJC 1EFHA 1OLOA 1KK1A 2JGNA 4HB2A 4IVQA 3RS4A 2O0KA 4KVAA 1YVDA 4ZO4A 2G9NA 2OUKA 4BFUA 1E96A 1DG3A 1HE1C 1KI7A 3QG5A 4IDNA 2IC5A 4YQFA 5JLJA 4Q9LA 3EC1A 5CIWA 3FHTA 1E32A 4TTQA 5K8TA 2ZJBA 5BYJA 1CP2A 4TYNA 1TEXA 1H8EA 3K09A 2VYFA 1Z5ZA 2WWXA 4JMPA 1W2GA 2PX0A 1U94A 4O25A 4RZUA 3GPLA 2YWGA 4CRWB 3QKSB 2CLDX 2GVDC 3PUWA 1JPNA 2ASEA 1BYIA 1SKYE 3WBJA 1E1QA 5HKKA 3THWA 2QTHA 3VHXA 2VLIA 4ZCLA 3LBNA 3KDSE 1P5ZB 1N0UA 2VA8A 4O3MA 2XOKD 1JR3A 4LOAA 3DVLA 4TQUS 5EXSA 3RNLA 3UG7A 1UPTA 2WKPA 2B8TA 2BDTA 3SJZA 1KDRA 4OQXA 4MQBA 1GITA 1KAOA 1L2TA 2FU5C 3NDPA 4G3XA 1NVVR 4RKFA 1KI9A 4Z1MD 1BS1A 2RH5A 1N6HA 3ZDQA 4IJMA 1SXJC 2HCBA 4UNSA 3PEUA 3UG6A 4PFSA 5TDHA 2D3WA 3ZVMA 4OHWA 1ANKA 2FFAA 1HQYE 6Q21A 3IQXA 2QE7A 4L9SA 4L16A 1DOAA 1OB2A 4NKRA 2O8EB 1A2BA 2NIPA 1VG9B 4PO9A 3T5GA 1OKKA 2JASA 2WPDA 4LZZA 3ADCA 2O8BB 3HDTA 4DLWA 2XNSA 4TMZA 2R6AA 1LB1B 4A8JB 4FWTA 1MRNA 1SXJA 2EQBA 1ZU5A 3EXAA 2JJ2D 3HU2A 1ZUHA 1ZM4A 4E07A 4PQRA 2QN6A 5HCNA 4WZAE 3AP2A 1XCMA 4OI4A 4IHQA 2ZSFA 4Q7KA 5A4JA 2RB4A 4DLSA 2GF9A 2DFLA 4PQFA 2V8OA 3FWYA 5IF9A 2G1KA 2MSDB 1MO4A 2B92A 1NP6A 1G3QA 4QL3A 2QP9X 3AH8A 3PUZA 4JT2A 3Q7PA 2FGJA 3QOFA 2IXGA 4C9BA 1P2TA 3T61A 3L82B 3WYGA 4D80A 2FF7A 3RHFA 2WVJA 2FSGA 2H57A 3CNLA 4ARZB 3MUFA 4E5UA 1LV7A 3LW8A 3ONWA 1Z6AA 4B2IA 3O8RA 2BM1A 3V9PA 1DVRA 4JJZA 1NSFA 3DHWC 2PLFA 1ZRHA 2BC9A 5H8WA 3LLMA 3NBXX 4B3FX 2H5EA 4Z8YA 4D25A 4NHOA 4AG5A 5ELXA 4ACBA 1DO0A 2BEJA 4DHEA 1R0XA 1Z2AA 1N6NA 1KO1A 3AKCA 1M74A 2VTKA 4NYMR 2W00A 3R7WB 5B30A 4YMVA 3RAPR 4TMXA 2C04A 3SQWA 3K0EA 3MLEA 4R7ZA 4MYHA 5DE3A 1NKTA 1MT0A 1ZU4A 1E2EA 1CTQA 2IF0A 3C4JA 4OQNA 4DDVA 1KY3A 3EPHA 2JLRA 2VH5R 3AGQA 5BN5A 4EAQA 2ERXA 3CRMA 1CU1A 3CX6A 5IT5A 1DADA 2R8RA 3THYA 4DT1A 5DI3A 1E9RA 3VFDA 4C0SA 1G20E 1G64A 1D9XA 1XCGB 3QENA 4GZLA 2PH1A 1R0YA 1R6BX 4NYJQ 2QAGC 3AF2A 5FTLA 4M1TA 3RLFA 2GESA 5KNCA 1RFLA 3OAAD 4XVRA 1Z0IA 1AA9A 3H86A 1XTIA 3VX4A 1YU9A 2GAAA 3LX5A 3AUYA 1XZQA 4YLGA 2ZUCA 5DGXA 1A82A 2F55A 1DEKA 4HZIA 4PPFA 5L3VA 2VSXA 1KTVA 2QAGA 1NMXA 1MO3A 221PA 4HB3A 3RSLA 1OYYA 1UADA 2FSIA 3FDIA 1Z2CA 4MRNA 2Q9CA 5EP1A 3CIOA 5IDVA 2XZOA 3KKOA 3NC1C 4DSNA 1SVIA 5KPDA 4GOJA 3BIFA 3K1JA 4QG7A 4EJSC 1DAIA 2WWYA 5HE8A 4HAWA 4U7DA 2GXUA 2C98A 4KLNA 4TYPA 3IIJA 3AV0B 4S2EA 3BXZA 3BB1A 2R6CA 5E7MA 4BFTA 1IY1A 2J9RA 4LC0A 1FL9A 5AUPB 2ZJOA 4ERNA 3OEHA 3OFND 2CLCX 1B0UA 2NTYC 1Q3TA 3R8FA 3P4YA 2GNOA 3BE4A 4IRUB 4A9AA 3W8RA 2MSCB 5FL7A 3K9HA 4IDQA 3QEJA 1W7AA 3A4NA 4ZPXA 4EUNA 1XRJA 2QPTA 1ZIPA 4LJAA 1BO6A 4Q21A 1QZXA 2VL7A 5JWHA 4M8NE 4DSUA 1E0KA 1ZJ6A 3VR2A 4DC9A 3LBIA 1NBME 3GFOA 3EPKA 2R6DA 3NWJA 3Q85A 4AYTA 1MR3F 1VECA 1XXHE 3QEOA 1XCPA 3KX2A 3UANA 3VR6A 1ZCAA 2V1XA 1NSTA 1E69A 2ZRDA 3L8ZA 4TTPA 5FOUA 4RZ2A 1F3OA 1OIVA 2WTUA 4QBIA 2KE5A 5EQTA 3GLGA 4GSYA 2ZU6A 2JJ1D 2ZI4A 3QKRB 1AGRA 1ZVQA 1Z8FA 2HV8A 1O87A 4KI0A 2PLRA 3LXRA 3FFBA 2W6ID 1E1RA 5B57C 5C2JB 3TSZA 3JZAA 1XTRA 1G5RA 4URZR 4A2WA 5LD2C 3QBTA 3T15A 3AUXA 4OHVA 4AKGA 1F2TA 1O3YA 2V55B 4M9XA 3DDCA 4WVFA 3F5FA 5JI3E 4MGYR 2PZEA 4GP7A 2OE2A 1YZQA 1Z3IX 1U8YA 1AZTA 5J4VA 5E7IA 2FEMA 3O8CA 2IA5A 4IKEA 1OH8A 2WJYA 3LO5A 1CJUC 3NBFA 1JEDA 1U8AA 2RHDA 1XPRA 3I92A 3EZFA 2ZRGA 5FUVA 2V3CC 2FH5B 2XTZA 2ZE5A 3EARA 3K0CC 4H9GA 5IK2A 1KSGA 1U0HC 1Z0DA 1ZCBA 2KBFA 2XNDA 1TAGA 4EPRA 4M2LA 5KSPA 2YC4C 4IXNA 3T5DA 5D3MB 3KQHA 1E94E 4JVMA 2FWRA 4B47A 2ZU0C 3IKJA 3CF6R 3C8UA 3E1SA 3QVUA 4NCNA 3VAAA 3IIKA 1KO7A 1L4YA 1MO6A 3K0CA 2VHTA 5CITA 1D5CA 1OXXK 1A5TA 3KUCA 4DCNA 3HU1A 3GLHE 2J0VA 4LV8B 3ZVRA 2GJKA 3FMFA 4B71A 1A1VA 4Q9KA 3TSWA 4C3ZA 4B3GA 2OBMA 4I81A 4W5HA 4QBGB 1LF5A 4LBWA 3G5UA 1G4UR 1KI6A 1T5IA 4FD2A 1FMLA 2IHBA 4JS0A 3RC8A 1G8YA 2F43A 2R9VA 3VKHA 1SGWA 5CIQA 2NO7A 1EFRA 4FI3C 5FBLB 4M1KA 4CW7A 1VCIA 2J7PA 5KOYA 1U98A 2J1LA 5LBIA 4JLJA 2ZETA 2QMUA 3CZPA 2C5LA 3NG1A 3W3AA 1CBUA 1CXZA 3EZ6A 4OL0A 1QG2A 1XD9A 2C2HA 4P4TA 5EXPA 4TZ0A 5HE9A 4N0EA 3VNUA 1SZPA 1EX6A 3SQXA 2D7DA 5HKKD 5FUYA 4HLCA 2NQ2C 2QRNA 2WWWA 5JWOA 2ZSAA 4XD7A 4GP6A 1TQDA 2G0TA 3UK6A 2TMKA 1Q1QA 1X3SA 1JR3D 1J90A 4BGDA 1XPOA 4R2HA 5IHPA 2QTFA 2JLVA 4JVLA 4B44A 1RRPA 2ONKA 3KXLA 2IUTA 2PL3A 1QHYA 3ZD6A 5AJVB 1N0WA 2BBSA 4DIDA 3QPVA 1XTJA 2QUZA 1GNQA 3SHFA 1F2UB 3GLFE 1JXOA 4PANA 2A5JA 1OH7A 1LF0A 4KSCA 1NBMD 3EIEA 4F4IA 3TE6A 2QE7D 2ZJ8A 2ZQ5A 4NE2A 2ZXUA 2DB3A 1XTKA 3ZJYA 4IXMA 1OKKD 2WPDD 3ICQB 1FNMA 2F3TA 1AS2A 1LY1A 1UDWA 4M22A 1SXJD 4D26A 2GA8A 3H0KA 3U7FB 2GXSA 1Y3AA 2H16A 4JBXA 2CL0X 5DYIA 4AKIA 1ODFA 3BH6A 2GXQA 5C4GB 2Z43A 4JBWA 1D6JA 1QBKC 4QHTA 4TLCA 4HB4A 3U4QA 1F60A 1OFTA 1IM2A 2QEQA 3NHAA 5AR1A 4BFVA 4DDWA 3KQLA 3K9LA 4HYYA 2RAPA 3NTUA 1Q12A 1W5SA 2QP4A 4E09A 2OFXA 2Q9AA 4YMTA 2A3RA 4XH9B 2IUUA 1X8JA 3K8YA 1GKUB 1GUAA 3UIEA 4V02A 5KNBA 1M7HA 421PA 1YR8A 1R7RA 3NBZC 3AKEA 3N2EA 5GVSA 1QDEA 5JI2E 5SZHB 4TL8A 4IDOA 2VP6A 2O0HA 2AR7A 5JECA 2RMKA 2I1QA 4D2IA 4TSFA 1G8HA 1P9WA 1SVMA 5FBWB 1HYQA 2PZFA 3B1WA 1OFHA 2XX3A 1IXZA 4LCBA 2GKSA 3U7HB 3CR8A 5C1BA 2E87A 3VR1A 4DRZA 3FKSD 3B60A 3QXCA 4TYWA 4QGHA 4CT4B 1GRNA 3CB4A 1H8HA 4EPXA 2WSSA 2ZRAA 2V9PA 1KI8A 1XBTA 1YHNA 3P1JA 3TRFA 4MKHA 4GL2A 5EZ6B 3EASA 1QHNA 1Z07A 1YR9A 2J59A 1CJMA 4LYAA 1Z0FA 3B1VA 1C9KA 2R44A 4GBMA 2ZE7A 2O8EA 1IY0A 1LNZA 1U99A 2XTMA 1CULC 2O8BA 1N5JA 2QM8A 2Q3MA 2FEOA 4NONA 3TAUA 4KHZA 4U00A 1TL7C 1W47A 3WNDA 5E95A 1FP6A 4I4LA 4JLOA 5EXXA 2XITA 1WXQA 4XWKA 3T12A 4UXJA 2Q6TA 2OV2A 3PUXA 4GOKA 3A8TA 2YWFA 2ZRBA 4DEXA 3F8TA 4OQLA 2A7QA 2WIBA 3EA5A 3TGPA 1XMVA 3DOFA 5K8LA 2BMDA 5G3ZA 3QUSA 3SJBA 4AURA 3KUDA 4CDGA 4LHWA 3RRMA 2JLUA 1WBBA 1P2SA 1HT2E 5SZJA 1J99A 4PHTA 4KYIB 4ARZA 1Z63A 1KOFA 2IWHA 4Q48A 2PJZA 2FDCA 3SYKA 1US8B 4CVNA 3A4LA 5JMTA 4ABYA 4P4SB 1Z0JA 4POAA 3B2EA 3SI7A 4PPQA 4TMTA 1WE2A 3IO5A 1P62B 1GILA 4WOPA 2WWIA 2X1VA 4DDTA 2WAYA 1KNXA 3ASZA 4P4UA 4QKQA 3HJNA 3R7WA 1QF9A 1YQTA 2FFBA 4BEBA 4URVR 1XEXB 3GFTA 4DSTA 1OT3A 4LRWA 2IYXA 3AVWA 1WRBA 2H7VA 5DHFA 3THOA 1ZUNB 1CJTC 4BRUA 2D06A 2OLJA 1NN5A 5KO2A 3V4FA 3ZIAA 1NLFA 3REGA 2VP5A 1GSIA 2XAUA 4TTRA 4EFMA 4TMKA 1E9AA 5DO9A 3QI2A 1VCOA 3KJHA 5HZHA 2OM2A 4A2QA 3EC2A 3AVOA 4RFSB 1K5DA 3A36A 3LVRE 2W2XA 3W5IA 2DFKB 3CR7A 3FHCB 4OI0A 2J7KA 4JLAA 5DIFA 3NHBA 5EJEA 5JCPA 1NVWQ 5FUXA 4DVGA 2H17A 3GJ6A 4EIWA 2Q21A 2FJUA 4KBFA 3AKDA 2VHUA 4HAZA 1VHTA 2ERYA 5IK2D 2R2AA 1GFIA 3OZXA 4V03A 1GKYA 3HR7A 2A5GA 2EFCB 2GAOA 2WJHA 4KLZA 1W36B 1ZD1A 5EE9A 1GDDA 1JAIA 1ZNXA 2BMJA 3IEUA 2YWEA 5K8UA 2MMCA 3QKTA 4IFBA 1NVUQ 2D2FA 1XP8A 5TV2A 4M1OA 2FA9A 4II7A 5DYGA 5JHHB 3K53A 2DCUA 2V7QA 5HCIA 2QG6A 4KAXA 1XJ0A 2Z83A 4OHYA 4K46A 3THXB 4DZZA 1X6VA 4PR0A 3ZGXA 4CIDA 1S3GA 2NPIA 2QP3A 2OZEA 3AVVA 2LKCA 3VR3A 1KI3A 2R6FA 5DN6D 4BRWA 2J0UB 4HI0E 3WNBA 4A4DA 4QNRA 2XEXA 5JWRA 2JIZD 3RRYA 1W0KA 1FUKA 2VP0A 4EFLA 2QROA 1EFRD 1KI1A 5FPTA 2VP2A 1P7CA 3D31A 5CDFE 1N5IA 1NG1A 1E2GA 3U3KA 4LGMA 1S1CA 1Z6YA 3RS3A 4PAOA 2FGKA 3CUEF 2CHQA 2PMKA 4MDEA 4BPBA 2FSFA 2GCOB 2ZUBA 2BBTA 1E0SA 3X1XA 2G6BA 3TUZC 3B8HA 4H1UA 2X77A 1VCNA 1R10A 5EE1A 3GJ8A 2WOOA 4JIMA 3QKRA 2QAJA 5KSOA 2CHGA 1VKJA 4YC7A 2CDNA 3PEVA 1EXMA 2ZE8A 1KNQA 2F1IA 2ZJZA 4C0QC 2NO1A 1A7JA 4KODA 2OCBA 3VU9B 2WWHA 3IBGA 1HY3A 3I5XA 3A1WA 4QGFA 3KJEA 3MJHA 3ADBA 1P3JA 1LS6A 4Q4HB 1QHHB 3I72A 5J4HA 1EWQA 2AD5A 4RD0A 2QORA 4RY2A 2HYDA 1S0UA 1GL7A 3BFKA 2BKUA 1RC8A 3NIBA 1M1YE 2EW1A 2GRJA 3BBPA 2ZRFA 3M6AA 2WJJA 3OF5A 3QVVA 3L8YA 4GT1A 5GJWC 4IOMA 4M0LA 3BAFA 3GLIE 4BLPA 4D4LA 3QPWA 2GJ9A 4B73A 1T3SA 3D8BA 5D3MA 1Q1ZA 1RYHA 2WHXA 5G40A 1MRSA 2FPKA 3Q8XB 1WDTA 2BMEA 3FPAA 5EUQB 3T34A 5HTKA 2H8KA 3L2OB 2EFHB 3EAQA 2IX3A 4ZIRB 5B58C 4HAXA 4BZXA 1U81A 2XJ9A 3U6KA 2XSZD 1OXSC 4Z51A 2FMXA 1EESA 2ZR9A 4M21A 1Q44A 3WHKA 1VIAA 3OIWA 3T06B 4MRVA 1YZGA 2RHMA 5EE5B 1AM4D 2EFGA 3LQQA 3LVQE 5E4FA 2WMNB 2ZSBA 4LHVA 2YKGA 3C14C 3PFIA 1FZQA 1YZNA 3OEED 3NXSA 2REXB 4B34A 1IJEA 1FQKA 2OO7A 2QNRA 4B6EA 4M1WA 4PSVA 2BCJQ 2CMKA 3RSOA 1FTSA 2NO6A 2IBMA 4TSFD 3TMKA 2HYIC 5GJCA 4A0FA 3DZDA 1Z6GA 4GNKA 1S9DA 1S9HA 1OXVA 2G1JA 8OHMA 3DZ8A 2GEDA 1WB9A 3PJRA 5JBQA 4R2IA 3E2IA 1G8FA 5A5GA 1H8HD 4Q7MB 4MKIA 5E7JA 3I4LA 4OI1A 2DYKA 4NYIR 4C0HA 4JL5A 2QMEA 1F2UA 5KDLA 1ESNA 1F48A 4HATA 3NH9A 2ZI6A 2XJ4A 2FFHA 2E9SA 4US1R 2NZ8A 2ZTSA 4WBSA 3PENA 2P3SA 5AUQA 4B33A 1KI2A 1CR2A 2Z0MA 1V43A 2RGXA 4PC3A 3W90A 3T35A 3WMGA 5JRZA 3IPYA 5CB8A 4KFSA 1TF2A 2IF2A 4CT5A 2W2VA 3IHWA 3EIHA 5EP3A 3KXKA 3U7EB 4HUQB 1GZSA 1HQCA 2XGJA 1G7CA 2Q3HA 3CNOA 1Z28A 1GWNA 2O8DB 3VNVA 3HPQA 3QXHA 3QF4B 1VG1A 2ZS7A 1SVOA 3AQ4A 1FMJA 1TU3A 1DAHA 2ZJAA 4F4CA 4WAUA 1RZ3A 1X86B 3WXMA 1IN5A 3HWSA 1SHKA 2VHCA 1PLKA 4AD8A 2HJVA 1CLUA 5JS7A 4D4JA 1M34E 4PZZA 3TR0A 1I4TD 1EFUA 4J0QA 1YJ5A 5C4MA 4TL9A 2CNWA 5CJ2A 5KU1A 1E9DA 1DELA 3VKWA 4PHFA 2JA1A 2CK3A 2UZ3A 1HUQA 1P72A 4QJ4A 4ACAA 3ZS8A 2YOGA 1RE0A 4XTCS 4C7OB 1Z06A 3IEVA 3I61A 1ZMXA 1IY2A 1NLZA 4B35A 3B7GA 1QHIA 1FW6A 1BYUA 1R5BA 2ZPTX 4LK2A 3VX3A 3ZIAD 2HDNB 3U3MA 4BLSA 1SKYB 4DKXA 1D9ZA 4B3DA 1DE0A 3D3QA 2ORVA 4Q5IA 1CKEA 4V0LA 1ESMA 2OLKA 1NL3A 1G7TA 4RD6A 2EVWX 3WMFA 1J8MF 2QL6A 3SNHA 4Q18A 5FOXA 1M7BA 4PO1A 1YR6A 2GVZC 3S1AB 4TLDA 4QFMA 1UBEA 1CRQA 2FSHA 1X1SA 1G8PA 2ZRCA 1L8QA 3MG9A 4URYR 1ZAKA 1QRAA 4G0NA 4OJQA 3RS7A 1KDOA 3SHWA 4K8OA 5LB4A 2BBOA 4P31A 2HLDA 5BN4A 1E4VA 3HR8A 4ASUA 2QBYB 1DAKA 2C78A 1P2UA 4GI7A 4QNMA 1JR3E 4WIAA 5J40A 721PA 3DMDA 2CJWB 2JLQA 1CR4A 3GEHA 3I32A 1KK2A 1RYFA 1G18A 4Q47A 5JSZB 3U6BA 3ICEA 3RVBA 1G7RA 3NKVA 4GMDA 3B82A 2VEDA 4JKIA 4KSBA 1M2OB 3KZ1E 3DKPA 3MCAA 4WZBE 3HU3A 4GPTA 2F1HA 2HXYA 2V7QD 2OXRA 4NTZA 4OHXA 3UXMA 2GXAA 4A15A 2FE4A 4I1UA 1E2LA 3CPHA 2O8FB 1MABB 3CF2A 3I1FA 2XXAB 1B23P 4BASA 1AKEA 2VP4A 4OK5A 1G6HA 5AJZA 4Q66C 2YC2C 4B2LA 1TF5A 4BZPA 3KQUA 4JL8A 1W4CA 1CIPA 1S4QA 2FOLA 4LJ8A 2RGGA 1W4BA 2CCKA 2YJTD 3GJ7A 3JVUA 4KFTA 1SXJE 5FPHA 5G41A 4FMDF 3M4YA 1L4UA 3CW2A 2OCAA 1EGAA 3IPXA 1KO8A 3NDBB 2JAQA 1US8A 1W49A 2QTVB 3TKLA 4P4SA 3H1TA 1Q21A 4LHXA 5FBVB 1JPJA 2ZJYA 3K0AB 1AQUA 4EPWA 2VPPA 1FX0B 4EDHA 3GJ5A 4DUGA 3X1YA 4URWR 2VIIA 4D6PA 4DLXA 4XSHA 2WIAA 3B85A 4HZUB 4LJ7A 3PXGA 4BFYA 1XFAA 2WICA 5TXGA 1HA3A 3TAHA 1XEXA 4MRSA 4A2PA 5F98A 3LNCA 4LJYA 2ZS9A 4Q7LA 3OIYA 2E1RA 5F2EA 3U3JA 4AIIA 2D62A 4DB4A 1KKMA 3K9GA 2C03A 4FIDA 4GMXA 3TW4A 1UKEA 4D4MA 4G5OA 3RWMB 2HUPA 4B2PA 5FTKA 1TNDA 4XTRA 3FFAA 4RFSA 4XOIA 1W36C 3H4MA 1I2MA 1OF1A 3SR0A 4M9SA 1E2QA 4L15A 1E79A 1TF7A 1K8RA 4QHSA 3TLXA 3ZVLA 1W48A 2W83A 5L3SA 3M1IA 4OHZA 2G77B 4TT3A 1EFTA 4G5SA 4MYUA 5BQ5A 4DLZA 3PIRA 4DDUA 2BJVA 3B6EA 4MYCA 5GADl 2WJGA 1HURA 2JDIA 4ON9A 4W5JA 4C30A 4M9ZA 1NNEA 5JJLA 4CZ2A 3IUYA 1H8ED 2D74A 3UPUA 1GL9B 2CHVA 4IDPA 2IXEA 2ORIA 2YVUA 1JR6A 1RJ9B 4PHHA 3X1DA 3LBHA 5KTYA 3B5JA 3GJ0A 3BS4A 4HB0A 2Y8EA 4OYHA 4QGAA 5KHOC 4YMWA 4FXPA 3THXA 2GHIA 3GQBA 4ILEA 1E1QD 3ADDA 2CBZA 4Q4JB 1FQJA 2PX3A 4FMCF 3J81k 3AEZA 4HAYA 1NN3A 1KYIA 4QM7A 2J0UA 1IQPA 2QZ4A 4TZ6A 4LPKA 5TMPA 4KV9A 1E9FA 4P0TA 2F3RA 4AC9A 5FR1A 3CBQA 5EP4A 2ECKA 2ZRPA 4GDFA 2DWOA 3PUYA 5CM8B 5DNYB 3SE0A 1D8TA 3ZD7A 4BLTA 4TQAA 4IOLA 4UQOA 3TUIC 2C77A 3OE7A 5JS8A 2JLXA 1ELOA 5C18A 1G16A 2REBA 1E2KA 2GCOA 4DXAA 3B78A 1CR1A 3WYFA 1XXHB 4Q7JB 4W7SA 4EPTA 3T1OA 1BKDR 3AB3A 1J8YF 4MRRA 4DLRA 4QBHA 2OAP1 1SXJB 3QXXA 1KDPA 1HH4A 4AY2A 2N46A 4ZKEA 3ZZTA 1YZUA 1G3UA 4C0JA 2YOHA 4GRAA 3L0IB 2ZSDA 1VDZA 4Q00A 1R4AA 2OFOA 3VU9A 4LYHA 3SN6A 1RRGA 4PSKA 3WP0A 1WBDA 1OFUX 3PITA 4NYJR 2NMVA 5FBRB 4AI6A 2PBRA 1LS1A 2YWHA 4JZKA 4ZDWA 4Q4HA 4V0MA 3GLGE 1NJFA 1XZPA 3CM0A 1QHHA 3W3ZB 1Z29A 5SZKB 3CKLA 3FTQA 3I8XA 3K9NA 1XPUA 4I1SA 4TL7A 2EFEB 1HTWA 1R5OA 2HEIA 2YZ2A 1EG7A 5IRCD 1CR0A 3RRZA 1NN0A 5EE3A 3AF1A 2NZJA 2YV5A 2DR3A 3C41J 5EP2A 2CCJA 2NG1A 2IYWA 5SZIA 3K70B 3A1VA 1JEEA 4OQFA 1II8B 4BECA 2ZANA 2KWIA 2V6IA 3QKSA 2GF0A 1PVOA 2W2TA 5F9HA 4DEYA 3LX8A 5EXTA 3GLHB 1S8FA 3KKQA 2CCGA 2BVNA 1P75A 4MITA 3TVTA 3C5CA 1VPLA 2WSMA 2CNWD 1GNRA 1RVDA 2W6JA 1PUJA 1G4AE 5CLLA 1GIAA 3WRYC 4CF7A 4TMWA 3PR1A 4US0R 3EPLA 2P2LA 4LC1A 2J46A 2ZRIA 1S96A 1HE8B 1G9XA 4WZ6A 1M7GA 2W0MA 4NP6A
chains in the Genus database with same CATH superfamily
4BO5A 2GO7A 5EMLA 1N6IA 4NBUA 4DLVA 1H6DA 2C0PA 4N5MA 3PNKA 4PAGA 2CV1A 3F2VA 4LUCA 3K20A 3NHJA 3VU3A 2K4MA 1QYCA 1A8IA 1O9GA 3N0VA 4GLBA 3VOSA 4W5QA 4O0MA 5ECWA 1NQTA 3DWFA 3R5HA 4FCWA 1KSHA 4IFIA 1H5QA 4BZQA 1C3JA 4ZZ1A 3FTNA 1CRLA 2V1UA 1G1MA 3MF4A 3RREA 4LYYA 1KJ9A 4G63A 5L3QB 4QELA 4Y8VA 5M3BA 5AVUA 4M8KA 4MGEA 4XR4A 3AHHA 1H9BA 3CBGA 4NBSA 2FW1A 4R0MA 2F6RA 2XB6A 1LX7A 1MB4A 1RRCA 3SLKA 1L7OA 2HTFA 3BWVA 1GUZA 3TR6A 3GPDG 1P4SA 2YYSA 3D8UA 3B36A 4ASUD 4HNVA 3SHTA 1R5JA 3LFUA 3L1UA 4AJOA 3WYEA 5M7EA 4Z0NA 1SMKA 3R0IA 4EQ6B 3U2QA 4FZRA 3LXMA 4R9NA 5FAKA 5EQJB 3NR2A 4K26A 3O75A 4TV8A 3SGLA 4D8VA 4DSOA 5AJXA 1II9A 1N2HA 4KXMA 4EJSB 2CWDA 4W5OA 3VPHA 1CB0A 1W4AA 2V6MA 3TQIA 1XHEA 1XTQA 4DV0B 3FMVA 1A72A 1CDOA 3EZYA 1JIJA 1S89A 5FOSA 2CE2X 3Q0IA 5C7IO 2QW0X 4G5RA 1MX3A 4P22A 1T2DA 2P6PA 4QXMA 5ILGA 3IP7A 5HIJA 2LP4Y 3KB2A 2XBUA 4N65A 3VR6D 3OPXA 2J3LA 1T0BA 4BMCA 2VWPA 2W5UA 1OIWA 3GT0A 4IUDS 5JZVA 2YIMA 3ETNA 3H87A 3UA3A 2JBHA 1A0OA 2JVKA 1CY8A 3CE6A 2R8PA 1CUIA 1CVLA 1X1BA 3BKXA 1BVYF 1NJGA 3RJ5A 2VSNA 1QTRA 2AKAB 3VM6A 4A82A 3EJ6A 5AKZA 2HJRA 4DA8A 2YW9A 5F1OA 2C9MA 4FWIB 3SEZA 3FB4A 3GL9A 3LKBA 4JH0A 4XRRA 2B35A 3FM9A 2F1JA 3ZW7A 2X40A 1DPGA 3P7MA 1HBJA 4G0XA 4MA4A 4YUXA 4MS4A 3T1TA 5CX1B 2XLBA 3BHMA 1DC6A 1IIBA 1KO4A 1XE3A 1E2FA 2IELA 2GBGA 4JBYA 4PXAA 1JXAA 2IYVA 3DKIA 1PJRA 1XVAA 5B3AA 1E1KA 1QLJA 1P3DA 3CGGA 3FPFA 4PNPA 4HQKA 4YRSA 4R83A 2QG4A 4C7OA 3O95A 1ZCZA 1NY5A 4QJIA 3REFA 1WZUA 4JK3A 5CYOA 3OKAA 2VJLA 4FMBB 3FPGA 4IMIB 3WDKA 4DTIA 3WSWA 1IN4A 3H42B 5FYQA 3HM2A 2F9LA 2NSJA 4L4RA 1FTWA 2AXNA 1VMKA 4Q12A 4RVOA 3B70A 3MTEA 2YV3A 5DKFA 1Z08A 1CZOA 1KPHA 3LQRA 1WHTA 4P81A 4RIEA 1YI1A 3RARA 1BN6A 4ZALA 1M6NA 1WLSA 3FDZB 3LPCA 2G8LA 4PSCA 4MP3A 4MVJA 2AV6A 3EA0A 4N3GA 3U3OA 4EI9A 2V4MA 3C5VA 2OCIA 5E2AA 4AG3A 3R5XA 5F12A 4KHPB 1SPXA 2FZVA 3K0SA 2X3YA 5FAXA 5GONB 3GRUA 5K0ZA 5EI5A 4WA7A 4H7FA 2R68A 4D82A 3OPNA 1B43A 1G17A 3PRKE 4K6GA 2RGBA 1GAJA 4BV8A 4NZ9A 3ILSA 1W5BA 3RU3A 2AE2A 3HH8A 3C5HA 1P60A 2CJWA 4EYSA 3V7WA 3F47A 3BZBA 1B8UA 4JD5A 4ZO8A 3PGKA 3DMYA 4OK6A 3TWOA 4OHOA 1Z4IA 4EJFA 3T1QA 2ETVA 4Q9NA 3AT1A 5CFLA 5LZ9A 3EFHA 5G1PA 3X1ZA 1M2OA 4XLZA 3ZG6A 3P20A 1MTOA 3NWEA 3JYHA 1WU7A 4OKSA 1AKTA 5DGTA 3I9KA 1K4KA 1LV8A 2VSFA 3ONFA 3NIGB 2IHKA 4HLNA 2GNAA 3WLTA 2O3UA 4OQZA 1LJLA 1CEEA 3AVTA 5IEJA 1JKXA 3I6MA 2HA3A 2Q49A 3DO6A 4E13A 1IJFA 4HXFB 3EDCA 4NZYA 2BWJA 3EVFA 4TYMA 3SXJA 2CDAA 2VRCA 4NH0A 1S3FA 4YPVA 3HJCA 3MWKA 3SEAA 1BMTA 1QR2A 4OGWA 1JG4A 5AUOB 5CH5A 2IYEA 1KZGB 3PD7A 2VNJA 5JLAA 1IC6A 3VDXA 4FI3F 1X14A 1AMUA 1L5RA 2JJYA 3W0LB 2G63A 2YHAA 1P18A 1C14A 2BN4A 4ZI7F 1OY1A 2RJNA 1CUHA 4FYWA 3TH5A 2JLSA 2A59A 3SLGA 2GPWA 1TMYA 1ZH2A 1T3LA 4LOHA 1VMIA 3JQ6A 1HNWB 1FS6A 4HQRA 4FILA 1XLWA 3UXYA 1JU4A 1E3MA 4GPAA 1GZUA 2O7SA 1T4GA 3GJ4A 5CU7A 3MOSA 4FGLA 1XKLA 1HDZA 4O4LF 4PXYA 2XF2A 1NFRA 3HP7A 3I5YA 2GPTA 3IUJA 5FT9A 5KHLB 1OV4A 1FNSA 2PTHA 2ZJ5A 4EHHA 4JX9A 4KWIA 2F17A 4KAFA 1U04A 1BXZA 1ULBA 3FGZA 1N2EA 3QTTA 4ALKA 4OHBA 1XMQB 4OB8A 3WICA 1TKRA 1ZK3A 1QWSA 4AP9A 2UVPA 1R66A 3CH6A 3LLVA 1IUNA 4WGGA 1A8SA 1ZIDA 2V96A 3DBRA 5F3RA 5BOVA 4GH5A 5DCLA 5BT8A 1JU9A 1WPXA 5HHTA 1LNSA 1A8HA 2ODNA 3FMGA 2X2OA 2ZRKA 2BE7A 1MPXA 4CR6A 5AW2A 5DBFA 5JQWA 4JLNA 3TM4A 2O3QA 4RSHA 5BPHA 3H1PA 2DP4E 3MT9A 1NVDA 3O8QA 3PICA 1O6BA 2FRDC 4I1OA 4Q4LA 4RHEA 4ODIA 4BX9A 1K5HA 3GAMA 3HA2A 3IVMA 4JYCA 4TKVB 2DR2A 5C1OA 1AQYA 1IOWA 5E9QA 3BZWA 3KUKA 1ZNWA 4MW2A 4U3JB 1M2NA 2ZB8A 2R1ZA 5BNZA 1UF9A 5MN6A 4P3NA 4PZDA 1DDOA 4EG1A 2JA2A 2PUCA 2VT2A 4MKXA 1A4XA 5EHQA 4AWBA 1N6LA 3ITEA 2BI4A 4DXHA 5UKDA 2H85A 5A02A 1KJNA 2FZLA 4NMMA 3SXUB 4OVKA 5JFGA 4CMBA 1YTUA 1F6BA 4KB5A 3ILXA 2FRDA 5KNBD 1LW7A 1Y81A 1W96A 3KWLA 1PGQA 2ZW9A 4JU9A 4KI7A 4NAHA 4Q3EA 1IOVA 4D8UA 2H4WA 1Y37A 4B43A 2A33A 3ORRA 3A6DA 4W7IA 2FV8A 2JJMA 3ANLA 1UKZA 1W2WB 3OD5A 3SYNA 1TVKB 4AS2A 4DZRA 1RJ9A 4MMZB 1RLMA 4UPDA 4IM7A 1NN1A 2OBXA 3TNDA 4KW7A 4MS3A 2B4YA 1P1CA 3O21A 4GL4A 4DBLC 3QVJA 1KK3A 4M9QA 2PM8A 1UKAA 1ZD9A 3U61B 1BDIA 4Q4JA 1HEUA 2R25B 1XN1A 1ECJA 4DDMA 5DM70 3QX9A 1G5PA 4OPMA 3ROGA 3UMMA 3BWDD 3H8WA 4B31A 2I2DA 4O2BA 4G5HA 4U02A 1F4PA 4EL5A 4DA7A 1FRZA 1QF7A 1ZQ1A 4M36A 1YQXA 3NPMA 2DQSA 3K6JA 1UK8A 3AJEA 1Z7YA 1T2FA 4CQNA 2XQGA 2BH2A 1TEVA 5ARCA 3LE8A 1NHWA 5KU7A 3A2NA 3CZ9A 1ID8A 2ZYHA 1P7VA 3MPOA 4NZZA 2PAAA 5L7TA 4S35A 3ND6A 1E6KA 1JQLB 1JYEA 2B1IA 2D1QA 1NBMA 2OEPA 3D54D 3NORA 5JCOA 1HSZA 5U4QA 3V8MA 1J33A 1E6CA 3U7JA 1H65A 2IYPA 1J06A 3LQ1A 3DR3A 5KYVA 1XXHA 3QI7A 5K4GA 2BFPA 4V0RA 3WJ7A 3R1IA 1KAHA 5ELLA 5FJIA 3VZBA 1GPAA 1GL6A 3AJ8A 2AB0A 3DPIA 1W1IA 4HNHA 3S40A 3AVQA 5LP1A 2X2EA 5K8VA 4PZCA 1BWQA 4EF5A 3O93A 2ONZA 2J45A 3GLUA 4N6GA 5IM4A 1E18A 4GZ3A 1NF2A 1PFQA 3MELA 2NXJA 3P71T 1ETHA 4OATA 1NMSA 4KQKA 1CZNA 1SUWA 4QUGA 3H5OA 2AJ8A 3MBKA 3IR7A 2GYUA 3TNJA 1RRFA 2O2ZA 4IZIA 1DUSA 2V7EA 4URXR 5KC8A 1SNYA 1AXRA 3N07A 5ES3A 1KRWA 1KJIA 2NU6B 5AM2A 3GDFA 1TK3A 3UTCA 1SCUB 1M6WA 1I5OA 1L3CA 1WSDA 4FGUA 1PF7E 3DD5A 5CVVA 3TI7A 1AF7A 2LNDA 2YQ4A 1OFIA 3GVXA 1C80A 4PM4A 4YV0A 1AH2A 1QM5A 1VJDA 4WK4B 3WXBA 3BMOA 3KZCA 3LUCA 3Q1LA 2JFUA 1VYHA 4D4KA 1KWGA 1PZXA 2B7CA 2OVFA 2QX8A 1QH1B 2O6HA 3BRSA 5FV4A 2OCDA 2J33A 5A6SB 3RC1A 4E2ZA 4F6CA 4CEHB 2Z5GA 3OLZA 3OT1B 1UXHA 2WA2A 3RANA 1V8OA 1ZWLA 3K8QA 4HY3A 1U7OA 4YJKA 3JAKB 2Y6UA 3TR5A 1G6KA 4BJ5A 3FNIA 2OP0A 3IKVA 1QFXA 3DVAA 5BQPA 2IS1A 3MS7A 1D1QA 1YIDA 2ZEJA 3KXIA 3Q8MA 1NF9A 1GG5A 1VMEA 5HNKA 5KYWA 3GF4A 2HHAA 3IEPA 4HJXA 4O4HB 5LQRA 5K51A 3Q5EA 3UKDA 2FFQA 1FYDA 3ADKA 5FWXA 5K45A 2DHCA 1NR5A 2WFMA 3OBBA 3EC7A 3KBOA 2Z5FA 3IDFA 4CMIB 3HNPA 4ETMA 1GGEA 4N0PA 2C4HA 1QHEA 3MUOA 1THZA 2IIPA 4RQUA 4I08A 5T64A 3DDZX 3OM8A 4KXWA 1WF3A 1Y3FE 2GA9A 1MRZA 2DWQA 4IQ8A 3OQIB 1N8TA 4ZVNA 1U2RA 2CBGA 1CLEA 1NJ1A 3OT5A 3I6QA 3PFBA 2OB1A 4KU4A 4MDYA 2PH5A 3VR5H 1WXGA 2P6UA 2J3KA 2D7CA 4I6JA 4BO7A 1PEYA 5G0UA 1SFRA 4DYDA 4F91B 1J8FA 3GXBA 5HG0A 121PA 1LLFA 5J2UB 3W4IA 4YDQA 1GR0A 2D3TA 3N6XA 4OUDB 4HDOB 4L7QA 4MV1A 1SOWA 3RK4A 5I8PA 1HDOA 2BOVA 2PK3A 1UIRA 2JKYA 2VDLB 2JAHA 3C3PA 2I7XA 4G4SO 5AXDA 3AI2A 2QD4A 4L28A 4YMSA 3KTAA 4FC7A 1Q0QA 5DWVA 1IEQA 2R60A 1CE8B 1VHLA 1DCFA 1UMDA 3AFOA 4LWQA 1Z7GA 1MAWA 5CX4A 1ZH0A 4KL8S 3VR3D 3WNCA 5JNUA 4WINA 1XQ6A 5A3QA 2IS4A 4ITRC 3ORSA 4YXWD 3U7GA 3D8SA 4CPDA 1T5DX 2YIDA 5IJWA 2H65A 4N7RA 3E1GA 2AN1A 3IBCA 5JAMA 3BXGA 2A57A 2AHOA 2X8AA 1QB7A 4QXPA 1KJZA 1XJQA 4B3JA 3BC1A 2V5UA 2VAWA 3E4CA 2PX5A 3L6CA 3OF3A 4NENB 2EFDB 4XVCA 1AUPA 2GS9A 2RBKA 3ED1A 3S2GA 3W5JA 2G36A 3CONA 1GY8A 1T36B 2DLCX 4A2CA 3JVVA 1U2ZA 4TKMA 4MQEB 5KVQA 4IZ6A 4RTRA 2J5BA 3FBTA 3NIFB 4J0JA 3WL3A 1P19A 3KSZO 1W0JA 1N6OA 3HXKA 5EJ9A 5LUBA 2C96A 3CXUA 4KGXA 1T0UA 5D86A 1DHRA 2NUPA 3ZLBA 1RKBA 1UL1X 1X1RA 2IODA 3ELUA 1DZ3A 5IS2A 2UYHA 4X93A 4NJEA 2XZLA 4HYTA 2ZI3A 4Q1EA 3T54A 1JA1A 3I58A 3HCRA 4R98A 4DJTA 2D1YA 1FU4A 3A04A 1Z38A 2OP1A 2ZWMA 3H18A 2ZKIA 4KXUA 3T3GA 4BV9A 1MFPA 2FETA 2WF5A 1E0JA 2VTDA 2X76A 3HYRA 3OSZA 4O08A 4D8XA 1I7DA 1BDMA 3DL4A 2Q1WA 3NC4A 1T4BA 2DQZA 1GNPA 7ABPA 3UWOA 1SOMA 4KVFA 2W2PA 2PUBA 4FYHA 4Q3CA 1JMYA 2J6BA 2P9QA 2HRZA 3EQ8A 1YJXA 4IGKA 1Z6QA 4TUYB 4KNYA 5KB3A 1W35A 1GO2A 4CEJA 2QTZA 3NYQA 4H4DA 4QUIA 5A0FA 1IN6A 4H16A 2D1SA 2FMUA 4MYDA 3PLAE 4YDHB 5K2OA 1RCUA 3VH4A 2RH4A 3B9PA 5LKRA 1Y6FA 1NUSA 3PYXA 5ALDA 1I6WA 5AYVA 2M9MA 3F6BX 1HKHA 1SU8A 4OI2A 2P5SA 4ISBA 1F8GA 1KJWA 3PA6A 4MOWA 3NOOA 4UBJA 3DYBA 4EVRA 4RTKA 4HTAA 2BEWB 4BIMA 2H2FA 2VYNA 4XARA 1GKIA 4TXLA 3EDOA 3ZLJA 3VKGA 4FE3A 2QTBA 4LDAA 1FCJA 4YPOA 2NACA 2X8JA 4LX0A 4NULA 2ZYUX 3PHGA 4P2GA 4S1TA 1OI7A 1E1NA 3P4XA 3MWEB 4EY7A 4XUCA 3SQLA 1WMFA 2XE6A 4HQ6A 5JMOA 2JLYA 1VXOA 3KL4A 4NZOA 4QT0A 5HMMA 3AF6A 1SURA 4IFEA 4N5HX 3AJ9A 4YCNA 4GMGA 5BUZA 1JDSA 1Z4LA 2XWQA 2Q3EA 4PQYA 1FP1D 2QA5A 2WU3A 2ZUDA 1B8PA 1S4MA 1YR7A 4KITB 4QO7A 2EARA 4MUBA 2HLPA 4RCYA 1E2DA 1IK4A 2I6UA 3L1KA 4D9MA 1UODA 5EIBD 4MVJI 1THTA 2IEYA 3A3NA 5EHXA 1LW6E 3WYAA 1SUFA 4KFUA 3CZRA 2O5RA 3HUUA 1HTTA 3AVPA 1SKQA 1JU3A 1DAOA 2QZPA 1PG0A 4JYAB 1H85A 3VSEA 1F5SA 1MH1A 2AWOA 2QGNA 1WM1A 3EBLA 2GK7A 3HY4A 1GSAA 3PUVA 4M8SA 1M1XB 4O8ZA 1U0LA 2Q4TA 4PCUA 2FX5A 2HA0A 4TTIA 3UMFA 5CA0A 4I1VA 1N2SA 4QSHA 5J4YA 5I7VA 4HMPA 4KZKA 4Z4HA 1VIDA 1NW7A 2NO0A 3PWKA 1TXGA 2YV1A 3BSSA 3EIUA 5DHPA 1R37A 4HZGA 4PW0A 3MCUA 3NM6B 3JTEA 4MCIA 2PD3A 2QNBA 4LZAA 1JTFA 3EFBA 3WKEA 5KYNA 1GU7A 3R3XA 2I78A 3PNVA 3TZCA 1EVZA 1VDMA 2KJQA 4XIFA 4C0BA 3SG0A 3VPAA 5K3OA 4RETA 1G3IA 3F9CA 3G2JA 4GEKA 4WN9B 5AM3A 1A9TA 1Q11A 2H9AA 2WWFA 4WDRA 4A73A 1XMIA 1D6NA 4HAUA 3CW8X 3U7QB 2ZRJA 3TSOA 3X2FA 5LQMA 4GW3A 3AUKA 4L9RA 3PBKA 1WNTA 4OJNA 2INGX 3P2KA 4PZYA 3B51X 4L8GA 2QZJA 2XWSA 4DTCA 2RGYA 3EVAA 4Q4AA 5A5VA 4DLPA 4FINA 5FPYA 1GPUA 1N5DA 1OPRA 5BNWA 3GLRA 2O1WA 4LPSA 5E3HA 2R6GA 3UJHA 2IUYA 4F60A 2DE0X 2GBCA 4ZGGA 1CDEA 1QFZA 1VPWA 1LI5A 2OO3A 4HGPA 4FHGA 2NOAA 3Q0TA 4XPIA 1FUYB 2GM9A 2VAVA 4Y6OA 4WXHA 5LBTA 4KPYA 3FTFA 2RAVA 4PPGA 2GN1A 3BMQB 4DRXA 4U6QA 5TARA 3IV6A 4DIEA 1IZ9A 1XRNA 3VZSA 4INPA 1BJRE 1Z6TA 3W9YA 3FGOA 2GBPA 4IVPA 3BSYA 3CYFA 4CTJA 1YZHA 1JDVA 1Z2PX 3QXSA 1W1UA 4B6GA 3RVNA 3E7DA 2I34A 4PGGA 1T5SA 3K6SA 1OZAA 2WIDA 2F62A 2JBWA 2ZB4A 4IV8A 4KREA 1MW9X 2CLHB 2YS6A 4J8PA 3F6EX 3WFIA 2CZCA 5B37A 4O1MA 4G1VA 1MDFA 4E5PA 2I8LA 2ZROA 3VTKA 1N36B 3ZS9A 1OIXA 2ZIAA 3OQBA 5DGDA 1JLMA 1W93A 1SCNE 3KXDA 2ATXA 2VFAA 4WLVA 4B82A 3AU8A 2FSUA 3NTLA 3N7AA 5IT0A 3IKTA 5KSZA 1ZGZA 2CXUA 3O47A 1G9TA 4JLPA 1YQEA 2AN9A 5DW3A 4DIFA 5FEMA 2OQIA 4MV9A 4CXMA 2D5AA 1U4NA 4PAMA 4AN0A 2EERA 2XYGA 3GUYA 4RWEA 4DCTA 1DBQA 3G5MA 2JZOA 3QWBA 2GJSA 3WLAA 4D4IA 2ECFA 1MKYA 5F7OA 4D9IA 1KRXA 5BN5B 2I76A 3NRBA 4KXFB 3IBYA 5HSGA 4RXUA 1Y4UA 1J25A 3SPXA 3THYB 3MINB 4TWJA 4CUJA 4H0FA 2E5LB 2A9QA 4NXMB 1UAGA 1EWKA 2TYSB 3GRCA 2V3VA 4O5OA 3KQUA 4ZKDA 2GOYA 1N0VC 3EGOA 4DMGA 5KDDA 3PP8A 2R5NA 4Z1MA 1QYVA 2EP5A 2UYQA 2Y71A 4G09A 1H0RA 4YRQA 4ZCSA 1N2OA 4LWZA 4RSGA 2PT6A 2NO9A 1E3WB 1OW3B 2AJLI 4PSAA 1L5OA 4U39A 3N8HA 1H2AS 4BNDA 2AI1A 2XVYA 4RK1A 4X6XA 1PJ3A 5IC5A 1KY4A 1RI1A 3BDVA 4JQCA 4FJ0A 4Q19A 4TL6A 7MHTA 1GT6A 1MAHA 1NPTO 2DFVA 2WHPA 2MR6A 5TIIA 4A92A 2BEVA 3GGCA 4BNTA 1U3FA 5EJ2A 1O6ZA 3EHEA 4B84A 5DNCA 3LD9A 5CNKA 1EBBA 2IE8A 1XQ9A 3DWEX 5JY1A 2KQUA 1YUBA 3HVJA 4X45A 4DQDA 4Z7JA 2G88A 1SC4A 3LO8A 2CDRA 2JJ2A 2BF7A 1Z83A 2QOEA 4AK9A 1UJMA 3OIUA 1JLLB 4DLUA 4F2DA 1PEAA 3A2MA 4NVRA 4YRMA 4TYQA 1MOSA 2CXSA 3AM5A 5JAPA 1AMOA 1B0ZA 4EW1A 4PO3X 4C1NA 1JAZA 1J70A 2VEOA 2OCXA 2QRMA 2VDWA 3WFJA 4HNTA 5HJ7A 4YONB 4CMEC 2FQ1A 3P9RA 5DCWA 3PJEA 2XMBA 2X41A 3TOZA 1SXQA 3EF3A 4GAEA 1YKFA 4B7CA 3Q72A 4HH4A 4R8RA 4WFIA 1XCBA 5H7XA 1N0HA 2JHCA 1M2VB 3PLRA 1YDWA 3WA6A 4A7PA 5GY7A 3MCWA 1XCJA 4YPFA 3V1UA 4LGCA 4HX9A 4CMHA 1XD2A 1TX4B 1XRRA 1XZFA 2EW8A 2PX2A 3O31A 4HWOA 1DAFA 4CMEA 1HV8A 3TSAA 5AXAA 4IIXA 4ND3A 2XGOA 1K88A 2E2WA 1J39A 1PIWA 3V7YA 5LZ5A 4CTOA 3D6NB 5IBQA 2D8AA 1DFHA 5JNLA 5A2QA 4RS4A 4F04A 3L7MA 5BXQC 3UAYA 3QE9Y 1XB2A 2QGFA 2L19A 2NUAA 4E6PA 3GLGB 4R8MA 1R0WA 1NR7A 4CGZA 1ZOSA 1B3BA 1V71A 1Z8DA 3A2LA 3FVTA 5I9LA 5FPSA 3OQ6A 2JAWA 2WKWA 2YFYA 4JKYA 1KORA 5CFNA 2Q99A 4HUJA 3EOAI 3V6MA 1UXIA 1DC3A 1HPLA 1XLTC 3UB3A 2GYWA 3EPRA 3NHRA 1E1YA 3VUFA 1XZHA 1R4NB 3UY4A 4DUGD 1F2TB 1XZMA 2WF6A 3ELWA 4PX2A 4WCVA 5DX1A 1VZ2A 3QNMA 3R5KA 3KJFA 4Y2XA 2DVMA 1E9BA 3BRWD 4PLFA 1ORTA 3P9IA 5AK0A 4EI2A 5ALJA 1U0NA 1J5PA 3HSKA 3QYAA 4MUEA 3IAHA 3UMVA 4S05A 2DEUA 3Q3VA 4EY4A 1XLTA 3W5UA 5KTMA 1XEWX 2ZBQA 4LXUA 2EOAA 1HLPA 1HMPA 1NIJA 1ODJA 1SVUA 2XGSA 3EIFA 2A84A 3IPLA 1RLIA 4AY4A 1UBCA 1ULZA 1T8PA 1WA5A 2ORWA 2Y1XA 3COPA 4ZU6X 3V3KA 1J97A 1O94D 1SVNA 4V0NA 5ENDA 1JAXA 1JQEA 1L7EA 4BV2A 2PWPA 3SIPA 4DR2B 3L18A 4Z54A 2B78A 2CL7X 2G7MC 2OHOA 4M7RA 1SWVA 4G4SP 1ZNZA 2IGTA 1W29A 3DCYA 3QHAA 4ONEA 5LIPA 1IHOA 2A0KA 5J58A 3HCAA 3GZ4A 3UMSA 3KBBA 5K8JB 1JLSA 4WY2A 1YNOA 2X13A 3IJEB 3NJRA 1V4NA 1VCMA 2FZKA 2W6QA 1T0JB 1RKQA 1FFXA 3AOEC 1W36D 2QR3A 3LK7A 1QQ5A 1QRTA 2KI5A 4JLMA 5HXAA 1PR9A 2W2LD 4TLLB 1UC5B 4HVLA 3EXIA 2C7RA 3N2NA 3L4EA 2F43B 1GQ2A 3MD9A 1QYXA 4JI1B 2UXCB 5F78A 4ES6A 1MXFA 3K0FA 3L7LA 3KQNA 2C7GA 3G8YA 2GEVA 1XELA 4XW2A 2C5GA 1VRWA 2P6NA 3MFYA 4FKZA 4QQFA 5JNVA 3AR7A 4D97A 2O0JA 3RAGA 1NTRA 1ZJ4A 2K87A 2P5UA 2NWQA 2A7XA 1IFXA 4GE3A 4MW9A 1Z13A 4X41A 3S2UA 3VNBA 4CNBA 3HEBA 4CUKA 4R8SA 1UFVA 2CVHA 1C1DB 1PW7A 2DLDA 2VJAA 3E9RA 4FYYA 3CH4B 4G8BA 5J59A 4MHTA 2FJ0A 3M3DA 3U44A 2QENA 4AF8A 3PHHA 1FQOA 2EKPA 5C9ZA 3ABZA 4JCCA 2SCUA 4KQCA 3I5UA 5CK4A 3G8CA 4KO1S 2XNKA 4ZI7B 3HJAA 4EO9A 1NATA 3EG9A 2JLWA 3C4QA 1G19A 3B3QA 3OQPA 3K9CA 3UHFA 2XVZA 4DC0A 1KEZA 2W6IA 3PI6A 4O4LB 3P5BA 5ENZA 4LJ9A 1HEIA 5FO0A 2IL1A 5MDHA 1IAVA 3B1YA 2J32A 1EP3B 2YY5A 3FPCA 5TY0A 3URKA 5AJYA 1J2YA 2KS6A 5JH7F 2D5IA 2R62A 4MPDA 5TE9A 4FOPA 3UT5B 3EX7C 1DBIA 2QM7A 5AJTA 3FVQA 2MYNA 4Y30A 3PPIA 4EH1A 3NVMB 4ZAZA 4DDKA 5K9ZA 2R79A 2O0LA 2DOKA 1KYYA 4C08A 1AN0A 5J2TF 1K3UB 1B76A 3B1KA 3EFEA 1FRVA 2FEKA 4Q1AA 4GLFA 3GMSA 1QS0A 2FFJA 1ZKDA 4JT4A 1JE0A 2PGAA 1ESDA 2C94A 2RI0A 2ZRLA 2F2TA 2ZULA 1ZM9A 3HKCA 1VYUA 2AZ4A 1YAHA 1JMVA 2DPXA 3CRRA 3OIDA 4HYEA 3RYHB 3T4XA 5IPFA 3B53X 3P5SA 2WOJA 5JD4A 5K8IA 5K6RA 2NTEA 4DLBA 5TMDA 2BMWA 2OBLA 4EJ0A 3H11A 3U4QB 4C2BA 5IJ0B 1BWRA 1Z5GA 2B3DA 4N5DA 4Q1BA 4ZVUA 4MMYB 1WL8A 5BWCA 2BISA 3JARB 1ZGGA 2Q1TA 1KK1A 3H0EA 2RD2A 1F0KA 2B20A 1GAXA 3R74A 1YRLA 1YFJA 2XVXA 4S1VA 1YVDA 4CNQA 1EA5A 4ZO4A 2G9NA 2PZLA 1E96A 2CVOA 3HB7A 3R41A 2HSJA 1ISHA 1DQZA 3I1JA 1DG3A 1I1NA 4HWPA 4IBOA 4F4UA 4HH0A 1KI7A 2ZTHA 4WLUA 1GA4A 5LJIA 4Q9LA 1W4LA 3EC1A 1MAAA 1NW6A 5CIWA 4BN0A 1CQPA 3FHTA 3M9XA 4M46A 1LPPA 1CP2A 4I1YA 1PK7A 3PEEA 1TEXA 4XQCA 5LIRA 1Y8ZA 1HFKA 1USKA 2VYFA 3PPXA 2O1XA 4CQLB 1W2GA 2AOTB 2H2AA 2PX0A 4O25A 4UREA 4ZARA 4J2OA 3GPLA 1W8DA 3N7TA 2DHQA 3A1DA 3LFHA 3PUWA 4V24A 5BR8B 2AMYA 1ZESA 4IPTA 1UQTA 2JI8A 3N8NA 5NLLA 2VYVA 4B3IA 4DIOA 2QTHA 2ZYRA 2R5WA 3AX6A 2JLBA 3QW2A 3VHXA 1F9AA 3VYTB 3FRIA 1V7CA 2RDMA 4OMDA 2HQOA 3AL0C 2QJRA 5LU9A 2XOKD 4H4EA 4LOAA 3Q87B 3PQ7A 3EQ2A 3WB2A 1LLUA 2B8TA 4ZN6A 3PDHA 3SJZA 1KDRA 4LAFA 4OQXA 5ALMA 3TLGA 1GITA 3NHMA 1L2TA 3F97A 2GZMA 3NDPA 4G3XA 3X44A 1NVVR 3WGKA 2V6FA 4IDCA 2PFGA 1BS1A 4D0RA 1N6HA 4I3FA 4IJMA 1JB9A 4XYEA 1MCZA 4L22A 5HGJA 8ADHA 3UG6A 4EAAA 5JV5A 3SF0A 1NOIA 3KB8A 3OPQA 1QGYA 3SIRA 4BATA 2B83A 1ANKA 4MTLA 3OLVA 3I04A 4CU2A 1OB2A 2VYQA 1A2BA 4PGAA 4PO9A 2BR4A 1QOPB 1ULSA 3V4PB 2JASA 3ADCA 2DXIA 3FTDA 4YROA 2O8BB 1EVQA 2BFAA 4C4OA 2VTVA 4MARA 2R6AA 4TMZA 4G25A 4E7PA 4FWTA 2MHCA 1BS9A 1LBQA 2EQBA 2BL4A 3KR0A 5DHTA 3VAZA 3LT0A 3U31A 4G1CA 4PINA 4D02A 5AESA 5BMVA 5I51A 2WB4A 2G71A 2WA1A 2QN6A 4CWAA 1N32B 2GYVA 4H6PA 4WCFB 4WZAE 4DUPA 2J4CA 1XCMA 4FNAA 1I4EB 5EHIA 4A5OA 4CFZA 1L7BA 2GF9A 1HQKA 4PQFA 1LZLA 5AJUA 4KRGA 5IF9A 5JC1A 2CMDA 2LCQA 3IOBA 4GOOD 1NP6A 4K8RB 4ZYYA 2AC4A 1A98A 5JADA 4JI4B 3IXLA 4D9HA 5EJ8A 3DPSA 2ATEA 2DR0A 2EEZA 5JO9A 5AK6A 3GFQA 3WI7A 4I9HA 4JT2A 2BHNA 1NFFA 2FGJA 2GPYA 2IXGA 3HN6A 3QOFA 3T61A 4DG9A 1Y7TA 1YI8A 2FF7A 5GIOE 4LW8A 3KIPA 3FTPA 1WMBA 3CNLA 2ZUVA 4D7AA 4TV8F 5A4IS 5REQB 1PSWA 1GKLA 4PS0A 1Z6AA 4II3A 1JDPA 3BN3A 3KPJA 3O8RA 3HK2A 1DVRA 2QLTA 3A7EA 4YLEA 3GU3A 2O3TA 2PLFA 4M87A 2P40A 3IMCA 3L7JA 4KC0A 1C0LA 4OHRA 5LQSA 3EEYA 4W8GA 4DMKA 1XVUA 5IWAB 4ACBA 2DM6A 5ELXA 1WETA 2IVFA 4DHEA 1FC0A 2IYAA 2VJBA 4J07A 1N6NA 4IFTA 3WWYA 3LMKA 2VTKA 1Y3CE 4NYMR 3P19A 4YMVA 3EXFB 4QOEA 1JSZA 4HJRA 2H06A 3K0EA 4XJTA 4R7ZA 3SVZA 4MYHA 5DE3A 3WL7A 4V3BA 2XCRB 1Y5LA 1EB9A 1Y98A 2JH9A 1ZU4A 1WZIA 1E2EA 1WY7A 2HO4A 1JVSA 4EW3A 1CTQA 5E3IA 4J03A 3IEMA 2GZSA 5LP6C 2QMYA 2RC6A 2VH5R 5AVXA 3RVJA 4EAQA 1F8UA 1EZ4A 2ERXA 3A6KA 4O4JA 2XECA 4AJ9A 3HKEB 5H4HA 5IXJA 1DADA 2R8RA 1WW8A 4IGFA 1A9QA 4DT1A 4RM2A 2YXLA 3T8YA 1QANA 4C0SA 1RTKA 4LYEA 3FZNA 4PYJA 5B7QA 3HHEA 2MU1A 1D9XA 4UTRA 1XCGB 1OI3A 1AQIA 2C2YA 1EGHA 1NBHA 2PH1A 4LZLA 2ZWOA 1REQB 1ECCA 4KQGA 4Y7DA 5FTLA 5LP6A 2JFXA 4LF8B 2C07A 1CD5A 1RFLA 3OAAD 5LR6A 2NVOA 1H3NA 1KDVA 3H86A 2BP7B 2V6GA 3VC3A 4RVFA 3WNQA 5A4DA 1NV8A 5B1SA 1L0BA 1X1TA 3Q3EA 4M0PA 4UVHA 3H05A 2DBVO 1KEPA 2H6EA 1L5LA 3BCRA 1AV7A 4AWAA 3OQMA 4KUHA 1MO3A 3U3RA 2B5OA 2GDZA 3CIOA 4J1NA 1Q95A 3KKOA 3NC1C 4MVJF 1O9BA 1IZYA 5AI5A 2LW7A 3RSZA 5E9JA 1JDBC 3OICA 4RA9A 1YQGA 4XEHA 1RS0A 3GGOA 3NTOA 3G2HA 4GR9A 2PSSA 4C20A 1VP9A 3AHIA 2XZTA 5E7MA 1IY1A 2J9RA 4LC0A 3BWMA 1FL9A 3COYA 5AUPB 1TQHA 3CLRC 3EB9A 4X20B 3KLOA 1N7JA 2NTYC 2UYYA 4GPEA 3P4YA 1OTXA 1U7WA 2GNOA 4IRUB 5AI8A 5FLYA 4DR7B 1VLVA 4REOA 1H1LA 3NNNA 4RIGA 1SD5A 4GXNA 4LQCA 1XRJA 4EGFA 1BO6A 2BGMA 3KNZA 2VL7A 4DNFA 3RYCB 4DSUA 4DW8A 3CCCA 3KT0A 3VR2A 5IWCA 2HU5A 1GGVA 2R6DA 5C8VA 2IZ6A 3LP5A 1RQXA 3NWJA 3Q85A 4AXBA 5GMOA 1PDOA 2MR5A 3K2IA 4W5NA 3QEOA 3JWJA 3VR6A 3UANA 2PAFA 1RBMA 4E33A 2Q0QA 4H2DA 1NDQA 3C8HA 4MX8A 3CKYA 3OD1A 1C7RA 4DUYB 4TTPA 3L8ZA 5G1OA 3T99A 1DLIA 4J0KA 1T3GA 2KE5A 4HXEB 2AG5A 4P5DA 2Y2UA 4R84A 5IAOA 2ZI4A 2FHPA 1XDWA 2AFIB 1AGRA 1GL3A 3D3WA 3VUEA 5CFZA 5IT9A 3Q8LA 1O87A 2C92A 1OLUA 3V97A 3EDQA 5U9CA 3WYNA 5C2JB 2XA9A 2NU8A 3EBPA 2E6KA 4C4ZA 1K4YA 2R6R1 2ZDQA 4CQMB 1S8NA 1YOVB 2XQVA 1B1AA 3G0GA 3IOEA 3T15A 2OGZA 4OHVA 4AKGA 1O3YA 4WVFA 2X9QA 3FWKA 1UFKA 4OLJA 3KWFA 1ZO8A 3FPJA 3ICVA 1UWLA 2ZT8A 5J4VA 2FEMA 4G81A 5T4BA 3QPBA 1Y4AE 1U7HA 2W6ZA 3KVNA 3NBFA 1Q1AA 1JLRA 2NU9B 4HDKA 3Q15C 2V3CC 1DIRA 1EFKA 1AB6A 1KSGA 4UM5A 1Z62A 4KYVA 4QYSA 3LWDA 4LOKA 4G9GA 1P7WA 1PJAA 1Q0HA 2OQRA 3LUFA 4K9KA 3TL6A 1P4RA 1PR1A 1FJ2A 2O8NA 4H6WA 4R9RA 4AJLA 4M2LA 3DO5A 5KSPA 4F8JA 4XGRA 2XDAA 1HDXA 2C83A 3JSXA 4M9RA 4NU8X 3T5DA 5BR7A 4UHJA 1UUFA 4AL4A 3KQHA 3FJYA 3VDQA 4YASA 1E94E 1UDRA 2RHTA 3CWCA 5A03A 3D7SA 1M3SA 3UWSA 1QUFA 5IZCC 4EBFA 1C41A 2BI8A 1YVUA 1KO7A 1Z26A 1SU6A 2VHTA 1JHXA 4HNRA 4X63A 3B2QA 1A5TA 3GLHE 5F51A 4XI9A 3R7NA 1YL6A 1XUOA 3LG2A