1HE8B

Ras g12v - pi 3-kinase gamma complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHATIDYLINOSITOL 3-KINASE CATALYTIC SUBUNIT, GAMMA ISOFO
publication title Crystal Structure and Functional Analysis of Ras Binding to its Effector Phosphoinositide 3-Kinase Gamma
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase/hydrolase
total genus 55
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2000-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1he8B00
1R10A 5H70A 4N0EA 3Q3JB 2GHIA 3SFVA 3QKSA 3KFXA 4RKFA 1SKYE 2JJ1A 1TF2A 2NO7A 2CVHA 4Q1DA 2C77A 421PA 3AVQA 1CJTC 1UBGA 1ZIOA 1AIPA 3FDIA 3T5DA 3ZVMA 2V7QA 4KFSA 4FMDF 1AS0A 4GBMA 1WXQA 2K5UA 3MD0A 3QPUA 5KO2A 1NVVQ 3ZS8A 2PLFA 2HJVA 2RCNA 3LFUA 1KJWA 1US8B 1BMFD 1E32A 4MYUA 1JQJC 4DCTA 4JSYA 1GSIA 2FSHA 3DM9B 4QGAA 2WJIA 2ZSDA 3RHFA 2SHKA 2IEYA 1U8AA 1NBMA 4C0BA 2IYLD 1XPRA 1EGAA 5J47A 1G7SA 1HY3A 4JYCA 5AUOB 1DAFA 3AVOA 2G83A 3FKSA 4Q01A 2R65A 4V0LA 3ZYCA 521PA 1CJUC 2REBA 2XAUA 4QGGA 4UJ5A 4DLSA 4HLUC 4EJSB 4M1TA 5F98A 2ZJAA 4HLQB 1C9KA 2D2EA 1LY1A 3ZZTA 2ZRAA 3ICEA 1E0JA 2V6JA 3IQWA 3I3SR 1D9ZA 1EFTA 3AUXA 3TAHA 4TLBA 1B23P 4NE2A 2GXSA 3PENA 5M04A 2WJHA 1ZVQA 3SHFA 4KITB 5JJLA 3FHOA 2IA5A 2WSSA 3OEHA 2ZRIA 3C8UA 4TMKA 3HR8A 1KI9A 1QDEA 4OHWA 1ZD9A 2OBLA 4HUTA 2R6DA 3FHTA 3KTAA 1FMLA 2ORIA 1YR9A 4R7ZA 4X8MA 3KKNA 2D3WA 3PEVA 3U4QA 5EE9A 4B75A 5KDOA 4QL3A 4C0HA 4GOJA 3FMOB 2QROA 3I72A 1LF0A 1OXXK 3FFBA 2ZM5A 4IXNA 5FBQB 3W34A 4B34A 4LSGA 2OCPA 5AJYA 3DVLA 3L2OB 4IRUB 2AD5A 2QBYA 2G6BA 4LJYA 1E99A 3B1WA 5H8WA 1F3OA 3QKRA 2KI5A 3LWNA 3OIVA 4US1R 1WBDA 2ZRMA 2OCBA 5TDHA 1ZINA 3FPAA 3MMPA 1QHHA 4KBGA 2IYZA 1R0ZA 3PUXA 1EWQA 1N2CE 3HDTA 2GJAA 2LKDA 4HZIA 4ZO4A 4OK6A 1DAMA 4JL5A 1YHNA 2C9YA 1ZNXA 3A4MA 3T1QA 1IXZA 1FTNA 3RYTC 1G64A 4KVAA 3SDZA 1E9FA 1SVWA 4KXFB 1NNEA 1GL9B 4A0GA 2QAGC 2VL7A 3LNCA 1IJFA 3QXSA 2QM8A 4XWKA 3CPEA 4FD2A 2C95A 2FFHA 3CZPA 4MGKR 4HB2A 2ZI9A 1IY2A 3SYLA 4G01B 2D62A 4IOMA 1AK2A 5HZKA 1AS2A 2ZITA 5KYKA 4PZLA 1NN0A 1QG4A 2MMCA 1DAEA 2NO0A 4MRRA 4GZMA 3L8ZA 4YMVA 1E2KA 4I1VA 5FTMA 1G5RA 4A6XA 4ZCIA 1SXJB 4W5WA 4PR0A 2VLIA 3CNOA 2JJ1D 121PA 3ZDQA 4CF7A 1SQ5A 2A30A 2G1KA 2NQ2C 3VU9B 4NYMQ 1YZGA 2Q21A 2V7QD 4FWTA 1WE2A 3OESA 2ONKA 2YZ2A 3OIUA 2ZUBA 3K8YA 4LX0A 3TSZA 1GFIA 1E2JA 3SJCA 3CR7A 3I92A 1F2UA 2X1VA 4X8OA 2VSOA 3W5IA 1G8YA 4CW7A 1CR2A 3Q7PA 1VIYA 3CLVA 3U44B 4OI4A 1QVRA 1OIXA 1S4QA 1KO4A 2QG6A 1IBRA 4ACAA 1TX4B 4TYYA 4Z51A 5JRJA 1NBMD 1UDWA 1ZNWA 2C9OA 3SBDA 2CJWB 3TW4A 5AJZA 1NP6A 2AFHE 3CF6R 5KUTA 1Z29A 1AS3A 2Q0HA 3FKSD 1SVKA 4UQOA 4UKDA 4EUNA 2FPLA 4I81A 3EPKA 3C14C 1DAHA 5CM9C 1VHTA 5JS8A 4Q4JA 2O8EA 1ZM3A 1T3HA 5FR1A 4I1OA 4MH0R 1MRSA 2ZJ2A 5B58C 1E2GA 3OEHD 2WSSD 4G1UC 5DO9A 3T12A 2Q3FA 2WHXA 4D0NA 1WBBA 2VSFA 3HPQA 4B2PA 1NL3A 4GPTA 5KTYA 1SHZA 4LRWA 2DWQA 2DFTA 4Z8XA 1CR0A 2BM1A 5ELXA 4V0OA 2JEOA 2FFAA 1FZQA 1OPXA 1J90A 1W49A 2ORVA 5FL7A 3T61A 2W58A 1L8QA 3MUFA 3SN6A 1M1YE 2GCOA 3NH9A 2HYIC 2BVNA 4CDGA 2XJ9A 3V4RA 3HPRA 4MYTA 1NG1A 2Z4SA 5E7MA 4ESVA 5JJIA 2B6HA 1G291 2BM0A 5TY0A 3TQCA 4B2LA 3AGQA 1S0UA 5JSZA 4Q03A 1XZPA 2DHRA 1CTQA 2EFHB 3P4XA 4XH9B 5FR2A 3E2IA 2VA8A 4OQMA 2QTVB 2F9MA 3KB2A 3KQHA 5BN3A 3THYA 5G3YA 2HUPA 3IHWA 3LAWA 2GZAA 2OO7A 2GK6A 1NLFA 3DO6A 4FCWA 5L3QB 2VHCA 2HYDA 1NVXQ 2YV5A 2RGGA 3QENA 3THWB 3VKGA 4TYWA 2VP4A 2FOLA 3X1DA 4LYAA 3THOA 3QPVA 5ANRB 1O87A 1DAKA 4JT2A 4GSYA 1XWIA 4V0MA 2CL6X 4P31A 3ZZUA 1DBSA 2PEZA 2FPMA 1TTTA 3QBTA 4YMUA 4Q9HA 1KI8A 1S3SA 1LB1B 4N3NA 1FP6A 2IX3A 4JT4A 2XX3A 4XIGS 2R6FA 1OKKA 2JLXA 4HLUA 2ORWA 3KKPA 1FW6A 4ZCMA 4Q7KA 1ELOA 1OFUX 2AWOA 5FUYA 3U3KA 4V0NA 2RB4A 2HEIA 4D26A 4ZIRB 4Q4AB 2BKUA 4W9MC 3ZIAA 4ESHA 2ZR7A 1L4YA 3ND9A 2OZEA 2XZPA 3SI7A 2J7PA 5LD2C 2AKAB 2V54A 3RRNA 2QMUA 2OLJA 3KX2A 2A3RA 1LF5A 1YKSA 3QI2A 4IOLA 2AR7A 2W2TA 3CUEF 1G20E 3MCAA 5HE9A 1RJ9B 2JAQA 1AQYA 2RGCA 2ZE6A 4PO1A 4TL7A 4CEIB 5L3RA 4CZ2A 4EFMA 4DLRA 5EZ5A 4QNRA 4UNSA 1F2TB 2HLDA 3THXB 4TZ6A 3CH5A 1XRJA 1WA5A 4V0KA 3IBGA 4G0NA 4F4CA 2A7QA 3GJXC 1FQKA 2ZUCA 4PHGA 5E3HA 1ESMA 1KSGA 2YINC 2YC4C 4M21A 2GJ9A 4Q4HB 3ZQJA 1GRQA 1KO5A 2ZYUX 4Q9IA 4URXR 1NMXA 4M8NE 1RIFA 5TB5A 4BLSA 2QP9X 2ZSAA 2BMFA 4A1FA 3RSOA 4XSGA 1T3LA 2B92A 3E70C 2WWWA 4QJ5A 2WWGA 4O3MA 1XMIA 4X8LA 2XTNA 4TQUS 5GJVC 3FYHA 3H2YA 1R7RA 4DXAA 5FI1B 5FL7D 2QAGA 3IPXA 4PO9A 1S2MA 4ILEA 4W7SA 4CEHB 3EZ2A 1J8YF 2IS1A 3D31A 1P72A 3BK7A 3BFXA 3GD7A 1P4SA 1IY0A 5FPHA 3KJIA 1Z5ZA 3PEWA 3IIJA 2R8RA 2A78A 4ACBA 4BGDA 3HYRA 5AK0A 1JXOA 2CK3A 2QUZA 1E2FA 4RKEA 1U99A 5D3MA 3K0CC 5DISB 5B64A 5J4HA 2YWGA 3L0OA 3LBHA 2O52A 1UAAA 4OBEA 1U0LA 2X2FA 2PCLA 3PQCA 4JVLA 4M9SA 3TRFA 2EU8A 3CX7A 5EXTA 2QN6A 3LW7A 2WKRA 3QQ5A 1KDRA 4MDEA 1IQPA 1KI6A 2QY9A 1YZTA 4PXAA 2JCSA 3RANA 1F5NA 1LNZA 3E5HA 3WMFA 5BQ5A 1H65A 4YMWA 3BH7A 3EA5A 1MV5A 1N6RA 2GTPA 2VPPA 2FG5A 4KCGA 1J2JA 4QFMA 4IEIA 2ZUDA 2EVWX 4WIAA 1NIPA 1Q21A 1NKTA 3CKLA 2CCKA 5IHPA 3AUYA 3K70C 1N6PA 4TMXA 4DLXA 1XXHE 1OKKD 1ZD8A 5GADl 4BFSA 1XEXB 4EPVA 2VHQA 3OE7A 5IF9A 2GZDA 1VG0B 3SJAA 1Q1BA 1XCMA 3MGCA 1UJ2A 4Q19A 2RMKA 5EE0A 1BKDR 3VX3A 2ZRGA 3ZIAD 3AV0B 1Z0KA 2F1HA 3RS3A 2GBLC 1BS1A 1EFCA 1G7CA 4JKYA 2J7PD 1KK0A 1ETUA 3AF1A 2F55A 1PJRA 3JVUA 4HEJA 4A2PA 2E1RA 4LV5B 3CB4A 4ZDWA 4B71A 3DHWC 1CP2A 4Q9JA 4DLYA 3BB3A 1JJVA 4A8JC 3A58B 3L43A 2FSGA 1KNXA 2DFNA 4KBFA 4OK3A 3WHKA 4BRWA 2HLDD 2JASA 2P2LA 4MGZR 5CYOA 5E95A 1E2DA 3C4JA 1II8B 3B8HA 2FA9A 1NVVR 1R5OA 1OXUA 4BFVA 3UG7A 4M0LA 4GOXA 5DE3A 4B44A 1U8ZA 1TU3A 3PEUA 4F91B 3C7KA 2XSZA 2ODEA 4IFEA 3A1TA 1CRPA 1UEJA 1CS4C 4EQ6B 2DWOA 1KTVA 3NH6A 4L8GA 2Z6VA 3EZ7A 4PHTA 3VFDA 3VNVA 4HAUA 5CLLA 2BBSA 4D25A 1JALA 2VTKA 2F9LA 3WXMA 1KMHA 4FCTA 4IEEA 1ZUNB 4QJ4A 1WMSA 4NYIQ 2PH1A 2PX3A 3FMFA 3SNHA 4HUQA 1R5NA 1E4VA 2JLWA 3PG5A 4JBWA 1EESA 1XMSA 4I99A 2QI9C 3WP0A 4PSKA 3DMNA 3KJHA 2V4ZA 5P21A 2GZHA 1VG8A 3O8CA 3SEAA 1KYIA 2OV2A 1CEEA 3ASZA 3REFA 1N6KA 3D6TB 3QG1A 4AG5A 2CK3D 5AUQA 5FTNA 4AIIA 1KK3A 2BCGY 2C9CA 5AWFC 5KNCA 2J0QA 2F6RA 3NHAA 2OFWA 3V00A 3BWDD 5FOVA 2ZRCA 5JEDA 2O8BB 1NVWQ 1OH6A 4LC0A 5F9FA 3QY0A 2GCNA 1XZQA 1VYVA 3SE0A 2QPTA 1IM2A 2FEOA 2BJWA 4C0JA 1AGRA 1D2EA 5BN5A 2DY1A 1IOZA 4OQNA 1P2UA 4MQBA 3TUZC 1E98A 2N42A 1KMQA 1XEWY 2P6NA 4YMTA 2ZXUA 3SQXA 1ZU4A 2J1LA 3RVBA 3P20A 3WY9A 4JJKA 4NDZA 2OT3B 3BB4A 2FWRA 5CK4A 4NL4H 1Q1ZA 4Z54A 4TYQA 3UMRA 4ERNA 3OE7D 1G7TA 1KY3A 1OFIA 3LXRA 3QVUA 1CBUA 3W6OA 2G77B 3IEVA 3RS2A 2MSEB 1KGDA 3TR5A 3DZ8A 4RJLA 3B60A 3U2QA 1Q3TA 1JJ7A 5DN6A 4WZBE 1N5KA 3EZ6A 3R9WA 3CM0A 4U7DA 2GCPA 1HTWA 3JZAA 4NTZA 4M2LA 3SQWA 1JB1A 4GP6A 4CIDA 4NYMR 3I8XA 1DVRA 4JMPA 1MH1A 5HTKA 1XMJA 3K0FB 1MOZA 3EIHA 4TT3A 2PMKA 2ZRBA 5FTKA 3EASA 3I5YA 3H86A 4JLNA 2IS6A 4BQSA 5AUPB 5JZVA 1XCPA 3KUCA 1XD2B 4CRWB 1PV4A 3GPLA 3LD9A 1O3YA 1G3MA 3CPHA 2F7SA 2ZAMA 3GLFB 2XSZD 3ONWA 1AQUA 1TQDA 4W5JA 3WHLA 4TQAA 1IHUA 3K0CA 1NG9A 2QTHA 3GLIB 1ZC4A 2UVQA 3OEEA 2W2XA 2PX0A 4NH0A 2FNAA 2WJYA 3CNNA 3DEFA 3QF4A 4DKXA 1P3JA 1DO0A 1T5IA 2IXFA 4AYTA 3U7EB 2XTZA 1P75A 1TL7C 2BV3A 2H16A 3VKWA 1JNYA 3VX4A 4AWXA 3K9GA 2VHJA 1Y3AA 3FHCB 1XTQA 2A9KA 4RD3A 3U7HB 3Q5EA 2RAPA 1NLZA 4KLZA 1OXSC 4KI0A 5G53C 2B21A 1E2QA 2QT0A 721PA 3AKDA 3I32A 2ZRDA 2R2AA 3TH5A 1HT1E 4JYBA 5CJPA 2YHSA 3A4LA 2QSZA 2F1JA 4PTLA 3GJ3A 3HP1A 4KODA 1NMZA 5KSYA 4TN1A 3A8TA 2VP2A 2QE7A 3PV0A 4M1MA 4RSGA 2R62A 5AJVB 3UWKA 2J3EA 3WNBA 1DTSA 2AK3A 4MDFA 5TV2A 3LA6A 2GBLA 3AP2A 1W4CA 3UATA 4PPNA 3RWOA 2KB0A 3AF2A 5AJWA 1OB2A 2KE5A 1OLOA 1N5LA 4LC1A 1W44A 1S96A 1XP8A 2J0UA 5K8LA 1H8HA 3RRMA 4Q4LA 1YRAA 5EJEA 2ONJA 1XXHA 3UPUA 3AEZA 3GJ6A 4A8JA 3R7WB 2FH5B 3AKYA 2VSXA 1TUEA 2F43A 1E9DA 4LCBA 4XTRA 1YR8A 3WBKA 3ZVNA 2CDNA 4MKGA 4ARZA 2PBRA 4RD1A 5J4LA 4BFXA 4TMZA 1ZRHA 5JI2E 3PCRB 4OQFA 1WCV1 2BCJQ 2J7KA 1JQLB 5JECA 4UNQA 4LGMA 4Q18A 3MJRA 3EX7C 3FWYA 4JVNA 5SZHB 5DN6D 2XZOA 1QBKC 5KDLA 1X1RA 4O25A 3RLFA 3CONA 3GLHB 1W0KA 5CM8B 4C7OA 2ZU0C 4JBYA 2ZJ8A 5BYKA 3QEOA 2HDNB 1U9IC 1QVAA 1ZJ6A 4HDCA 3WMEA 4BFZA 2IS4A 1SKQA 1ZAKA 4TT3D 1JBKA 3Q7QA 1FPMA 1K5GA 1JR6A 2VHTA 3F3YA 3KXKA 4CT4B 4C9BA 4RZXA 3B1VA 2AXPA 3F0TA 3MWKA 4QM7A 3LX8A 2D4HA 1WF3A 3EXAA 1N3BA 2WAYA 1RYHA 1XBTA 2ZJ5A 4A0HA 1FX0B 3SR0A 4AC9A 4IW3B 4TYPA 3R8FA 3VQTA 3I8SA 1A5TA 2NGRA 1IJEA 1GDDA 1OXTA 3CPJB 3CWZA 1E0SA 1IXSB 2FSFA 3OEED 4TLAA 2XXAA 4W5HA 5CB8A 4IOJA 2D7DA 2ZYVX 4RZ3A 2HCJB 2BMEA 3U61B 4ZPXA 4JLPA 2O0KA 3RS0A 1XJQA 4FWIB 2EFGA 2IS2A 2GF0A 3QNUA 3NTUA 1FNNA 2ZRJA 4M1KA 3NC1C 3B7GA 4ASUA 2YWFA 4MRNA 4QXAA 1G3RA 1T9HA 2IXEA 4BWYA 3ADCA 4IVQA 1R0WA 5L3VA 4WZAE 2IYSA 1Z63A 1W4RA 4B3FX 1VDZA 3K0AA 4QRHA 2V6IA 3EA0A 5G3ZA 5JBQA 4QM6A 1GM5A 3FTQA 4IDPA 3Q72A 2HXYA 3NC0C 4B3BA 5JMTA 1PUJA 3K70D 2GXUA 3T34A 2WJVA 3EZ9A 3KJGA 3W6PA 2C98A 2CCGA 4BUJA 4MA4A 4JLDA 2J0VA 1DG3A 3AP1A 3TR0A 2BEJA 1G7RA 5G41A 2IUUA 1R4AA 2QE7D 4UXIA 2NO9A 2VF7A 2WWFA 4LBVA 2GESA 3B9PA 1P5ZB 2Z0MA 1OYWA 2GA8A 5DIFA 1G5PA 4M4SA 3QOFA 1T6NA 3K53A 1GUAA 2LCFA 1G5TA 1I4TD 1KZGB 2AWNA 5B30A 4QHYA 5EP1A 1TF7A 1GRNA 3HJNA 4XD7A 1YRBA 2ZRLA 2ZREA 1H8HD 3W5JA 2DCUA 1W5SA 1E2EA 3HWSA 2GVZC 1TADA 2XNSA 4YDSA 3O8BA 4JLKA 5FOXA 2XB4A 3ZQ6A 4DT1A 1YZNA 4B3GA 4TZ0A 3IIKA 3A1WA 1NSTA 2ZI6A 2KBEA 4LBYA 2P65A 3HU2A 4LYHA 2ANCA 2BDTA 4MITA 3N5CA 1BO6A 4TMVA 3ECCA 4URYR 4QNMA 4KHZA 4LBZA 4WOPA 4OJKA 4QBHA 5G40A 1NN1A 4D82A 2H57A 2H7VA 5EP2A 4EFNA 5L3SB 4J0QA 4G5OA 3KQLA 1SULA 5IT5A 3ADKA 5DHAA 3TKLA 4I1SA 4PAQA 1HQYE 1HV8A 3SC3A 2QP4A 3LLUA 2DPXA 1W0KD 1C4OA 4LV8B 1QF9A 4XWAA 1EFHA 4FIDA 1XTKA 4C0SA 4ZKEA 2BBOA 1E3MA 1W36B 1LTQA 2D2FA 4M1WA 1KSHA 2F3RA 4NONA 5JHGB 2Q3HA 4G5QA 2AXNA 4MKFA 4EJSC 3TE6A 4Q5IA 3TK1A 1GKIA 3BS4A 3R8CA 3ADDA 4OQXA 4TLCA 2RHDA 3T1VA 3PJRA 3SFZA 1MABA 2A5JA 3FVQA 2WZQA 1JEEA 2YYZA 2RGDA 4C3ZA 4DB4A 5CIQA 1IXRC 1V5WA 2XNDA 5DI3A 5FOUA 4QOSA 1KY2A 2IUSA 4FI3C 3CWQA 1GOTA 4M1OA 4AD8A 4ZDJA 1Z8FA 2O8CA 2JJ2D 3UWOA 4P3YA 1JPJA 1FNMA 3LX5A 1W4BA 1XCGB 1WB9A 4XTCS 3A4NA 2QQEA 3GP8A 3ZVLA 3QXXA 3R9XA 1VG9B 5J5CA 4ASUD 4JL6A 1OV4A 1KSJA 1UBCA 1SZPA 3S1AA 1ZW6A 2ZR0A 5FPTA 1DO2A 4C2UA 5AUNB 5FBRB 1Z3IX 4HAWA 2R6AA 4TLEA 5CLQA 3FB4A 1Q1QA 4DUGA 3W8NA 1SXJE 4HSEA 3NHBA 1OH5A 1CJKC 2H17A 3RC3A 2ZI3A 4ITRC 3NG1A 1ZU5A 4L15A 3C5HA 1G18A 5SZKB 3WBJA 1BOFA 4DZZA 1ZUIA 1NY5A 1XTRA 1B0UA 4F92B 4QBFA 3AM1A 4KV9A 3B1YA 4Q7MB 2GXQA 1TQ4A 5DYIA 1RRGA 2IYUA 2V1UA 4XD7D 2C5LA 1RRFA 2KJQA 5K8UA 4I1UA 2FMXA 1SXJC 1X8LA 4EPYA 4HZUB 4TL9A 1U9IA 2ZJOA 4GT1A 4PPGA 4RFSB 5CITA 1Z83A 3U7FB 1G21E 2DFKB 3EWAA 4ZDIA 4LUCA 4R2HA 2ZEJA 3VTKA 1W36C 4AY2A 1EWRA 2HF8A 3B82A 3W9YA 3NDBB 4TSFA 3VNUA 3O47A 2QMEA 2I3BA 2P6RA 4Q9KA 3T06B 2BMJA 3PFIA 1W2GA 4DC9A 5HCNA 8OHMA 1FOEB 2A5GA 2FV8A 3TVTA 4RY2A 4F4IA 2ZSEA 1CU1A 3L0IB 3FMIA 1KOFA 2GK7A 3NDPA 1K8RA 2J5XA 1PZNA 1CR1A 1HE1C 1E2MA 4C0KA 2ANBA 2P0EA 4B35A 4A0FA 2GJKA 1E9RA 3C5CA 4P4SA 4LPKA 4DEXA 5E7IA 1U2RA 1UBEA 1XTIA 3OFNA 3R9IA 2ZS9A 1UADA 2P5SA 4IVRA 3GLGB 1K5DA 1G8PA 3ND8A 3U60B 1PLLA 2FJUA 2KBFA 1UEIA 4BECA 4CEJB 4TTQA 5C1BA 4K46A 4TLDA 1G8FA 4D0LB 2J87A 5KPJA 3D7MA 1W2HA 2IHYA 3MG9A 4II7A 2IF2A 4LV6A 3BOSA 2EWVA 2AKYA 3LO5A 5FUXA 4BFYA 4M1SA 1V43A 1J7KA 2XNDD 3P32A 4P4TA 3QEJA 3A37A 3B78A 1VPLA 1YZUA 3PUVA 2EWWA 4NMMA 1T8TA 2QU8A 1G6OA 1OXVA 3JZMA 3IEUA 1TPZA 4H1VA 1XU4A 1IONA 3TIFA 3DOEA 2NG1A 1KJYA 3AP3A 1MT0A 1AKEA 2YC2C 1P9WA 1E96A 1A4RA 2P3SA 2A5YB 4XOIA 4P0TA 3CNLA 2X77A 2O8FB 1ZCBA 2QGZA 1EXMA 3RC8A 1E9BA 1JPNA 4DDWA 621PA 1MO6A 3U3MA 4ZCLA 1AJEA 1TQ6A 3IILA 4P32A 4DUGD 4HDQB 2WAXA 2IYXA 1P9NA 1T0HB 2Q9BA 2J59A 1YZLA 5A4JA 2CL7X 2O8DB 2BMDA 1XTJA 4L4UA 2ZYTX 1MO3A 3KJEA 1M8PA 4Q1EA 1HH4A 1FL9A 1US8A 3EZFA 4AURA 4BZPA 1R6BX 1UBFA 4KAXA 3M6AA 1FP7A 3DKPA 3FE2A 3BXZA 1P9RA 3L0PA 1TUIA 1KO1A 4N1AA 1N5IA 2IYYA 3DDCA 1IN5A 4YLGA 5HR5A 2ECKA 1S8FA 2QEQA 4JKIA 4MUBA 1UKZA 2D7CA 1G3IA 4EJSA 1F6BA 3X2SA 4U5XA 4A92A 2DYKA 4Q1BA 2ZAOA 2PJRA 2O0HA 3NEYA 2J9RA 1RPZA 4TSFD 1XEWX 3QKSB 4TL6A 2WBLC 4KFTA 4A36A 3ICQB 1RRCA 1DOAA 5JLJA 2C04A 4F93B 4C4PA 2J45A 2NOAA 2HT1A 3K9NA 1R0XA 1QHYA 3RDPA 1DPFA 5FTJA 1W46A 4GRAA 1YQTA 2GJSA 4KJZA 2LWIA 2O5VA 3OAAA 4NZYA 1E9AA 2V1XA 1GAJA 2G3YA 3OFND 2IYRA 1H8EA 2PLRA 4O2LA 2WTUA 1KK2A 4D2IA 5SZIA 4V02A 4CYMA 4AKGA 1RZ3A 4UXHA 1NJFA 3EARA 1GNPA 2IW3A 3IO3A 4IXMA 3H84A 2C99A 1P2SA 3H4MA 3RABA 4L9WA 4OHXA 4Q1CA 3TGPA 1KKMA 3BAFA 4XVRA 4PQYA 3PUZA 2XJ4A 2C8VA 2L0XA 1N6LA 2PT5A 2JLVA 4JBXA 4OHYA 3DPUA 1G8HA 3BBPA 2ZTSA 4LHWA 2GKSA 2P67A 1P7CA 4C30A 2QAJA 1P6XA 1Q0UA 1S1MA 2AHOA 1M6NA 4L5BA 4PQFA 2BHRA 2Q3MA 5BXQC 4OQLA 2H1LA 1SGWA 5FOTA 3RSLA 3TNFA 3BFKA 2VP6A 2XTMA 3AVXA 1XD9A 2GILA 2ZSFA 3KTAB 1D8TA 3OF5A 4PQRA 4TMWA 1OYYA 1GVNB 1A82A 1XB2A 3VR6A 1DEKA 4BFTA 3U4QB 2VBCA 1M7BA 1KDPA 2IXGA 3P27A 3B13B 4BZQA 2HT6A 1R2QA 3KQNA 2G88A 2JDIA 1SXJA 1AM4D 3W3ZB 2CLCX 1SHKA 1YE8A 3CX6A 3Q8XB 3TW8B 2ZIAA 3AVUA 1E9CA 3VU9A 4GMXA 2TMKA 3N2IA 1DG1G 2CEAA 2QBYB 5JEEA 3MLEA 1NKSA 5GVSA 3QKRB 2BKEA 4PC3A 2VP9A 5KNBA 2ZSBA 1XX6A 4PC1A 4KYUA 1BYIA 2IC5A 2VQSA 1QHHB 2CCJA 1BH2A 2ATXA 2QENA 1HE8B 2X2EA 2P5TB 4D4JA 1U0HC 3LY5A 3Q5DA 4HYYA 4MYCA 3U44A 1NF3A 4PHFA 1CKEA 4G5GA 2FN4A 1IAQA 1S9HA 3GEIA 5KSZA 2OAQ1 1ZC3A 2CJWA 1GITA 1MR3F 4LHZA 2WJGA 4Y0VA 1M74A 1YVDA 2OESA 4JLAA 4URWR 1U94A 4NYJQ 3KXIA 1OSNA 1E1RA 1EFUA 5AJXA 4E03A 2YKGA 1J70A 1L2TA 4ZI3A 1RW4A 5KNDA 2QTFA 3WYFA 4F7WA 3PVSA 1GRRA 1PUIA 1UPTA 3RS7A 1OB5A 1EK0A 2G0NA 4C0AC 2EYQA 2VYFA 3SHWA 2KWIA 3E1SA 5EXSA 5GJBA 5CYPA 3VMFA 4EKDA 3AVTA 2X8AA 4Q47A 3VR4A 1PVOA 3CRVA 4MYHA 2VHUA 2YVUA 2V55B 4A9AA 3K1JA 2ZANA 4DLZA 1M7GA 1Q1EA 4RD0A 2IL1A 2GRJA 2OCAA 1Q3HA 3OAAD 1F2UB 1IN6A 4A2WA 2DB3A 3QE0A 2ZRKA 3NIBA 5EE1A 4LOAA 1ZNYA 3BE4A 4FMCB 2R44A 4DDVA 1E94E 3MFYA 1H8ED 1HUQA 3SJBA 1EG7A 2IYQA 4DVGA 4NCNA 3ZLJA 3O8DA 3QG5A 4JLMA 1IY1A 4QGFA 4MRVA 2XGJA 2EFCB 4IJMA 4A0RA 2RGXA 1AN0A 1JAHA 4UNRA 3PEYA 2RGNC 2CXXA 3LQRA 4CVNA 4QBGB 2VEDA 3M1IA 5L3QA 2CE7A 2IEZA 4Q4JB 2WWYA 3THWA 2O8EB 4X8HA 3SOPA 5F9HA 3K0EA 3OIYA 3T15A 1KZ7B 4DIEA 5KDDA 5C18A 2V9PA 3UMSA 1EX6A 1P61B 1D5CA 2QA5A 4OI1A 4B33A 4O2RA 4DEYA 2GEUA 3HR7A 2HJGA 1HYQA 3RRYA 5FUWA 5DYGA 1W4AA 2A5FA 2XOKD 1KO8A 5CIWA 2BC9A 2NO6A 1K6MA 2GCOB 2OLKA 5CJ2A 4EAQA 1ZM9A 4RCYA 3UK6A 4Q02A 2JDID 3X1ZA 4RZUA 1SXJD 4MKHA 5JCZA 3NWJA 1ZM4A 3QF7A 2DBYA 2ZS8A 4OHZA 5JSZB 4MGYR 4BEBA 1GNRA 1JR3E 3GQBA 2HXSA 4XJXA 1W36D 1AZTA 4EPXA 4ZIRA 4Q4AA 1T0JB 3CF0A 1E2NA 3N2EA 5FOWA 1I2DA 1DAIA 2W0MA 2EYUA 4KSCA 4RD4A 3RWMB 3THYB 1BYUA 1KDOA 1T3SA 3TSWA 2CL0X 3PITA 1ESNA 3U3OA 5K8TA 1ZNZA 4HAZA 1WQ1R 2REXB 4URVR 4A4DA 1RJ9A 4AKHA 1QZXA 4CEIA 1KAOA 2F1IA 3L82B 5EZ6B 4OL0A 4JLJA 3TBKA 2E9SA 1GILA 1HURA 2WJJA 2IWHA 1F2TA 4URZR 3THXA 4PC7A 1II9A 3LXXA 2EFEB 3UMFA 4B3CA 4B47A 1E1RD 1J99A 2MSDB 2QQ0A 4Q1AA 4RD2A 1E1QA 4KVGA 2F1RA 4DLWA 1SKYB 1OJLA 4QKQA 3EPHA 1EFRA 4Q4HA 2J46A 1Z06A 4GFDA 3ZS9A 1TQ2A 1YR6A 2QORA 2EFDB 2R6CA 1G17A 5KPDA 1DE0A 3BH6A 1P62B 1HEIA 2OCYC 4B3XA 3GLFE 3K9HA 1PLKA 3NXSA 2CVFA 1Y63A 4HLCA 3GLIE 4IDNA 1OFTA 2QSYA 4NKRA 2FEMA 1ZCAA 2ZE7A 5E4FA 1S1CA 1TEVA 3AF3A 2REOA 3AQ4A 2YWEA 2IT1A 1A7JA 4CEHA 2OXRA 4KU4A 4IDOA 1N6NA 3CRMA 3NBZC 2VRWA 3LV8A 1TAGA 4O0MA 3CRQA 1KK1A 4R98A 2JGNA 3H1TA 5FL3A 5JFGA 1RC8A 4H1UA 5JCPA 3KQKA 5FTLA 4E22A 4HB0A 5FPYA 4IDHA 1RKBA 2D06A 5CB6A 2IF0A 5C46F 4IVPA 5FBVB 3P1JA 3FOZA 1XMVA 2WIAA 3HYTA 1E2LA 4WW0A 3MWLA 4G5RA 1ONBA 4UNNA 4M22A 3I4LA 1VYUA 4PFSA 4S2EA 1JEDA 3BFVA 2PJZA 3QKTA 1CIPA 221PA 3CBQA 3QIAA 3RRZA 4LYFA 5EP3A 1N5JA 1SVSA 3CRW1 4BPBA 4HB4A 3WRYC 1G41A 4LYJA 4WVFA 1GL6A 3PXGA 1CF4A 3Q85A 1IN8A 5EQTA 4ON9A 3IBYA 4GDFA 3ASYA 4QHTA 4V03A 5DSZA 4P33A 2YOGA 1XPUA 3I61A 1XD8A 4IHQA 2OG2A 3VHLB 4Q7JB 4DRZA 2QAGB 2JJ2A 4HAYA 1NIJA 1P2VA 5J4VA 4B32A 3RAPR 2V8OA 2WMNB 2PEYA 3P4YA 3I62A 4QBIA 5LB2A 2BEKA 1XEXA 1GNQA 4AK9A 2UZIR 1VCOA 2QNRA 2JLZA 4EPWA 4FMBB 2FZ4A 3TMKA 5HZHA 3T1TA 3OZXA 5D3MB 1JI0A 2BJVA 4PZZA 1R8QA 1AA9A 1Z2AA 4OI2A 1DELA 1LFDB 1N6HA 1VCNA 4D80A 1KI6B 2YJTD 1WDTA 4D4MA 4CGZA 2VF8A 1C1YA 3K0SA 1LS1A 3PUWA 4PX9A 4BLRA 3GLHE 3T35A 2WVJA 1G9XA 3CO5A 1DS6A 1WP9A 1RRPA 4EDHA 4CT5A 2N1BA 1E6CA 1II8A 1UM8A 4YONB 4FN5A 1VECA 1E1QD 5J4YA 1SVOA 1EFRD 1S3GA 4PAMA 4N0DA 2JJ8A 4FMCF 4EQ6A 5JWOA 4LBWA 2ZRHA 2GEDA 1F48A 1T8UA 2RGNA 4G3XA 4B3DA 1MO5A 3EC1A 1GP2A 3GMTA 2W0SA 3ZVRA 4TWZA 5BYJA 3ZD6A 1U8YA 3VHXA 2GEVA 4MRSA 4YMSA 5DLQC 5H1YA 2CNWA 4B48A 1LW7A 4BLOA 2VH5R 2LKCA 4XVQA 5B2ZA 1NI3A 1YR7A 3CZQA 1NVUQ 2AD1A 2NZJA 1EX7A 3DZDA 5KOYA 1VHLA 4U00A 2IHBA 4JS0A 2JLUA 4L9SA 1XJCA 2H5EA 3LBNA 4NBSA 4TTPA 2C78A 3W8RA 4OI0A 4PZYA 3VR5A 1X8JA 2ATVA 3CX8A 2FFBA 3TSOA 4XWOA 3MJHA 3BB1A 1VTKA 2AL7A 5LB4A 3KUDA 2WOJA 4P4UA 4DCNA 4RVCA 2QZ4A 2PT7A 3B2EA 3W6NA 4AYWA 3LBIA 3LH5A 2C96A 2UZ3A 3CR8A 2ZQ5A 1NLYA 2ZR9A 3C15C 1OH8A 3GJ0A 1NSFA 2NPIA 2A5DA 2O8BA 1WRBA 2RGBA 4LJ6A 3P26A 4NCKA 2ZRFA 4KFUA 1Z6AA 5HCIA 2QM7A 4DBLC 2JLQA 3CF2A 3WNCA 1TU4A 5DNYB 2PCJA 2ZRPA 1KMHB 3GJ4A 1HT2E 3B6EA 4MUAA 4D6PA 2ZJYA 4HUQB 2FZLA 5A5GA 2ZU6A 5FUVA 4A82A 3SU8A 1X8KA 3ZD7A 5LBIA 3NBXX 5BWMA 1JR3A 4TL8A 5HE8A 3FMPB 4KFRA 5FI0B 2OBNA 3AKCA 4DLTA 4RFVA 5FFMA 4KLNA 4RD6A 3ZGXA 1XDBA 4US2R 4K8OA 3VKHA 1FFHA 1QHIA 2XB2A 3AVWA 2Q9AA 4XVUA 1KJZA 4WBSA 1VYTA 5EUMA 4YQFA 4DSOA 2ZE5A 4B74A 4OKSA 4JLBA 4KSBA 2GDJA 3IIMA 1X3SA 4GZLA 5TXGA 4U02A 1Z2CA 2ZI5A 2OFXA 2PZGA 5K8IA 4DCVA 2OXCA 4NYIR 4Q21A 2CLDX 3NVAA 1KO7A 3NEJA 3AF4A 4PO8A 1G3QA 1E9EA 2FU5C 4B6EA 5JRZA 3R20A 4GNKA 3K0FA 5LD2B 2YNMA 2N46A 1NRJB 1UF9A 2R6GA 3IQXA 1XD2A 1Z6TA 3ZZ0A 3SYNA 1VKJA 3QKUA 3GJ8A 4BEJA 1X1SA 1D2MA 5CDFE 1U81A 1XFAA 3LW8A 3GLFA 4WXPA 5AR1A 1N0WA 4NHOA 3GLIA 1X6VA 1T4GA 1DADA 4DIDA 4QJ3A 4D4KA 4LWZA 3LRPA 1R8SA 3AVVA 1KAGA 4GL2A 1ZUHA 4NYJR 4RCZA 2CNWD 4TQ9A 1M34E 5KSOA 1KHTA 2Z4RA 2GXAA 2UKDA 2R9VA 3EW9A 1R5BA 2I1VB 1D9XA 3GCGA 2X19A 2WWXA 3QVVA 4B2IA 1ZP6A 4F4JA 3KB1A 1CLUA 5FOSA 3JVVA 2ZROA 4PSAA 2F3TA 2WKQA 3V9PA 4BLPA 4KO8A 4E09A 2GNOA 2ZI4A 3B9QA 3G5UA 4ZDKA 3QUSA 3WNDA 4ZI2A 3MWYW 3SYKA 1TMKA 2W83A 1Z28A 3K09C 1Z6YA 2C03A 4XSHA 2JLSA 5FPKA 1UKEA 1SVMA 5EP4A 4ZKDA 1TF5A 1RYFA 3PR1A 2RKOA 3OHMA 3DL0A 2FF7A 2CLSA 1G19A 2ZETA 1PLJA 3EC2A 4R9UC 3HU1A 4AKEA 3TUJC 2FSIA 4A15A 2BBWA 2GETA 2GWHA 1JXMA 3GFOA 3WP1B 2ODNA 3BC1A 1CXZA 1AKYA 2PMDA 2P6UA 3IUYA 3QF4B 3B1XA 5FPSA 1LS6A 5BN4A 1W7AA 1Z47A 4PPQA 2ODWA 3M0EA 3MAAC 2VP5A 2IK8A 4OJQA 4WZ6A 5C2JB 3R7WA 1TNDA 4DLUA 4BRUA 1M2OB 2B7BA 4URUR 3U6KA 1E2IA 4QG7A 2AN9A 3X1YA 1JR3D 3MSXA 3KQUA 1KI3A 2JLYA 3GFTA 3WRXC 4E07A 3UIEA 3TLXA 2GAAA 2WMOB 4Z1MA 4OHVA 2YWHA 4YC7A 3ZJYA 3K70B 3J81k 1AGPA 5UKDA 5IK2A 4YXWA 4TYNA 2OFOA 2CHGA 1ZMXA 2JATA 3WYAA 2RHMA 3SBEA 2NPFA 2ZS7A 4UNPA 3TQFA 1KIMA 3GLHA 2WWHA 4DSTA 5EXPA 2FPKA 4EIWA 5GVRA 1NMYA 3Q9LA 3RS5A 2IYVA 1U90A 4BASA 1XJ0A 1J8MF 2WV9A 4DWJA 1JAIA 1HQCA 1G1MA 2WKPA 1W0JA 4JVMA 3U3JA 1NN5A 4MGIR 1VCIA 1ZD1A 3IPYA 5HPYB 3GLGE 3CH4B 3G0HA 2J0UB 2QL6A 4POAA 4C0QC 1W48A 3PUYA 1VCMA 3L0SA 4HB3A 1XXHB 3IDQA 4A8JB 3NBYC 1FX0A 4LJ9A 1UDXA 2EQBA 2ODBA 3TJZA 3WYGA 2F43B 2GJ8A 4DCUA 5EE5B 5B57C 1M7HA 4LHYA 1GZSA 4C0LA 1E9SA 4DDTA 2W6JA 3KFVA 1G3UA 4JL8A 2Z5FA 5DH9A 4ARZB 1OIWA 5GJCA 1GG2A 1Q20A 4IOKA 1GL7A 1Q12A 2BWJA 4FINA 1QHNA 1T91A 2WPDA 2RH5A 4R71A 2DR3A 3IO5A 3C16C 5F3WB 1JECA 5FBLB 2WICA 4C7OB 1MRNA 3GFPA 5JS7A 5LPNA 3EIQA 4LHXA 4LJ8A 2IYWA 4BZXA 2G0TA 1ANKA 4MRPA 2B7CA 2ASEA 3KKMA 1GIAA 2PZEA 2W00A 3IHLA 3VR3A 4FCVA 2BOVA 1N6IA 1VG1A 2JIZA 4F38A 5L8VA 1AZSC 1RFLA 3NBFA 3AVPA 1QHXA 4M53A 3EPJA 3M4YA 5TMPA 3I5XA 2BBTA 5JWRA 4AKIA 2ZVQX 1F60A 4M9XA 1ZYUA 4Q48A 3QBVA 1G4AE 1HA3A 2NO1A 3U5ZB 4ABYA 3U6BA 2CBZA 2VO1A 3DMDA 3BIFA 4RZ2A 821PA 2XXAB 3D3QA 2OAP1 4JZKA 2GVDC 5D3QA 4Z8YA 4PC2A 3U3RA 2GF9A 3SZRA 3MWJA 1OIVA 4M9ZA 4LJAA 5CK5A 2V3CC 4BLTA 2EW1A 1Z0IA 3EIEA 4JVSB 1A2BA 3BH0A 2CE2X 2NTYC 4DSNA 2NIPA 1OT3A 2OSBA 1BIFA 1FUKA 4UXJA 3LDAA 3K0AB 1E79A 3AF0A 3C41J 4LJ5A 1U98A 3KDSE 2Q9CA 3BERA 4LPSA 1Z6GA 4Z1MD 2O0JA 4LY6A 4BFWA 1LVGA 5FBWB 2J0SA 3F8TA 2XOKA 1Q22A 5L3SA 4YXWD 5IK2D 2IBMA 1T5LA 4H9GA 2QPOA 1NN3A 2Q6TA 2HF9A 1D2NA 2WOOA 1VIAA 2XITA 3A1VA 2OBMA 2JLRA 4Q7LA 2ZVPX 3LVQE 4S35A 1CJVC 2ZPTX 1LV7A 1YZKA 4M1YA 2QMHA 2VIIA 4TMTA 4WA7A 2OILA 2VP0A 1G16A 3GEHA 4AG6A 4PC6A 3TVDA 4AYXA 3A36A 1W0JD 2WM9B 4FMDB 1SVLA 3U7GA 1X86B 3QPWA 5CDFA 4BE7B 3B85A 5SZJA 3DM5A 3IKJA 2KSQA 1NBME 4YDHB 4JLVA 1MKYA 1QHSA 4AI6A 2WIBA 3X1XA 1OHHA 1XF9A 1Q44A 2A2ZA 4DT1B 4DHEA 2XEXA 1VMAA 1Q57A 2ZI7A 3K09A 5EXXA 3MRSA 3AVYA 1FMJA 3KL4A 3KXLA 4R2IA 4WAUA 3ETLA 2B8TA 2W6JD 4C2TA 2NMVA 1UKVY 1P73A 1G8GA 3CW2A 1Z08A 4NP6A 1KI2A 2ZJBA 1FUUA 1OFHA 1R0YA 3KZ1E 3UG6A 1Z0DA 3QSYA 2H18A 5JHHB 3AGPA 5KU1A 5C4GB 2WPDD 3GJ7A 4A6PA 3A1SA 2ZE8A 2FGJA 2NZ8A 3UANA 5KSPA 3NKVA 3BORA 1MO4A 3A6PC 3UKDA 2Y8EA 5HKKA 3KKQA 3X1WA 2W6IA 3AH8A 3ADBA 2J41A 3FFAA 4JLOA 1A2KC 5JI3E 2IWRA 3OIWA 4OYHA 5TARA 3FKQA 4LJ4A 1ZBDA 1OH7A 4FW9A 5H68A 1XNJA 5DHFA 2FE4A 2WWIA 1D6JA 2JIZD 3KKOA 3PIRA 5TVKA 5JJKA 2G9NA 4HAXA 1N0UA 2ERXA 1E69A 3IGFA 4PANA 1FQJA 1Z0JA 1W47A 1KI1A 4DB2A 1MABB 1L4UA 4QGHA 1GWNA 4B6FA 3RNLA 2RGAA 4K81B 1E0KA 1A1VA 1I2MA 4EPRA 3GEEA 4G5SA 2W2VA 5DI3B 1KNQA 2E87A 4PAOA 2O8CB 5A0FA 2QPAA 1UFQA 4UJ3A 4PSVA 2GAOA 4QC2A 2H92A 4BLQA 2QRNA 3EAQA 1YZQA 5DI9A 1KDTA 4ZV4A 3B1ZA 3UXMA 4A2QA 4HZUA 4JIMA 4IKEA 3LLMA 1I4LD 1COWA 2CMKA 4NCIA 1IN4A 2QMOA 4RFSA 1G6HA 1SVIA 3WMGA 2ERYA 4LZZA 4PHHA 1NJGA 2C2HA 4MKIA 3S1AB 2DFLA 2DWPA 2YOHA 1OW3B 1E79D 1CULC 1ZM7A 2I4IA 4FXPA 2JA1A 5DGXA 5EUQB 3EPLA 2HV8A 3ZH9B 2BIFA 4GI7A 2QP3A 1P2TA 1P60A 1KKLA 2I1QA 3K9LA 1XTSA 4US0R 1E0AA 3QXCA 4HI0E 4DJTA 1ODFA 3EWSA 4Q00A 4B43A 3QXHA 4OK5A 4LK2A 3T5GA 2Z83A 3VAAA 4GMDA 4GOKA 1KI7A 2QT1A 3T1OA 6Q21A 1L7VC 1BMFA 1W5TA 2PL3A 4BFUA 4D0GA 2XZLA 2OHFA 2QGNA 4EFLA 1IN7A 1E2HA 3CRRA 2CHVA 3G82C 3L8YA 3SJZA 4Q1FA 2ZRNA 3GLGA 4HLDA 3I1FA 4Q9LA 4CEJA 1UKYA 3CIOA 5C4MA 4I4LA 4HAVA 3I73A 1QG2A 1KI4A 4D4LA 3O8RA 1OHHD 2MSCB 1QHGA 4DDUA 3D8BA 1II0A 4M9QA 4NCHA 4D81A 4DLVA 1GTVA 1FTSA 1E4YA 3AKEA 3VR1A 1CRQA 1Z22A 1YJ5A 4QHSA 4DCSA 5EE3A 4E5UA 3TUIC 2HCBA 1NY6A 1QRAA 4HATA 3TAUA 2FFQA 2OEPA 4LI0A 1RE0A 3BGWA 2PZFA 1KSFX 2AFIE 4B76A 1E2PA 1N25A 5J4KA 1GKUB 2FGKA 4B73A 1XEFA 3RS4A 2OE2A 2WSMA 5KHOC 3DOFA 4HDOB 2FX3A 1CR4A 1OE0A 3FGNA 4Q66C 3A1UA 1G4UR 4EPTA 2O8FA 2YOFA 4LHVA 5GJWC 1N0VC 3B5JA 1YU9A 3QJYA 4IFBA 1TEXA 4NPHA 2IUTA 4P4SB 2W6ID 5E7JA 2CHQA 5HKKD 1OF1A 2OUKA 4LJ7A 3V4FA 5JWHA 1DAGA 2G1JA 5F2EA 3REGA 2QRZA 2MMGA 4JSTA 1DARA 1GKYA 5BW8A 2O8DA 1XPOA 1Z07A 3HU3A 2FDCA 3LVRE 4TTRA 2AX4A 2D74A 2H8KA 2ZJZA 2ZYWX 4WXRA 2OM2A 3BD9A 5LDDC 3N70A 2IYTA 4DSUA 3BRWD 5FH9A 3GJ5A 5J40A 1ZIPA 1U0JA 4NCJA 1CJMA 3SS8A 4L16A 4PPFA 2Z43A 2AK2A 4LDJA 1S9DA 1Z0FA 2RGEA 1N6OA 3QXJA 3EG5A 1Z6XA 3DKVA 3VR2A 3W90A 4NU0A 3H0KA 3F5FA 4KYIB 3AB3A 4Y0AA 5IDVA 5IRCD 1RVDA 1COWD 1I4DD 1Z0AA 3BJIC 4IDQA 4GP7A 1W1WA 3W3AA 3LQQA 1ZM2A 4V0ME 4JJZA 2B8WA
chains in the Genus database with same CATH superfamily
5J2TB 1CUCA 3DQQA 4L28A 4UU1A 2AJ8A 1RWWA 4XWYA 3EEFA 5JSQA 4CM4B 3DZGA 5FDFA 3GRKA 1CUIA 3NALA 4DRYA 3IMGA 4J16A 1UBGA 4F8YA 1AIPA 3FDIA 4RL6A 3T95A 1YZVA 3UMJA 2ZJ4A 5IPFA 4FMDF 1AS0A 2OAGA 4GBMA 5ALDA 1JEAA 3E84A 2ET6A 1FDTA 2SCUB 5CPBA 3SQOA 4GGPA 4MV8A 1I51A 5C5DA 4XFJA 1X7XB 2PFKA 4TKUB 2VXYA 3ZS8A 5CXSA 2RCNA 1BMDA 1RZVA 1US8B 1YCFA 2ODPA 1E32A 4MYUA 1JQJC 3L8DA 4KI7A 5DCYA 1GSIA 3QFFA 5ALZA 4UBIA 2DT5A 3E15A 4MW2A 2RHOA 4IL5A 5KVQA 1ADFA 3IPRA 3RHFA 3ZWPA 3W79A 3HHEA 4DPMA 1NBMA 1TQHA 1T13A 2PMCA 4C0BA 4H3VA 4KXNA 5AESA 4MKXA 4KXVA 1EBBA 3D0KA 3Q88A 1GZHB 4UCQA 1LA2A 3FKSA 4BNHA 2R65A 3ZYCA 5LLDA 3RYIA 2REBA 3GZ4A 3KXDA 2XZTA 4JOQA 2AMFA 3PXEA 2I9PA 4NECA 2JFVA 1C9KA 2D2EA 3KYIB 1TYDE 2ZRAA 1T2EA 1E0JA 4MCJA 3ZZTA 4ZGWA 2V6JA 1ORHA 1D9ZA 3TAHA 2VQDA 1B23P 5DBGA 3X43A 1NBOA 3TNJA 3KOZA 3JSXA 4BGVA 3B5EA 5M04A 4UDYX 5I5EA 2AMYA 3IAHA 5DHRA 2IA5A 4HJRA 3W4KA 3VPXA 1M1XB 2BGGA 2RH9B 3IKLA 2OD2A 3FHJA 1ZD9A 2IXAA 2OBLA 4K9PA 5EFOA 5A3SA 2R6DA 1CVRA 3UAOA 3KTAA 2R3SA 4QYMA 1U7WA 2EGHA 2G8NA 4R2XA 4R1MA 1DKMA 3G5TA 3SHVA 2G4CA 2WT4A 4EZIA 4EA9A 4EG7A 2UYQA 2C9BA 2PX4A 4LDRA 4O4JB 4PV7A 1WHTA 2GEBA 5ALSA 4GOJA 4A6DA 1KU6A 3PJEA 4C0HA 3I72A 4YRTA 2GBCA 3QE4A 1X92A 4LSGA 5AQ1A 4QU5A 2P1DA 2YMQA 3WV4A 3HFGA 3NHJA 2VTBA 3A04A 4EKEA 2BI7A 2YWRA 1VJGA 4RVOA 3DVLA 4WEOA 1PCXA 4IQFA 2G6BA 3WAKA 3EWNA 3QKRA 2I55A 3KR2A 2XQGA 4RK6A 4RCVA 1QDUA 3MMPA 1IZZA 1RKXA 4KRYA 2Y93A 4G07A 4OAPA 2IYZA 4OUDA 1R0ZA 4DV4B 1EWQA 2LKDA 4RMJA 4HXGA 2PZMA 5KYTA 2VJDA 4JL5A 1QFXA 5KYUB 5B1HA 1IXZA 2YW2A 4KXXA 4AROA 1E9FA 2RAUA 2CUZA 2PNFA 2XYRA 2ZB7A 3JW8A 3OQIA 3PQ8A 3HXLA 1IDN1 4LXGA 1IJFA 5FWAA 2QM8A 1T10A 1GKLA 5D2CA 4KEAA 1ZXBA 3CZPA 1V8ZA 3HNRA 3S7ZA 1FSSA 3NETA 2EATA 2ZITA 2JBAB 5TT0A 3PLAE 3IUQA 1O1YA 1P2FA 3UJDA 1QG4A 3KPUA 1DAEA 4UARA 5ALXA 1LPPA 1JHZA 1E2KA 1GCUA 2VWGA 3NHLA 3WGNA 4W5WA 4PR0A 3CNOA 3T3DA 1YJBA 3K2IA 3WSVA 121PA 3ZDQA 3NTLA 2A30A 3DZJA 3O2JA 3Q10A 4R68A 1NW5A 3VU9B 4UM8B 4ZVNA 1LU9A 3OC0A 2Q21A 3DA8A 2V7QD 5A3JA 1WE2A 5CDTA 2UUPA 3ZWQA 3OESA 1BJTA 2ONKA 2CF6A 2I3ZA 1LBSA 1EZ4A 4R41A 3ZWNA 4DKJA 1KF0A 4IIHA 1MZVA 1KP9A 3I92A 4L5IA 3NDRA 2XWSA 2SKCA 1VL8A 2VSOA 2X4IA 1EKXA 1U0SY 3MBKA 3NAMA 3ROGA 4CW7A 5JADA 3RADC 1ZNQO 1CR2A 2F1OA 1VIYA 3D0QA 1WDKA 3NHZA 4XYMA 4OI4A 3V8PA 3BGIA 4BO9A 4WXHA 4WOBA 1KO4A 1ENZA 1IBRA 3VNRA 4ACAA 2G9ZA 4ML3A 4Z51A 4TYYA 4RHYA 3M82A 1FNDA 3SPXA 2VJMB 1VSVA 3TLAA 2FHSA 2XIJA 4ZEXA 3UJHA 3VPFA 4DCJA 1XAIA 2IV3A 4RTKA 5JUWA 4JBHA 3ZBQA 4Y2XA 4L6CA 2PKYX 1KY4A 1ECGA 1R6UA 1SU6A 1Z29A 1G21B 1SVKA 2JW5A 2Q0HA 4GECA 4UKDA 3JQDA 1X7WA 3M7IA 3B3FA 3UK0A 1YE5A 5AMXA 4BMCA 4AY6A 2NX2A 1QOPB 3JTMA 2I6SA 1CQZA 1EM8B 4HH0A 3FYUC 1Q0ZA 1ABFA 2BJHA 4MNTA 4Q4JA 3VR5H 3GU3A 1T3HA 4GICA 3ZNQA 2O8EA 3TBHA 4KWTA 3NHMA 1GDHA 3JQ8B 4D9MA 1R6XA 4JOCA 4UVEA 1K7SN 5D7NA 3S6JA 3I04A 5B58C 3T7TA 1LLDA 2Q3FA 2WHXA 1WBBA 4IDFA 2OFPA 2FMKA 4U0JA 3KVRA 4E5SA 3H1AA 2DFTA 1B14A 4RVUA 4Z8XA 5ALQA 2JEOA 4L85A 2FFAA 1Y1PA 1C0KA 4M76B 3SF8B 3OKFA 3ZBTA 3MUFA 1M1YE 4CU5A 2HYIC 1I36A 2K4MA 2VDWA 3WQBA 5E3IA 2BUCA 3V4RA 1TYEB 4JB8A 1PR6A 4RA6A 5JJIA 5TY0A 1G291 2PKQO 4B2LA 3G7NA 3AGQA 1S0UA 3PQFA 5JSZA 1QS0B 4HY3A 1E1CA 1XZPA 1JAYA 2AG5A 4HVTA 4MAFA 4OQMA 1S01A 4OXYA 1QP8A 3KB2A 1A4UA 1RABA 5B3KA 3ORHA 1F06A 2G72A 2Z95A 3LYLA 4Q6BA 3RTAA 1B26A 3ZE7A 4ZICA 3HCPA 2H1CA 4BVHA 4MS3B 4FCWA 3ZGOA 4CTKA 3VO8A 1ZK4A 1NVXQ 3SE7A 1C3EA 3OM0A 2PHZA 2X76A 3KVNA 3O4FA 3QVGB 1OYVA 5HCUA 3V7WA 3WVNA 4D0RA 2C57A 3O9MA 3THOA 1P0QA 3QPVA 4B3MB 3BMCB 1DAKA 2QD2A 4JT2A 3UWMA 1YIOA 2A0XA 4YJDA 4EI9A 4KMMA 1H0SA 1EJ6A 1XWIA 1Y8RB 3WJ1A 3ZHZA 3BE6A 4AJKA 4V0MA 2FKNA 3GG2A 4RKQA 3SQDA 2GDZA 1H1LB 4P31A 5E0KB 4KK4A 3QBTA 4YMUA 3FUCA 3RVMA 1LB1B 5DOZA 1RXVA 3NO4A 1LFAA 5JD3A 1Z18A 3FYDA 3PNVA 2R6FA 1OKKA 2QLMA 3SJ7A 3ER8A 5LJLA 3U56A 3HYLA 4CKXA 2ILVA 1R8XA 4HLUA 4BQQA 1LV8A 3HVRA 3KKPA 4ZCMA 1U2PA 1QR6A 1F14A 1OA1A 1OFUX 1TD9A 2YH2A 1W30A 5C8YA 5REQA 4ONEA 1CK4A 4QOFA 4D26A 2HGSA 2PN1A 3GRUA 4ISBA 4W9MC 5IDXA 1ZDMA 5KBYA 3MNFA 4RPKA 1CW2B 2M98A 4X1YB 4G84A 5JSUA 2GK3A 4K1LA 5JMPA 1BHSA 1C1HA 1LBHA 2AR7A 3CUEF 3R7AA 1HI9A 3O1HB 3OD1A 2VI5A 3N2ZB 3NBUA 1PEYA 2NVUA 4DAOA 2APJA 4ENUA 4WBNF 1AQYA 1V1RA 2RGCA 2CUKA 2WE8A 2H08A 4R1LA 5L3RA 4PG4A 5G4LA 3QP9A 3ZJTA 3I9OA 3WHPA 3TJRA 3E2MA 3E8SA 4UNSA 2EKBA 2C2WA 3THXB 1YBAA 5FQOA 4DUYB 1WA5A 4V0KA 4TTSA 4CMHA 3IBGA 3M89A 4G0NA 3GJXC 4JP2A 4UE6A 4F4CA 4BE4A 1MTZA 3DT6A 2Z2YA 3PF8A 2FUKA 3ZQJA 1TVMA 2HU7A 2GJ9A 2YC4C 3H2SA 1DIOB 1GRQA 3Q41A 4GGOA 3WV5A 2V58A 3ELUA 4IUDS 4RK7A 3L7JA 2J3KA 4QICA 3RIYA 1SEPA 2Z2ZA 3T9CA 5JQWA 2Y71A 1O7JA 1U7UA 5HIAA 1VJRA 1P7PA 1M2KA 1SUDA 1T3LA 2B92A 3E70C 2P77A 3FSRA 4IINA 4KW7A 1YL5A 3AY3A 4JT8A 4O3MA 4X8LA 3DHNA 4P93A 4BQNA 3FYHA 2QN9A 1R7RA 2CHFA 4J3NA 3U37A 2WM8A 3BHIA 5FL7D 4DV0B 1YFJA 2FYTA 1EHCA 3G89A 3IPXA 3TLGA 4RPJA 4BGEA 5AXCA 4H4CA 2E4ZA 1IVYA 4W7SA 4BQOA 2RHLA 4QUDA 2BR4A 3HWWA 5KQPA 4WACA 5T7BA 4O5AA 3BK7A 3GD7A 1P4SA 1Z7BA 2PE5A 1JDPA 2R8RA 2A78A 3MINA 1N2CA 5KTMA 5JJBA 5AK0A 3MGGA 4DR1B 1A50B 1LPSA 2D5BA 2ZAGA 3E7PA 3OZDA 5DISB 2VAVA 2XYQA 3LBHA 4MRAA 1K98A 2XB8A 3KQMA 1K5PA 2NZYA 2NV2B 1Y1SA 1UC8A 2PUAA 1WXWA 1AQIA 3I2HA 2VF2A 4JVLA 4QDUA 3ZH2A 2G09A 3TRFA 1S3IA 5AXBA 5I9BA 2RIRA 2PRJA 4RTOA 4R51A 1P1CA 3QQ5A 1PUXA 5AJTA 1KI6A 4UTNA 2QY9A 5AI6A 3AUKA 3WGLA 2LPMA 2P2YA 1FS6A 2FMHA 1T5OA 2R6HA 3HADA 2C0PA 4CIXA 5HJEA 5K0EA 4EDFA 1F5NA 4QNNA 1QC5B 3E5HA 4UE3S 4KR2A 2O3QA 2V5AA 2Y76A 3H7AA 3O0DA 3LM8A 4GXTA 1YOVB 4YMWA 4BL5A 1F1BA 1N6RA 4CQMB 3HXKA 2GTPA 4COOA 3ZU4A 5BSUA 3WLMA 3ZHYA 1ST2A 1GPJA 3B3QA 3FJYA 1Q0SA 1PT8A 2I2XB 3GOHA 1O95C 5HF5A 4ZCRA 5F12A 3K70C 5GADl 1P17A 3RSSA 1XXHE 2Q6OA 3JZFA 4YH1A 5LP6C 1PJ8A 1ENYA 1OWLA 1XEXB 2C1XA 3D1JA 3K1AA 3MTIA 4RS3A 2GZDA 5ECDA 1IEXA 5MFPA 3JYLA 3CZ5A 2C7PA 3DV0B 3FWHA 3JXEA 3MGCA 1UJ2A 3K7EA 3OZTA 2UZ4A 1ZHOA 3X0DA 3I42A 3GK3A 4L4RA 1AD2A 1Z0KA 3ESDA 1MC1A 4IAOA 4U8GA 4DMRA 2KQUA 3KWMA 4R9VA 2PZKA 3AF1A 2C92A 4PCUA 1WCYA 3MBIA 3SM9A 5BUQA 3A1EA 1HWYA 3C7DB 1GADO 3FWPA 5FNZA 4CV1A 1WAMA 4LXXA 3JVUA 2C8JA 1CUSA 4RY8A 2H4XA 4FQ8A 1I8TA 4G5YA 2XAAA 2YVAA 4A5OA 2W98A 2ZULA 3AQIA 2E1RA 4KFCA 3ICVA 1CP2A 4Y6SA 2OUIA 3AEKA 3GDWA 4HXEB 4OH1A 4Q9JA 3RVNA 4A8JC 4BWGA 4DLYA 3L43A 5DRYA 1YDEA 1OZFA 4KBFA 3IC5A 2HLDD 2HHHB 5THQA 1DDOA 1QIIA 3AETB 4KRFA 4DJ5X 3F1KA 1EFLA 4KV7A 3RG2A 2FAXA 1OXUA 1RAAA 4GF5A 5JAIA 3LCRA 5AI0A 4B6SA 3IOCA 2XSZA 1ZK2A 2ODEA 1ZFNA 2C3YA 1FFYA 1N3YA 2AQ8A 1XU7A 3NOVA 3W5AA 1QGED 1XRNA 1B42A 3NH6A 3UPDA 4ES6A 3LZDA 2JLBA 4HAUA 2CGEA 2BBSA 3U4AA 1ND6A 2VTKA 3P8ZA 5E9JA 3RUPA 2PXAA 1RACA 4MV4A 3BD7A 4IEEA 3G8YA 4GXQA 4QJ4A 4LKRA 2VS1A 4E4RA 3FMFA 4QXMA 1T9AA 1MOQA 3R0ZA 5G1OA 3HJGA 3F5MA 3C7AA 3S4YA 1E4VA 2XNCA 4ZV7A 3VPAA 1V11A 4BHTA 4QDXA 3B52X 3PG5A 1JKFA 1KP2A 4I99A 4BFSA 2QI9C 1A98A 3WP0A 1OAOC 1JT9A 4AO8A 3LFHA 3DMNA 4B46A 4D45A 1P1FA 2GZHA 2WMDA 5JC8A 1HNNA 1GJRA 1XVUA 3SEAA 3G0IA 2Z8XA 2OV2A 4XJTA 1CEEA 1XKQA 3DVRX 4JUDX 1QTIA 1HDRA 2O2XA 3PQEA 3D6TB 2O5EA 3SMQA 2QR2A 3VI4B 4I5DA 3FLEA 5FTNA 3K8ZA 4IIVA 3W2EA 1DC3A 1PDOA 1T1JA 2PSJA 2WRZA 5CA1B 1OQAA 2BCGY 1ZGZA 3G9TA 1T2CA 2C5HA 3PSAA 1TA4A 2X14A 3GLVA 3I0NA 3QTTA 4R9NA 2RHGB 9ATCA 3F4LA 3OJFA 1YTUA 2BDEA 4HGYA 3JQAD 2QX4A 1CC1S 4J43A 4BUCA 4OGWA 2O8BB 2VH1A 3FPGA 1M0WA 4RIFA 2I29A 4J9UE 4HNUA 4UVIA 3HKBB 1J0XO 4YUAA 3O8LA 4LC0A 5F9FA 3MW8A 5LNK6 3W9BA 3SE0A 4ZQHA 1IM2A 1R0CA 2FEOA 3F5DA 4MIKA 4WCFA 3KQVA 4IO0A 1HO3A 1U6JA 4OQNA 3TQTA 5JROA 1UOQA 5DDIP 1KMQA 3QX7A 5DEOA 1W52X 5FBHA 3JQBA 2DUWA 3DC2A 2HQSA 5C7LO 1ZI8A 3WY9A 4X85A 2BAGA 2OT3B 2FWRA 4FSDA 2Z98A 5EERA 3GLRA 4E70A 1Q1ZA 4XLLA 2O9JA 3UMRA 1C4KA 1TECE 2AN3A 2P9CA 4C0XA 4MLDA 1J5XA 5ALRA 1KY3A 5H80A 3LXRA 3V8VA 5E6SB 2UYHA 1CBUA 3HB1A 1RM0A 2G77B 1NR1A 3HZRA 1QYCA 1XMOB 1NMEA 4QDKA 4L75A 1P0FA 2YJZA 4WK2B 3TGLA 2MSEB 1KGDA 2VBIA 2X6RA 3IUMA 1G20A 2HQ1A 2QJTA 4TZTA 5A71A 4ZMSA 5BWLA 4RJLA 1DQSA 4DMMA 4RXTA 2FQXA 3W5DA 5DN6A 1S8OA 1YDMA 4ROSA 3NYWA 3EZ6A 2JAPA 2WD7A 4H4EA 1PW7A 4R31A 1YL6A 4X6XA 5K01A 3R9WA 2GLXA 2CKMA 2ODTX 2RBGA 2EG9A 3P9XA 5KREA 5A0TA 1JA0A 4CIDA 1BW9B 5KNDH 4NYMR 1SXGA 3FYCA 4QOGA 4QFCA 3NCHA 4EB8A 1XMJA 1SCUB 2WTNA 2FW8A 3IT3A 4KL8S 4TT3A 3PC3A 3L4JA 1EX9A 1SCKA 4HVLA 5KQGA 3EASA 4PO3X 3EF0A 3GH3A 3WZLA 5JZVA 1I5EA 4IO1A 4JJ6A 2DBQA 2I1LA 4EYGA 2BFNA 3DXYA 3MVEA 3IR5A 1P44A 5JVDB 4CRWB 1PV4A 2YV1A 4NMLA 2IODA 3ENZA 5K8CA 4ER5A 5CDUA 3GPLA 4KBYA 1O3YA 3KJXA 2RKWA 2VAWA 2ZAMA 2PM8A 3MEQA 3KSRA 1AQUA 1TQDA 3I1YA 3ONWA 4TQAA 4W5JA 1CZLA 1SM4A 2EW2A 2HI0A 2C2GA 3LHFA 4I1RA 3MAJA 3N2KA 1K1EA 2C7BA 1A9PA 2OQ2A 3JR3A 5K3AA 1A27A 1YMQA 2GPNA 5IJ9B 3K0KA 3PFFA 2W2XA 2WLTA 5DIZA 5CX1A 2BE7A 2P4QA 3PI6A 3CNNA 4NX2A 4NXMB 2FOXA 3PLNA 4M88A 1T5IA 4JXKA 4MQ4A 1LNQA 3C5VA 1GY8A 4CG2A 2BV3A 3VX4A 4IJWA 1O6CA 3K73O 1Y3AA 2CYAA 4IX9A 1XTQA 3STTA 1MX5A 2VPIA 1EWVA 1UBUS 2A9KA 2XQKA 3SYMA 3I34X 3Q5EA 2RAPA 3FTPA 4BBPA 4YAKA 1U2ZA 3NHYA 2Q5FA 2YCBA 5GONA 2IHUA 2R6JA 4UCFA 3GA5A 1OXSC 1WY7A 1S3FA 2NSJA 5G53C 2B21A 2QXYA 3GYBA 1LD3A 5DT9A 3RTCA 3TX6A 721PA 4DR7B 1TCVA 4E5NA 2YIVX 3AKDA 4J76A 4Z1OA 3AJEA 4JEHA 3ZX4A 3WRWA 3OZRA 1RYYA 4KTVE 3OTQA 5GM2A 3L1JA 5CJPA 2YHSA 1ZLXA 3A4LA 3ONDA 4Q9DA 3VPBA 5GINE 1XVAA 2HB6A 5BRNA 2VAXA 1OX6A 5EKTA 4DV6B 1NMZA 3IPAA 4NY1A 3A8TA 3UWKA 1Z74A 2QE7A 4L2IA 3PS9A 4Q82A 3ROZA 2E4AA 3ELYA 1KZHA 3LYHA 3WNBA 5BOSA 5EIXA 1UWLA 5KTRA 1QE5A 1P1BA 3NAZA 2Y1GA 3V1YA 4TV8F 3P96A 2GBLA 3AP2A 1SXQA 1JKXA 3UATA 2NUPA 4PPNA 1AO0A 1WCXA 2HJRA 1RYMA 3KU1A 1OB2A 2PS9A 3DDUA 4D56A 5BN4B 1GT91 4XEUA 1WMEA 1TO1E 1RYDA 1QPGA 3HLTA 4XIIA 3OH8A 3RRMA 2ZPAA 1AKNA 5F52A 4E30A 2ONJA 4MHOA 3M5PA 3GJ6A 3JATA 4OG2A 2UV8A 1SBIA 5TQJA 2A6PA 2FH5B 3LC2O 1CQJB 1VSUA 4ZTBA 1TUEA 4HNVA 3KQWA 3R5KA 1D04A 3K15A 4IH9A 3W2IA 4LCBA 1J9EA 3QLUA 3DB2A 1O6BA 3GDHA 4G89A 4RVHA 1KXZA 5DP2A 3U9LA 4FGWA 5AKYA 4GSKA 5JI2E 1TTPB 1DTWA 4K9LA 4OQFA 1JQLB 4UNQA 3QE9Y 3ABSB 4P7BA 5EWMA 5DV9A 2JGEA 5CVCA 4B3RB 1SUSA 4J7UA 4K5QA 3CEHA 3MILA 1QBKC 4TKLA 2ZYGA 3GLHB 2GH1A 3AL0C 4C7OA 1WCIA 3JQFC 5L7WA 1KEVA 2EKLA 3PPWA 5LOVA 3K8OE 1G8KA 5KWEA 5ERYA 4X60A 1QVAA 1G98A 1U9ZA 5CFMA 1ZJ6A 1BS2A 3N2GB 1OX4A 1ZOPA 3G68A 4KE8A 3RUFA 1FPMA 4HK4A 4AY5A 1QWSA 2VHTA 4XGQA 5B37A 2DTDA 4AXXA 3H9UA 4QPNA 3TMAA 3QFHA 2P6MA 1RTTA 1DIGA 1FX0B 3LS2A 3S40A 1FVFA 3SR0A 1CIVA 4AC9A 5KQLA 2Q1SA 1PR3A 2VNIA 2JFWA 3I8SA 4D4IA 2X41A 3G59A 2NGRA 3TD9A 1IJEA 4F4UA 1OXTA 3CPJB 3CWZA 3H0CA 2O7RA 4HFNA 1T34A 1IXSB 1EFPA 4AZTA 4W5HA 5EINA 5JDIA 1LTHR 4ID3A 1RQNA 4RZ3A 1UDCA 2PRSA 2HCJB 1JZQA 3O2QB 1DRWA 4JLPA 4MVJE 1S2IA 4GM0A 3NTUA 5AJHA 1FNNA 2ZRJA 5AW8A 1GUBA 1ODCA 1AB5A 5HJ2A 1HZZC 1J07A 1EUQA 5AM5A 3UAGA 4BWYA 1J09A 1T9HA 2IXEA 1K3TA 3O83A 3U0BA 1KMMA 4LDPA 1EGMB 1SELA 5ESRA 2IYSA 1Z63A 4O02B 4B3FX 1I30A 4JT9A 4U6SA 4B4DA 1GGJA 2GZ3A 1I32A 3IULA 2F48A 2Q2QA 3OHPA 5G3ZA 5JBQA 4IDPA 4EUHA 3JAMA 4QM6A 2WT9A 1DOZA 1YD7A 1RR6A 3GEGA 3NC0C 3U0VA 2OCDA 1LRKA 3ZGVA 4H3KB 4NK5A 1VKRA 1H6DA 1JLKA 1O95D 3K70D 5CG2A 1RMTA 3EZ9A 3OFSA 2C98A 3ZIDA 2B1RA 1QZUA 3AP1A 3TOSA 4TPKA 2NSYA 4HAOA 3HRIA 1G7RA 4MI6A 1MB3A 1XZNA 3AONB 3HA7A 4YI3A 4EY5A 3MYYA 2BDUA 1YL7A 2NO9A 3WKAA 3B9PA 1OYWA 2CFOA 3KOXA 4M4SA 3ILSA 3EB9A 2LCFA 5D6OA 2V9CA 2AWNA 1FS5A 2QG4A 3IJEB 2G7ZA 4AP5A 4AL4A 3DTVD 5A7GA 2CJFA 4QXQA 3ZW8A 3M6LA 3PHGA 4HEA1 1VLMA 1X7GA 2ZPUA 1ISGA 3G0DA 3QYPA 3TXXA 3WS7A 4EFDA 4XVCA 5KX5B 2XLCA 1XDGA 4M3NA 1H8HD 1JJAA 3OCYA 1SCIA 4TS3A 2PKWA 4A2CA 4MDHA 5F1KA 1P81A 1Z0SA 2FG7C 2C3MA 2XNSA 2IP2A 4G41A 3DCIA 2XB4A 4NDAA 4U9UA 3AUUA 3ZV4A 4LRSB 5NLLA 2DLNA 3QW4B 3ETHA 2KBEA 2KMLA 4LBYA 2EOAA 4LYHA 2BDTA 1T43A 1W76A 3KUUA 1AT1A 1Y4AE 4WJLA 1VE9A 3IUBA 1QHFA 3F3SA 4LDNA 3A6ZA 1Y5LA 4LQCA 3CEPB 4I9NA 1Z56C 4W6ZA 1F8YA 1R88A 5EP2A 4G5OA 5FV7A 4W7IA 1JA9A 3ADKA 2R1ZA 4QSHA 4OP1A 1H2YA 4YWJA 6YASA 3FBWA 1TM3E 3SC3A 1HV8A 1ZEMA 2PRYA 4GU5A 4XA8A 1JDBC 2DPXA 1W0KD 3HSKA 3H2IA 4XWAA 3HMKA 4C0SA 1QQTA 3Q12A 4ZKEA 4KE9A 1W36B 3KELA 1RBZA 3TNLA 1KQNA 2F3RA 4DC0A 2QN3A 3SVLA 3BWXA 4G5QA 3TE6A 2XBLA 1MJGM 1GKIA 1KVSA 1BE1A 1LDBA 3DZIA 4DCGA 3H2JA 1PU2A 1NP7A 4M49A 1R0KA 3U3XA 1GTJ1 5EIOA 8GPBA 1K27A 4J1NA 3TG8A 5A4IS 3JQGB 5DCUA 4C3ZA 2EX1A 2RGDA 4JI2B 5CIQA 5CLGA 1IXRC 1J97A 1KS9A 1AE1A 1V5WA 1PYOA 2BFOA 3QA9A 4IIJB 1U3DA 2XNDA 1I7NA 2IUSA 3ZKWB 1Z8FA 4DPLA 3DBOB 1QIDA 3G0CA 5ALTA 4F4HA 1NFFA 4BTLA 3V2HA 2FWNA 2GHQA 2RK6A 4KRGA 2DHCA 5BURA 5JZOA 2Y1XA 1ECLA 1VIDA 3LL7A 1D1QA 4RF2A 4R7GA 5EQJB 1I0ZA 1W4BA 2G67A 4XTCS 2NSDA 4ZVSA 3GP8A 3HYCA 1CIJA 3I76A 5KVSA 3IA7A 4GX2A 1H93A 3QXXA 1Y9EA 3R9XA 2ZVDA 3QX8A 4JI4B 3EHEA 2IOYA 3E0XA 1UBCA 3TTSA 3S1AA 4F8EA 1HNZB 2IBSA 1N2HA 5AUNB 4RUKA 4GWKA 2B5VA 3V1KA 5TQ2B 2D0IA 4TLEA 3FCSB 3HBAA 4GC9A 5FTWA 3ZXSA 5CCEA 3FVRA 2W2PA 5JSKA 1X1CA 1BW9A 1EG2A 1A9XA 3DUWA 3NHBA 3WMXA 1GQ2A 2OVFA 1HDXA 4Z7NB 2ENUA 4IG4A 2DZDA 1CJKC 4ITRC 3KYJB 1EWKA 2H0RA 4L15A 3C5HA 4NICA 4QUAA 4LVUA 3HKEA 3ZJVA 2WA1A 2BEUB 1G63A 3GYGA 3H5RA 2I03A 3ED5A 1T2AA 1YA8A 3AM1A 2QQGA 3OA0A 1G60A 5C5EA 2Z1MA 3HNPA 4C6TA 3MWFA 3B1YA 3L0DA 5DYIA 4XM1A 4KDFA 4PG6A 1EPUA 1Y4DE 1Y9AA 5AKEA 4QLBA 4PRYA 3T4EA 3FDZB 1RRFA 2QX9A 5J1TB 3EC7A 1UWKA 5LQAA 4TL9A 3FRIA 4TKMA 1ORDA 4B7UA 1U9IA 3D4BA 9LDTA 2CXNA 4PXSA 4XFDA 5B3JA 5CITA 4IHAA 5DGTA 1LLUA 1BU8A 1T4CB 1XZIA 2ZEJA 3UOWA 2GPJA 2HF8A 3H1GA 3B82A 4P38A 3RASA 1BWSA 4F4DA 1GUDA 4F6CA 3H75A 2BKVA 4CQLA 1QV7A 1TD1A 3O47A 3E9MA 4KO3S 4R6XA 5DMHA 1RYNA 3LBFA 5ALMA 2I3BA 1K3FA 3PEFA 1GYRA 2F9FA 2J3IA 4Q9KA 2P6RA 2X40A 3PFIA 3CGWA 4AJ9A 1V4BA 5JO9A 4EENA 2DUUA 5LXTA 1JEJA 1CU1A 1ADYA 3RYFA 5HKOA 2AW5A 4BXOA 1K8RA 2J5XA 2MT9A 4G5HA 4C0KA 3O2NA 4G1VA 3RUCA 5E6UA 4XR4A 4M9CA 1ZMOA 2IEDA 1BHJA 2JH9A 2C82A 2AVDA 3IQZA 4LPKA 4DEXA 5E7IA 3LCVB 1QIKA 2OB1A 4C3OB 3OFNA 3R9IA 1TYBE 2X7HA 4WWHA 2P5SA 2VPXA 2RIPA 2PJUA 3OZUA 2IX9A 4FOLA 3H9BA 4ND7A 2OCXA 5FHQA 3BL8A 2PH7A 4AY3A 1LGYA 2KPOA 4P7FA 4TLDA 3GRCA 2CUTA 2Q5JA 2J87A 2EZUA 4OATA 3SC6A 3SHTA 4D0LB 1CQXA 3D7MA 1L6RA 3N6XA 1JLHA 1YS9A 2BF4A 2H1WA 1Y37A 1NONA 2PX5A 3V7UA 2GEJA 2EWVA 2AKYA 5LA6F 3LO5A 2J5KA 1E1NA 3BIWA 2AFVA 4TWBA 1J7KA 1FFAA 1TTQB 2QOEA 2DT8A 5B3AA 2AYXA 3DCJA 3QEJA 4C7BA 3A37A 3B78A 1J0EA 1Y42X 1YB7A 1SHUX 1FFBA 4D4HA 1R12A 1Q0TA 1T8TA 2P2DA 1GPDG 4JLUA 1G6OA 4Q6WA 3D64A 3AHEA 3BJMA 5TMDA 4C03A 2GPYA 4ALJA 4PHCA 4P4GA 1N75A 3TIFA 3ZE6A 2LXNA 4AS2A 3O26A 1ONPA 2W8BA 3AP3A 1Z4PX 2P27A 3BDVA 1Q0HA 4F86A 2OMKA 1RI3A 1A4RA 2A5YB 1FFEA 1SA0A 1XQ1A 4DDKA 2XRZA 1U3WA 2WM3A 2IOQA 2L69A 5DHUA 4GC5A 1JFSA 5KYYB 1EXVA 2YFHA 4WKOA 3CCCA 2J09A 3BMOA 4RKRA 5I7VA 5KTOA 3A05A 3F49S 4ZCLA 1NQ5A 4KQJA 1E59A 4TWRA 4YV0A 4U2CA 4D98A 1L1QA 1FLVA 1VXRA 3PNBA 4HDQB 3T7IA 4DUGD 4EF5A 3DE0X 2IYXA 1DT5A 4WLNA 1T0HB 5AM1A 3EIWA 2BZGA 1PQWA 2O8DB 3UN1A 5HM8A 3ITEA 4RHCA 3QFTA 4OBWA 5FORA 1M8PA 5A0VA 3QOYA 3T3NA 1SWWA 2AZDA 4K2HA 1J9GA 3EZFA 4NZNA 1GQQA 4BZPA 1QGYA 3UWDA 2YMLA 3S5JA 3SC2A 3M6AA 1FP7A 2PKQP 4MV9A 4IJKA 3A3NA 3ZWVA 2Q5HA 5K3FA 3LUPA 4ZZ1A 4IFTA 1JH9A 4XJSA 1PNTA 3FDJA 2JI4A 1USGA 3V8NA 5IJXA 3WLAA 2HSJA 1FSGA 2YYAA 2ZUWA 3HO8A 4EJ6A 2HSDA 3DDCA 1IN5A 1NV8A 2QEQA 1JKMA 1VMDA 3NRCA 4JKIA 1F9EA 2DEUA 1UKZA 2ZYAA 1IMJA 2P4HX 2QVYX 3OC6A 2D7CA 4AQYB 4J2OA 3WDMA 3FG9A 1A2QA 1NJ6A 2LZ0A 5U9CA 3MJEA 3X2SA 1Y9ZA 4HWOA 5IFKA 4Y2YA 1O5IA 3NEYA 2J9RA 4WBNA 1WEHA 1LK7A 3EBLA 3SHQA 1XEWX 2Q4RA 3QKSB 4TSKA 1J20A 3TTXA 3ICQB 1V6SA 3QQPA 1VC2A 3DBHA 3GGSA 2PG3A 3MCTA 4P2BA 3E53A 4GPZA 3VTZA 4F5DA 3E9RA 1BXGB 1NDHA 4QU8A 5ITZA 1DPFA 4J0HA 5FLKA 5FTJA 4E1AA 4CF4A 4BEVA 1CETA 2CNNA 1AURA 1RSZA 1RIIA 4RTQA 3LIIA 4DJAA 2PBZA 1NRWA 5JT1A 1TKAA 1V6CA 5KMGB 1TB4A 1ZL2A 4LOIA 3S8YA 3GP3A 1L7DA 1GAJA 3IXQA 1GCOA 2X7XA 1HYEA 2WG0A 3MRXA 4O2LA 4NENA 4IICA 5F78A 3GGOA 4MZDA 2WTUA 4BMVA 2JKYA 2H0QA 2B99A 4Z9FA 2RHWA 3O73A 3UKOA 4AKGA 1RZ3A 3E22A 1GNPA 4FUTA 4DM4A 1ZMRA 4ER0A 2C99A 3AB7A 1Q3KA 2GEFA 2QVCA 4L9WA 1YJAA 3WFZA 2ZWOA 4Z0NA 3TGPA 3EXIB 1BKSB 3RJMA 4L9RA 3ZNNA 2XJ4A 2C8VA 3RYCA 1U63A 1TEHA 3EDRA 4OHYA 4L4YA 4ATNA 1MT3A 1G8HA 2ZTSA 1XMPA 2EG5A 2GF2A 4MVJD 1Q17A 4UM7A 5C35A 1TLFA 4GQBA 4PQFA 5HK9A 1S89A 1EUCB 1VKHA 2H1LA 1SGWA 4MULA 3TNFA 1JJFA 3BFKA 5U4QA 2AF4C 3OD5A 4FE7A 3RGGA 5A9SB 1GU0A 3PNYA 4M87A 5LUBA 1XD9A 1RPJA 2IE8A 3QJGA 4PQRA 1KJIA 1F4VA 1OYYA 2WF9A 1E5XA 3VR6A 2VBCA 5E9QA 1AH2A 3SZMA 1KDPA 2QUBA 1VRVA 3BIJA 4MR7B 4BZQA 4C5BA 1R2QA 5BVGB 5EJ8A 2JDIA 3N53A 3L1UA 3TSYA 2L18A 3IYLW 3OBIA 1SXJA 4YASA 4XLTA 1ZOOA 5AI8A 2CLCX 1SHKA 1DPGA 1IRXA 1FXWF 1XK7A 3GZNB 2ZIAA 3AVUA 1OTYA 4BE9A 4E2WA 1JDNA 3N2IA 4EW3A 2PRZA 3IESA 3MLEA 2I6GA 1TLLA 4J8PA 2NSLA 1DNPA 2C00A 2QTGA 2BKEA 4ALMA 1OASA 5JD4A 3DLCA 1XX6A 3O7WA 1WABA 3MRVA 3EGCA 4KYUA 4PC1A 4XCXA 3A0RB 2ATXA 1UT6A 1ORTA 4COKA 3H2GA 4CPDA 3MIIA 3AR9A 4MW1A 4D4JA 3C3PA 2HV9A 3FVTA 4MS1A 1U0HC 3U44A 4I9UA 2C2YA 2HSZA 4YVFA 5TNXA 5EIFA 3DGFC 5H3LA 1NOKA 1GVHA 4G5GA 4WJKB 4NPAA 1FNBA 3R3VA 4E11A 4ND5A 4KRXA 4E12A 1JVBA 1IAQA 5F77A 2OAQ1 2ZBVA 4U9HS 1MR3F 2FSUA 4RGYA 3F1LA 4GAEA 1WS6A 1H6AA 1CQPA 3P5BA 2FVXA 1DKPA 1HRDA 3F7OA 1GPYA 3SX4A 1OSNA 2P9ZA 1EFUA 3PPIA 1E3IA 3NEPX 4FYXA 1K9VF 3W2GA 3L5OA 3ND6A 1Y9JA 2A4KA 4EHIA 1MVNA 2QIPA 1SOVA 1PUIA 4P2GA 4H08A 2Z09A 5LDHA 1O0CA 2GNAA 2G0NA 4K9NA 1OAAA 3B7WA 3STYA 4LGCA 2KWIA 2QLLA 2PAFA 4W1PA 5CHYA 4CG3A 3R1IA 2QXUA 5CYPA 2CXUA 4RHTA 4EKDA 1NVEA 2X8AA 1M33A 2JI8A 3UYLA 3KQTA 4ZI5A 5KI6A 1X77A 2Q41A 4A9AA 1XV5A 2ZANA 3PRYA 4ZOCA 4DLZA 4RD0A 3O0TA 2AN5A 3W4JA 2OCAA 5ESWA 1O2DA 3OAAD 1YS2X 2WUGA 4A2WA 1E18A 4MLZA 3BWEA 2FMFA 5DSTA 2ZRKA 4NEQA 3H6KA 5AW6A 1DCTA 5H83A 4BGUA 2JHFA 3KWLA 3ZWXA 2WR8A 4LOAA 4JU9A 4DDVA 1VP9A 2VHYA 2EBHX 3BEDA 1YAHA 3D6AA 4NCNA 1RFGE 3ACBA 1DUVG 3UC9A 1IY1A 4ZOQI 1XDWA 1ZOIA 2A8YA 2G9VA 4QGFA 4N7MA 2R5WA 4MRVA 1CY6A 1KAHA 2BUBA