1HEJC

C-terminal xylan binding domain from cellulomonas fimi xylanase 11a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
TGSCSVSAVRGEEWADRFNVTYSVSGSSSWVVTLGLNGGQSVQSSWNAALTGSSGTVTARPNGSGNSFGVTFYKNGSSATPGATCATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-1,4-BETA-XYLANASE D
publication title Evidence for Synergy between Family 2B Carbohydrate Binding Modules in Cellulomonas Fimi Xylanase 11A
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase(xylan degradation)
total genus 9
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hejC00
3NDYE 5DHEA 1C7SA 1EXHA 2XBDA 1QBAA 2CWRA 1HEHC 1HEJC 1E5CA 3NDZE 1C7TA 2RTTA 1QBBA 5DHDA 2CZNA 1E5BA 1EXGA 1XBDA
chains in the Genus database with same CATH superfamily
3GKZA 1LEIA 4HISA 1N4XH 1YNTB 3ISRA 2PP8A 2P7TB 5AW7B 2R51A 3GTTA 4GW5B 4AGNA 3WNKA 5IVZA 4AUJA 1YNKH 4LSTH 5CLTA 4FNPA 5SWSD 5AL8A 1ZXQA 4TVPE 4JM0A 5GS0C 4XVOA 3BVWA 2ZUUA 5AB9A 3NP3A 4PYGA 1ECZA 4X8XA 1KEMH 2YWYA 3HE7A 3GXPA 4KKBD 3LOWA 2ZUYA 1KC5L 1YJDH 2FEDD 1A6VL 4XRCB 3VFVA 2BCMA 4I5BB 1PAMA 3HG1B 2P5ED 5IJVA 3WN5A 2OP4H 1ZKAA 3MBXH 4TVPL 4QRPE 1BYPA 1REIA 3DUSB 3F12A 1B4JH 5F7AA 2D0FA 4FP8H 2WQAA 1V27A 4ZYKB 2MH4A 3C12A 3OX8B 1H15B 1CYXA 1P0SE 3ZDXE 2P80A 3C5SB 4Z7QE 1E8ZA 1MI5E 3PJSB 1IGCL 4LFHG 4YSAA 4JRYA 5GRVL 2OL3L 4XCEB 4AV4A 3D0VB 2WJ7A 5D7KE 4XNQB 4P0DA 2OMXA 4NQXB 3MRQA 3AT8A 1MJUL 4E41B 3RY5A 4I8DA 4W9LC 2X5PA 1C16B 4Y4KB 1MF2H 4UZGA 3RL2B 2IG2H 4NQDA 5F1SA 3VWJB 3PAVA 2W88A 1HHJA 4U1KA 1I1FB 3LKOA 4IBQA 3TV3L 4YXKL 1H5BC 2CDEB 4NRXB 4PJCF 4QYOB 4WU7A 2C1PA 4HH9A 1PSKH 3BHBB 3WE6A 5A6MA 3RL1B 1NZRA 3RVWD 3NSCA 3QJZA 3ILQD 1KBWA 4NO5B 4WEBL 5T1KB 5TFSL 4WK4B 3STZB 3L3IA 3LNEA 1A5FL 4DOHE 2LVCA 2Z4QB 3GXNA 3QFGA 4FTDA 5E7BA 1KZQA 2HRGA 2AEPL 3O81A 5TE7L 1AZZC 4YHPB 2Y7SA 4BIKA 2ETWA 1SN5A 4LLWB 4Z0BL 2NNAA 3FTYA 1S6NA 4X8JA 4AYSA 4WCYH 3HFFA 3QAZC 5JIHA 3LRLA 3EO9L 3ULUH 3DIFB 3NCXA 4UM9A 3MLRH 1UOVA 2ZD0A 4ZS6D 3D39E 1JCVA 3BX7C 2FJHB 3WU1A 5J3HD 4S1RH 3BGFC 1CK0L 4NBYB 4UBDD 1O6VA 2IWKA 5EOCH 4IK6A 1EEYA 1NIBA 2GJ6B 2PO6B 5AOIA 3ZIMA 4YDKL 4ADGA 1RUAL 5JPNC 4MCZB 1YG9A 4CVZA 4U3SB 3T8MA 2JLPA 3P0VH 3PGFH 4X99B 4KAQL 1DJZA 2CM6A 2Y36L 4I4WA 5F71A 4Z7NF 5KS9A 1GYAA 3G5YA 3ARPA 3MRBB 1D9KA 3EYQC 3HE7D 3MUJA 4UINL 1AP2B 3IEAA 3B3BA 4JRLA 1WFIA 3CNKA 2OLDA 5KVEE 2AQTA 3D5OF 2F74A 4LASH 1FL5A 4CDGC 1HSAA 3QYCA 1PKOA 2YJLA 2NY0D 3GT6A 1UD3A 3OWEA 2Y7MA 3ZL4L 1I3GL 2XN9E 3B7TA 3U30C 1XF3B 2XWCA 2PR4L 4S0TD 4UNVA 1F6AA 5GJSL 3GMPA 1D5ZB 1BZ7A 4JRYD 2WXHA 3FOMB 4L23A 3ASWA 2AXGA 1Z1WA 3GSUA 4JZJC 3S3DB 2GW5A 1QR1B 4WUKL 2LAAA 1MIEL 4FG0A 5TTRA 2FT6A 5G4OA 3HS0C 3L8QA 1MCWW 1G7PA 1ROWA 4P04A 2ZX5A 1Z3GL 4QHKI 4B95C 2R2BA 1ZGLP 1J88A 5C0EA 4K94L 3PRZA 4N5EC 5BUGA 1HINH 1IB5A 5C07A 3U6RB 3AY2A 4OLVL 2BDNL 1EXUB 5AVUB 5DMYA 4QGYA 4TUJA 3QJHA 4NDMA 1MHPL 4PJ8C 1SJEA 1A4BA 2X0UA 3O3DA 4ODHH 4PRNB 1E9QA 1RAMA 2HFTA 2YRPA 5IGXL 1T22A 1MJJB 3I50H 4TTDC 2BHZA 4D7BA 3TA3C 5DFAA 1KG0B 1PEWA 3N1MC 2LFGA 3H6AA 3UGUA 3R8BB 2OXGA 4DNLA 3QUYB 3LZFH 4NQSB 2KDYA 2W9EH 4JMNA 2JFCA 3F7PC 3MSPA 5HVFB 3T0EE 5LGKA 4C4KO 1HDMA 4J3BA 1FV1B 4QRSA 3DPBA 4W6WB 2FRGP 3I6KA 1E6OL 5ADPH 2CKBA 3G5XA 1WBXB 4RBPH 3BDBA 1CTNA 4UM9D 3IXAA 4YHKL 4AK2A 1J0JA 1MHHA 4BQ6A 2KYIA 1FWXA 1X6LA 2R23B 1OAQL 2WLYA 2WGXA 3PLYA 4WENB 5E24E 4LEXH 4IU2B 4AL8C 2NNCA 5B1JA 4YQXL 2UWEE 2TAAA 2W95A 5AW1B 2A6JB 2BXZA 2R1WB 5SWZA 4ZPTA 1RI8A 2VLRE 2QLVB 1K2DA 4G70B 5DJ2A 1MRDL 6FABH 5DRNA 3QDMA 1ERNA 3QUMA 1LP9E 4N0RA 1U8LA 1NL0L 2R83A 3RGVA 3LHPL 1D9KD 3W0WD 3CZSA 3QC5X 4U1SB 5I6XC 1RY7B 3MBEA 4CAGA 3HA0A 1EGJA 5EUOB 2MOQA 1CD8A 4Z3HA 1ZY9A 5IR1A 4RH4A 1TSRA 2X6BA 3IB4A 2HVBA 3VG9C 5C7XL 1UWEL 2Y4SA 1MCLA 1XQ4A 3LVTA 1A7OH 3DX0A 3QUZC 4XO5A 4AIZB 4N8CL 4W9FC 4EUPH 1DL7H 2JB6A 3IFOB 4FG6C 3B2MA 1JE6A 3WAKA 1IBGL 5T1DL 1MREL 3BIAX 1VEPA 1MCHA 4P2OB 3S5LB 4B9PA 2VUOA 1FE8H 4FTVB 5JQHC 1J5OL 4B3VA 3LKPA 1MW3A 5F96H 4OUUB 2JV6A 1YYLH 2GIXA 1AS7A 4H5SB 5DJDB 3MROB 2W9DH 3O6LL 2F68X 1I8MB 4L9LC 1V7NH 4B9JA 4OZGA 4K3HA 3HRZC 2X6UA 4O51A 3S0PA 4JW3A 2YPLA 3AWFA 1F58L 1P5VB 5G55A 1F90H 1I9RL 5E6SB 1OV8A 4J8RB 3B2VH 2A6DB 4ONGH 3ABMB 5SWQB 2ZG1A 2IPUG 2E6QA 3CSTA 4WHCA 4H25A 5C07D 2B20A 2MQGA 1JS4A 1KTCA 3NVQA 5CGYD 3DLQR 3FU8A 1IBDA 2Q76A 3JYCA 3WLWD 5I24A 3VG0L 1OSPL 3IF1B 1ZS8A 1KN4H 5HI4C 1YRKA 5CZKA 1QFHA 1I7UB 5DDHB 2N0KA 5BMFL 4IDLA 5CM1A 3WE1A 1U8PA 1XWVA 3OKMB 3RWFA 4ZUTB 4PJDA 4P2YA 3KMDA 5CJOL 1N5AA 3VW3H 4BZ2L 1HQRA 3NCJL 3BDYH 3UFIA 2CBTA 4Q14A 4H26A 3ENEA 4OCWH 3QZMA 3OR7A 2JQAA 2J8UE 2A4ZA 4KC3B 4YMPA 3D51A 2EXWD 4HPYH 4O5LL 1XGPA 5KG9B 1A4JA 2HJFA 1H5BA 2Y7NA 5CZXD 5ESVA 3EDDA 4BRVA 3BN9D 3MRGB 4FZEL 2EUVA 5CJ8A 5A3ID 1IAIM 4W9EC 2BINA 2VTFA 4QTIH 5F7HA 3QRLA 3RYMA 3RFZC 5EU6A 3WGUB 3DI3B 1RV6X 3FSAA 1CFBA 2DAVA 5SWZD 1A1NB 2W07B 3FUIA 4Y1AA 5D7LE 3FRUA 4HZAA 2OW7A 1GAFH 3P0YL 3LNDA 1XGYL 3QDMD 4AV5A 1HX0A 2X42A 1MCJA 3L4UA 4RLDA 4LGPB 3V4PL 5BO0D 3UJTH 3RGVD 3NN8B 1FZMA 3P69A 1RULL 1T7WA 3MBED 3K6IA 4LHUA 1L9PA 4DPBX 1AYOA 4HALA 3W56A 1LO4L 2CBQA 5HHOE 4CGUB 5F1IB 4TSCL 5FKAB 3ZE0B 4HC1H 4EN3A 3V5DA 4XN7A 1JJUA 4N2OA 1FC1A 5KYYB 1JZJA 1QBML 1T5WB 4W9DC 3MV8A 4A7QA 2VLKA 1MKFA 1SY6L 5JQ6L 2GIYA 4QCIB 1D7BA 4JRXA 1CJYA 2IH9A 2DWEB 1DVFC 3HFMH 3NGBB 3QZPA 5JPNA 4PJXA 3PPEA 4MLSA 1I9IH 1NAMA 3ZQXA 3UG3A 4LPYA 5BRZA 2OTWA 5F7KC 3PF2A 3IMTA 3KBFA 1VB9A 2R56L 3LZRA 5D70L 1XD1A 2GEQA 2YPLD 3L4TA 3PP4L 4D3CH 3HN8A 4WEUD 4HWEL 5ICYB 2FE0A 4L8DB 3ZKND 1M7IB 2IPTH 1QP1A 4PJ7A 4EBQH 4WI4A 5IHUH 1A6TA 3IDJB 1LYQA 5IMOB 1A6UL 4YEFA 3P11H 1FVCA 4XPFL 1ML0A 2VN6A 3VU2A 2WXNA 1OF2A 1FL3A 4M6MH 3WFEH 5E94A 1G7IB 3RAJH 5L7XL 4HCRL 4JREB 1YNLH 2GAZB 1C1EH 3ILEA 5EFIB 3TBCA 1MELA 1UGKA 5ABZA 3FJTA 1DLHB 2YGVA 1NCJA 1NAKL 2FQEA 2B1AL 3O45B 4QRRE 3KEDA 1NFAA 4XMXA 1F3RB 2D7OA 5D5MB 3IGAB 3OWRA 4H2AA 5IEHA 2F53B 3FO9A 2DWDB 3H9SB 3HS0A 1J5CA 4B41A 4G8FB 5D8JL 1U93B 2AK4A 2PPEA 4M43H 3IBEA 2ZCKH 3DGDA 2R2EA 5DJ0A 4BFEA 1WJ3A 2R8SL 2CO7B 4GAFB 4BCYA 4BEIA 3GXTA 2X4PA 5JHDA 2A9BA 5IW1A 1CCZA 2XBZA 2CDGB 4I0KA 2OX5B 3VA6A 5ADOL 1QR4A 5TPWL 3IFLL 4KHTH 4PJ8A 2Y6TE 2EJ1A 5EU6D 5LCVL 2R29A 1LJMA 4F5CA 3SE9H 4Y1AD 5A2FA 3WHXB 1OE3A 1TO5A 3UP6A 6PAZA 1WA1X 1NDTA 3RURA 5ISZA 3TA3A 2ILLA 5ID0A 4NFBA 2BO0A 3T2PA 4DKEL 4WFEE 4XNYH 2JJTC 5F9OL 3VI4F 4OLZH 2J1KA 3CMGA 3D07A 4JKMA 1YAIA 3L7EB 1ZXKA 1NFDB 1UASA 1RJLB 4LHUD 4NP4H 1S3KL 4R5VA 5FO9B 4GKLA 4NGHH 2Z8SA 1EZSA 1B4RA 1ID2A 4J12A 3DVNA 1JWMB 4QRQA 2ZX6A 3O11A 3G5WA 1E28B 4FXGC 5FA3B 4IRJA 3CN1A 3WTSA 3O2DH 1YO4A 4ABWA 4OZIB 3GB7A 1ND0B 1BQLH 1C5DB 1DQLH 3MV8D 4GKNB 2PPFA 2MHAA 2VLKD 4JO4L 2HVJB 5K5YA 4PV9B 3HRPA 3WIHA 1NC4A 1AR2A 1ET7A 4PS4H 2E9JA 5DI8B 3TCLB 1SQMA 4G7QB 5DGRA 3T4YB 5FHBL 5CBEB 2V2TA 4FABL 2DJSA 4JFHD 4OCRL 5BRZD 2J71A 2CIKA 3VXMA 1MWAB 4Z7VB 1HVXA 2CJUH 2XPZA 3KLDA 1QNZH 1WC7B 1J7VR 5FAAA 3V4VH 1YN7A 2VITA 4KUCF 3WTUA 4KNQA 1KGWA 3UYRH 3ZE1B 4FD0A 1GJIA 3RY6C 1B4TA 4B3EA 4DGWC 2YAEA 3MRMA 4PB0L 3U0TA 1WCBB 4B9IA 3S3SA 1P5UC 5CCKL 4FJYA 3VMOA 1FYTE 1I85A 4GP8B 4PJAA 5AL0A 4F2ME 3WS6C 4FNLH 4F58H 2NDGA 3OSVA 2YRBA 1MPAL 5GRUH 3W39A 3NQIA 3ZRSA 3JV4B 1U2YA 2NYKA 3KVQA 4JO8A 1VFOA 5C0GB 5I73C 5JA8B 4MA3A 3GGWA 1OAYH 5GXBB 4IMKC 4B5EA 1SGKA 4QLRA 2OSLB 4OM1H 1G9NC 1SJXA 3VXNA 5GGRA 1WBYB 2ZSWB 4EE2A 1NGZB 2BVOB 1NLBH 3ARQA 1BJ8A 4HWZB 4M8QB 3RDJA 3WFZA 4GW4A 3X11A 4MAYC 2WIIA 1HC1A 1YYML 3UBXG 3HRZA 3AS0A 3TEWA 3OLIA 4OFVA 3JQOB 3RWHA 4Z78A 2VDQL 1FFNB 3L3DA 3BQUC 3MGTB 4NI6A 1CDJA 3QUGA 2C7UA 2MPVA 2AK4D 1EH9A 3P9LB 2Z34A 1K8IA 2YKKA 1AACA 2Y7LA 4A67A 1JXKA 1E4WL 4GIPD 3LEXA 2L7EA 2J73A 4FFYA 1CICB 2QQKH 4PJ8D 5MI0C 2BERA 5CSGA 4F3FB 3LN4B 4EKJA 5EEZA 4Y4FA 4G2AA 3TEYA 1BYOA 3ZE0F 4HHGA 3V0DA 4Z7OF 1OB1A 4HUVA 4UQ3A 4NQVB 1U8NB 4FCAA 3TA3D 3ZMEA 5ISZD 1VPOH 4WJG3 2Z8VC 5DZOA 2CXGA 3NYKA 3X3FL 3PJNA 1QTPA 5I8EB 1E7VA 4PJ7F 4Q9CA 4M7KL 3AG4B 3SKOB 1KEGH 1OQXA 2ZXEB 3G9AB 4YDNA 1SHMA 1KCKA 3LN9A 5DHEA 1LD9A 3SYPA 3H9YA 2NLJB 2WNWA 3DYOA 3L9EA 4GG8A 3CFCL 4A68A 4BKSC 3IBOA 4L3EB 1SBSH 4M1DL 5C0DB 1DCEA 2FO4B 1YQ2A 2ERJC 1TZHA 3VCLA 4IRJD 1SUJA 5DJYB 4DQOH 3QQ9C 4LVNC 3CSBA 4R9HA 2BSRB 1NOAA 1S9YB 2GBAA 3EFOB 3SKMB 2K3TA 1NC4D 1TMCB 3RPIA 2GTQA 1PU0A 1Q0XL 1E2WA 2GVYA 2BFVH 1AKPA 1XGQB 4NXKA 4L0PB 2UY6B 3KJ4C 1D7DA 2XWTB 3VXMD 5C6PB 5D71H 4XWOC 3EBAA 5TDNB 2XZQH 1R17A 1BFOA 1NBYB 4KZEL 2QPDB 3VO0A 1W72B 4Q4EA 5EO1A 2V2WA 1LE5A 1OT4A 5HBBA 5DR5H 5E1AB 1JZ8A 5BRQA 4JFEB 5I19H 1KYFA 3QUZD 5ECGA 1C8PA 4ZSOA 4E9LA 4NO2A 3MRDA 2AJ3B 4HKZB 4G8AC 4UIKL 5CGTA 2XTJB 4CVWA 1T4KB 2WQ8A 3QZNA 3UG5A 4MB4A 1U92A 3HE6C 4XB8A 5DD3L 3SOTA 4D2NA 4D0BA 3G6AB 4OT1H 5KAQG 2AGJL 4RZCB 1DVFA 5IVXE 1UA6L 1EDYA 2MWCA 4ZUUA 4AYDC 4R7NA 3HAEG 3PAUA 5AOKA 1EVTC 3K6NA 5DK3A 2WZPA 3PV6A 5I9QC 5EBMB 1LK2B 2YR3A 3FT4B 3F5WB 3CXHJ 2I07A 4KROC 4NAQA 5EIIG 5ID1B 4N6RB 1JRHL 2FWUA 2VDLH 3D69B 1XF4B 4EXPX 2ICWB 4WWPA 3RPKA 5D2NC 4MJ2A 4FNSA 3GMQB 1C5CH 1LO3L 1I8IA 3WO4C 1SRDA 1KGXA 4ZNEE 1PF3A 4Y4FD 2P5WB 3LEYL 1P4BL 2Z8WC 4ODWB 3WJLA 4ALAC 1T21A 2GUOB 2R0WH 2F58H 5GSRB 2BY2A 1SYSB 1WAAA 3VXOA 4WI7A 1FN4A 4XBEH 2GSGB 4IBLT 4Y4HB 1QRNA 5DD6A 3I6GB 4MDRA 1TQCC 2G2PA 2ICEB 4R7VA 3GS7A 3HUJB 2XWEA 4U0QB 3ZE2B 4OIIL 4RDQG 4HZLA 4L0ZA 4M7ZB 4PJAF 2DLFH 3MLYL 3MR9A 2VMCA 1Q0YH 4OLUL 2X41A 2X53A 2B1HH 4OF0A 1AQMA 2F2HA 3DX2A 1BVLB 5HJ3A 2C9PA 3KPLA 4O02L 4UIMB 3DVFA 2NX5B 3OGCA 4J3TA 4MJIB 1X7TA 2NSMA 1JHKH 3OB8A 4DQAA 3MACL 1ZVYA 3U0WH 3Q2WA 2C3GA 4AGOA 5LG1A 1X3DA 2WXJA 1CFVH 3LY6A 3GMLA 4OGXL 3N1FC 4XVTH 4MBRA 1ZOXA 4N8VB 1BD2A 3KW8A 1RSYA 4FQCH 5EN3A 5F7MC 5L6YH 2Y23A 1A14H 3DV6B 3VTMA 2YZ8A 4GNKB 4FRWA 4O2CA 5E9DE 4NC1E 3UOAB 4ZTOH 2CO2A 4WAFA 1X5YA 1AANA 5IWLC 2Z93A 2IQAA 2O6EA 2E9BA 1D5XB 1F11B 1R75A 2RR3A 25C8L 3SSGA 3OF6A 4MNGB 3HZYA 2XQ0A 3K1DA 4TUOA 4IRZL 3UG4A 5FKPA 4UZUA 2YA1A 2YPVH 4XXWC 3BFOA 2LR4A 3QDJE 3SE8L 3RUGF 4MZ2A 4MHHI 2HT2C 4DVRL 4ZO6A 3ZSSA 2CE6A 3G08A 5IMLA 4ICWA 4XHQA 4X4MA 1IAIL 1DVFD 1OAUL 2G2NA 3D9AH 1I53A 1MCOH 3SYOA 2Z92B 2P8PA 1QYGH 2ZXWB 4C56B 4QY8B 3EGSA 4X5PA 4G9DB 3GRGA 3UJJL 5EU5A 5KSUA 3QXUA 2WZPD 4NNYA 3VYPA 2L04A 2AVFA 4HIJB 3QIWB 3KCPA 3LKNA 1D6EB 3RY6A 4IBZA 4PGDB 1XZ0B 1A0QL 2AQ1A 3G6JE 1G9EA 2QKIA 1P5UA 4HAGA 4MTMA 1UVQA 4UTAL 1QLEL 3GXDA 4WU5B 3VXSA 2AJSH 3NJMA 1E4XI 1QI4A 3GRWA 4E36A 4XC3H 4G9FB 4YH6A 4YR6B 5L0QC 3GIVB 4NQCE 3WEXB 5E0QA 5SX4H 4JDZA 1E50A 1E9OB 1TTRA 1DVTA 5I76B 3QWOB 3LH2H 3NSJA 4HT1H 2F5AH 4N2EA 1BXUA 1LO2H 4GMTL 4H1LA 3DI2B 4FQQA 5DHXB 3TF4A 3D3VA 1QRND 1TTFA 1N8ZA 4QGTA 2AEWA 2CLZA 1CFSB 4MAYA 3EADA 4AYFB 4M5YL 5DJCB 2FX8H 2QELA 2Y2YA 5A40E 3FT0A 4RCAA 1AHKA 4ZFFA 3BQUA 3ECBB 3IWVA 1RZGB 2FX9L 4V2CB 1JXGA 1MFBH 2FUTA 2ZOUA 4HFWB 4Z95L 3REVB 5C0CA 2KLRA 1BAFH 3KPPB 1NLDL 4X8CA 4CW1B 3WN6A 3WIIL 2XWBB 4H2CA 1PLAA 4WV1B 4ZO8A 3MZGB 2P5PA 3W11D 1FORH 3BFQG 4AE1A 3ULSA 4RAVB 4HEPA 1TJGH 4K15A 3TBYB 3S5YA 4AVJA 1W0VA 2NTFB 1IQWH 4KK5C 2W91A 4X98A 4I9WE 3KG5A 2I27N 3FCBA 3UZEC 3B83A 4G7SB 4U2YA 2ZP8A 2OJZH 2IV9A 1L3NA 5FCSH 1GTFA 4HBQA 4MGXA 3ZDYF 4WKZA 3O0RL 2VR6A 3HPJB 5ES4B 1KCWA 1AYRA 4JHZA 2ISDA 3WSQH 5I1DA 1ASQA 2DEWX 2VXVH 4L1SA 4EN2A 1AD9A 4Z8FL 3A0OA 1S4IA 3RB5A 3OF6D 1CG9B 32C2B 2BOCA 2W80C 2Z1KA 2FEEL 1NCDH 1FLRL 1E5CA 1UOKA 3K2UL 1WAAF 3LSOA 5MERA 3JWOL 4U05A 1L6XA 4PR5B 1ROCA 3RWCA 5I1LB 2NTSP 3BSZL 2IADB 1R5VB 5IFJA 4PJEB 4FFVD 3QSKB 2JKIS 3L81A 4Y16B 5DZNA 1XXDC 4F8QA 3V7AG 7PAZA 5J06A 5FO8A 2XVKA 3CVHB 4LSRH 5PCYA 2ICES 1P4UA 3RGHA 5IBTL 3KPOA 4FXKC 4R26H 2AJZB 5L2KB 3ARUA 3OR6A 3HUJF 3DXAA 3H1ZA 3ZHNA 3VXSD 4YXHH 5KTEL 5IB5A 4H4NA 3DX1A 3F84A 1FFTB 1OWWA 2QT6A 4J5VA 4A63A 4G43A 5ETUB 1BQHB 4YSDA 2VR7A 1JD9A 4IS6A 2K3HA 2A74C 1A6PA 1YMHA 2GTZA 2EDKA 2GJZA 1JWSA 3WLBB 2WWMD 4KKQA 4MAUL 1NCWL 3BDXA 4XOAA 4AQ1C 4PLOB 5HHMD 1ULVA 4DGYH 1EFQA 5LBSA 3ILPA 3D3VD 5I26A 3UDWC 1EAQA 4MAYD 3BH8B 3F58H 2RB8A 3QPKA 3U9WA 3E6HB 3BQUD 4G6FB 1TEYA 2UY7A 3HKZA 5DZAA 4X5XB 2D9QB 3SDDB 2ATPA 4U1NA 5IFAH 3EFFB 2G2RB 4G82A 1H6TA 4KZCA 3BP5A 3K8MA 1HS6A 1CGVA 3NJXA 1JPFB 3QQ3B 4Z7QB 4X5RA 4J3XA 4PY8J 5JOFA 4U3XA 3IGLA 1DBML 1UQSB 2E7CA 4GG6B 5LQBL 3QPXH 5SX5K 1OARL 2YAMA 1JIBA 1G9MC 2VOTA 4TQ8A 4R3SA 4DPCX 4GRWB 4N2HA 2ZX9A 5DZPA 1KLFA 5C0BB 1KIQB 3B2DC 2VC2B 1PLCA 1QFOA 4EKXA 5EMYA 2QHLA 1MI5A 1E3XA 2ZG3A 3D87B 4JQIL 3RWJA 3LD8B 4U33A 1NDGB 1OPGL 2AANA 1QEWB 3FH7A 4XAWL 1KYAA 4N2MA 2V3EA 4XMPL 5FC9A 4DVBB 2PR9A 3BEWB 2FO8A 4PJBB 1LEKA 4U1MB 4FZ8L 1TG8A 5F88A 2MKWA 3QQ9D 1Y0LA 5FO2A 5DJ6B 4NKMA 4UTBH 3T2NH 2CHNA 3HG4A 1I8KB 3BO8A 3VB8A 4QRFA 1IAKB 3V9FA 3MLVH 4EUPG 3WEAA 5CEXB 1U8HA 4XZUA 3ZDZE 4H8VA 5DEGB 4NCDA 4JPQA 4X6CE 3T0VA 4QKTA 2O5XH 3AABA 3SPCA 3QIBB 1ZA6B 1KJ3L 1UEMA 3MLWH 4YHOH 3UJIH 3CFKA 3IJHB 2FWOA 1OP5K 3IJYA 3GI9L 4ZUWB 1P69B 3TYFB 3MC0A 3NESA 1R47A 1OE1A 5L9DH 2QVKA 4LDEB 4R7LA 4XXDB 4X4XA 2EIDA 3DXAD 2PXYC 1U3JA 4CU8A 2VH5L 5BO1L 4HGKC 1BFTA 1BREA 1Q94B 4QTHA 4G5ZH 1ZLSH 4XXWA 4MDJA 4JPWH 3FCTA 3WNPA 3HE6D 1NCAL 4XVUC 4M02A 4EI5C 3HBZA 3FHEA 1S9VB 4L5FE 1CBJA 3QE5A 3ZQ9A 5KYXB 2M26A 1CVSC 5FGBC 2J1ZA 4K71C 3BGMB 5IY5B 2R9HC 2HKFL 2X09A 5I74C 3KPRA 2EC9T 4CRPA 4V33A 4Z5RB 3G04A 3TIDB 1WVZA 1H3PH 2H2PC 5C0FB 3DX4A 2IFFH 2F54B 3S5ZA 5IT2L 4JCMA 3QJQB 4L5FL 4ZMOA 43C9B 5GIRB 4KROD 1GW6A 1J0HA 3ZIYA 2C9SA 5CD5C 1JHLL 4MXQC 4HQQL 3VMNA 3ABLB 5DUMH 3I84A 3OAZH 3ZK0A 4MA7L 4TLUA 2L4OA 5AVSB 3HC4L 5TF1L 2ZWNA 3IPEA 1JZEA 3NIDE 2H2SD 5T8IA 4ZW7A 1NGPL 2G5BA 3UH8A 2EH8H 2ATAA 1EIBA 5FOBB 3Q6GH 1UUNA 3QXAA 1AD0A 4NBZB 1MI5D 1IKFH 1IL1B 1PZSA 2Y06H 3MPCA 3QWNA 3MJ7B 4UT9A 3CN4A 3V0WL 1U8KB 2ZUTA 2OYKA 2COQA 3CK0L 2E59A 4KTDH 1P4LA 2TRHA 1CC3A 3AZUA 1JYXA 1HHGB 3BLKA 3QW9A 2A9NL 3HNSL 4Y9CA 2ZXDA 3CXDH 4G71B 3K72A 4BH8B 3KNBB 4FYSA 3FB8A 4NQEA 5KJ7E 5DEFA 1NPUA 1U8IB 1HXKA 2ED7A 5DUPH 2YEZB 2Q7YB 3UCQA 3AXLA 4KNUA 3AAZB 2IBZX 5SV4A 3RX7A 1NGYA 5DD5L 2APFA 4LLMB 3NEOA 1ZSDA 1Q1JH 2I5YH 3O2WL 2AQQA 3TN0A 3SZKC 3BKYL 4KRPC 3KXFA 3C8DA 1XF5B 3BVVA 1RU9H 3NIFB 4M61B 2W81C 5DMKA 3NQKA 5FM5M 4UOW0 3UAAA 4GT7A 4YL9A 1XIWC 1AQKL 3CD4A 4D9RE 2P4AB 2X89D 4AIEA 1M6OB 2R1YA 1N2RA 4M4PA 1HILB 2OCCB 4KJQD 1AOHA 1WIPA 4LLQB 3HNVH 4HUUB 1AO7E 3MNVA 4OQ1A 3MCKA 3W2DL 5TE6L 3WJMA 3MRCA 5CSZB 3UGEA 2F61A 2UWEB 3UO1H 4YO0B 3PGDB 4R0LC 2V8MA 1U2HA 1DLFL 3B5HA 4KRNA 2CK2A 2I25N 1WS8A 1NMAH 1V7MH 2AQ3A 4PUBH 3QHFL 2CCLA 2WO4A 5I75B 5JPMC 3FT2B 3UEQA 4CC4C 3ZDXF 5AB0A 4Z7WE 4Z7QF 1V5JA 5I8OL 3T2OA 5BCAA 3I9AA 5DZ9A 1JZ4A 2IH1A 2J5WA 2EEAA 4S1SH 2X4QB 3N44F 2N1TE 4L4TB 3EDKA 2ZXAA 5EWIH 4OIAA 5C0RL 4PTTB 2B8OT 3KPRD 5K1JA 2FJSA 1WG3A 4DP2X 1RZJC 1RPKA 2H1PH 5F1KC 1YA5A 4KH9A 4URTB 4JVPA 3S3CB 3CPLA 2R4SH 4AV0A 1INDH 3TJHC 5JOEA 1T3FA 3GHBL 4WNQB 3KEHA 1CL7L 2QZQA 2YA2A 3L4VA 2HG0A 4FXKA 4NPKA 5JIKA 2HJLB 1JPTH 2BWQA 3JWNH 3FQYA 4CADA 2HJKA 4WTXA 4XT1C 1AGEA 4YXLH 2XXMB 5I1GL 3HG0A 3PWUB 4PRAB 1R19A 1JMXA 1I3VA 3T6XA 4KI5C 4WEMB 1UM6H 3ZTEA 1ZVNA 5L88L 2OYLA 3L95A 2AITA 4KOBA 3QA3B 5DVMA 5E1QA 4XAKE 1DJYA 2WQXA 3MJGX 3ZTNH 5KVDH 4AQ1A 4WY7L 3MLTA 4JFOB 3RJQB 3GMMA 4IBVA 2IIJA 3UDWA 5DWUH 4N3TA 5ECJE 2O61B 4LCVA 2GFBA 2D7TH 3HR6A 4TNFA 1OIOA 1UD8A 4HLZH 3MRNA 1QLRA 2Y1YA 2Y1AA 5J12B 4NQED 1DUZB 1XSJA 3RZWA 5CBAB 2VXQH 3OHXB 3VUAA 4PB9L 3LZNA 1TQTA 1KB5L 5BZZA 2YO3A 2AJYH 3FYEB 4I7ZC 4BA0A 1BZOA 3TN0D 4P3DA 2O30A 4ZNCD 3KXFD 1WBZA 1XCQA 4IIQA 5JNYA 5GRZA 3TNMA 1I1RA 2DQDL 2E56A 4JAMA 2B2XH 4KK5D 3NJHA 2WUCL 5T5FL 2J72A 4AMKL 2E9GA 1LEIB 4JKNA 2ED6A 3WUWG 5KVGH 2X7LB 1E8WA 4Z0XB 5I8KL 3MTRA 1WT5C 5DEZA 1FZKA 4TRPH 4H0LC 5MP6L 4YBLB 3Q9QA 5HJBA 2JTYA 2VNCA 4Q4IA 2CSPA 3L1GA 2XZAL 3VX1A 2AVGA 3RY4A 3KZ8A 1ZGLM 3OKEA 1F56A 3EZJB 4AYBA 3T4AC 2I7SA 3R7RA 2YD0A 1R3JB 1W72H 2A0LC 4GUOA 4OJDH 2IDTA 1FC2D 3HE7B 2ZOKA 3WFHA 1PNDA 1KXQA 3V4PA 3ZPDA 5DMJB 2J25A 2FX7L 3ML8A 3QEGH 3VFVB 5KANI 5K1VA 4BK5A 4HWBH 1H8OA 3CUPA 4I2XE 3PNRB 4Y2DC 2RQEA 2NY0B 5D2LE 2DI8A 4LGRB 2Z0UA 1LM8V 4YDIL 4DAGH 4KTEH 4QWWC 2BJMH 3QDGA 3ESOA 2DQTL 4RA0C 3VGHA 2C5DC 2UVFA 4M5ZL 1OAXL 1MJ7H 3AU0A 1E6JH 5D2NE 1OK8A 2JI1A 4JRYB 3S3JA 1QFWH 2VAJA 1AR1B 1QATA 4HUXB 1WV7T 4Q6KA 2OMXB 5BV7B 4YHLH 3A6CL 4HUKB 4HK0A 5IB1A 1UB5B 4AW4A 3SE4C 1PZBA 4EXKA 4PP2A 1AKJA 3PWPE 1HHJB 3BISA 3P9MB 4KY1H 4U1KB 3FU9A 3V4LA 4A2GA 2GKIA 3Q1SH 4WU7B 1SJVA 1B2YA 4Q0XL 2C1PB 4JFFE 1CGTA 3WE6B 5FYJU 5IM7A 5EU3B 3O3EA 2NW2B 4L3FA 1HNYA 2F15A 3MXWL 4UT7H 4HOWA 2CK0H 3QZLA 1QUNA 4BKTC 4A6YA 3BOVA 3L3IB 4FKHA 2WBJA 3RGBA 4XNBA 3MCG1 2CIIB 4LLDA 4JRFA 4XN1A 4NO0A 3NCBB 4UAOC 3W3BA 1EJOH 3IN2A 1ORSA 2NNAB 2UWEF 3FSZA 2V5YA 1SDAB 4LL4A 4X8JB 4JDTH 1IEHA 5KJ4A 4Z3EA 1A4CA 1UWGL 2Q20A 4OV6F 2IANA 1A3ZA 3S36L 3VXQB 4UM9B 4LSPL 5DSCA 1J48A 2N01B 2X1WL 3QFDA 1LP9F 1NGQL 2FNBA 2VAAA 2PPDA 3MLXL 4QRRA 2DQGL 3SGJA 4Q89A 2R2CA 4GKSB 2WNXA 4C47A 1IFHH 3MLUL 1B2WL 1NCBL 3VXPB 5LCVA 3T04D 4JZNA 4G5AA 4Z3JA 1GOGA 4I4WB 5KS9B 4LSUL 3JV5A 1JWUB 2XQBL 2A77L 3LRKA 4OTXH 1BPLB 1D9KB 4GAYA 3W0WB 2A73A 2QFPA 1FGVH 1KPUA 2BRRL 5B3JE 4HS3B 3E80A 1FZJB 4QLWA 1XH1A 5E2UL 3E38A 2YQ3A 1KFAH 1UWXK 3VFGH 3D06A 3GJFA 5DC4B 4MZ3A 4A39A 1HSAB 4GO8A 2CG9X 2R0KH 1GOHA 3GF8A 3FHQA 5GS2H 4CSZA 4YHML 4L0YA 5E8DH 1OSYA 3AG1B 2HZHA 2GHWB 4ODTH 3QDGD 2OZNA 3QG6B 4ZO7A 2QQNL 3SDYH 4NAMA 1F6AB 3MODL 1U8MB 3GBNL 4YX2L 3FO0H 4AGPA 1CDCA 3BKCL 3GMPB 5E8PA 1GJUA 1BZ7B 2AXFB 2LU7A 3CQQA 2AXGB 2PXYD 4MJ6A 3GSUB 2JCWA 4K3DL 3MMEA 2CMRL 2VXUH 4R0LA 4AJ0A 1HYSD 5BNXD 4PJ5A 5GHWL 4RMUA 4ERSH 2HRPL 2XSKA 4FQPA 1AKJD 2NY1C 4XVUD 4EZKA 3MZTA 4CC4A 3U0PA 5JW4M 2AF2A 2BZCA 3F00A 5DLML 2R2BB 5M7QA 1JNNH 4DW2L 1VAHA 1QHPA 3DUUA 4CGTA 4QPEA 4K3GA 1Y07A 3KHQA 5C07B 3GLEA 4OV5A 1GCFA 3DV4A 3NEEA 3QYMA 2Q7AA 3E8UH 4TUJB 2JKLA 4FLRA 1GHFL 3QJHB 4NDMB 2R9HD 5C0AA 4N2KA 4WW2C 1NANI 4LVHB 3O3DB 2F0CA 2J8UF 1E9QB 3E2HB 4BJLA 2VE6A 4JHAL 1S7TB 2H2PD 1T22B 4FF9A 3VI3E 3Q2LA 4F2MB 1MLCB 4OGYH 4U3CA 4NO0D 3ZL2A 3Q8CA 4HEME 4MXQD 4X9FA 2NW3A 1KCLA 5DO2D 2FJGA 4LVOC 4LZKA 1FF5A 1U6AH 3KL5A 3UC0H 2Z6FA 1IEBB 1CDUA 1KCUH 4QRSB 4JG0H 2OSXA 5I6MA 2IAND 4XBGA 3I6KB 4DEUA 3N0PB 2NY7L 1IGTB 3G5XB 5KN5A 4AWJC 4GFXA 3OVUB 4PVMA 4M62L 1CIDA 2VLMD 4NKDA 4BSWA 3EXLA 5I6PA 5J0BA 2YFOA 4QRRD 2G0KA 5IHZB 2AJVL 5C08D 4ZPTB 1NJ9A 5SWZB 1K2DB 3H7BA 4PJHB 5DJ2B 4ZW5A 2XHNA 3VNYA 4PLJC 4P46C 5JHLA 5DRNB 1ILUA 3QDMB 1QTSA 3QUMB 1JGEB 3N04A 1U8LB 1HEZB 3RGVB 1HE7A 1V05A 2VDPH 1S5HA 4NZTH 3SO3C 1R6VA 5AYTA 3ZKXC 3VQ1C 3K74B 3ARYA 4JCWA 5C09E 3OKLA 4KRPD 4PV8B 5IR1B 1T5XA 1TR7A 2AK1H 2WZ6A 1VACB 1MOEA 3FQUA 2AABL 3B5TA 2JB6B 1ES0A 4JANA 1EZUA 1GKEA 2YQGA 3O41B 1AGDA 3ETSA 4LPWA 4OFQA 2AEOA 1E4KA 3U7WL 2NXYC 2O6FA 2QQLH 1NCOA 4F7PA 1J9TA 4RFEB 1A7PL 4FFZL 1AHWA 4I18A 1CFQA 2EDYA 4OZGB 2F8VA 3T4AA 2EYTA 4O51B 3CVHH 4PJ5D 4Z7AA 2YPLB 1EXHA 2YARA 2GHZA 4W1TA 3DO4A 3V2AR 4PRIA 5AB2A 3S8WA 1KC5H 1A6VH 3D0LA 3QZOA 5CF3A 1TU2A 4KKRA 4H25B 2ZAIA 1IC5L 4WFHE 3EF4A 1CLCA 4TVPH 2HYMA 1J9CT 3T3PB 2N7SA 3OG6B 5C0AD 5JLZB 3CLFL 4ZX3A 4TOYH 1JOIA 4UI2A 1JNJA 3SCMC 3SGKC 3QR0A 4OKDA 3MRLA 5E2TL 1HWHB 3T09A 3RWFB 2J88L 3I02B 1IGCH 3V0FA 4BDVB 4AVHA 1F5WA 2OL3H 1N5AB 4JDEA 4N3UA 3B7YA 4UOQA 1HQRB 3V0VA 5CEZL 4G42B 4OD1H 1VKXA 2WQVA 1FSKC 1P1ZA 2EDEA 3OMZA 3OR7B 5AYUL 4NCC2 2YAQA 4AK1A 3FTSA 1JV2A 3WBDA 5HDQL 4X5QA 4FERA 1SEBB 3FQ2A 3VSQA 1XGPB 3NCWA 5D55A 1H5BB 1OVZA 5EO9A 1AIFB 3KS0H 2WKLA 1IZKA 4OLYL 1URLA 2B9BA 3HZ3A 4PREB 4LSVL 5EU6B 1Q9WA 2O1AA 4GRWH 1DEDA 3DHMA 3J2PA 4WEEA 4WEBH 5B3NA 2OBGA 3ORJA 3WL9A 3SDXE 4HKBB 1A5FH 3MJ9L 4OVVA 4QOKE 5IB2B 2YGNA 1FZMB 2AEPH 4JFVA 2VR9A 1M05A 2C8NA 4U1JA 3WJJA 4B60A 5JIIA 5B39G 2KZ1B 2P24A 1CN4A 4PWFA 4LHUB 5DU7A 2P47B 1B0GA 3ULVE 1HZHH 2I69A 3QAZB 1SN0A 3DRTA 2NZ9C 1ZSHA 4NPYB 2NY3C 2W1NA 2OQJA 5F3BB 3NRQA 4AEHL 1BVKA 3HNTL 1ET5A 2IPKB 4Y1SA 4R96B 4PIRF 3V5DB 4AT6A 4CSPA 2BK8A 1KOAA 3BGFB 3HZMA 1DBBL 3JBG7 3MV8B 1IV8A 3ULVL 2QPSA 1TYRA 5EEWA 1F3DH 4O02A 5JPNB 1RUAH 2ICWI 4PJXB 1MVFA 4XNAA 5T3XE 1NAMB 1XGUA 5BRZB 3T0AA 1F4XL 2NMSA 3GSNL 4LKXA 2A0LD 3ARXA 2VCOA 5KVFE 4DP1X 4WIQA 2HFEB 1ZCRA 4U6VH 4PRID 2GG1A 3J07A 2WOYA 4NNPL 3M8OL 3L5XL 4M7LL 1DQJA 5DC9B 3PIQA 1XSOA 4I3SL 5F7YC 5T3XL 1U8OA 3ZT5A 3K7UA 1ZLEA 4IMLA 4RGNC 1OF2B 1FL3B 5E94B 2CNYA 4NC2B 1X5HA 1X9RA 3ZZLA 4Q2ZA 1NEUA 4U4IA 5C9KA 2CLRA 5KVFL 1ETJA 4QWWD 3U30B 1KV7A 4IRZA 5EBWA 5KVEH 4ZQKA 3QJXA 3DHUA 4E42B 3PHQA 2PCFA 3LQMA 3CVIL 5JW5A 2CBMA 1E42A 5A2AA 1HHKB 1Z9PA 1EO8L 2E8YA 4JZJB 2FL5B 4WF7A 1UC6A 3HLAB 3QEQE 2OK0L 1RUML 1G4RA 1MIEH 1WGVA 3FO9B 4W93A 1HCVA 3HS0B 4F24A 2TRYA 2IMNA 2N0MA 3CV5A 5IJCC 5D7IE 2NY6C 4ZOAA 4ES9A 2D2CC 2R2EB 5DJ0B 1I7TA 4Q7DA 1O0VA 1UCBL 4I0CC 5DRWB 5HI5C 3KBEA 2X4PB 4K94H 1UH2A 3B9KC 4PS8A 2CCWA 4GS7C 4IEFA 4U7SA 5IW1B 1Q9KA 4OLVH 4ZMPA 2BDNH 2LGNA 2OMWA 4LCYB 2VLLA 1AC6A 4PJ8B 4GAAA 4MD5B 4UTAA 4AYGA 1ORQA 1JV5A 2FATH 5A2CA 1BG9A 3DTUB 4QXTA 1M7XA 2OZ4A 4CJ1A 4KMLB 4KKNA 3TA3B 5ISZB 3CXFA 3L2LA 1G0XA 2WWOA 4XOBA 3GNMH 4JUTA 3ZHKA 4AZ8A 5EORL 2BOLA 1I1AA 3AU1A 5GGQH 3MBXL 1AZBA 3M1BA 3DDFA 5INDA 7FABH 3TF7C 4BYHA 2R15A 4ELME 2EADA 3L5WA 1M2VA 3T71A 1B4JL 5FXCH 5KBMA 3DVNB 4FP8L 1LDSA 1BZ9B 3SN6N 4U6HA 4QRQB 1FFOB 4NQCA 4YHKH 5KYWA 3FQRB 3DRQB 2QLYA 4IRJB 1I8LA 5FECA 4OZHB 3GB7B 3A4AA 3T5WA 1U91A 3BKJH 1H3UA 2MHAB 4MYPA 4BZ1H 1C8QA 5C3LD 3VD9A 2P8LA 1NC4B 4Q52A 4WVRA 1KGCE 3DOHA 3F7VA 1MF2L 3GMRA 2IG2L 4BWTA 1MRDH 1KN2L 3ECVA 4KHXL 5T1JA 3BWAA 1IGIH 1NL0H 3JV6B 1KY7A 4JN1H 5LAXB 3LHPH 2VITB 1URZA 2DV6A 5EZLA 1PSKL 5CU9A 1WTLA 1PKQA 3QAQA 4J6RL 4PCKA 1CO1A 3MRMB 3GPEA 3V5HB 3VG9B 3P2DA 2A83A 5IVXF 3QUZB 2CGZA 1S7RA 1UWEH 5C7XH 5KYYA 1EX0A 4ZTEA 5IQ7L 1U21A 5LAPA 2PTUA 1KT2A 2R69A 1I1CA 1IBGH 1MCPH 1THAA 3FQXA 3GZKA 2DICA 2YD4A 3MRPB 3PU7A 3Q13A 1J5OH 3W39B 1TNNA 1B0WA 2JQZA 1U3HA 4HXAH 2E86A 5DFTA 1I7RA 4MA3B 3GGWB 5DK2B 3D25A 1DEEA 5GGSY 3VXNB 5B8CC 2BP0B 5GGRB 3BUYB 2A9CA 3AB0C 4KI5E 4TQPA 5K59E 4L9LB 3X11B 3ULUL 2W8CA 2WIIB 3HRZB 3BSZA 5B7MA 3ME0A 4IOSA 4LLUB 1N6UA 3N41B 1F58H 3L3DB 1HQ4A 1MG2C 3MA9H 4N0FA 4S1QH 5CP3H 5E9NA 5J4MA 1TIUA 1I9RH 2NY1D 5KZCD 4HFUL 3B7UX 1KJ2B 1NFIA 1A8JH 2BP3A 3E9TA 5E00A 5EOCL 4NHCH 4AXWB 1HT6A 4QRAA 5HJDA 5BVJA 5JIMA 5D7EA 3ROOA 3P0VL 3PGFL 4P23C 1X9LA 4PH8A 4BFBD 5B3SB 2JCCE 1XH0A 3VG0H 1OSPH 1TO4A 2EUXA 1OB1B 1CPUA 1VFBB 3SCMA 4JPSA 2WJ5A 4FEMA 4B96A 4PI0A 3KPSE 4FA6A 2CBPA 4J3WA 4LQ1A 3BLPX 2FBOJ 3V7AE 2ITCB 3V55A 5IQ9A 4BZ2H 3TYGH 2UYLA 3NCJH 1GY1A 2H6PB 2WB7A 2ZG2A 1OLZA 2EDFA 2WXIA 1LD9B 1GGTA 2QSVA 3DOSB 1E30A 2Y3AA 4HUWA 5E5RB 3HCVA 4O5LH 3DECA 1WA0X 4NQCD 3AWGA 4Y19E 3VCLB 3CSYA 1T4WA 3BSHA 5EULV 3BZFA 5DTFA 3MRRA 2KQNA 1IM9A 3SO5A 5DD0H 5HPMA 3RFZB 1T7VA 2XY2A 3KBPA 1BG1A 3RPIB 2ZPKL 2WN3A 1F2QA 5AKVA 5DS8B 2NSXA 2YAPA 1R34A 4AENA 5J89A 4ZMAT 3KYMB 1J18A 2CD0A 5ALCL 1BFOB 4F7EB 1HINL 3ZQWA 5BS0B 4JY6B 3JWDC 4J3OH 1UURA 1LE5B 3W1ZA 1FNAA 2ENQA 3U6XA 4ODHL 5IQLA 2EEBA 3FRPB 4NO2B 1FFRA 2GABA 4ZSOB 5LXGL 2BSSA 3ZYZA 3FONB 3J27A 4HV8A 4I9WD 5IF0B 3VFNA 4KZ0A 2DJ4A 2EDWA 5HYSA 2B39A 4P4KC 1QBMH 5G4NA 4P2RA 4MNHA 2NXYD 3B2PA 4CSTA 2XCMC 4D0BB 4DZ8A 1SY6H 2W9EL 3SDCC 4XH2A 1DVFB 1JPGB 2F7RA 3NSYA 3G6JF 5DHDA 4ZUUB 4NN5C 4R7NB 2XV3A 5BUPA 5ADPL 5DK0B 3NJGA 5L4MA 4AKQA 1D7CA 2R56H 3NCYS 3NZ8B 1DANU 4IOSD 1EJ6A 3WDIA 4HWEH 4K4KA 4LEXL 2CR3A 4F9PA 3EH2A 3HHRB 3BH9A 3INUH 3JWNG 1UG9A 4J3UA 1MXDA 4EI0A 5K69A 4XPFH 1N9PA 4ONHA 5GGUA 4A2MA 1T66D 6FABL 2Y6SC 1GTNA 1UGNA 5L7XH 1WYJA 1A2YB 3REWA 1USQA 4HCRH 3KBHE 2FJFA 1T21B 3P30H 3SCMD 5I71C 4LRNL 1FFPA 5C9JA 2ZWYA 4NKQB 3CIQA 2Q9OA 4XI5C 3RA7L 4LPXA 1I8UA 1V8HA 5LN8A 3FQTB 1QRNB 3F01A 5DD6B 2QQQA 1A7OL 4WTWA 5AEAA 1CDYA 5B7FA 3PABA 1U8JA 1PW3A 2AMGA 2B15A 4BK8A 1MVUA 2Y2TA 5DHYA 1R4XA 5GGTH 5D8JH 2QR0A 3MR9B 1FE8L 4QHPA 4CMMA 1ZDQA 3OJDA 5F96L 2VISA 2R8SH 3M1CA 1YYLL 1PBYA 3B9KA 2Y22A 4U6YB 1LK3L 5HJ3B 1IM9D 2W9DL 3KPLB 3NZSA 5TPWH 3OGCB 5TE4H 4S2SA 1MN4A 5DVLA 4A2FA 1BCIA 2HPTA 4KO6A 4TM9A 2Y5TB 1G7JA 1A66A 2BVUA 1UHVA 1F90L 4V2BA 2BY0A 4MXVE 3B2VL 4ONGL 1JDCA 1UZ6E 3NJIA 3OKKA 5J7CC 5F9OH 5KBNC 1OCWH 2BMKA 4O2CB 1MHCA 3FB6A 5E6RB 2DH2A 2Z93B 3MOQA 1ZHKA 5FWQA 4HJ0C 5MENE 1OP9A 2KLTA 2JKRM 5LN4A 2NY3D 3DETC 1KN4L 4CSSA 2AAVA 2FTAA 1W80A 3HZYB 4FXGB 4NHUA 3X13A 1T2JA 2EVHA 4FHBD 3BYYA 1WFUA 5IHHA 2XYBA 3EFDH 1QSEE 2B4CH 2PYEE 4P2RD 3VW3L 1GGIH 4G8EB 3T3MB 4AY0A 3PAYA 3L3OC 4C55A 5FA4B 5IMLB 4OCWL 4NOFA 5FGRA 4LFHD 1HN1A 2P8PB 6CGTA 3L1EA 4HPYL 4FABH 5JTWA 3BAKA 1AZRA 3HC0A 3I75A 3Q8AA 4PRPA 2EDRA 2OJ1A 5EU5B 5KSUB 2RIKA 5JW4R 1M7DA 2R59A 3KHOA 2G60L 4NNYB 1NH6A 3ZBMA 4U6XA 4YK4C 3LKNB 4Q9RH 3CFJB 3ETBF 3SD2A 1FVEB 3WKYA 2B5IB 1PLBA 4PB0H 4JPIA 4HU2A 1F00I 2K6YA 5CO1A 1P5UB 5I18L 3TX4A 2ITDA 3VXSB 3EF7A 4RGND 4OGQC 5DQJA 4KRMB 4H0IA 2LTQC 1DQVA 3FU7A 3LV3A 4LCCC 2FIRT 1Z9SA 5F7UA 3UJTL 3HKFA 4JDZB 3CFEB 1QKZH 5I73B 1QW8A 4GXUM 4UV4H 1TQSA 3T6WA 4R8WH 4O58L 5E8EB 1FVDB 2MFNA 3SPVA 1RVFH 4H1LB 4FQQB 1SM3L 2XTSA 1N8ZB 3TEZA 4MAYB 3X1BA 2WWKT 1YYMH 1MFVA 3TPKA 1UXWA 3AS2A 3EIFA 2NT1A 3X14A 3BQUB 2VDQH 1BFSA 4EQ2A 4UQBA 4Q6IC 2NY6D 1I7ZA 3LPFA 1ID5I 2DI9A 3IN0A 3HG3A 3QNZB 3VM5A 1Y7VA 2CRIA 3B9KD 3T8VA 2WBKA 3HFML 4AGLA 1MFUA 3O4OC 1G4MA 5F2FA 4HH8A 4P23A 5MI0B 3ULSB 1F13A 1G1YA 1I9IL 4M7JL 5AAPA 1XMEB 1FAKT 2TSAA 2X4UA 1NCNA 5DHVA 1EEZA 2J1YA 4X98B 3EO1A 1A1MA 5KWYC 1AXSA 4CVUA 1M6UA 1E7UA 4XNDA 2IPTL 2UVEA 3ZKMC 4Z77A 3RTQC 5IHUL 1KB9J 4WKZB 5EZJA 1HTYA 3P11L 2E47A 2V0AA 4NWUH 3US0A 5I1DB 4M6ML 1XSKA 2V7NA 2BIIA 1GRWA 5DJ8A 3RAJL 1J1PH 2YGOA 3LH9A 3ZDZF 1E8XA 3CFCH 5BZXA 1VERA 4PG2A 5IK3A 4V1DD 5J9PB 4X6CF 3VFUA 4AUUA 2VZSA 4XCYA 2WSPA 4ZOBA 2V9TA 2BOCB 1IAMA 2CO1A 3K8LA 4LVNB 2H8PB 3CFDA 2IPUK 4JG1L 3LSOB 3T1FA 2DTSA 4D9QE 4FQXA 1E5AA 3A24A 4Z78B 3G5VA 3EJJX 2H5UA 3TM6A 3PCYA 1RMFL 4XXCC 1Q0XH 4HU8A 3B1UA 3KJ4B 4M43L 5FF6A 1N10A 5IFJB 2LLGA 4PRPD 1L0PA 4EOWH 4POYA 5FO8B 1SOQA 3TONA 4MQTB 4N4YB 4URKA 1TFPA 2W38A 3KPOB 2J5LC 5GS0H 4FMVA 1LVEA 1TZOA 2ODHA 2ALWA 1N6QL 5IB5B 2OR9L 4UIKH 3VACA 4GAJH 3QZWA 2JKJA 3FH5A 4FE9A 4CU6A 1D2OA 3V8OA 4G43B 3TASA 4PJIA 4XNYL 1QPXA 3HE6B 4IS6B 3FF8A 1LGVA 1E4XL 4OLZL 4KMQA 4XTRC 4F80A 3ESPA 2CRMA 2GTZB 5DD3H 5CCGE 4OJAA 2VWEC 1IC7L 4X6FA 3T9WA 4UYPA 4ZMYA 4NGHL 3P4MA 1TJMA 3U4EA 5ITFA 1BGXL 1KACB 4HKXB 2FT8A 3QFJE 1F4WL 4PI2A 5IESH 4S0SD 5D2LB 5I9QB 2XWJA 2EEFA 3PP3H 5EC1A 1HCFX 3NIDF 4D0DA 1BQLL 4X4ZA 1AS6A 2YEVB 5DRXA 2APSA 4KROB 1N0LB 4ZS7H 1EMTH 4PS4L 1J5IA 3KWWB 4ABVA 5GSVA 1KTRL 3TC9A 2WTRA 3WO4B 4P23D 2EDMA 4GT0A 4L8BA 2NY4C 3LEYH 2YD7A 4BFIB 1UD2A 2CJUL 3TH4T 1QNZL 4WLCA 4R3SB 3C6LC 3UYRL 4BQCA 3A4EA 3UZQB 1JK9A 4FFWD 4NIKB 3MNZA 2KUTA 2IBGA 2HLAA 3F6JA 2H41A 3RWJB 4QO1A 1TQCB 5ANMA 2R1XA 5CP7B 4LLYA 2EDOA 4FNLL 1L7IL 4F58L 1IIKA 3LPOA 3W37A 5EU7C 3MLYH 3QWRA 1LEKB 1P1VA 1XL6A 2QMKA 5GISL 2DQEL 3PWPA 5F88B 4PBXA 1OAYL 4LESA 1HIMH 4OQTH 4OF5A 3HMWL 4OM1L 3ESMA 4NKMB 4ENEC 1MRFH 5HGGS 3GBDA 4FQXD 4PRHD 4ZDHB 5HDBB 2BWIA 3II1A 3W57A 4X7SH 3EZ8A 4XZUB 1UENA 3JT0A 3MNMA 1Y6NR 2A9DA 4OGXH 1RUPH 1ZEAH 1RZ8B 3F8UB 4IRSA 4WUUE 3S96B 4G7YH 4M8RA 3CFKB 2ZP0T 4I88A 2FHCA 2Y9RT 3CFQA 1ZVHA 3IJYB 5I17B 4ODUA 4Z7WF 2QQKL 2OMTA 1JF6A 1NEZB 3GLDA 4JM2F 4MS6A 3TBTB 2VDRB 5D1ZC 3N43B 3FUKA 5F21B 25C8H 3KWUA 5DURB 5IQMA 2DBJA 3ARRA 3B2UD 2R7EA 1EAPA 1VPOL 5E6UB 1WAEA 3FCTB 5CS7A 3SE8H 2ZWKA 1AE6H 3L3OA 4XBMA 2PLTA 2UXVA 1IAIH 2VZ1A 3DJZA 1KIPA 1OAUH 1DO5A 2K0RA 3FB7A 4WWOA 5GRYA 5D1QC 2G3NA 1GW0A 3KPRB 1SBSL 4OFYA 2X4SB 2EQDA 3BVNB 3P4OB 1ITBB 1INEL 3ZO0A 2J8OA 1KNOA 5L4FA 1AR1D 3FFCA 3X12A 1NIAA 4XPBH 3DROA 4Y5VC 3P73A 3K4AA 4KRLB 3VXRA 3GZOA 5A16A 2BFVL 3CFTA 5TH2B 2XA3A 4LCCA 5L0QB 2EE9A 2BLFA 4P59H 1OTSD 2VERA 1EAJA 1K3ZA 4HCIA 1TTGA 1YPZA 4M4RA 5AQ0A 1O75A 2BH0A 3FO2A 5KUMA 3HG1E 1W6WA 4XI5D 3BWUC 1NQBA 3TESA 5D6CB 1S9WB 3OPZL 1AD0B 3L4WA 4RESB 5DR5L 5EPMA 5CMAA 5I19L 1P7QA 3RB7A 3B6SA 4HJEA 3T6QC 1CGSH 1P4LB 3ZTDC 1TCRB 4PJGE 3ETBJ 4W9KC 1GC1L 4JUSA 3KM2A 4Q6IA 3COOA 2QV2A 3K72B 3QWRD 4NQEB 4Z95H 1KJVA 3O6FC 3PWPD 3GSXA 3WNOA 3AXLB 3DK2A 1O5DT 4OT1L 1CLVA 4IGBC 1A47A 3V8CA 4E41E 3OKYA 3TFKC 1YJDC 2DYPA 3UYPA 3HBPA 5CU5A 3KXFB 3J8F7 3V6OE 4FLOA 4J3VA 3KLKA 2WLHA 1G7QA 1KBPA 1YY9C 1UT1A 1DTUA 2I32A 2WLNA 1DDHA 3PWLB 2X3AA 1NCCH 12E8L 1OXYA 3LS4L 4GPVA 3VGBA 1DE4B 3DA0A 4K7FA 4LARH 5J1SC 1XGTA 3SYQA 3QORA 5D1XC 3CDZB 5F6HI 2YZ1A 3NTCH 1UB6A 1EFXA 1FHGA 3H2WA 5J1AA 2O5YL 1G0YR 4HLJA 4OGAC 3AM8A 4ZO9A 3MRCB 1CE6B 3K4DA 4MVBD 4KK6D 4U1LA 4Z8FH 3GM0A 1NSNH 3DETD 2FSEA 3QS3A 3QDAA 3P1VA 3ELQA 4XZ4A 2R0WL 2F58L 4QHLB 5FYJE 2N4IA 2A38A 2DBLL 2H0FA 1GIGH 2G9HA 4OU3A 3PXHA 4JFQB 3K2UH 3WDHA 1G6VK 1S7WA 4MDIB 2BNRE 3HVNA 2IH1B 1N68A 4XXCA 1VGEH 5ITBL 3B3IA 5HGHA 4ZMWA 2ZJSL 3EG9B 2WXKA 2DLFL 5FYJL 1Q0YL 2EZ0C 4RX4A 3ABZA 3UBXA 1KB3A 2NY2D 2RQ8A 3CPLB 3WMSA 4BCZA 2GJ6E 2YS4A 1MIML 3FFCD 1GJWA 4FQHB 4FXKB 3G9VA 3FUDA 3U0WL 5C09A 3MV7A 3NA9H 4JR9H 2WYTA 1AFVL 1YEJH 3VXRD 4O2EA 2HJKB 4CADB 1IGYA 5A2LH 4AC2A 1A9VA 4FFZA 1KJ2H 1MDTA 4FXTA 1L5GB 5L6YL 1JZIA 3C6SB 1A14L 1R5IA 2A74B 3WI9A 3T1WA 2AEIT 3L95B 1ZA3B 3M17B 5D4IA 5E2VL 1YEIH 4LNRA 1NCWH 4AQ1B 4B9FA 1XH3B 3MLZH 4W6XB 5TK2A 4C59B 1NGXA 3MLTB 3QP3A 3GMMB 4YDMA 1P7QD 2NNXA 1MCCA 2ADGB 3UTPE 3VA2C 4PJFA 5CR8A 1CD9B 3X1FA 2GFBB 4X80L 3BWZA 4YE0A 4HCGA 3BP6A 1QLRB 4ZZKA 1DSYA 3LRGA 3T6VA 4X6EB 1L9RA 2E8ZA 1IVTA 4E68A 4HHWA 3ATDA 1CDBA 3F3HA 3GSOA 4AGMA 4RAHA 4JN2B 2DYPD 1CURA 4NN6C 3D9AL 2ZF9A 3QI9A 1WBZB 1QYGL 1XCQB 3TNMB 5LQBH 5CGBA 1M42A 1D5MA 1IX2A 4OJFH 4R7DA 1OARH 3C6LA 5FW6A 4JFYA 5CIPH 3D12B 4FQJL 4FAAB 3QARA 3ZKMD 3PAZA 1S7SA 3C8KA 1BBJA 4JQIH 3RHWF 5B3JF 4PQXA 2HTKC 5L8LB 1EFXD 4XO4A 3UTZA 1INQB 5JA9A 1MDAA 4HDIA 1OP3H 3MGOB 4XAWH 2J2ZA 4LK4A 5DC0A 5DFVD 4XMPH 4XC3L 3OKEB 4NWTL 3N42B 1T89C 3TO2A 4E0RA 1IKNA 4HIEA 4CC0A 1C7TA 3DWTA 3FQNA 3X1NA 1UJTA 3SDXB 4MS8C 2X4OA 2ZOKB 3LH2L 3MJ9A 1LO2L 1PGRB 5AG9A 4W9ZA 3TNNB 1FFQA 2VN3A 2PPAA 3SE6A 3OHMB 3QUKB 2ZKMX 1BJ1H 1BSIA 4JKWA 3SKNA 4CJ0A 3CUPB 3CX5K 1TZIA 2EABA 4Y8DC 1RJCA 5GZOA 4HWNA 1MFBL 5IW6A 2W60A 4RX4D 4XR8C 2C9VA 1MW2A 3QDGB 5BQ7A 2DEYX 2WVVB 2Y7QA 3OBAA 1KY6A 3GI9H 2L7JA 2NY5C 4TVUA 1RZ7L 2X4RA 4BXVA 5JDSB 2EDTA 1FG2A 3BP4B 1AMYA 5C09D 1TJGL 3MV7D 4OBSA 3QWQB 5EIIA 1HXYA 2PXYB 2XUWA 3EO0A 2EE0A 3LKQA 4MSWB 3R4RA 5BO1H 3BQVA 4G72B 2DM2A 3QGVA 5HSFA 4HK0B 4UOW1 4LB8A 5DMIH 1HHIB 3WENA 5LGJA 1TQWA 5EUOE 1AKJB 3NFSH 3AREC 3VI3F 3EYSL 4EI5B 2DLEA 5AALA 3IVKB 4OCSL 3FTGA 1DSFL 4GKZA 2ORBH 5LBGA 3WSQL 4A7VA 1JYNA 5IM7B 4W4OC 3O3EB 3TBSA 4K71B 4JFZH 5D1QA 5I74B 3MREB 2HKFH 4AQ8A 4AIXA 3UZVA 3L45A 4FTVE 1BBDH 2Z3FA 1PEZA 3VGFA 1CB4A 1IJ9A 4UV7H 1W8OA 4P9HC 2X0VA 4A6YB 4P5TC 3UAFA 3FQ4A 2AXJA 4L5FH 3I6LD 1ZGLB 4LLDB 1B88A 1CD0A 3OSKA 3HPLB 1LQSR 2BSTA 8PAZA 4R90L 4HQQH 3EH1A 2OTPA 1EA9C 1DJWA 3QI9D 5CEZD 4GSUA 1OSZA 2NY4D 1DBAH 2IANB 3PNWA 4MA7H 5ACZB 3GMNA 4N2IA 3HC4H 4YDZA 1URIA 1IT9L 3C6LD 4QI3A 5DSCB 3QFDB 5I66A 4LSRL 2WQWA 2BHUA 2YD6A 3SD5A 1IM3A 3LN5A 4UNUA 1NMBH 3APCA 4R26L 4M6OL 4LXFA 3V0WH 3D34A 4YXHL 4W9JC 5C08B 4XOCA 1PPIA 5IB4A 1UADC 2QVIA 3QEQA 3CX2A 5FUOL 4JZNB 4CNIA 8FABA 4GAYB 4N2FA 4J3OG 4IGBA 2A73B 4YSOA 2IDUA 1S7QA 1KPUB 1WA2X 4NM4H 3L7FA 4FG2A 4Y9EA 4DGYL 4KRPB 2MNJB 2FQFA 3UAJA 3NIGB 1OKEA 1XX9C 1RJYA 3KLAB 2HUEA 3AS3A 1ZRUA 1M57B 1XIWB 5GZOD 4MZRA 1PYWA 1AQKH 2XPGA 1TF4A 3S4SB 3JVFC 5A2JH 3DOIA 1L0QA 3MBWA 4WK0B 1G6RH 1AZNA 2L3BA 1ETB1 1ZVSA 2X12A 4AQAA 4CBPA 5E8PB 1OCCB 5AOZA 3VD7A 3TCTA 3ULVD 5C8JA 3PFQA 3F05A 3BZ4A 1ZV5A 5D1ZD 5A7EA 4ELMA 4MJ6B 3KDMA 4DN3L 3MMEB 3B8YA 4R0LB 5AW6B 4PJ5B 2DWYA 3IE4A 1DLFH 3MRHA 4N24A 5F7EL 1X5XA 3GHEL 4PY8I 2GI7A 2WLKA 3QHFH 5JPMB 3U0PB 1OCRB 3WFDH 5I8OH 1DP0A 5J6GA 3WFBH 1XEUA 4FGMA 1A7BA 4OV5B 1H6FA 2B14A 3DV4B 2F8XC 2C9XA 2EDHA 4BH7A 2ENSA 3WEOA 4G7RB 1UZ8B 2KERA 3APMA 4Y5YA 5D1QD 5C0AB 5C0RH 1TSHA 5FYKD 2ZWLT 5K9QI 1TQUA 5EZOH 1EEUA 1SHWA 5E2JA 1ZPLA 3T2NL 1FIEA 3TBWA 5TGBB 1ANUA 2NW3B 2V37A 1IGFH 2OMUA 4HHAA 3S37H 2FJGB 4K3EH 4ABUA 3B4NA 2JIXB 4K9JA 3S3PA 3VFWA 4XBGB 1QEXA 3MLWL 4YHOL 2K7PA 3PWNA 4GAGL 3SDXF 3UJIL 5L88H 3VJ6B 3S37X 5DJAB 3B9EA 3OTTA 1I3RA 5FOJA 1IM3D 4FOMA 3ZVVA 4NKDB 4BSWB 2GBUA 3O2VH 1BZDA 4KK9C 4H0GA 4C4KT 2WV3A 2YBRA 3ULVF 3IJEA 3INOA 4ABQA 3GM8A 4AQOA 3MX0B 3QEQD 4G5ZL 5IBUB 1MCDA 5F3HA 5CLWA 5CJXA 4OLEA 5DVKA 2D31A 4PW9A 5ICXA 4APQC 2AJXH 3SGDH 5D5ME 1S5HB 4IGBD 2DKMA 5AVQB 4PB9H 3KPSB 2YUZA 1YECL 5K39A 1KB5H 2F53E 3QYNA 3A47A 4LEOB 1OHQA 1T1ZA 3H9SE 3EXJA 2CO6B 3TWCL 2ZKXA 1BMZA 3UAJD 1ONQB 1BW8A 1E3FA 1F8TH 4UQ2A 3EGDA 3FQUB 1YY9D 4MNQE 1FCCA 4PY7A 3K5SA 4JANB 2IFFL 4UT6L 5T5FH 4K3JH 3GTVA 3UPAA 1AGDB 4RDQF 1RUQL 1L7TH 1YEDA 4AKPA 2X70B 5I0DA 3Q3GA 1FAIH 2ZXCA 4AJVA 4JVWA 4BXSV 3PDOB 3FO1B 3P77B 4OGAD 5DUML 4LSSL 4FJZA 1IBZA 5FWRA 4KZDH 2H6UA 1CFQB 3HR5A 3T4AB 2EYTB 5KSBB 1VEOA 5FV1L 1M7UA 4XMUA 1NFDE 2VWEE 3Q6GL 4PRIB 1QZ1A 2Y06L 3BRDA 3AMLA 3D0LB 1PX3A 3QG7L 1TU2B 3MUGA 4X7TB 2IALA 3SJVE 1PDKA 4OF8A 1T1YA 2OJEB 3GI8L 2YUWA 1OD7A 1O7SA 1KGCD 2VGLM 1EHNA 1NMCC 3CXDL 3HS9A 1BQSA 4OZIE 2Y7OA 1PD6A 5DUPL 1LO5A 2FBJH 1RZIB 3QNYB 4PG9B 4F2EA 3BUQA 5KBKA 4IM8A 4GINA 2LW3A 5D7IF 1N7MH 2CA3A 1OT1A 3MRLB 1OAXH 3WTXA 4LCWA 1Q1JL 5B1CA 2I5YL 2XPYA 3VGGA 1Q9LA 4JPKH 3QIUA 4X6DA 3V0VB 2WHVA 4WJ5A 3HVDA 1IQDA 5E0FA 1P1ZB 4Z7VE 2Q6WA 1ZE3C 1G7LA 1TUPA 3A6CH 4L4VA 2CO4A 2YGQA 3BH4A 3ULUD 1JV2B 5E03A 3ZE1E 2P26A 4NNXA 4ODBD 4N90E 3ARWA 3L1OL 1P2CA 2YKLH 4AOFA 3HNVL 5EO9B 1JMZA 2NNRA 3T8XB 1KIRB 3LNHA 2DWSA 4W4OA 5T3ZE 3O3BB 3UO1L 1RK1A 3BAWA 1MWAL 1XMWA 2RTTA 5F9WC 5EU7E 1Q9WB 3MXWH 1DUYB 4LEEA 4ELMF 4HAKA 2OSWA 4LAJH 3LDBC 2X3CA 1J05A 1J8HE 1XFPA 3ZRCC 1U3ZA 4PUBL 4WKXA 4PBWD 4XE0A 2K8QA 3V5KB 2WYHA 4N2DA 4MMYA 5I75C 1CLOH 3BUTA 2EYRA 4H44C 1M05B 4HETA 4UAOB 4LCUA 5T3ZL 5TDOB 1AS8A 4S1SL 5CCHE 3K6FA 1DQDH 1JL8A 3SGEH 5EWIL 1T0MA 1BZEA 5LG6A 2D73A 1HEJC 1I75A 3P2TA 4WI8A 3DRTB 1T20A 2AQNA 2HTLC 3UTSA 3D2UD 3X1EA 4EUPA 1AQHA 2OQJB 5B4MD 3C9NB 3BZ5A 1RZKL 5SX5H 2R4SL 1BVKB 1INDL 2QGBA 4AT6B 3BZEA 3HZMB 3MV9A 4ZPVA 4TNVK 4WWNA 1B3IA 4HKJA 2DQGH 3FQWB 1QWNA 2IDFA 4OAWB 2N7AA 4PRBB 4YXLL 5C3IA 1AJ7H 2VABB 2X2YA 2VW4A 4LU5H 1XR9A 1NCBH 2P1YA 1O6TA 1XGUB 4GI9A 3GSQA 2WPGA 1BX2A 4ZJ9A 1CU4H 3Q6FA 4LKXB 2XQBH 2A6KB 2A77H 3RJOA 2I9TA 5KVDL 3OMAB 4GSXA 4FNTA 1WFJA 5A1AA 4X42A 2XT1B 4J4PA 4X9HA 5E2UH 3RVWC 1DQJB 3UXFA 5C86A 3PIQB 3MUHL 4L3EE 5KYUB 4GEJA 1U8OB 2D7TL 1OB0A 3IPBA 1IJNA 4IMLB 4KI5F 5K59F 1UXLA 2EIZA 1UOWA 4Q2ZB 4PVLA 4Q9QL 3TZVA 5DJXB 3PUCA 2P48B 3F65A 5EBWB 1L9TA 1SXCA 3DMMC 3LB6C 4KOCA 4P2AA 2VXQL 4XP6L 5BJTA 2DJUA 3ARVA 2VLJB 4NO3A 1XH2A 2XIIA 3GBNH 3MODH 3EOAA 4LCWD 4RRPM 1OP5H 4YX2H 3X1GA 3PHQB 5E6YA 4BRJA 3QIUD 2ZOTA 2VB5A 1VFAA 4YDJB 4K3DH 2PP9A 2FH8A 1Z5YD 3R06A 1QABA 4KVNL 4P57A 3IDIA 5GHWH 1M71A 2HRPH 4L4VD 4ZS6C 2JCCF 5KZCB 1N3NA 3NMEA 2NY1B 3CQFA 3EH4B 4HJSA 4CC1A 2Z31A 4ZX6A 4UBDC 1K4CA 4PGBB 2HMIC 3DKHA 4QHKJ 4JFEE 2PYEA 4DW2H 4AEEA 4U6TA 3DO7A 1D5BA 1QA9B 2WLLA 1U95B 1Q9KB 3CVCA 1JZ3A 2OMWB 2XTJE 5TQ2H 2VLLB 1GHFH 2H26A 1A1OA 2LVEA 1E2ZA 1W72L 4MB1A 3LXAA 4HJJH 4QD2E 1TETH 3DC0A 3HE7C 1L9SA 2BVYA 3QULA 4RAUA 3IDXH 1C08A 4E9VA 2CUIA 4JDVB 4Y1TA 3QEGL 4FEIA 4AZ8B 3NP4A 2UXTA 3MJ8A 3AU1B 3WN5C 4LVOB 2YFNA 3M1BB 3VVVA 1TITA 2VDNH 4D0CA 3UTTA 1SDDA 5JORA 1QQDB 2HX7A 2BIMA 4P5KA 2KI6A 1M2VB 3L5WB 2E7MA 2VMEA 4DAGL 3UTSD 4KTEL 5AUMB 4APXA 4HC1A 4U6HB 4OCNC 1MCWM 5D1XE 3VYOA 3S88L 2EVJA 5KYWB 4JK0D 4NSKA 4TVSa 5MEQA 2BSBA 3L2MA 3MV9D 1U91B 4LSQL 2I9LA 3ZGHA 2P5WE 1UYWL 4ACPA 3F7VB 1GH7A 4X0KB 4P46B 5F97E 1NIDA 1KDIA 4KY1L 4YFDB 3FC8A 1J0KA 2H1LM 3BWAB 1YUKB 3DJRA 4KXDA 2AV1B 3I9GH 2X4NB 5FV2A 3SO3B 2CUAA 5CZVH 5JW3H 4QDGA 2Y5QA 3BPLC 3ZKXB 3ZE2E 1OT2A 1PKQB 4QXGH 2R2HA 3SHSA 4N68A 4J4PD 3K6SA 4PGCA 2IAMA 2LQRA 5T1MA 2PMZA 4UNIA 4ZMQA 3FUNA 1AQDA 3QXVA 5IB3B 1SPDA 3P40A 3QJVB 1CMOA 5J6HB 1X5GA 3GC3A 3P3YA 4OM0L 2F5BL 2WYIA 3TZVD 3U4KA 3R8QA 2D3LA 2J6EL 3HG5A 2NX5E 5D9SB 4GB9A 4MJIE 4WSKA 4PGJA 2XN0A 3U7WH 2NXYB 1TTUA 2WZ5A 3TIEA 1ACYH 1EJOL 3D25B 2C4XA 1DEEB 3G6DH 3NCMA 4WTQA 2PTTA 1HU8A 1A7PH 3OJVC 3U2SA 5A6IA 5I1AA 4N2BA 1FNHA 3EYVA 3TT1L 3FBQA 2KDGA 1Y6MR 3ME0B 3SPJA 1HQ4B 3BIBX 4HOZA 4FI7A 5IV2B 1CT8A 5AB1A 4YSRA 2ENYA 5E00B 4YWGL 4JFPB 3VFTA 2VJ0A 2PYED 5F9JA 3CU7A 1FP5A 1DO6A 1UKQA 1NBVH 1IC5H 4NQQA 4MNGE 4OVUA 4F37F 3IDMB 4NZRH 1IFHL 5BVJB 2VDKB 3ROOB 3HMXH 2V33A 3CLFH 3GSWA 4AJWA 2NT0A 5D7JA 1CYWA 4OTXL 4QRTB 3GZQA 1OE2A 1D9KC 3SCMB 4O2FB 4G80A 1B0RA 5E2TH 5HDWA 4C58B 1OO2A 1AGCA 1P7KB 3DGGA 3LCYA 3RU8H 2KZKA 3IE9A 1D5IH 4C56E 1KFAL 2XFXA 4E9SA 2UYLB 4XVJH 1FSKB 4ORGA 5AW8B 1BMGA 2ZTBA 3W9EA 4C57C 3UTTD 5T33L 4H40A 3FT9A 4HUWB 3DYPA 4Z7UE 4M5TA 1M1XA 3BUBA 5IMKA 3HCVB 5E8DL 4PJCA 2IDQA 1GKOA 4H8UA 3SDYL 4MXVF 1JF1B 2A9AA 3CSYB 3O2DA 5BVPH 1UZ6F 2FQGA 3FO0L 5E5LA 1OL0A 3NFNA 2IEPA 1KTJA 4OLYH 1IM9B 3EHBD 1T2QH 4KK9D 3WUWA 3H0TB 4DH2A 5HPMB 5I28A 5E8OA 4G9FE 1K5NA 1G9MH 2OMVA 2QDWA 3CLEH 3IJSB 3UL4A 3GIZH 5KSVA 4KU1A 3P4NA 5HYJA 3FCSA 2DQMA 2R0ZL 4OZ4A 1F0LA 3LQAC 2HFGH 4H88H 2AQPA 2RCSL 2WANA 3MKKA 1KBKA 1J9QA 5FK9A 4AENB 3RKPA 3V95A 1JNNL 3V4VA 4S11A 1GZPA 3CSGA 1YEKL 2VL5B 3QCVL 2E46A 3CVDA 2BW4A 4CMHC 4OD2A 2JXMA 2PN5A 5CGYC 5AVTB 4YPJA 3BCDA 3LXUX 3WLWC 2IAMD 2IXQB 3GPSA 2NY3B 1H3WM 4PJ6A 5EF2A 4DP7X 3RNKA 5AENA 1GR7A 3HNTH 3IU4H 2YAFA 1WDAA 3VSUA 4OGYL 1MUJA 1T83A 4P2RB 4X9GA 4ZMLA 1B3JA 4D9LL 2X2HA 4DZ8B 4U1HB 2CLVA 4TTGA 1IBFA 3BESR 3DUHA 2JH2A 1U6AL 4Y9FA 3UC0L 4TNWF 3APDA 1KCUL 4WW2F 4GJTB 3AXHA 5AVYB 4GQQA 2EXWC 3SPHA 3E0GA 2BIHA 4LBEA 3S35L 3RIKA 3GSNH 5CZXC 5HYQB 3STBA 3QJOA 3BN9C 1E2VA 2C3HA 5A3IC 4WHTA 1TTCA 4IJ3C 2QVTA 4NNPH 3BH9B 4J23A 5E6IA 1HOCA 4MKMA 4M7LH 2WO3B 4GMSL 4XNMA 1WLHA 5T3XH 2V5RA 2NUPA 2XI9A 3QHTC 4RGNB 5GGUB 2RALA 3S97C 5E08H 1JFHA 4A7SA 5FM5O 3REWB 5KVFH 2FJFB 3DMMA 3T65A 4DP6X 2DW5A 4XMTA 4WUUA 4L2YA 5CEYA 1FFPB 5HVHC 3QJUB 3AXIA 3MBEC 2SODB 2BPBA 2MEJB 4E9YA 1ACCA 3CVIH 5I30H 3GYRA 2HXAA 1QNIA 1CUOA 2KBGA 1QSFA 3CN2A 1U8JB 4A6YH 1RUMH 4PLNC 5BZDA 5KBPA 4JFDA 3SDAC 1MVUB 3OL2A 1Z9OA 3F85A 2NY6B 2QR0B 5EOCJ 2EILB 2XWRA 2FVNA 3OJDB 3MXVH 2H45A 2VISB 5L2KE 1UCBH 2ZSVA 3EYUH 5B38G 2WINB 1JFQH 3B9KB 2QQLL 4GS7B 4U3HA 5C1MB 4WSGA 4L29B 4S2SB 4X0NA 2YUXA 3IAPA 5FYLD 1KYDA 3CVHL 3QBTB 1YNTA 4FJ6A 4Z6AT 5HYJD 1DJXA 3Q5TA 1IE5A 2P7TA 4M56A 2VKWA 3GMOA 3VFPB 4AJYV 3ZKNC 1RQ5A 1WGOA 1XDTT 3OKKB 2X2JA 5EORH 3FB6B 4DEPC 1HWGB 3HB3C 3FUFA 3ZOAA 5HYSG 1ZHKB 2BOBB 3KPNB 2E6PA 1SF3A 2LLNA 2HTLD 5IW3A 4V1DB 1KENH 4HOMA 3O4LA 4TOYL 2XJLA 1WFTA 4PJGB 1HZKA 1MAJA 2VR4A 3L16A 2ZYSA 4NRZB 4XRCA 3X13B 3ETTA 3FUJA 4YZFE 3FRPG 5HD8C 2HRLA 2F6AA 3QJFB 4WW1B 4GG6E 4YFLF 2VMFA 4OD1L 2Y24A 3G7TA 3PQYE 4KNSA 2UX6A 3DSFL 4FHJA 5LGHL 2PCYA 4GRWE 3AC0A 4ZYKA 3OX8A 5C0BE 1H15A 4HS8H 1FUNA 2E0PA 1KN2H 1D5RA 1KDJA 1LO0H 4KHXH 4OCXL 3I75B 2XVLA 4PRPB 2YC1B 3S3BB 3IAGC 5F0LB 4U6XB 4XCEA 3QRFM 2CU9A 2OCFD 3D0VA 2ENPA 2X40A 2O72A 5BRPA 1YCSA 4AVIA 4J6RH 3CN3A 5E6ID 2JKXA 1C16A 3U36A 1KXVA 2BNUB 2ZNXA 3DYMA 4J1UB 5I16A 3V6OA 4PJBE 4QHUA 4UAHA 3VWJA 2V9QA 1UWXH 2ITDB 5IQ7H 1I1FA 2VC2L 3S8GB 1MRCH 3I2CH 1E40A 3FU7B 2YSSA 3LV3B 2NR6A 4NRXA 2EXTA 4Z9KB 3NBNA 2D8KA 3CSFA 3DMMD 3LB6D 2AERT 4WUUD 1A02N 3ZT6A 3LNFA 1PD0A 5EF0A 4PS7A 1UJ3C 1HZHL 1WD9A 4KH2A 3SPVB 5B8CB 2VDOH 1EK3A 4MFHA 1J0ZA 1RZJH 1QHOA 3AB0B 3IGFA 4NO5A 2BNRB 4ILDA 2CRYA 3PXJA 2UXGA 3ML9A 3SQOH 1QSFD 1Z7JA 3RQ3A 1UXWB 1UFGA 4JFDD 5CWSA 4EN3C 3X14B 1Q8MA 4LCIL 4ENZA 4TS6A 2XXCB 4BHUI 4YHPA 4FLQA 4HFUH 4LIQH 4X7EC 4OZFH 3MKGA 2FO1A 2HMID 3IU3A 1E4HA 4Z18A 3LQZA 1HZLA 3U6XS 2ESVB 3LAFA 4GSDH 3AUWB 2EDJA 1QD0A 2AZUA 3FBKA 2X6AA 3KYOA 4UM8A 4P23B 3ZR5A 5MHSD 1MFDH 4DO6A 5HGAA 1HWWA 3CHSA 2X4UB 2FJHA 4E9TA 1EEZB 1G9HA 2VSMB 1LTXA 1PJ9A 4P2QA 2BCKA 1A1MB 1KIUB 1Y1DA 3PE9A 3E6FA 3K71A 4U6VL 4Z77B 2GJ6A 5EU4A 3N1QC 4HIPA 4K8RL 1HL8A 3NAAH 4OI9A 2ED8A 3QPQC 4HMCA 4U3SA 5AW9B 5HHPA 4CVXA 1OGTA 1YZZA 1CI5A 1GL4B 2V7NB 2LHAA 2F54E 3LMJH 5F70A 5IK3B 2J3SA 4FQIL 2WXOA 1AP2A 3O4LD 3VFUB 3FTVA 4H8HA 4XCYB 3HG2A 2QL1A 4XMKL 2YPVA 5KVEL 3CXHK 2F7OA 2P80D 4K9EC 4Y2OA 4JQVA 4P48A 3CFDB 1JGUH 4HUNB 4ZX4A 4FQXB 4PRHB 1J9SA 1E90A 4F8OA 3K46A 1DQML 1ZMYA 1YC7A 2OM5A 5DO8A 2WLJA 1KBVA 2ZPKH 3S96A 2JJWA 2DI7A 5L4JA 3EBHA 2KS0A 4NQDD 5EC2B 5KJRL 1EHAA 5FF6B 2ZUWA 4XAKD 1E9PB 4BBWA 1D5ZA 4U7MA 1RK0A 3FOMA 3H3KA 5ALCH 1PZ5B 2F7QA 1Q90A 4R4ND 4M6NH 3O3AA 1ETZB 2VM9A 4PS3A 3B2XA 1QR1A 5CJQH 1U30A 1FZOA 2Q8BL 1D3CA 1NUGA 1I3UA 1H8LA 1TQVA 4JBSA 1OOAA 4UU9A 4H8WL 4N2LA 1WIOA 2FATL 4LPUA 2IO5A 5LXGH 1UM5L 3ZYOA 1YNTF 3I9IA 2BSCA 5EUKA 2NR6D 4P4KB 1HNGA 3M6DA 3UTQA 4EPSA 2GTWB 4PJIB 4BWUA 3GNML 1KCBA 2VZVA 4YE4L 3NIFE 3SDCB 5GGQL 1U3NA 4X6FB 4KQ4H 7FABL 3IPFA 2K6WA 4NN5B 1P6WA 1VZIA 1NTDA 5ITFB 5BUAA 3NEXA 3ILDA 4OR1A 5C7ZA 1OY3B 1ADQH 4PGEB 2DWXA 4IRJC 2XWJB 2D0HA 5EC1B 2HCZX 4K7PH 3QUYA 2YMTA 4NQSA 4U0RC 3BKJL 1JXDA 3IFNL 4BZ1L 3AGVA 4KKPA 3I9PA 3LH8A 2MCG1 1KXTB 1T03L 3FTZA 1AI1H 2ZOWA 1KCRL 4RSYA 4HPHA 1N5YL 3HC3L 3W38A 5FUZH 5GSVB 3AS1A 1RK7A 1FNLA 2WTRB 1W0YT 2E6JA 3D08A 1G0DA 1DVXA 4RNRA 4L8BB 1JPSH 1IGIL