1HEJC

C-terminal xylan binding domain from cellulomonas fimi xylanase 11a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
TGSCSVSAVRGEEWADRFNVTYSVSGSSSWVVTLGLNGGQSVQSSWNAALTGSSGTVTARPNGSGNSFGVTFYKNGSSATPGATCATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evidence for Synergy between Family 2B Carbohydrate Binding Modules in Cellulomonas Fimi Xylanase 11A
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase(xylan degradation)
molecule keywords ENDO-1,4-BETA-XYLANASE D
total genus 9
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hejC00
1E5BA 3NDYE 2CWRA 2CZNA 1QBBA 2RTTA 5DHEA 1EXHA 1EXGA 1QBAA 3NDZE 5DHDA 1E5CA 1C7TA 1HEHC 1XBDA 1C7SA 2XBDA 1HEJC
chains in the Genus database with same CATH superfamily
4KHTL 2QDWA 4JN1L 4O2EB 4ZQKB 1YPZB 3QB7C 5F1SA 3IDIB 2IBZX 3FS9A 1AXSA 4AZ8B 3O4OB 5LBSH 3T09A 5ISZE 1MCPL 2VDRH 2MTPA 5IFJB 3RBSA 2G2PA 2YWYA 4XVUD 4NKDA 5K39B 4IIQC 1FRGH 5IF0B 3UAJD 1DQDL 5JIKA 3QJTB 4CDGC 3NTCL 3HCVA 3RE0A 4X6FA 2XJLA 5CHNA 2D2CC 3H3BC 4BGDA 4R0LC 5BUAA 1INQA 1AQ8A 1BIIA 1IIIA 4XXWA 4LPVA 2HRLA 3THML 4ZUWA 4HG4J 4LLUA 1MCDA 4MB3A 2AEQH 3VX1A 4GRWE 1D5ZB 4JW3A 3C8KB 3LPGA 1YYLH 4XAWL 1ED3B 4GW1B 5IK3B 2F8IA 3HE6A 2AJSH 4U1HA 1K2DB 5I0VA 2UY6B 2AQ1A 4PGEA 3KPPB 2CHDA 3KGTA 1ZT7B 2RALA 1ZGLP 1TTGA 4NYLA 4CW1B 3EH1A 1Q9WB 4OGYL 1TFHA 3PAYA 2X40A 4P2OB 3L1EA 3L4YA 5D2LE 3U46B 2YMOA 4FF9A 1KF9B 3HN5A 1I85A 5C9JA 3RJOA 4YDKH 1IEHA 1L9RA 1KXQE 3HZYA 3MRPB 1GJIA 3LKOB 1B2YA 4GPVA 4HJTA 2B14A 3BIAX 3G5XA 5BJTA 5F7DA 7FABL 2J3SA 3LS5L 2AJXH 5FIEA 4AQEB 4JG9A 3VB9A 2BP8B 3KEHA 4KVPA 3D2UB 4PJHB 4G7QB 4JPKL 1FNHA 5SWSE 2QVFB 3UG4A 4S1RH 1CO1A 1MH5B 2CK2A 2EIEA 2WXHA 3AREA 2DWEB 5IESH 3NSCA 2WSKA 2R2CA 1VHPA 1LDSA 1WUNT 3WFEH 3EHBC 4Y19A 3IVKA 1KYFA 2E76C 3ARDA 4GQQA 4ZTPH 3ZW3A 2DOCA 5HI3D 43C9A 3CFDB 2I7SA 3TCXA 4IBYA 1HSBB 2CRMA 3TFKD 2XZCL 5CLZA 4I2XA 4Z7NE 2A9MH 5KJ4A 5K9QG 3G6DH 3NJLA 5BS0E 2V0AA 3L17A 2OTUB 5I1HL 4F9PC 4HSQA 5BMFH 1ZT1A 2WVTA 2PPAA 3JQOB 1UZ8B 2BZDA 2HRPL 3GBEA 3GJEA 4AT6A 3VXOB 1A8JH 3AB0B 4PSPA 3VXTA 1RZFL 4YHMH 2IVFC 2OK0L 1TVBA 4FFYH 4B9ZA 2FIKB 3LV3A 1SXZA 2D8KA 3V4VH 4LMQE 4QJ3B 4FQHB 5DRXA 1I9IH 1YNTF 3PHQB 4XB3A 2W60B 1GZPA 4WHDA 5D2LF 4K3EL 5FCSH 1SJHB 5DRWA 4ODTH 5MENA 4G3YH 1SXBA 1A4AA 2DJSA 4LSQL 5KSUA 3K1DA 1G7JB 5I8KL 4IOSA 1MHCA 1XIWC 4P06A 4FL4B 3O6FB 2YSSA 2C7FA 4Y4KD 3GBNH 3II2A 1JNNH 4JO4L 4WVRA 2FB4H 3QWOA 1OM9A 1VACA 5F0PB 2QPDB 1A47A 1A8ZA 2G2RA 2Y5TA 4U4BA 1ZJBA 4HUVB 1G7IA 1OVZA 2VKWA 1NFDE 2EINB 3GIVA 3ILQD 2QKIB 4ZMPA 4DQOL 1KXQA 1QFHA 5CF3A 1P4BH 1R0AH 1P5VB 4G72B 1E2ZA 3SDXB 3AQYA 2OYKA 3JWNC 1W72L 3VDCA 2E8ZA 1LXMA 3KPMB 1A14H 1NCAH 3JWDC 4PRBA 1NPUA 3QRGH 3U25A 2JKWA 4PJ5E 4PJIF 2X88A 1MXDA 3ZU8A 3N41B 1YNTA 2AJUH 1HCFX 5T3ZH 1KJ2L 4BKLB 1FGNL 2YBRB 1N19A 5JW5A 5I6LA 2VR3A 2Z7WA 1CXEA 4QTHA 5CZVL 5IW6B 2IAND 2JKIS 2X70B 4WUUA 5BVJB 4H4NA 1RPQA 3H8NA 2WP3O 5CINH 1RK0B 3FB7A 4JM2A 5C2BL 3NCJH 2I26N 3SO3B 3RNQA 2ICWB 3F7LA 5I1EH 5JZ7D 3TBCA 3EJZC 3U2SB 1Z7JA 4LCYB 4JO2L 3ULVD 3MJWA 1XCXA 3AB0C 3FT3A 4JM2C 5B1CA 1V8HA 5T5FH 3MCKB 4HXBL 2Z7ZA 1T4KA 1PG7H 3QS3A 4FQ1L 4FRWA 3U36A 2DQMA 1NLDH 1TYEB 2R69H 2VWEC 1U58A 4DGIH 4WWID 2F7IA 4EIBA 3U4BL 2VMDA 1YJDH 1YYML 4FXGB 1BVLB 4M8UA 4XPGH 1DVSA 4JFFB 1AGEB 3RWFA 4QNPE 2DIBA 1PZBA 2IGLA 1JTTA 5D6CB 4FQHA 3OGCB 3L5XH 3H4FA 3QS2A 1TCRB 5AYQA 4NGHH 1WT5A 3PP3K 4DO4A 1R3KA 3MJGX 1NCOA 4OZGB 1XT5A 4KJQC 5ALCL 5F9JA 5T3XH 1BOGB 2R9HD 4YSTA 2V37A 2BDNL 4TNFA 4FC3E 5TH2B 4FQCL 2H5UA 3GS4A 2KI6A 4N2LA 3NK3A 1LMKA 2H9GB 4JPQA 4GNKB 4PJ5B 4EXPX 2B59A 2LV4A 3TWCH 2Y5QA 1DLFH 1MPAH 2HRPH 3U7YH 2QR0B 1AC0A 2VABB 4CBPA 5KBLA 3VXMD 2FHFA 3T0WA 4URKA 3PL6A 3NRFA 3SKJL 5JMOC 4E5XB 1G7HB 2H1LM 3KPQA 2VWEE 5HDQH 5T3ZE 5J89A 5LCVH 1NH6A 3GNML 2KMWA 4PW9A 5AQ0A 2EIJB 1OWWA 4NM8H 2AANA 4A6YL 1FJ1A 3ZDZF 3EZ8A 1IE5A 3GK8H 3SE9H 5F96H 4LSQH 3IYLW 4B27A 3HG5A 4AV0A 2OZ4H 2WZAA 4LSRL 4O58L 1W6LA 4GXVH 1ZLSL 2X6VA 2PYED 1NIDA 4QEGA 3H9SB 3NH7H 2CKNA 1YEHL 3T3PE 2ZCHH 2VABA 2MQCA 2GABA 1RZFH 5DC0A 4Z3JA 3KH4A 3NG5A 4WUUE 3STLA 3MGAA 2CIKA 2ZWYA 3IDXH 3MYZA 2V9RA 2VXUH 3GXDA 3I74A 4QXTB 1DJHA 4GIPD 5I1HH 1KJ3H 4Z7AA 4I3RL 1NL0H 3AAZA 3QEQB 5I5JA 4PGEB 3VAEA 2PXYC 1NGQH 4TTGA 4L8SB 3RPIA 2GJ6D 1MQKH 3K8LA 3NT0A 2YMTA 2XIDA 1REIA 2QADB 2O6CA 2VMCA 3QPKA 4AUYA 3P11L 3TBVA 3P2BA 4YDVA 2DICA 4JFEB 4TKWA 1N59A 1RZKC 5CKAA 4XN5A 3DRTA 5HYJB 1IB5A 1E40A 2R51A 1EAOA 1HSAA 1OB1B 1T2QL 2BCKA 3OPUA 1Q0XL 4JHZA 5HGAA 2WAHA 4N0YH 5E6YA 2XRAH 1KB5B 2Y36H 5EF2A 2CLVA 3UACA 5I73B 1F86A 3NZ8A 5K9KB 2XTJB 1QA9B 4KX7A 3S36X 3IJSB 3KNBA 2C3XA 4YHNA 3T2PA 2NY4D 1E4KC 5FGSA 2HVJB 3ARED 4JPSA 3ARPA 4NKOA 2N1TE 2VR8A 5I1DB 2IGFL 4XP5L 2BS9A 2Y7SA 3OKNA 4MXQD 4E5XG 2Z31D 2P42B 5AAMC 2MCPL 3KVQA 2DMBA 2YAHA 1AGFB 4UT6A 2P48B 3RVTC 5J6GA 3CV5A 4G7VL 3GBLA 3ZSSA 5IR1B 5HGBA 3SD2A 4KK8D 3DURA 1IC1A 2XKUA 2F08A 3VA6A 1J0YA 2Z92A 4GG6E 1MVYA 5HI4C 1NCWL 4GW1A 2PF6A 1PLGL 4HIHB 4HLZH 4WI8A 4XP4L 4Y4FB 4N8VB 1MLCA 4IMLA 1TJIH 4KX8A 4PJIB 2BHZA 1UXSB 2UWEF 3R8BB 4UNTA 4MCNA 2A2QT 4Z0XA 3QT2A 4JVWA 4WZ9A 3UGUA 4PTUB 1YN7A 2YAFA 4ESKA 4N9GB 1E8WA 2JKNA 2JK5A 3VH8A 4F7PA 4H8VA 4WWKB 2H2PD 2AEQL 5D72L 2WCSA 4QCIB 1BCIA 5TE7H 1T66D 2HFGL 2NY6D 4YVUA 1WWWX 4RLDA 4KRPB 3TOPA 2PETA 1NAML 1AGCA 1VPOL 2CHXA 1HS6A 3RKDD 1H5BC 3IKCB 4P99A 1M6OB 1WFUA 4B9YA 3C9NA 1MHCB 2NY4B 2MKWA 4OT1L 4RMUA 4KK9D 1QNZL 5ANMB 3VU1A 4K94H 1I7UA 3EYVA 3UTTD 1BXUA 2BP5M 3TYGH 2JB6A 2LQRA 2WTRA 2FNWA 1TEYA 4H8UA 4Z7UB 5C0AB 3GKZA 1GR7A 3BZDA 1FHNA 2BP8A 5LBSL 1AVAA 1D9KB 4DZBA 4EZLA 1ZLVH 4RZCA 1FUNA 3C6EA 4PP1C 1JWSB 1XZWA 3P9MB 4BFBD 4FL4C 4FQIH 4LLMA 1SPDA 2Z0BA 4JO1L 1YEWA 3WS6A 2DKSA 2XWZA 4AG4L 4F57H 4NN6C 3GJEB 1S9WB 1H9DA 2OMVA 1NCBL 1OCOB 1IFGA 4H0IA 3L3JB 1KIUB 2H0JA 2Q2EB 2RA1A 2D2OA 2OFQA 5AD0A 5FM5O 4GSDL 1M6OA 3C5JA 3GRGA 1BXVA 5H37A 6PCYA 2WP3T 3BYTA 2B15A 4K55A 2EDDA 5DUPL 3WEBA 2FLRT 2YD5A 1AQKL 2EYTB 2XPGB 2G3MA 4HQQH 4CN4A 3RY4A 1LWRA 8PAZA 2Q0ZX 5FB8A 3P73A 5G4OA 2D7TL 2FECL 3BD5A 5LB1A 1F58H 1AXTL 4GKZB 3IXAB 3VGAC 3HUJF 1HQ4A 4Z0BH 2RFXA 3CWGA 5AVTB 4IS6B 3FCTB 2ZXWB 3F83A 5CN3A 5HHVL 1SHXA 4FTDA 4Z18A 2Z92B 1BSIA 3X12B 3GMQB 2FBRA 3ULUH 2AK4E 1EEZB 2Q8BH 1I1AA 1NCNA 4HAFA 4AL8C 4DUXA 4QJ5B 5IKCA 4HSAC 5T3XD 3CDZB 4J3VA 3RVUD 3CVBA 3GYRA 1BZ7B 1I9EA 3A5VA 2HP4A 5HYFA 4OLXH 3RUGA 4ZMXA 2R15A 1IKOP 1ZY9A 2C9SA 1Y1DA 3CDFA 1MFCL 1XSJA 4JG1H 5IVXA 3SDXF 5JIPA 2OZ4L 1JHTB 1CR9H 1SY6H 3N9GH 1BQHA 3TNNA 4IW4C 1HZHH 1IX2A 3U4AA 4YZFF 1PD6A 1TTFA 3VVWA 1S46A 1U8JA 4KO5A 4LGSB 1G9HA 4XP6H 2FWUA 1SXSA 5HHVH 1N4XL 5CR1A 4S0HA 2KH2B 4FP8L 5GGVH 2ZAGA 3KLQA 3OV6A 1D9KC 3EOBB 3F7PC 5JTWA 3LZRA 5C0BA 3JVGA 3QDJD 1QTYT 5T1KB 3ZMNA 1PYWB 2A9AA 4YR6B 5IREA 5E8PA 4XP1H 3FQ4A 2X4OB 1MFUA 2HLAB 4J1UA 3VQ2C 4U6HB 2Z0UA 2YD0A 4X4ME 2DJMA 1QFWL 4KK5D 4LLVB 3U2SA 1T03L 3FN0L 4RETB 3S8FB 1OSYA 4JS7A 1FVEA 2F53E 4MB1A 4QXGL 3ZYZA 4NFDA 3BHBB 4G1EB 4NKIL 3EGDB 2PWGA 4M48L 4XOCA 2APBA 3LEXB 4XXDA 5F9WC 2WSPA 3EDFA 4JFPB 1QBBA 3NABH 5DJAA 3TVMD 2R29A 4HFWB 5FKPA 5JIDA 1T7VA 3LZFL 2YAEA 4UQBA 1KBVA 2OL3H 2AABL 3TBYA 3HB3C 4L3CA 3QJSB 2NCEA 4HJ0D 5INDB 4Y5XA 4Q2ZA 3SBRA 3MGTA 3LKRA 4GEIA 3QZBA 1R3KB 1HWWA 1RZGB 5DMIL 4RX4A 2OCFD 2Y07H 2ROYA 1ZE3C 1FAKT 2A83A 3GXNA 4K8RC 3X12A 1XFPA 4HC1L 4U6HA 1KYOJ 1G1CA 1NAKL 3T0EA 5BO1L 2VZTA 5E00B 1HQ4B 3UZEC 3WUWA 5HPOA 5JW4N 5E9DB 3U4KA 3PE9A 3WNMA 2WBJA 4R7VA 1NLDL 2R69L 1T7XA 3MUHL 2XPYA 2R23A 2IV8A 2ISDA 8CGTA 3ZKXB 3UZEA 4HS3B 3BH8B 3BW9B 1F4WH 1ET8A 3II1A 3HHMA 4PTTB 1E4HA 5G4NA 3EOTH 4MNGE 1H6EA 5AG9A 3DVGA 1FYTD 5HVFB 1GSMA 4ZJ9A 4YHPB 4H8WC 5DC4B 4NNYB 5MP6L 4NQDD 2L4OA 4CGTA 4ZUSB 3MNZB 5GS1A 3GGWA 2X44D 3H9SD 5EU6B 2R23B 3B2PA 1BX2B 3MLWH 5FGRA 4H1LB 2LTQB 2ZOOA 4YHKH 3KPRB 4WHTA 1KV3A 3C12A 3N40P 5JHMA 4IMKC 5JPNB 3QRGL 2RD0A 2PYEB 4OAWA 4WWOA 2GIXA 4HH8A 3SKMB 1AGDB 4QRPD 4ZRGA 2I60L 5KSAA 2FLBT 1NUDA 4PJ9C 4FG6C 4AW4A 2PPFA 3U4EB 3VWKC 2OMYB 5AKTA 1TQCC 2MCPH 1DYZA 5FYJL 4KZEL 4QRRE 2H6PB 4NCC1 3VXMA 4MBOA 3GUTA 4KQ3L 5IHBA 4EXKA 5D6CA 1WICA 4P5RA 1RJYB 1RMFL 1HHHA 2XCMC 4LOUC 5KVMC 5JPMA 2FB4L 5KYXB 1TQTA 4TVPD 2XA8L 2XTJC 1T5WB 4W6XB 3EDKA 4TUJB 4GXUM 5C7XH 2I24N 4JFED 4L0PB 4X6BA 1S8DB 4H8HA 4MCYB 1YPZF 3K6IA 3H2WA 4HWUA 2JQZA 4I4WA 4EOWL 4PBXA 3CX5J 4CL7A 1C12B 4Z76A 3TEUA 2MNJB 1NAKH 4PS4H 4Z3TA 3K72B 2WQ8A 5CEZL 5DJDB 1JGEA 5CGYC 4QF1B 4DVRH 4MAYA 1Z9LA 1UD6A 3SGDH 4U1MB 3C5ZA 3LYRA 4MRBA 3F64A 4OCWL 4XODA 1B9ZA 3RA7L 4NQQA 1NIAA 1WZAA 3RG1C 5IW3A 4ANKA 1SLWA 1S7SA 1RU9H 2H3NB 1LDPH 5D1XE 4MAZA 3HZYB 1OTTD 3MRPA 5DJXB 3OKEB 5F70A 5HSFA 5J11B 1LGVA 3SDAC 4NKIH 5FC9A 2P8LA 2VLME 3Q1EA 5E5MB 4D7BA 1AGCB 2X7LA 1ZHLB 4XPTH 1EXHA 3T6WA 3WLWC 2A9CA 1NEPA 3MRNA 4FHBD 1PAZA 1XAUA 4JX0A 4LPCA 4MNGA 4QCIA 4P9HC 2BK8A 2Y5TB 3GKWH 1IGMH 3GXIA 3GMPA 3W81A 2X4NB 4IBVA 1WVZA 4PGDA 2O6PA 3MXVL 1XGUA 3SJVA 1WIPA 2MTAA 4GI8A 3FAWA 2ZKHL 4EI5D 1KACB 4RMSA 3ALWA 2ZNWA 4NUJA 1NJ9B 3VA2C 4N8VA 3ECBA 3DTXB 2FJUB 4WSGA 4A7QA 3FT2A 3PAVA 1AD9B 4XMWA 4B7IA 4YSAA 4DZ8A 3FL7A 1OGPA 2DWYA 5BOJA 3O6KL 3UBHA 2DQUL 2CDEB 5D1ZC 1NM9A 2AJXL 1HXMA 4LOUD 1TQVA 4M43L 4ZSOA 4JHWH 2ICCA 3AITA 3QCTL 4ZUUA 3HCVB 4UAHA 3UTTB 4JFZL 5C0NC 5H94B 1DVYA 4B9JA 2VLJA 4XZ4A 3C5JB 3BLPX 1R4XA 4N8CL 3EKCA 5I23A 1RJZB 3L3JA 4DWHA 3QJFA 4M9OA 2YXMA 1VGKB 1YY8B 4EBQH 4K73A 1G6RB 2WHVA 4QHLA 2HMIC 1TFPA 1JCVA 1KBPA 1DQML 1BF2A 3B5GA 4J2QA 4XO4A 3SKUD 2O26U 3RVWC 5IHHA 2UZIH 3BIKB 4O9HL 5AYUL 4KKCD 1T89C 3QRFM 3E2HB 3E80A 3EOAB 3NIDE 2YD2A 5DUML 2H4EA 2WLYA 1JWMA 1JZDC 2R59A 2V8LA 4HZLB 5C07E 5CCGE 1SVBA 2C1OB 3AT0A 1S3RA 3VE0B 1KTJA 4X5RA 5DHYA 4Q9RL 4AQ1B 4I18C 4YFLI 4DTGL 2YPLD 4UMGA 4PW3A 3DJSA 5IROD 2UZXA 4Z7OF 4UT9L 1FF5A 2CJUH 3JVFC 4Q6IB 3V0WH 4NHCH 2ATKA 1R5VB 5ID0A 4QTFA 1UWGH 2NXYC 3T8XA 1T3FB 1UKSA 3FU9A 4OSUH 4XN8A 1QTPA 2VDRB 3KL3A 4P3WA 5DU7A 2QPSA 4Z7WE 3WTVA 1TQSA 1INDH 2J44A 5LCVA 2FVNA 2OMXB 4C55A 4ZNEA 4N9GA 3AG4B 4KO9A 4K5NA 5HHME 2XZQL 3ATEA 4H0LC 4HT1H 3GDBA 3O6FA 5D4QA 3QDMA 1HHGB 4N90E 4ELMA 4MJIA 4LOVA 5C08B 4KQ0A 3UJJH 3CH1A 3RZCA 4JB9L 3QJZA 1JPTL 4FI7A 4LSDA 4O2EA 1KIPA 3ET9F 3GTTA 3DIFB 5HHPA 4RMQA 2GW5A 4OZHB 1RCYA 2H45A 3QUXB 1DBAH 1HTYA 1WWAX 2AEIT 4HJ1A 3WD5H 1LJMA 1YJDC 5B4MC 2GJZA 1KCKA 1E5ZA 3KBHE 5DQJB 3QDJB 5LQBL 1KJVA 3QXDB 1LEGA 2X41A 3FH7A 1KB9K 1KTLA 5DR5H 1YYCA 2WVUA 1T4KB 1DBBL 4EN3D 5HYJE 3FQXA 5L4MA 3PJSB 4Z5RB 1I8KA 4YMPA 4HK3J 3TC9A 3KR3L 2O6DA 2PP8A 4ICWA 3QFJD 3MLUL 2NMSA 5BZDB 3WENA 2FWLB 4LF3B 4IM8A 4PLNC 3CAFA 2X70A 3KWWB 2O6EA 3LXUX 4TTDD 2NW3A 3QE5A 5B39A 1Y6KR 5BV7B 3NQKA 1AE6H 1SUJA 3GS0A 3QHFL 3TNMA 4GYBA 3O9WB 1YEGH 4BHUI 2P7TA 1JI1A 2IBZY 4HHWA 4ODHL 5TQ2H 4NKQB 2NY1B 2VSMB 4JFZH 2XXFA 1Z9PA 1GRWA 3CFCH 3DURB 3IDYC 3TVMB 4P59L 3ATBA 2X4TA 2P47B 4M43H 1D6VH 1CE1H 2WWOA 5JLZA 4G8IA 3LSOA 3UTOA 2XN1A 4KPHL 4W9DC 1I3RA 3D87B 3HPJA 5DF0A 4P5TA 1DL7H 1Q90A 3ME0B 3B2DC 4KKNA 4Y89A 1MZYA 1BJ8A 4XPAL 2V3DA 2TSAA 3JXAA 1JGLL 1L6XA 2BNUA 4JKPH 2D3NA 4GXFA 3GWJA 1JN6B 3FDWA 4BUHA 2AJVH 4GEJA 1G0DA 4AEFA 3K0YA 1Q0YL 3BUPA 5T1DH 2BHYA 2EYSA 5LXVA 3I02B 4TRPL 1AZVA 4WFHE 4LVHB 1U8PB 3WL9B 1XZ0B 5JPNC 4O51B 3EOYG 3BFOA 1W72A 2VDKB 2QQQA 4NKMA 3SGJA 3AW5A 2YKLH 4M62L 4DN3H 4F1ZA 3NIDB 5GRUH 4C83B 1IAIH 4QHNA 2VDPH 2A83B 3QIBC 1FL5A 3FUJA 1COBA 2QZQA 2K7QA 4MA7L 1YNLL 5IJDC 3DX4A 2J43A 4L8SA 2WB1A 3T77B 2OTPA 3CHXA 3RWGB 4HOMA 1PDKA 2D3LA 4OCWH 3SQBB 2XA3A 4OZFH 3LHPH 5EV7A 2V2TB 1YEDB 1AKJB 1BLIA 3H0TB 3TZVB 1A02N 3PIQB 2JCCF 1HZLA 1XF5B 2BSEA 2J1KA 5TQ2L 3VD5A 1XGRA 1MAKA 1IM3D 4M6NL 3UH8A 5D96C 1FYHB 5CU5A 2MWCA 3FT0A 1B3IA 1MCOL 3LMJL 2Y1ZA 2BIOA 2NNCA 2V7HA 1FVEB 1TPXB 3QIUC 1FSKC 4PJXF 5D8JL 4LNRA 4JFFE 1KT2B 4YJZL 3WLBA 1RZPA 2AVFA 1MWAA 2QQNL 3NK4A 3IVKB 4UOZA 3H56A 2EDJA 1DFBH 4TNVK 3RP1A 1TCRA 2MCG1 3QGVA 3SKJH 2JIXD 3FN9A 1E9PA 4WY7H 4W9IC 1AKPA 1R3JB 1S7QB 4NUGL 3BVDB 4LVOB 5A16B 1GYCA 2XG5A 4A2FA 3U7YL 1D5MB 5ERWB 2EE9A 5JQIB 4PJXB 3WFDH 5IEKB 1LD9A 2K8QA 4OZGF 2IPUK 3FRUA 5DS8A 1TEFA 4NCC2 2M8XA 4WFGD 3S3DB 4HIIA 3UTPD 2F7PA 3HE7C 3ULSB 1C16B 1UWYA 2P5WD 5IT2L 1UZ8A 1G9MH 2IG2L 3G9AB 4NO0A 4I89A 2YD9A 5ITFB 3BJLA 1UB6A 3FUMA 1DQIA 3DRQA 4XCNB 4Z7WF 3WNNA 1J05B 2QADD 4QKXB 4ZG1A 2MQ3A 4HIJB 3DI3B 1D2OA 2KDGA 3QQDA 4UQDA 3VWKA 4DKTA 4YS4A 5IIEA 2JXMA 1Z9NA 1BZ9B 3Q2VA 1DUYB 3D2UD 5KYNA 4MD4B 4AV5A 1INDL 4UM8B 4W9LC 3HI5H 4UQEA 1J1PL 3JWOH 3VI4B 4PD4J 1R3LB 4APQA 4LP5A 4LIQE 3RL1A 5LWYH 5CILH 1MG3C 3IXAA 4KI5E 2AJ3B 2EDHA 3RB5A 3LEVH 3E6HB 4OD3L 5EOQL 2QV2A 4BQCA 4Y2LA 4X8JA 5MEOB 2XN9E 4R90L 3UC0H 2GBTA 3O3UN 1FVDA 2QKIA 1E0OB 1E6OL 1J88A 4K9EL 3OMAB 2HJLA 2IOMA 2PCFB 1I8MA 3OZ9H 1XDTT 2DZEA 4L8BA 3P2TA 1QMUA 2OAAA 2MPAH 5CD5C 2E86A 3VFWB 4M7LH 3P2DA 2H26B 1WZKA 5EWIH 2ALAA 4S0TD 4V2BA 1G4RA 1J9SA 1NMAH 2X3BA 5HJ3A 4W9JC 1DQMH 1OSPL 4KNQA 1JGVH 3ALXA 2VXVH 1JWSA 3P9MA 4CVZB 3VGBA 1KGXA 3VGAB 2ERJC 3PU7A 2E7HA 3KJ4C 5EEUA 3P4MB 2OMWB 4WK2B 1AHWC 3EGSA 4E9QA 5EZOH 3UADA 5FYLH 5HJDA 5TQ0H 3TN0D 1O9VA 2XKNA 4IBUA 1QUPA 1WCQA 4PY8I 4L5FE 2OSWA 3V5KA 1I8MB 3TYFB 5CD5D 3GSNH 5ECJE 3GSXB 2WQUA 5AW5B 5TFSH 3KCWA 3M86A 1ITCA 2XVKA 1PX4A 4PJDA 3ZK0A 3I9GL 3BZFA 3FTZA 1FH5L 5GRJH 4EZMA 3CJJA 1JDDA 3MV8D 4Q4EA 4K5MA 3DO7A 3SE9L 4QYOA 5FFGA 1S7TA 2BVYA 1GCYA 5TF1L 1G5GA 1N6VA 35C8L 5D7KD 3IU4H 1B0WA 4JHAH 1HZHL 2UXVA 4PB0H 4F5CA 4XBGB 5GS2D 3VTTA 2MFNA 5C08D 3MRRB 1WUZA 2FEDD 4HIJA 3HIZA 4IU3A 3HNSH 1S7WB 1F3DH 1LE5A 1ZSDB 2WWMC 3AQXA 3BSGA 4Z7VE 4Z77B 2ZUUA 1GW6A 5AVSB 2BNQE 4ELKA 4GFTB 5F1IB 1KJVB 3FYEB 1N8ZA 3NJGA 3ORJA 1XF4B 3PFUA 2B2XL 1G94A 4IU2B 3F12A 4YSOA 4HISA 4EUPH 5KYWB 2DQHH 1M7DB 1P9MA 4ENZA 4GAYB 3AZUA 3QH3A 1RU9L 5D55A 2H1XA 3RU8L 2CXKA 3BGMA 3ZKQD 2EECA 2P9RA 4WNQA 4P4RB 5PCYA 5GS0L 1SOQA 3HZKA 4BXSV 2UYLB 5ALCH 4ZZFA 2MNWA 5A7EA 1J8HB 4N6RB 5BRZA 4CVXA 2NYZA 5E6RB 3N1GC 2D7TH 2LABA 3G5ZA 4TLTA 2WLJA 4DVRL 2QGEA 3QBTB 1ZHNA 4NRZB 4R0LA 4NNXA 2R8SL 3W9DB 5F7BA 2ZCLH 3DIDA 1I8IB 2ZUXA 3PLYA 4M7ZB 4AKOA 3DUSB 4B3VA 4UT7H 4UQCA 1ZS8B 3VFVA 5CEXB 4RX4D 3I75B 1J5OL 3R1GL 1PJWA 3OGOE 1R19A 4BCYA 1X6NA 2DDQH 2YQBA 1FNAA 5T5FL 4F33A 5KYYB 4WRLA 1J5HA 1AO7D 2VB5A 3E8UL 3HTLX 3MRGB 5A3IC 2VDNB 1F11B 3WN5B 5C0RL 4G6JL 2G0LA 4I1PA 2X2IA 2FT7A 4CILA 1CT8B 2PUQT 5CBAB 5I1EL 1N9PA 5J1SC 2WIIA 3CXHJ 5E5RB 1GA2A 1DN0A 3S7GA 3IN0A 1JJUA 2X38A 5HYQB 2VLKE 4IDJL 1S78D 1P1ZA 5CZVH 3MA9H 2CIKB 4NXSA 2QGCA 3NSFA 1OP9A 3REVB 4L2LA 3MJ9H 4PV1C 3QORB 3VTAA 1QZNA 4PWFA 4XCEA 2F5BL 2W65A 3V5DA 3N3EA 4NIYE 5GS0C 4NKDB 4KK8C 4JJ5A 1NAMH 1L5GA 1MXGA 3Q5OA 1OCRB 1GPOL 4M5YH 1OPGL 1VFAB 4AQZA 1XL4A 1A1OA 3BGFC 2UX6A 3ZDXB 3PXHA 3BW9A 2VDNH 4N24A 5KVEH 1Z5HA 3L54A 1HFUA 4O5LH 5FWQA 4GO6B 4K7PH 1L9TA 3V7AE 4XN7A 3S96A 4YN3A 3D6GA 4HWZB 2YUWA 5L2KA 3MR9B 2I69A 2W9EH 3KJ6L 5FUOH 3ZKXC 1TTUA 1ED3A 4NO5B 4UB0L 5ILTH 3D25B 3OAZK 2A6DA 3S36H 3NIFE 5IHZB 5IV2B 3Q06A 2CJ3A 1D5ZA 3NTCH 5IB1A 3HE6D 2UXTA 3RKDC 1IGCL 1S5IH 5DUBB 1NFDB 3SDYL 1AYRA 3K2KA 4AEEA 1IC0A 4X9IA 2VZ1A 1E8XA 1G6RL 5HGHB 5B8CA 3PGCA 5A1AA 4KZ0A 5GS3A 1E3XA 5I1KH 4HU8A 1NFKA 2AXGA 3RTQD 1ID2A 1SZNA 1NOAA 1ZV2A 2EXTA 1PSKH 5JR1H 2QVKA 2NYYC 1G1OA 4O00A 1SHMA 4J6RH 3KPSD 4QLRA 4G1MA 4N87A 1S7RA 4TULL 2YEQA 1NBYA 4F7CA 1I1FA 2F1AA 4QAMB 1JFQH 1YNLH 4LKCA 3BQUD 3RX8A 5J8OA 3NCYP 4MFHA 1SXNA 4N0YL 4QYOB 4KKCC 2ZAIA 1LQBC 4M62H 4J1UB 4U7MA 4WY7L 4X9HA 3RDJA 4R6UA 5MEQA 4RSYA 5FAAA 2PR4L 3LQAH 4P9HL 1XH3A 4X9GA 3WUZA 2CRIA 4I3SL 2QMKA 2R1WB 5KBPA 4PCKA 4ZW7A 2YC1B 3RYMA 5J13B 5GZND 1KFGA 2AJVL 4X99A 3WE6A 5E1QA 4AYFA 1JV2B 1QVOA 1E9OB 2X3CA 4JFXB 4LSSH 1W0YT 1V05A 1J8HE 2CZNA 2J5LB 4XMPH 5H2BB 3U6RB 1KWKA 4PYGA 1G7MB 3L2MA 3NN8B 5I18L 4HKBA 3QUGA 2IPKB 3WN6A 3O2WH 4QTIH 3ZE1F 4WEMB 4G7SB 3DOSA 4C56B 2BVEA 5CJBA 3LPPA 3MRMA 3CBKB 3RWIA 4ZO6A 3X13B 3F04A 1YVLA 4XNQB 5L6YL 1HIML 5C0DA 4B6ZA 1F97A 3WHXB 1BZOA 4KX9A 3S3PA 2BXYA 1OP3H 2QL1A 4OI7A 4YBHA 4OFYD 3FCBA 3WCYA 4X8JB 4AE1A 3FQWB 3O3DB 4ALAL 3DTUB 1ZCRA 4PJDF 1GMIA 3N50A 4P9MH 4ZFZA 4O2CA 4WGWB 4ELDA 4GS7C 1CDCA 4Z0BL 1R5WA 2X9WA 3VFGL 1FQ9C 3ZTCC 4XNZC 1VSCA 2PR4H 1AI1H 3Q9PA 3MRQB 5IVZA 4FQQA 1MCNA 3VYPA 2A99A 4ORGB 3HS9A 2AJSL 4LHUA 1AR2A 2MSPA 3B7YA 4NDMA 4ATTA 2VC2L 4DEUA 3MLZL 1KTDA 1JERA 4UTAL 3K5SA 1TZ8A 3MBEA 3QNYA 4P57A 1Z0MA 5I8EB 2LU4A 4PJ7F 3W39B 3IDJB 5K59F 1CE1L 3P4OB 4P46C 4AUJA 1WFJA 5FM8A 4NOFA 1U93B 4MMZA 2LAGB 3ROLB 3TN0C 3RVXC 2FYYB 3O6FD 5DRXB 5HYSG 2WLMA 2EVFA 3FW6A 2L7QA 2UWEB 2VAJA 2Z91B 4F9LA 2WLKA 1PLBA 3W56A 1PJ9A 1TNMA 1G7PB 4M3KB 3CFKA 3PAZA 3ZT5A 3E9TA 4KKAC 3K2UL 3MACL 4DPRA 3Q2LA 4AT6B 4I3GA 5KVDH 1JPGA 5EU7E 3FHAA 3BH4A 5MEPB 3NIFB 3KPLB 3TBWA 4H1LG 2HB0A 4Q2ZB 1WAAE 5JOFB 3C2AL 1EXGA 4M5SA 4EE2A 3BFWA 1MG2C 2AV7A 4KOCA 3A3YB 1G6VK 2AI0H 4TUUA 4M61B 4G5AA 3DTXA 2DYPB 3GSRA 4M93C 4BFKA 1FGVL 4XCFH 2EH8H 3O6LL 3BHBA 1NCDL 1WT5C 4K4KA 4M7JH 3SOTA 3QC5X 1UM6H 3HNVL 4X6DE 2UZYA 4U1JA 4BGLA 2NOYA 2DWEA 2K6YA 5D72H 4ZTOH 5TE7L 4PLKD 1U8OA 2ITCB 2ZF8A 3ECQA 4F7EA 4WCYL 1J86A 1YEKL 2F54B 5J06A 1QPXA 1E5UI 1HCZA 1VF5C 1WYJA 4P07A 3QUYB 1ZRUA 3WEMA 5L8LB 4LXFA 3ZT7A 5ELIA 2BS71 1MLBB 4HKZA 2NXZC 5HJGA 1RUML 4Q4IA 3HMWL 3HZMA 5FYJD 2X1PA 5IJKC 1F90L 2HZHA 3MRHA 4OCSH 3MACH 4PN6A 5I15L 1W72H 1O6SA 1J87A 3DVNA 2B4CC 1K5NA 5C0RH 3KS0H 25C8H 3MJ7B 1AQMA 4E9XA 3PPSA 4PR5A 1G0XA 3N55A 4FFZA 4DIXA 2EDXA 3UTSB 2LLNA 3R1GH 4HUMB 4GW5A 3X1NA 4S1SH 1RZ8A 3NJIA 1JPEA 3IDJA 1E50A 3WFBH 5F7EH 5CBEB 4L8SC 3EHBD 4UNIA 5HHMB 2NXZD 3WBDA 3ARFA 4G70B 4Q14A 3F7VA 4NBZB 4RGND 4TLSA 2QVIA 2ZAHA 5DD5H 1BQHG 3L1FA 1QLFB 3D09A 2G5BA 4G8EA 1GS7A 4ODTL 4M7KH 5E9NA 3G5WA 4JHBA 3SEPA 3QR2A 4P9ML 3GKWL 3MRIB 5I1AA 4AL8L 5MEPA 4Z8FH 3QIBA 4E9TA 1M56B 2H0EA 3GO1L 5E7FA 3V6FA 3VRIB 4OZIB 1AZUA 2CBTA 3REWA 3GSOB 2C9VA 2P80D 3OHXA 3ULAB 5JPNA 5D5MF 3PWPB 4UAOB 1Z0NA 4Q0XH 4CKVX 5EUKB 1KLFA 1EANA 1FZMB 2D9QB 1A7OH 2YPKB 1A7QH 2A6KA 2DQCL 3N42B 3NCWA 3V4VB 3JWDH 1C5BL 1JZ5A 2XQYK 3S2AA 1KEGL 5C0FA 1BQLL 1HQRB 3LHAA 4XC3L 1FPTL 2FHBA 3QUYC 3ZQ9A 3TURA 5AVVB 4XPHH 5JZ7C 2WQAA 3X3FL 3LQZB 4O58H 4YIQB 4TOYH 4J3SA 1OT4A 3PWJA 3BP6A 4JM2D 4PS4L 3R0MA 4PJBF 1N67A 3GTVA 1KV7A 3Q5YA 2R29H 3Q13A 2FO1A 4D9QD 3VI3E 4S10A 3QSKB 3LZPA 2ID5A 4G43A 4E41E 1FYTA 5LCVL 1K6QH 3O9WD 3W2DL 4NRYA 1IBFA 3VSTA 2IC2A 1IAOB 3KHQA 4NZ8A 1MRDH 4GSUA 1IEAA 3QFJB 5ES4B 3Q3GA 3KPOB 4NZRL 4EUPB 3HB3D 1BZDA 2B9AA 4TUOA 3X3GH 2KC0A 3ZE0F 3BPOB 5KJ7E 3DOSB 3IK2A 1FNEA 3BQUA 5IQ7H 1KOAA 2KLTA 4Y7MA 4B9PA 4BZ2H 4DESA 5JR1L 4FFTA 4M7LL 3X11A 1UJTA 5KSBB 2OXHA 2IDFA 2VERA 2KQNA 2LVEA 4JRYD 3T6VA 1MCIA 3MJ8A 4JN2A 4R4FL 5HGBB 3SCMD 1XGPB 2W0FA 3CK0H 1UGKA 4G43B 3ULUE 2ZP9A 4Y19E 5J13C 2PWHA 2VJXA 1X5YA 2WVVA 3HFFA 4UM9A 4BQ8A 2H3XC 3HI1A 3UC0L 3VH8G 4AM0B 4QMEA 2DM2A 2Q3AA 2Q7NA 1OHQA 4NO5A 5E0FA 4D9RE 3FT4A 5C7XL 1RP8A 3QP3A 5G55A 3WFCL 2W9EL 3K4ZA 1RP9A 3TEZA 4O51A 1WHPA 3U4BH 4PJAA 3WMSA 3UYPA 3VFTA 3V9EA 1CC3A 4NPKA 4UI2A 3FFOA 2QHLA 6PAZA 4PJ8D 3NBNA 3D4CA 2ITFA 1RK7A 3PQYA 3GSNA 1CYXA 4IRJC 3VSQA 3HEIB 1L7IL 3VRLE 1OQOA 1RSYA 5L2JA 1NC2A 3H9ZA 2FGZA 3NCJL 1J9QA 2MMXA 3K74B 5GS1C 1OP5K 5I17B 4HUUB 4UM9B 5IJVA 1QFWI 3VB8A 2IAMC 4QRAA 5EUOB 2B5IB 4UINH 2OR8A 4EKXA 2CR3A 3BZ4B 3VD7A 5C3IA 3H2QA 5CLXA 4OJFH 3MA9L 4DCQA 1J8RA 2M83A 3QJRB 2DWSA 3RL2B 3WGVB 3I6GB 3VM5A 1U9KA 3V0GA 4GAFB 2HG5A 1GGBH 4R4BA 2QTEA 3A24A 1YC8A 1C7TA 3E3QC 4M6OL 1AKJD 4UV4H 3JV6A 4J3OF 1UM5L 5A6LA 1TTRA 3FNKA 2AK4B 4KK6C 1FIEA 1T89A 2JKXA 3KVDD 1BZ8A 2YUVA 3E8UH 3F5WB 3L1OH 2CMRH 6TAAA 3IMBA 3HUJA 1T03H 3ARUA 3I75A 3T3ME 4CU6A 1KC5L 2XPGA 5KVGH 2Z4QB 3BVNB 1QLRB 5DURD 4B53A 2XWTB 5F9AC 3ZIYA 2R8SH 1ASPA 5MENB 1HAUA 4G42B 3W11C 4A2DA 4TOYL 4HG4K 1CGXA 2B08A 3ZOAA 3UO1L 1AXIB 2EEBA 3L3IB 3FOMA 3A22A 4QHMA 3WHE1 4JL1A 3V55A 2AV1B 1BPVA 4DEPB 1SY6L 1S2EA 1GHFH 2VH5L 4P4RA 2IADA 5I8CA 3Q8AA 3VXOA 4G59C 5D6DC 2G60H 3ZHDA 3QCUL 2XZAH 3D51A 3Q5TA 3N6YA 4Q0XL 3D3VB 2XN9B 1JGUL 1OGAE 2DQEH 3T0BA 4P3DB 4GG6B 3IT8D 5EU5B 5AUMA 3WHE0 2EXSA 3AWGA 5T5NG 4BEIA 2QVTA 4MCZB 4WI0B 1VADA 3WOVA 5KSVB 5KS9E 4XMKH 4FKEA 1HEZA 4PRPA 5KOVC 3WKNA 4BDVB 1SYSA 3AT9A 1ZTMA 1UWEL 3JUYA 4QRRB 3CSYB 5EFIB 2O4EA 4WNSA 5SX5H 3K46A 5DCCA 4EZKA 4NFBA 4QJ4B 1JZ2A 2E7BA 4ZNCD 3PQYE 2NY2B 3ZDXE 3DARA 4I2XE 5C0JA 4LK4A 5GGVL 3HFMH 1WBXA 4PJBE 3ENEA 4A6YB 5BS0A 3VH8B 4XH2B 5E08H 4HCRL 4JPIB 5KSBE 4LCCC 1Q0EA 1I9JL 4MDJA 4XMZA 4U6YA 2BY3A 1AQKH 2WW8A 4WO4A 5IESL 1U58B 1DJSA 5M7QA 1MFCH 4DEPC 5L4JA 2Z8SA 5D2NC 1QEXA 2MIZA 4YFEA 4BINA 3ZTJH 1LO3H 1A4JB 4M5ZH 4PHZA 3QUMA 1S3KH 2H8PA 3BAWA 2X4PB 3KH3A 1PG7W 1JXJA 5DRNA 1A3RH 3CH8A 4GW5B 3OQRA 4OUUA 1AS6A 3WXVH 3C75A 4ZPVA 4G42A 2HLFD 2XYCA 1XH0A 2YPKA 3SBQA 3DOHA 1ZVHA 3L3GA 4LRNH 2X4QB 2JLPA 5JDJA 5HI4D 4P57B 3B2VH 5JIHA 5C0CA 2A74B 1NKOA 4FQJL 4R2GC 4XT1C 3WXWL 1CFNA 4GKSB 3BSHA 4JGNA 4I7ZC 4K8RD 4PJ9A 2CR0A 2CHNA 5AYTA 1KGCE 4L9DA 2R0WL 3GLAA 3QUMB 5FXCH 2C1PB 3QW9A 3N1QC 3QXWA 3Q8EA 4ONHB 2RAMA 4QXUL 3ARTA 1B3JA 3M45A 2E9GA 2FQEA 4IBZA 1G0YR 5ICZB 5FS5A 5CXPA 2WBJB 5CEZD 3JV0A 1KBKA 1OW0C 1ACXA 2ARJB 1FLTX 1ZANL 1UA6H 5E00A 3OKOB 3DGDA 4UWQB 3LVEA 1ZXKA 2YD8A 3HBZA 3G5VA 1NFIA 2C3HA 5DQDL 4XN4A 2AXFA 5CM1A 5IGXH 1WZ1H 4Y2DC 1F56A 1OGAA 3GIZH 4X4KA 4PJ9B 4H26A 1JPTH 3C5ZD 3WIIL 4KDTA 3WIFB 4L18A 3F8UB 2VDPB 4FQ2L 2XG4A 4G8GB 3NP4A 4PRPE 3BCDA 4JQIA 1M05A 4K9JA 4ZO8A 4RA3A 3RY5A 5DRZA 2HT4C 1MUJA 4LCCB 4PLOB 4CU8A 1ANUA 5DA0B 1FLRL 3PQYD 4NRYB 1ZVSB 4Y4HB 1OE3A 4ANXA 2IMNA 2JKRM 2BIHA 1UQSB 2J1YA 3ETBF 3L95B 1VPOH 3MFFB 2PO6B 2J8UA 2OL3B 1A6AA 2KS0A 4NEHB 4XX1E 4UQ3B 1D5XA 4MBRA 3FQ1A 2CUHA 1MFVA 2IAMA 4RMBA 2WBJC 3NFSH 5CIPH 4KDTC 3GMNB 5I30H 4R97C 4RRPM 1NGXA 4R7XA 1N64H 5KUMA 1F1GA 3AABA 5H35B 5FFLA 2ZIDA 3GHEH 3MFGB 3H42L 1U8MB 3VI3F 5A2BA 5HVHC 3OL2A 4XNXL 5JNYA 2Y9RT 5F1KC 3R18A 4OLVL 3FXIC 1PLGH 3B9DA 4N2MA 4QT5B 4YDJA 4MCYA 3SD5A 5DZ9A 5FO9B 3W38A 5AAMA 4HH9B 2X4SA 3V5DB 1FFNA 3CVIL 1T5WA 3DI2B 3LXCA 3V9CA 2IDUA 3SGDI 5D7SL 1JYXA 1G7LA 2AQ3A 3EW3B 4K3DL 4G8FB 3FO9A 5CZRA 2PPEA 4M6NH 2E3VA 2ADFL 4S1QL 1V7NH 1CU4H 3O6MH 3KWUA 3DJZA 5M94B 5EC2B 1B4LA 1ZA6A 4HJ0C 4KKAD 5JXAH 3VXRA 4AIXA 1MRDL 2APWA 3BI9X 4PJGF 1WV7T 4UMSA 5G5DB 2MHAB 2I9TA 1EFXA 1RKRA 1EZVY 3NIGB 3IXTA 4NZJA 3SE8L 4APXB 3EDEA 5K5YA 1E5BA 1ONQA 1V3MA 3OAZH 4X9BA 1NANI 4N9OB 3GRWA 1EJ8A 3PUCA 3WKPA 5J9PA 1BQ5A 5D7LE 1OM3L 3BIBX 5JA9A 1CXHA 3O4LB 4HH9A 4EQ3A 4MQ7A 4UDUA 2J6EL 1SM3H 2J1WA 4D3CH 3INUL 3NACH 3BKJL 3AJ7A 1SOSA 1GOFA 2YHGA 4OZHE 1IM9A 4MNQE 1U8PA 4U3SA 2XV2A 1MCKA 3APDA 4GMTH 3QHTC 1N7MH 2OQJB 1J18A 3P11H 3NEXA 4HJEA 3LOWA 1TU2B 4OQTL 1JN6A 3UROR 3WLBB 1E9OA 4NM8L 2PCPA 4EQ2A 2ED9A 4OZFA 4N2HA 4G6FD 2MOVA 2CRZA 1F3JB 3POHA 4K23H 3C60C 4GI9A 4OM1L 3ES6B 3MRDA 2H3KA 4H2AA 4N2EA 5LBSA 7TAAA 4FKKA 4QXVA 1I4FB 1WS8A 4HXAL 1A4CA 3HZMB 3BRDA 1Q1JH 5FYKE 1B4TA 1AKJA 1DLFL 1MPAL 3H0TA 1OTSD 3SQOH 2LR4A 4WI5A 1ZMYA 2F7OA 3ZMEA 2R1XB 2VQ1B 1D7DA 5A2FA 5HHQB 3PABB 1EHKB 4LP4A 1RURH 1UCBH 2K45A 4UOW0 1L9NA 1KPVA 3KPMA 3TF7C 4YWGH 5TE6L 4Z3GA 2MKLC 5T3XL 1MWOA 3N0PB 5E5UB 4JRXE 5KVFE 3L4WA 3BVUA 4UOQA 4QT5A 1OCCB 5DFAA 1AP2B 5A7BA 1BD2D 3MV8A 5EBMA 3OHXC 3MBWB 2X1WL 3A23A 3LS4H 2I25N 2XTJD 1YN7B 2D31B 2G9HA 2I9LA 4LVNC 3OAWA 4X5QA 4DVBB 3ZTNH 4M6ML 1KTKE 2VLLB 1F5WA 3ZZQA 1BV8A 1PIFA 1MHEB 3SDDB 5JW3H 1THCA 2GBAA 4WWPA 3TO2B 1KBGL 2ZOLA 4G6FB 3P30H 4U1IA 1KCSL 1SYVA 2ZYSA 1GTFA 3KZ8A 3OAYK 4QRSB 3HE7D 4DAGL 4N85A 3MRLB 1WWBX 1QRNA 2VMEA 2F58H 4A2HA 4NM4H 3TX4A 3ARFC 4M5YL 3RUGE 2GJPA 4PWHA 2UWEA 1NDGA 1UENA 2WWNA 1SUHA 3PNRB 4DP5X 3TLRA 2CLRA 3QRLA 3IETB 3DIFA 4PUBL 4GUQA 1H5BA 2QADC 2HVJA 3MJ9L 3TFKC 2XNAB 3UBXG 1N26A 5T3ZL 1WZ1L 4J8RA 2A6JA 2WMPB 5L9DL 4MJIB 5ESQB 1N10A 2VXSH 1KYDA 5J1AB 3K81A 3DSFL 1SJVA 1T21B 2NY6B 1ZAGA 1MFNA 1AR1D 4XOEA 4TV3A 2DQTL 3LKNA 3BKCH 5BPPA 3S35X 5HHQA 4JNXA 1CMOA 4P2QE 1NDTA 1P4BL 1A4KB 3EYQC 5GJSL 3FMGH 2QFPA 1R5IA 2YAOA 4JDTH 3RWJA 3EO0B 4FTVD 2LAAA 1N5AA 3L9YA 5AVZB 2CJUL 4AGOA 1PIGA 4PVLA 1BIHA 3TYFA 5DC9B 1TQBB 5KYYA 3RPBA 4AIZB 2K6WA 4L3EB 1I8UA 5GRXG 4GIAA 3QXDA 1LWHA 3O9WC 3ULVH 2Z93B 4LLAA 4D2NA 4GKSA 2CKBB 5A40E 4G82A 4ZS6C 4X7TA 1BM7A 3OJMB 4Z7UF 2Z91A 1EBAA 3HN8A 3FSVA 32C2B 5DLLA 5ADPL 5EBWA 1J1XH 5SX4H 1C5CL 4XOBA 1SF3A 2E7MA 5ALBL 3PHAA 3TJEL 2L7EA 5AUMB 4HHGA 1E4KA 3VXPA 4GQ9L 3Q6GH 3HBQA 3Q8CA 1U91B 2A1WH 4GY4A 2YSTA 3T04D 3U2JA 3C6LC 5EIIG 2P5EB 1LEKA 4LCWD 4TNWF 5CJXC 1AFVH 3QJFB 5E8DH 3WG7B 1AQDA 1FO0B 1A4JA 1Y0LB 3ZE2B 3REVA 4BZ1A 4Q9CA 2X53A 2W9LA 2NXYB 3QH3B 1P7KA 2WKLA 2VJ0A 4YBQD 2G5RA 1Q9LA 5FA4A 2HKFL 3HNTL 1MVFA 4K3JH 2W80C 4AJVA 5E4IA 2FATH 5D1XA 2ZCKH 1TQUA 2IOIA 3FUEA 3AXLA 5E1AB 1R3HB 3KWVA 3HBGA 4TQEH 1RJLA 4K07A 3NFPA 4HU2A 1ZLUK 4F9LC 1A3QA 5LDUA 3OXSB 4KUZH 4YHIB 1XQ4A 3EXLA 3ZO9A 3ARQA 4KXCA 4YXLH 3BKYL 4G8EB 3NAAH 5HHXH 3EH4B 1Q9OB 1U8HA 1Z3GL 2BY1A 4IDLA 5D1XD 1FG2B 1L0YA 1X4ZA 2C1OA 4GXUN 4ZTPL 4XWOD 2LT9A 3F7VB 4PD4K 1CD8A 1TTAA 4WWNA 3IFNL 2VZSA 1INQB 3BKJH 3CDGB 4JVPA 2HRGA 1JDCA 3MRKB 2Q7YB 3LZNA 2OKMA 3NRQA 3US0A 3FU3A 4AYBA 5C0ND 2W9DL 3D4ZA 3GSVA 1NGXB 3ILDA 4X6FB 2F7QA 5IVXE 1MZZA 2K8MA 1G7MA 3KYMA 1XR8B 1PFOA 3N42F 4MA8L 1MJ7L 1UQSA 1GOGA 3ULVE 3FRPA 1OIOA 3OPZL 3DMMD 4X0NA 3RVWD 5JHAA 5EEYA 4KMQA 1F8TL 1FDLL 2E56A 1K4DB 3IDMA 4W70A 5F9OH 4QLWA 4ZSOB 1YMHA 4MNHB 3MV9B 5D7EA 5C0BE 2OR9L 3IPBA 2HJFB 4XO5A 3US9A 3L45A 2OZNA 1SJEA 1AXTH 2IQAB 2GQHA 3O41B 4HDIA 3AREC 3VGEA 3NIFF 2IPTH 3PL6C 5DJZA 1KC5H 3FQUA 4X2UA 3ARBC 4FLSA 2R69A 3Q1SL 1A6PA 1AZBA 2PTTB 4K9EH 2FT6A 2AXFB 5IHLB 3SPVA 5JUEH 1ML0A 2YAQA 4BFGA 1EHLH 5IMMB 1CXIA 5IW1B 1X44A 4OI9A 4AENA 3RWCA 1JCKA 1ZTXL 2R39A 1INEL 3LN4A 4F7KA 4JDEA 4AMKH 3QZWG 1EJFA 2YEZA 1ETJA 1JXKA 5E4EC 4JFEA 4LMQI 4N8PA 5F1NA 1LO5B 3V52L 5HPMA 1G9NH 3DVFA 5E2JA 3FZUC 4DUVA 5CSBA 5SV4A 1HESA 1HKLH 1KWGA 1F6AB 1O9WA 2A73A 4JREC 2DWDA 4UF7C 4OF5A 5GGQL 1WEJH 3O8XB 1OE1A 1NFDA 2WJ7A 2C1PA 5B22A 4KZCA 1BWWA 2NSXA 3O9WA 1W8NA 1A6ZB 3NIGF 4PV8B 3SKNA 5C0DB 3OMNB 4U0RC 2GYSA 2ROXA 1AGDA 1S5IL 3RWEA 3CLFH 1I75A 4L4VE 2Z8WC 5CSZA 3DTDA 4OH2A 3BPOC 3WNPA 4R2GB 1GYUA 1M1XB 4Z7OE 2DQJL 2GAZA 4JM4H 2HRHA 4DP4X 5IJKA 3RQ3A 4NOBA 1ES0A 5FW8A 2H6UA 1WFOA 2D7PA 2KT6A 4K7PL 3H9SA 3UYPB 3RI5K 3V0EA 1VFAA 3T0AA 2L04A 3GMMB 3N0AA 3IJEB 5EU4A 1JNJA 2EEDA 3LNDA 4OLUH 3MBED 3MV9E 5HDWA 2WV3A 4X99B 3WE6B 3QXUA 4IIQA 4PJHF 1MCCA 4FDWA 2P8PB 5K9OA 1KXTA 4BIKA 1N18A 2R1WA 1BF8A 2YARA 4G71B 4NQDE 1XGPA 3FUDA 5D7JA 1KELH 2PKDA 3FOLA 3GLDA 5SWZD 4ZUVB 5DT1L 5JMRA 1QFUH 2AERT 3A67L 3RRQA 3M7OA 3IEAA 4YGVB 2EO9A 2F7RA 2W59A 1WFTA 3NJMA 4HC1H 4ODUA 3AFLA 4A2LA 4YDLB 3O45A 3GXFA 4HCGA 1M42A 1WCBB 5SWZA 1L3WA 1MREL 2ZXDA 4J3OH 4OZIF 1XXDC 3HLKA 1DEDA 5CEZE 1E27A 1SBBA 2OXGA 4MWFB 1WP6A 2OMXA 4QRFA 5FO9A 5BOPA 4Z7VF 4FABH 5LBVA 4WTZA 4NO0B 5E4EB 2DDQL 2AEPL 3J27A 4KK5C 4XPFL 2VDPL 4KO7A 4KTDH 3LZQA 1HDMA 1EHLL 2ZJSH 4TVPL 4M1CD 5TPWL 3H3PL 3LD8C 4PJ7E 5K59E 3ECVA 1MLCB 5ACZB 3TN0A 1XCTB 5F1OB 4MMZC 1T0NB 2WOYA 3QIWA 5IMLB 2G4GA 5IQ9B 5FLVA 3OLDA 4PGZA 2VXQL 2Y06L 4LL1A 1A6UL 2VE6A 2VN7A 2AK1L 3GI9H 2QBWA 4HHAB 4HS6A 1A6VH 5J6GB 3ETBJ 5EO9A 2BFVL 2G9HB 2I9LB 2JIXA 1G84A 1FFOB 1RZKL 3CUPB 1FZOB 3STZA 4H20L 5E8NA 4L4VA 3UBXA 2LOEA 3C60A 3EYOA 8FABB 1WD8A 2PW2B 2VDKL 1BYPA 1UWXK 2HT2D 1X7QA 3EYQD 4G7RB 5F7KC 4PPTA 2E9IA 3P77A 3II3A 2ZCHL 3VACA 4KTYA 2ZXGA 1GW0A 4N0UA 4HMEA 5EC1A 4HGKC 3ARDC 2A3TA 4JFPA 3TWYA 4EF3A 3QQ3B 1NGZA 3C6SA 1P9MC 5FOBB 1ODAA 3OXRB 4AVHA 5AB0A 3EYFA 5JPMC 3GB7B 4UYPA 5IHWA 3SGKC 2YMXH 1PX3A 2ZWKA 4WAFA 4L3ED 3M7FB 2GB2A 3ULVL 1I7ZA 1VFOA 3TM6A 1JWMB 4HZLA 2JVUA 5GGTH 4D0BA 4Q52A 3VCLA 2V33A 2P5WE 1ZV5A 3MNMA 2XWCA 5T1LB 3GSNL 3NESA 3BIKA 4WEBH 2AS5M 2E8YA 3I9PA 3QA3B 3VFVB 2QSVA 4NZUL 3D69A 3SE6A 1HL8A 2P26A 2FZ3A 4A7TA 3AGWA 3ZBMA 5SWZE 4AKQA 5KANG 3MRFA 4L4TD 4WTXA 3IAPA 4FX5A 2A9BA 3T8MA 1UM5H 3O6FC 1EERB 2VKXA 2YD7A 1I85C 1FNGA 2FJHB 3QI9B 4G7YH 2LE9A 3QUZB 1BG9A 2ICWI 5ICYB 5DRNB 5D1QA 2V2WB 4Y4KC 5FM5M 5ESVB 1SJHA 1FIGL 4XCCL 5DRWB 1OSPH 3BUTA 3L7EA 3SPCA 3Q2NA 3EDDA 2J1ZA 3TTYA 4Z7NB 2MHAA 2I9TB 2FO8A 1EEZA 3TIDB 1EFQA 4NJ9L 2EIKB 4NGHL 4PRHD 3V6ZB 3RIAK 3WJMA 5IB4B 2BHUA 1RQ5A 5E2UH 5C0CD 1F4HA 4OBRA 2NQ3A 5H37H 4N1CA 2NCMA 1NM4A 4M1DL 2P7TB 2Q7YA 3RZCB 4HWBH 3UIZA 3WFZA 4OT1H 2EH8L 1KUMA 3ZQXA 2WXRA 4OD3H 3ZJAA 4CMMB 2Z8RA 3H7BB 2FJFA 4OZ4A 2UX7A 2E4TA 3IPFA 4JO2H 4Z7WA 1J1PH 3JWOL 4PJ9D 3A0OA 2LLGA 3GI8L 3RGVB 4MB5A 3WIHH 3W0WB 3BWUF 1FAIL 5FYKL 3OJVC 1ZKAA 5MHSD 1GY2A 4KVNH 4KZDH 4AEHL 2QKIC 4HFUL 3ARZA 1X5JA 2XN9A 2HH0H 4ACTA 2RB8A 2Q6WB 2JJWA 3BN9C 2BNQB 2YAPA 1P7QA 4ODXB 1YQ2A 4FG0A 4QOKA 1OTSC 2B20A 2J8UB 3KXFD 2JCCE 3VJ6A 3ZRSA 3BDXA 1OCWL 3EG9A 4MX7B 1H9VA 4MNQD 3I2CH 1X5AA 4FXGC 3SY6A 4G7YL 3WEXA 1MAML 2F58L 1XF4A 4JFFA 3RWDB 3QYCA 1W72B 1OGSA 2HTLC 4MSWA 2F61A 2EDLA 1PD1A 2IPUG 2P45B 3CH1B 3S48A 1T1XB 1Q9KB 1HH6A 2YPVL 1J10A 3I6LE 3QISA 1UXWA 3MLPA 4UILH 1Z6JT 5F88B 4U1KB 5GZOC 4JHWL 5D1QD 3BPCB 5DEFB 4PQXA 3LXBA 5IM7B 2F74A 1AOHA 1IIKA 4FFVC 4M00A 3RJDA 2EIDA 2YC1A 3EUUA 4AQOA 3JV6B 2JTYA 1UACH 2Q1EA 3FB6A 3CSBA 3FTXA 4WHCA 5KVDE 4RH4A 3PV7A 3SDAA 1JRHH 2ZKXA 3Q7JA 5CSZB 4F80A 3MRCA 4MB4A 1MCOH 3LMJH 3V7AG 1X5MA 3RWEB 1ZV9A 3M1CA 5BO0D 3T0EB 4IMLB 2YOAA 1G9EA 3FF8A 3NJVA 2WXFA 3EJZD 3GSXA 5J6HB 4OGXL 3SYOA 4WJG3 4XVJL 3OJDB 1BFSA 3TEYA 2D7MA 5GZOD 3BZ4A 3RPIB 2X6UA 2OMNA 4PLJD 1O0VA 5EUOA 4XPTL 4QHNB 4ZOCA 1U4EA 4P5MB 4J3WA 1IQWL 4KJPC 1A7QL 2DQCH 2WUBL 4I87A 4IOFD 1AIZA 5EU6A 5MI0C 4UTBL 2IPKA 1BLNB 1LDPL 4F93B 1DHKA 3BUIA 4FMVA 4MJHA 3AQDA 4NZDA 4Z7VA 4TNEA 2NTSP 2EDRA 4NQXA 4FA6A 5HJ3B 2EYRA 2L7JA 3DVGB 3SPVB 5JOPD 3NCFB 2FSDA 1JK8B 4UU9B 5CZKA 4NT6A 4JZNA 2DQFB 3MUY1 1Z9OA 4XVJH 2XTLA 2E46A 2CLVB 2O5ZH 1NBVL 3PDDA 2R0KL 3VXQB 1BFOB 1JVOA 1K4CB 1J9TA 5C0EA 4LLQA 3OSKA 4N5EC 4XPAH 5IQ9A 3FFDA 3TIEB 1JF1B 12E8L 3D3VD 5MEQB 2DRUA 5AW2B 1BVNP 4HX1A 4HPOH 4NB7A 3FSWA 1T20A 2PXYB 4PP1D 4U3HA 4OCXH 3Q8BA 2JCCA 1NSNL 1QUNA 4XBMA 2DKMA 1NGPH 1XGUB 3FUFA 3GTNA 1IM9D 1KCUL 1CGYA 1K5WA 2AZAA 3HMXH 2Y4SA 2IALB 2WLLB 2AJYH 2Q76A 3BAEL 1SN0A 1FO0L 3S0PA 1XF3A 2ENPA 4X4MA 3QEHB 1W0WB 3NJFA 3ARVA 4LOEA 5FYJH 2KPWA 4WI0A 3CN3A 3KHOA 5ABDE 3JYCA 1HT6A 2RGSA 2P24B 4X0KA 5EU5A 3EO1B 5BUPA 4OD1L 3E1F1 4LEXH 5GS0D 3T8XB 7CGTA 4ZDHA 3FU0A 43C9B 3F58H 3HMWH 5KSAD 4WU7A 2JTDA 3VFUB 1IGJB 2VLKA 1QOKA 2DQDL 4Q89A 5FWRA 5CUSL 2CM6A 3K5RA 5CN2A 2D03L 2CM5A 3VMNA 3P0GB 1L9PA 1TVHB 4CNIA 2CDFA 2CJSA 2YK1H 5IFAH 2VDLH 1KXTB 4GBXA 4FQLL 4M8VA 4XPGL 2J88L 3VX0A 2IO5A 2FD6L 3N91A 3GI8H 3VXUD 2X42A 3QPXL 1OARH 3S9DB 4ODBD 3THMH 2VZUA 4E0RA 4N6QA 3B9KD 4WHYG 3KXFE 1ACCA 3BVNA 4R4NC 2HKHL 5CJOH 3GZQA 5AOJA 3BZEA 1N2RA 2QFRA 2AQPA 4OLWH 1YEFL 5B4MD 3UTSE 1WS7A 2VLJD 4JQXA 2P5EA 4E9LA 1YUHA 5FKAA 2EYRB 3PHOB 1SEBA 2ZSWB 2VTFA 3E9UA 4Y9BA 2FWOB 3D0VA 3PV6B 2Z1PA 4WUUB 1GY1A 4R3SB 4W4OC 4LDEB 3UTZB 1DVQA 4FQJH 4NXKA 3CCHB 1AG6A 5BV7H 4JJOA 1DSFL 5F71A 3TONA 1BECA 5DZNA 4P05A 1DBMH 4KKLC 1KJ2H 1FZJA 4JCMA 4XBPB 5EBLA 3BH9A 5D1ZD 3S37L 3LKQB 1IAKB 1WFIA 2G75A 4X7SH 2ZOWA 1J12A 3C9NB 3MRMB 1LWJA 4IYKA 3JVGC 4YDIL 1NMBL 3ZL2A 3I6LD 1E65A 3FHQA 1WIUA 2EDQA 1AGEA 1AGBA 1ZANH 2E27L 2J4WH 2R4RL 5AOKA 4DTGH 2R7EA 5JUEL 1ZD6A 4ONGL 3TBBA 2X2JA 5DJAB 3GJFB 1L3NA 5IQNA 4HUVA 1CK0L 3LEXA 1HI6B 1A7NH 4AENB 3K1KC 2X4UA 4RIRA 1MJ8H 3IE4A 1M53A 1R3IH 1S9WA 5DSCA 3QR1A 1WC7B 3RNQB 1I82A 3BQUC 4NN5B 4EO5A 1T2XA 4F58H 4HJJL 1MKFA 2CLRB 4I18A 4LCIL 5LGKA 5D7IF 5C0IA 1BF5A 3MSPA 4JM2F 2FBOJ 3I3EA 3LIZL 2H2PC 2DD8H 3PDOB 2W60A 3F12B 2FX7L 2VL5A 3ML9A 3LPFA 4O4YL 5IVXF 4JG1L 4YL9A 5IROC 43CAA 3DUUA 4LT7A 1E5CA 2CSPA 3QUYA 5IJBC 3IF1B 1MW2A 2PMZA 2DBJA 4ODWA 3TA3B 4ONFL 4L2YA 3QCUH 4R8WL 4YQXH 4X5LA 1KCUH 4MVBC 1WC7A 1E28A 4QY8B 4I9WE 3WY1A 1T4WA 2FH8A 4PB0L 4ERSL 4PJIE 1UFGA 1DFXA 3UZQA 3X14A 5FF6B 3SY0A 7PCYA 5JQ6H 2WINA 2KZ1B 1FV1B 1HH9A 1BGXH 3G6DL 5HGAB 1G7IB 3VXSD 1S9YA 4FOMA 2A9ML 4HJJH 2DYPA 3FH8A 3RGVA 4WQOA 3TT1H 4LSVH 1JVLA 1W0VA 1KLGB 2P5EE 2QHRH 3RPKA 2VRAA 4POZD 1KGWA 5AW0B 2BSSB 5BW7A 5ABZA 1CG9B 1ADQA 5TK2A 3B5HA 2Y7NA 3GQFA 2P44B 3BP5B 5AW1B 4HAGA 5I0DA 4KKBD 1SJMA 3FO0H 5DZOA 1OPOA 5BW7C 5KZCB 1KY7A 4PH8A 2J4WL 1IGTA 1CLVA 3CFNA 3O0RH 3AROA 3P4NA 4Y5VB 3DETC 5A2LH 1AGFA 3U48A 4PJCE 4M6OH 4IEFA 4Y2DD 4LGPB 4RBPK 4S2SA 3TEXA 2OM5A 2C3VA 3WNKA 5CD3A 1XSIA 2RQ8A 2XHNA 3GZKA 3K6SB 3EO9H 4TVSa 1SHSA 5C71A 5IUSA 4L3AA 4IGBA 1A3LH 3QZLA 1BAFH 3H55A 3TJEH 1DZ0A 1V10A 3TGXA 5A2CA 3DX1A 3LN9A 1M1SA 3OZ9L 1H3WM 3PJNA 4TUJA 1LD9B 2FZ3B 4NI6A 2WWKT 3TS8A 2GSGA 3T3MB 4WFED 4OGYH 5F7NC 1I8AA 5JHDB 3OKMB 3CC5B 3VQMA 2BFGA 4MZ2A 3CE1A 1P2CA 3V0JA 2DH3A 3GUTB 1QX1A 1FL3B 3B56A 5T3XE 1P4LA 2PW1B 2WN2A 4MAYC 1A9VA 3U83A 1TEGA 2A5UA 1ADWA 4NHUA 4MXWL 5C07A 2JXMB 4ADIA 3L16A 3F6JA 1E8YA 3LB6D 1BFTA 1O7DC 3IGFA 2FJGA 1OHZA 4P5KB 5I26A 5B3JF 1R24A 3MYJB 1A7PL 2QKSA 4XR8C 1FV1A 4UQ9A 3B8YA 3IMVA 5HGDB 4PJIA 3B9VA 1ORSA 1PGRB 5CIPA 4JANA 5E8EB 1RLBA 3QRBA 5DFTA 3UYOD 3T77A 4HIIB 5JHLA 1GZQA 4J5VA 1GL4B 1T20B 3VXSE 5JNYB 4AYFB 4KKRA 4NUGH 2YBGA 1F0LA 1MLBA 3T2NH 4PEEA 4HBQA 4NKMB 1KCWA 1XIWD 3OKNB 5F6IB 1VFBB 4AVIA 1OOWA 4U1MA 1NC2D 3L5WA 1NGPL 2EDOA 4A38A 1AR1C 1R34A 4BCXA 4ES9A 1KTBA 4P5TD 1GVIA 3GT6A 1QSED 3FT2B 3GEFA 2CIIB 2Y36L 2J8OA 3LS4L 4LFHG 4PYHA 5AKSA 1EDYA 1CBVL 1QA9A 1DP0A 1L7TL 1HOEA 3VFUA 4E41B 1CXKA 1PZUB 4XNMB 3IRZA 3MNWA 2ZXBA 4FQXB 2V9QA 1M7UA 5DMJB 1IQDA 2AGJL 1I9RH 4BK8A 1BBJA 1NDMB 2EE3A 2P24A 3FT1A 4IRSB 1ZHKA 3GSRB 4X0KB 5I66B 4ELMF 3G5YB 3HR5B 4OJCA 4PTUA 3QORC 4GO8A 1I1YB 4YGAB 1UXSA 2DIJA 1KEGH 5MERA 1NGQL 5E5MA 2X10A 3Q2WA 5F9OL 3MLVH 3BP4B 2WUCL 3X3GL 3D39A 4H25B 3I3DA 4LSUH 1U92A 3WDIA 4A2MA 4RQQB 3ESOA 1D7FA 4X80L 3UBFA 2NNAA 3NDZE 4Q97A 1IC5H 2PW1A 1G7PA 1XL6A 3HLAB 5I28A 1A5FH 2NNFA 3L3KB 1PTZA 1E4WL 5AW3B 1CF1A 5E2TL 1NBZB 1XIWB 5C0BD 4JKMA 3CXDH 4JMXA 4L4VD 1T7YA 1SEBB 1DSYA 1N7ML 4H8WH 2EYTA 2NYKA 5IMOB 4HD5A 4EJ1C 4JKPL 4HUWA 2Z34A 1U4FA 3FQTA 4J3BA 1PNCA 1M2VB 1BP3B 3QJOA 4Y2NA 4GT0A 2ZKYA 2D7QA 4UOJA 4N28A 1B6UA 4AYDC 1CYWA 4HUXB 3I9GH 4K71C 5CS7A 5CR8A 3JYBA 3ISWA 1AGBB 4PJGE 3SE4C 1SLXA 1F1DA 4AQAB 4CN1A 5C08E 1MF2L 1T1ZA 2HJKB 3CU1A 3L3KA 4HCIA 2AJ3A 2Y1YA 4H0HB 2FIKA 3LV3B 4EN2A 1E7UA 3EGXB 1FYTE 5HHPB 3TWCL 1E3ZA 4K8RH 3FYIB 3ARBB 2C34A 3KGUA 5I24A 3LIZH 2HFTA 3BWAA 2Z35A 1Y6MR 5PAZA 4PJCF 2KERA 2WUCH 4IBWA 1JGVL 2YPLA 4R3SA 2Q86A 3P73B 4QR7A 5EDXA 2CR6A 1A6UH 3SSGA 3ESNA 4PJFA 3T2QA 4HIPA 3ESPA 2VR9A 4UCFA 1FL6B 1YRKA 4X4XB 1I1AC 4XZUA 5CGTA 3CSYA 3H42H 1N2RB 4LLYA 3MREA 4QRPE 4RISL 5AALA 5INCB 5LNGA 5IB3B 2YFNA 2YSSB 4CRPA 1HEZB 4G8GE 1ORQA 4JKWA 1T22B 4PRPB 1B0GA 4BDVA 6FABH 1YJDL 1YYMH 3OGCA 4TVPH 3EH2A 4XWOC 1VDGA 4M8QA 2QQKH 5JHBA 3Q6FB 3RWFB 1YEEH 3ATAA 1Z5LA 1QPPA 2ATAA 4A39A 2CO1A 1DANT 1RZ7H 3E38A 4YDIH 3ARFD 5B8CC 4PJAE 1B2WH 3BKCL 4RMRA 3O3BA 1QHPA 3KM1A 1L9MA 5FYLE 1U8QB 1FI8C 1DBML 4QHLB 5CCKH 5ESVA 1J8SA 1PKOA 2ODIA 3AWFA 4X6CE 2Y7OA 4HKXA 3S4SA 1GZQB 3QUZA 3D3VE 2NY3D 3WIIH 3BDBA 5L9DH 2XZQH 3LKRB 1N0XL 4YSSA 4Z7VB 4D9RD 5DZVA 2CO7B 1U0QA 5FA3A 2B3RA 4AYEC 1IEBB 1THAA 1LVEA 3OKDA 1KEML 1FIGH 4HW6A 3SOBH 3V6FB 3VRIA 4OLWL 1QR1B 4B97A 2XXGA 1QAWA 4LEOA 3BUBA 2GEQA 1UA3A 3H7BA 3QJUB 4A55A 4POUB 4XNMA 3EFFB 4Y9FA 4Z3FA 1HJCA 5EF3A 3P30L 2BVQA 4YDVB 3OX8A 1AY1L 2JELH 4P48A 2WXMA 1RHHB 1P4LB 4Y7OC 4KJWC 3IGAA 4LSPH 1BVLA 1AOZA 1LP9A 1K8IA 2WTPA 1BM3H 4O9HH 3MBEC 3TIDA 4GLRI 3V6ZA 2IH1B 1NCWH 4XBPA 3LH2H 5E51A 5LBGA 1I1RA 4LEOB 1PZDA 4BZ1H 2OSYA 1Z3RA 1MCRA 4QRUB 1QR1A 5I1JH 2PO6D 4QXTA 5T33L 1P7HL 2ZOUA 4Y4HD 3KWTA 1UXWB 2YPLE 4Y16D 1PEWA 5L6YH 3HPJB 4OGQC 1DBKH 3H54A 4JVUA 5SWSA 2BRRL 3RWDA 2VM9A 2JKLA 2DMGA 3DMMA 2H32H 3SGEI 4DP8X 4YHML 1OAUL 3LRGA 4GLRH 3ECWA 1SN5A 3BRGC 3T3PF 4IBSA 3IGAB 4OY9A 3ISYA 1WK0A 4GBXB 5C07B 4CSZA 2HAZA 1ICTA 1E43A 4LBEA 2HX7A 1Y18B 2N7AA 2Z7YA 4XP9H 1GGTA 2R0KH 4GUCA 1YMME 4I4WB 1E5YA 3FB8A 3P69A 1MCQA 3K0WA 3SDAB 4XB8A 4P0DA 3BOVA 2Y22A 2RHEA 4ZFOA 2ICEC 5FPIA 3X11B 5FDWB 3KXFB 3SZ6A 3ZYOA 5T1JA 2E9WA 4WIQA 1SM3L 5CMAA 2BIMA 3JTSA 1ZWIA 3KLLA 1I3GH 3BN3B 3V0AC 3SY0B 5FF6A 1MFMA 2ED6A 2GJRA 4AMWA 4OFYA 3U4EA 2DB8A 4J3OC 4YUEL 4WO0A 3O2WL 3SGKA 1EH9A 1YN6B 4WW2B 5JQHC 5DZLA 1CD0A 2KLRA 1H19A 3HG2A 4NERA 1FZKA 2WXPA 4RZCB 4MCMA 5KVEE 2HT2C 4AYID 3DX3A 3MRJB 3BRFA 1R1CA 4NC0B 1NAMA 1OAQH 2WXOA 1WGVA 5H8DA 2SEBB 4YDKL 2DM7A 3GMOB 3AU0A 3QJVB 2DQIH 1IGTB 3QHFH 1UD8A 3K72A 3L3DA 1JOIA 4XX5A 1XCTA 4C58B 3UPRB 1L9QA 1K4CA 1P1VA 4PRIA 3W39A 1M2OA 5EORL 5D7SH 3I3BA 2ZXCA 3V5HA 1J48A 5FW6A 3V2AR 1JGDA 2KPNA 3CX5K 3KJ6H 5FUOL 5ESAB 4KVCL 4B5EA 2OYMA 4NQSB 4ZXBA 2BERA 3QPQC 3DXAD 5K9KA 2NLJB 2ZF9A 4A7SA 1PPIA 1RH8A 1JWUB 1K8DB 1H15B 2ZCKL 4F37F 2BPBA 4PREA 5F0MB 2EXYC 1TKWA 5ETUB 3ZTEA 2UY6A 1FC2D 3C09B 2K3TA 4LASH 4WI9A 4G9FB 1YDPA 1CLOH 1AO7E 1DDHA 3BPNC 4DERA 4WEUD 1CE6B 2WJ5A 1MW1A 2FE0A 4FQXD 2W92A 4WU7B 2VDQL 3WHXA 4J6IA 4YHYC 4IRSD 2XKNB 1IAKA 2BW5A 2ITDB 5K33A 2PWDA 2A73B 1KXHA 2D0FA 1G6RH 1PX8A 2PN5A 2XQ0A 3FOLB 2R1XA 2VQ1A 2XICA 4ADGA 4AMXA 1UH3A 3GSWB 2AC0A 3L9RB 1EUUA 5T1LD 2K4WA 1RULL 3MX0A 1YAZA 4O02H 4UIMA 4HKBB 5FYJU 4RSVA 2O61B 5D7IB 3X17A 1E9QA 4HT1L 1WISA 4JDVB 2IFGA 3CBJB 4KBPA 1MI5D 1NWOA 1QYGL 4ANWA 5B38A 1EEYB 4NENA 1TQBC 2BP3A 2GHZA 1WHOA 4C47A 4YSDA 3A21A 5CP3A 1OAZH 1EXUA 3VRLF 1X6LA 4BD4A 3FHEA 3WJJA 1QLEB 4AI7A 3FB5A 2XBDA 4BSWA 3ARXA 2GTQA 1D9KD 4JY4B 2J8HA 1N6QH 2YFOA 4OTXL 2HUEA 4FZEH 1ZT7A 4NN7B 4HC1A 1TR7A 1XCWA 1IM9B 3GPEA 5C0BB 1M7XA 5BVJA 2BRQA 5BV7C 1VEPA 4MKTA 4WUUD 4MLSA 2CPCA 5E8OA 5GZNA 4ETQA 3DHMA 4EDXA 5IOPB 4KGLA 3O11B 3CQPA 3D4YA 3HAEB 3D34A 3IU3A 3MREB 2F19H 3T1FA 1D5IL 3QFJE 4KHXL 3ZIMA 3VXTB 4QRBA 5D2NA 2ESVD 3TPKA 1URIA 2IWFA 1A6WL 2OL3L 4YXHL 2X28A 5IIEB 1ZT1B 1F8TH 4WO4C 3MRNB 5AENA 5CCKL 2OTUA 4JPVH 4PRIE 3UTZA 3WKYA 3PNWA 5I71C 1AH1A 1X7QB 1U8OB 1SN2A 2P8MB 3EJYC 1DCLA 2EO7A 1G7LB 4ZW3A 3N1PC 3HUJE 3HZVB 3MNWB 4NP9A 4U49A 1BOGA 4ZMWA 2W9DH 2G9KA 2QQKL 3R19A 4CMMA 3VXRE 4Y19B 4X5XA 5GXBB 5JOPE 2X4OA 3O3BB 4Q56A 3QIUA 2R29L 2BOBA 2V7NB 1I8LA 4P4KD 5FX3A 5DS1A 4E42A 2A74C 1R3HA 1I3UA 5I19L 4U1NA 2B1HL 1FFPB 3DYOA 1UASA 3AY2A 2EDEA 3BQVA 3OG6B 15C8L 2IAMB 1RK1A 4LU5L 4A1RA 3LPWA 5GRZA 4OZHA 4MNQA 3WNIA 4E5XA 1CDBA 4HKJA 1CVSC 4HS8L 1A7OL 1AMYA 4P2RD 1H3VA 5KTEH 1HQRA 4FQPA 1U3HB 1U41A 5D1QB 4KRPC 4K3JL 4ZDHB 5LN4A 1BZ7A 3FULA 3QUML 4GUPB 4MD0B 3QI9A 2W0PA 3V8OA 2WM0A 1NICA 3T2LA 2BX5A 5K9QI 4HIQA 3CDGA 1YG9A 5IW6A 3EBAA 3ERXA 1JPSL 2G60L 1KGIA 1CS6A 4P5MA 3VXRD 3U0WH 4L29B 2WIIB 4KJWD 2NY0C 2EZ0D 2OMYA 1AHWA 1TMCB 2A1WL 3MCYA 4BSVA 4DOHB 3DGGB 1Q9OA 3SKOA 3QIBB 2ZICA 2ZWNA 4RMWA 2UY7A 3RZCD 4EDXB 1NQBA 2A0LD 4FI6A 3MKGA 1SRDA 4P4KB 2RQEA 3FTGB 4RWYH 3RWJB 1RJLB 3CU7A 4GO9A 3CIQA 4PREB 4DUWA 4XMLL 3DSNB 3EJSA 3Q9QA 2X1XR 3NCYS 3BKMH 3W9EA 4ONOA 4NUPA 4D3CL 1A65A 4F9PA 1OP4A 2K6ZA 3LN4B 3L3OB 2FJFB 3U9PH 4HAKA 1ZA3B 4IKNA 1MHHB 5EIIA 5IMMA 2YZ1A 4U2YA 3UL4A 2NPLX 3FT3B 4XGZB 3FAXA 4HBCH 4KRMB 5KG9B 5KYUB 3NIDF 4Z7OB 4N6RA 5IUCA 3NA4A 3HI5L 1XGQA 1XVSA 4UQIM 5I5RA 5I15H 4WNQB 4LSUL 1F42A 4UUJA 2NY4C 1GH7A 3AQZA 4JZOB 1P7QD 2VXVL 3VMOA 3WJMB 4L4TA 4OLZL 5KBMA 4RRPA 2WXNA 2XVBA 1MCEA 5D7LA 2C9RA 2NNAB 4BELD 1DQKA 1ASOA 4BH7B 4PV8A 3VWJD 2Y6TE 4AH2A 2K3HA 1XD1A 3KPPA 2H8PB 2P49B 1SYVB 5JIQA 3PWPE 5HYEA 2DWDB 3WAKA 1NBCA 4PJAF 4Y16A 4BWWA 4RAUA 4AVJA 5J5EA 4OFQA 1V5JA 3UDWA 3PREA 3C6LA 3D85D 1CBVH 4R90H 1OGAD 4GJTB 1DQLL 1KB5A 3WFDL 3ZTDC 1VCAA 1SF5A 1N6QL 5A2JH 2VLRA 3FB6B 1BBJB 1NDMA 1FAIH 4NAMA 2PPCA 1TLKA 4XAKE 3WUWG 2VW6A 3Q43A 1IEBA 1PL3A 2I07A 3BD4A 4XNAA 3ZTNL 1FHGA 5GGSA 4LBEB 1OSEA 4DPCX 2V6HA 2CO7A 4HWEL 2W94A 3VG9B 4PBDA 2CXGA 3M17A 1O75A 3BGFB 2C7UB 1FRGL 3UPRA 5A43C 4YVNA 2NY7H 3SJVD 2OS7A 2F53B 4M1DH 4YGVA 2NUTA 5I1GL 1KCVL 2NZ9C 4NZTL 1NAMB 2V5MA 3DPBB 5CAYB 4XMVA 3X2QB 1A3ZA 4PRDA 4YC2C 1PQZB 1MNUL 5TE4H 1RURL 1QHOA 1NFAA 1BQSA 4XNUL 1JFHA 3WDJA 3S5LG 3K4AA 3G5XB 1L4IA 4U31A 3TO4B 2VZOA 4NS0A 2JWYA 1JI2A 1QSEB 2Y7QB 2X4RB 4ZFFA 3QIWD 2PCPB 2HX9A 2CWRA 1Q1JL 3BO8B 2HCZX 2WZPD 4FYRA 3UC2A 2QDVA 4H88H 4PIBA 4EPSA 5CLTA 3V0VB 3A47A 4APQD 3ESUF 2X89A 2R2EB 1WLHA 1BPLB 1GMEA 3MUGA 3D9AL 5FDWA 2APFA 1BW8A 1AP2A 5CJ8A 1RZJH 4XO9A 1PZAA 4PJCB 1VESA 3HPLB 1U42A 3E6HA 1EFXD 1U33A 3R06B 4JFOB 4YHZH 2R0WH 2RFXB 4BQBA 5J9PB 1JZ4A 2APTA 2ZUSA 3F7YB 3IN2A 4G83A 2AK4A 1YECL 1YUKB 2CLZA 3HG3A 3PGDA 4W93A 5IBUG 4L4TE 4UM8A 3EO0A 4ZO7A 1WGOA 5FK9B 4ZAKC 3C8HA 1WD9A 1BQLH 4RBPH 3RTLA 5JQ6L 2YN3A 4IOFC 3BZ5A 3T4AA 3N9GL 3BUQA 4DPBX 5AEAA 3K7UA 3M6DA 1LO5A 1P5UC 1RUQH 5HPMB 1ASQA 4ONFH 2F15A 3WMPA 2ZPKL 1HEJC 1B0RB 2PCYA 4Y5YC 3RX5A 3NJKA 4P2QA 1OGTA 4OZGA 1PW3A 1NC2B 3RIFK 4ZMOA 3PG2A 4MA3B 4XN2A 3UCRA 4LE8A 4QNPF 1YLBB 5GRVK 3IF1A 3HRZB 4F2EA 2AITA 3HG0A 5KTEL 2XLLA 3TESA 4F7MA 3DX7B 4OF0A 5A16A 4L0YA 1UOKA 3KPSE 4ZODA 4Z7NF 2VE6B 1P7BA 5T1MA 4I77L 1K8IB 3C5ZC 4LAQH 1ROCA 2B1OA 3KLKA 4Q6YA 3GMMA 5E03A 1B9KA 1K4DA 4PJ6A 3BEVA 5IMLA 2XQYA 1BFVH 2DLFL 3KD4A 5J6SA 1NJ9A 1ADQL 4L5FH 3WY2A 4U7SA 5KYWA 3GBMH 1BQUA 3KBFA 4MQTB 1EVUA 4QO1B 1IBHA 4GG8A 3MLRH