1HEJC

C-terminal xylan binding domain from cellulomonas fimi xylanase 11a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
TGSCSVSAVRGEEWADRFNVTYSVSGSSSWVVTLGLNGGQSVQSSWNAALTGSSGTVTARPNGSGNSFGVTFYKNGSSATPGATCATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENDO-1,4-BETA-XYLANASE D
publication title Evidence for Synergy between Family 2B Carbohydrate Binding Modules in Cellulomonas Fimi Xylanase 11A
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase(xylan degradation)
total genus 9
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hejC00
1C7TA 2RTTA 1HEJC 2CWRA 2CZNA 3NDZE 1HEHC 5DHDA 1QBBA 5DHEA 1QBAA 1E5CA 2XBDA 1EXHA 1C7SA 1E5BA 1XBDA 1EXGA 3NDYE
chains in the Genus database with same CATH superfamily
4HJSA 1AYRA 4L1HA 2CGYA 5A2KH 5CP7A 4G8FA 4BQ9A 4PJGB 1SLVA 1FL6B 4GXFA 1R5VB 1C16B 3ULUD 2F53D 5C2UB 3VNZA 4EOWL 1A3LL 3FHAA 3Q8CA 3AY4C 4L29B 3QEHA 3ARQA 1J0IA 3HUJA 5ABAA 3W2DH 3ZMNA 3WAKA 3BKCH 4XNZC 1A7NL 1IGTB 3CTTA 4OV6F 3BAEL 5JIMA 2XTSA 3B7TA 3C60C 4TLUA 4GP8B 1O6SB 3FT1A 5SWSA 4HGWB 5L0QC 1RULL 4AUJA 3WNNA 4EUPH 1BX2A 1F97A 1TEFA 2W0PA 3B7YA 2BVPA 4Z7UB 5CZXC 2I9TA 1OF0A 4RSYA 3CBKB 1UM6H 2R1YA 3HG1B 4H88H 4JM4L 3V0EA 4DKFL 5BCAA 1H0DA 5I2IB 3VM5A 3CU1A 4N86A 1J9RA 1CB4A 3CMOL 1KTLA 1TETL 2Q2EB 4P5MB 2G5UA 1OARL 3QZNA 3HAEH 3KL3A 3LIZH 5HGAA 35C8L 1UT1A 2ED6A 1YPZE 2ZCLL 4WUUB 3VFGH 1MZYA 1QI4A 2XPZA 1EQWA 2M8XA 3W37A 1CYXA 2YUWA 4Y4FD 3GSVB 4M6OH 4BIKA 4PJBE 1ZVHA 4TSAH 3QR1A 4E5XB 3W57A 2G30A 3IDUA 1LWRA 1RJZA 2GI7A 3SY0A 1MHCA 3ZDYF 4FZ8L 4GP5B 2VERN 2PYEA 4GW1B 2APFA 4JRLA 4Z7OF 5E03A 1BXXA 2P4AB 5KN5A 3Q48A 2GJ6B 3WSQL 5EBWB 1AXTL 5KYUB 2XPGB 4GQRA 1XSIA 2A9DA 3NP4A 2AI0H 2LTQB 3A4DA 1Y1UA 3LZFH 2NUTA 2F7PA 4CMMB 2MCPH 4MQXD 4KKLC 2F19H 4LZKA 1S9KC 2W65A 4JKLA 3WO4C 3FS9A 3PGFL 1ED3A 5E5RB 3SDDC 5KVDE 5ALCH 4G1EB 1S7RB 3AWEA 3GSXA 3O3UN 2HB0A 1AOHA 2FE0A 4P23B 1X5MA 1HL4A 1NGXB 1NKOA 2JB6B 3CFCL 4M7ZB 3T2LA 2DWTA 3VSVA 1PX3A 5E95B 5B21A 3ARXA 3QEQD 2BSCA 2B39A 2QQQA 2LW3A 1FH5L 1MIML 1J5HA 1CYWA 4JFPA 2CHWA 3O45A 4R7NB 3IFLH 3BIKB 4YDLB 1IAII 4Y19B 1C1EL 3UO1H 4HC1L 4N0UE 2FQFA 1XVSA 2X4OB 5FHAL 4JY4A 3KCPA 1A9EB 1W6WA 4ETYA 1NGPH 3G6JF 2X6MA 4HBCL 4ENED 1BG1A 3CE1A 4X4YA 4Y16D 4F7EA 3OPZL 4YSEA 5A1AA 5F2FA 4Y9GA 3WD5H 2O1AA 5EORH 3S96B 4HHAB 4FFZL 1NUDA 4Z3IA 5MHSE 3S9DB 1MCCA 1FN4A 3FULA 1ZA3B 2JLPA 4NWTH 4HCRA 4ZODA 2KI6A 4U31A 3WKPA 4BQ6A 5E6SB 4M3KB 5IW1A 5F7BA 1N6QH 1FG9C 4ZUVB 1CGSH 4LVNC 3W0WA 1SLXA 1U8CA 4U0RB 1B88A 3QYMA 1UOKA 4KQ0A 3IDGB 3P0GB 4ORGB 1H3WM 1KOAA 1TJXA 1M56B 4PJCE 4EVNA 5DJDB 3VFVA 1A1OB 3ZKMD 1SEBA 1XGTA 2BY3A 4PWJA 1BOGB 2EDLA 2R29H 2B3IA 4W9HC 2PO6B 4WO4D 5D2LF 5A16A 4G7SB 5IVXE 5IMLA 2BVQB 4H25B 1AO7A 3BAKA 1Y07A 3T0WA 4TUKL 3TN0A 3BKCL 5HPMA 4WDIA 1J9SA 4GH7B 3NCJL 4D7BA 4KUZL 3EADA 2W59A 4QRRB 3MYJB 1QTYT 1FDLL 2NR6A 3WMQA 1MCKA 4HOWA 1NCIA 1BQHG 1LYQA 1RIVH 2OPCA 3BP4A 4H88L 5CEYA 3FQNB 2EQDA 2ICWB 4J4PA 1SN2A 5GHWL 1QBBA 4TNFA 4NQUA 5DK0A 2I5YH 3M07A 1VADA 5FWRA 4F3FB 1DVXA 2AXGB 4MQ7B 4BDVA 2HVKA 5C6PB 4P2CG 3LIZL 2A74C 3T65A 3VMPA 5IB3B 2D2CC 3I3BA 3JV6B 4XNQA 3ZGHA 4Q97A 3VFGL 2XG5A 3NCWA 1T2XA 2HT4C 3SE9L 4BSWA 4EQ2A 1HE8A 1TPXC 3LZLA 3EYUL 3B5HA 4R6UA 1TZGH 4HK3N 2UY6A 2ZSVA 3GSQB 1B0RB 3QWNA 3F85A 3F6JA 3VQLA 2F68X 1DQTA 2KMWA 4JBSA 3CFUA 1P7KB 2AV7A 2E5EA 3D48R 3D69A 3ARGA 3GRWA 4I9WE 4N3UA 5FA4B 1MN4A 2BWQA 1AS6A 3LEXB 5JHDD 2D31B 2XFXB 4JPIB 4B9PA 4JE0A 4PJXE 1DJIA 4N9OB 2LU5A 4PUBH 2EH8L 4C4BA 2E47A 4GIOA 2QLYA 3OHXC 5FGSA 3CV5A 2ZAIA 2F19L 4B6ZA 1I4FB 1QLEH 2DH3A 5D1XB 2X4QB 1ASOA 2DWSA 4LDEB 1JHLH 4AEIL 4HUVA 3VD4A 1CFQA 4OD1H 3BSGA 3DRTA 3MJ8B 1MCBA 2YBRB 3OZ9H 3G5YA 2ITDB 4X9YA 5CSGA 3KBFA 5ALCL 2YIHA 1Q72H 1U95A 3BD5A 4LPXA 1L0QA 4AENB 1Z9NA 1FL3B 1VEOA 1ZVSB 2O5NA 4XMKL 2A73A 4ANKA 4TVSa 1JPGB 5IB5A 2YAHA 3D07A 3EJJX 3IFLL 1OT4A 1Z2KA 2GAZA 3DVFA 2IOIA 4KQ3L 1YYLH 2JTYA 4HG4K 2WNKA 1A9BA 5IQ9B 5J1SC 3PP3H 1GJUA 2OCCB 4PJ7E 3MLVL 5BUGA 8PAZA 1A47A 2VLJD 5AOLA 5K1NA 1KSRA 4U1GC 1NGPL 5C08A 1FYTD 4TLKA 1WICA 1Y18B 2AP2A 1NFDA 1L0YA 1SY6H 5EUKB 4XOAA 3NJGA 1IIKA 2DJSA 1CLCA 1LGVA 2Z1KA 4ZS6D 5B22A 4M48H 1IZKA 4XCEA 5FLUA 5DMIH 1MVFA 4GAJH 3CK0H 4K5PA 1MDTA 3AACA 4NWTL 4D8PB 4OZ4B 3ZL2A 2J72A 1NEPA 5C0BA 1CGSL 2XWTB 1COBA 1KJ3L 1U92A 1Z5LB 2XUWA 4QXWA 1PNDA 3STZB 1GYWA 3RFRA 3WFDH 5GZOA 4ICXA 5FM5M 2Y7QB 3D52A 3T3PF 1J1OH 1WZ1H 5CD3B 2Y7LA 2DI9A 1N3NB 3FT2B 1CXLA 2VUOA 3CFEA 2NQDA 4MJJA 1LEGB 3KHOA 5I8KH 4NQEE 4LEEA 4UTBH 2NZ9C 5E4IA 4F2ME 5EEVA 3JTSB 5C0AB 2QKIC 3GGWA 2I9LA 4NUGL 1QRNA 1PZDA 1WCQA 2YRZA 1N19A 3HZ3A 2ZYIA 2EXYD 2ZIDA 1ZPLA 2E27H 3CZUB 5I6XB 5C07E 2F7OA 2H3NB 3SDDB 5AW9B 1LHZA 3T1WA 4FNQA 2BNRB 4NNPH 3DX6B 4A2MA 2DQTH 5IHLB 4MKMA 5F93C 3IMVA 4X7SH 7CGTA 4ODHL 4L0PB 1HHKB 1RD6A 1WAPA 1RIVL 1OTTD 3EF7A 3ZUCA 5GGVH 2GBTA 1B3JA 3G6AB 3VXQB 4JQXC 2Q6WA 1JK9B 1YMHA 4DN3L 1XCTB 2I5YL 3D3VD 3G5VB 3HPJA 5D7LE 1CD9B 4KI5F 2WLHA 3MLPA 1F6AA 1MHPH 4HUXA 5F1IB 2XQYA 3S3BB 5JW4R 4CNIA 2JXMB 2YPVL 3C8KB 4OFDA 1BLIA 3WLBB 2BIMA 5SWQB 5KBLA 4FFVC 1BW8A 4UNVA 2XETA 2IH1B 3FOMA 5F7DA 1X5KA 3GSWB 4J3TA 1TZGL 1UD3A 1T21A 3CLFH 4A6YL 3K1KC 1HILB 1KXTB 3NYKA 4E9WA 2COQA 1SPDA 2DYSB 3DIVA 5FYKH 4PJAF 2K0RA 4PW4A 4UDUB 1DDTA 1NL0H 3FUJA 2MWCA 5ALBH 2UXTA 4PJ8A 4Q58C 4WI6A 2J6EH 3DVGA 2IH3B 1IM9B 3QR0A 2B1OA 5DFAA 3U79A 1Z3GH 1FWXA 4DP8X 1JN6A 4PUBL 4TTGA 4ZPTA 1QHPA 1BVZA 1R3IH 2MPVA 2WM0A 5CILH 2IOMA 3TPUA 1X7QB 5DD6A 5GS1B 2EDOA 1JHLL 3ABMB 3E2HB 4XOBA 3O3BA 4FQHA 1GSMA 5FW8A 5KYXA 5KUMA 4NS0A 4OLWL 5D1ZD 2ZWYA 3G9VA 1G1CA 5K39A 5J9PB 3KWWA 1AG0A 3POCA 4IYKA 4ZXBB 2E86A 3S5LA 5H4YA 2CO6B 4FF9A 3V6ZA 1SDDB 3W81A 4UU9B 1RUAL 3B5GA 3CZSA 4Z95H 2CO3A 2X7LB 3HE6C 4FQXD 4MJIA 3SQBB 1Q0XH 4ZTPL 3IE9A 3MOBL 4MQSB 2X41A 2VXSL 5FK9A 4LF3A 3VXME 3Q8FA 2Y07H 1SBSH 2H8PB 1YNTB 3S98A 4FYSA 1OW0C 4MYPA 4P9HH 5E6YA 4PJ5A 1YG9A 4D0BB 4H20L 4P05A 3E6HA 2P8MA 3GXFA 1PNCA 1FP5A 4PYHA 3S36X 1M05A 4GIPD 3FF8A 4XPBL 3F5WA 4HFWB 4JRWA 4K9JA 1ZV2A 3CZFB 3L1OH 3RWJB 3KPMA 5FEBA 4MCZB 1O0VA 1SY6L 4Y4HD 1ONQB 1O6VA 2R2EB 3I9GH 3TBVB 2EDFA 4NFCA 2RGSA 1CXIA 1MI5D 1PMYA 4RGOL 2R1WA 3Q8AA 1A6PA 4M48L 4MB1A 1MJ7H 3MC0A 4TUJA 4GAJL 4ZMZA 5F0PB 1HCZA 3RY5A 1X5GA 2E7CA 3WKQA 5EPMB 4F2EA 1MSPA 5HI5D 3ENEA 4I5BA 4LPWA 4L0ZA 1LXMA 3WIIH 2YRPA 3E1ZA 5DSCA 3S5YA 1WWCA 1JYXA 2WLLB 5T5FA 4P9HC 1RZQA 4HZAA 2BNQE 3H0TB 4X8JB 3Q6FA 3T3MB 5J57B 1NIBA 3BMVA 4HG4J 2WWMD 4PFEA 3KPSA 5E8PB 4JLRB 4PJ9C 4WV1A 5I8KL 1IBGL 1Z0MA 1FUNA 4FABH 4K5LA 4R5VA 4I0PD 2K1MA 1BQUA 4HSAC 1XR8B 3MCLL 2X89D 2OX5A 3QJVB 1YY9C 3U7AA 1ECYA 3HS0C 5HYJB 4ZJ9A 3UC0L 2F15A 2ADGA 3TTYA 2DQTL 1IU1A 3QDHA 4UNIA 3T71A 4ZMPA 1N4XH 1HZLA 3GO1H 5IBUG 3VGDA 1IT9L 3REVB 2QMKA 1X5AA 3K6OA 3U4EA 5GGVL 1JXKA 1BHGA 4AK2A 5HGHB 4A6YB 1TTAA 5IGXH 4MSWA 2CBTA 4LDOB 3HKFA 2HFEB 3N9GH 4PRHA 9PCYA 5DJ0B 1RUPL 2VN3A 4HPOH 5GRVK 4RWYH 3SDAB 5H35B 2F08A 2A9NH 4L4TE 3NOIA 2XOTA 2CKNA 1SOSA 3MBEA 1KB5H 5IHUH 3CDZB 4ZI8A 1AHKA 4QRUA 1JZHA 2WWKT 3MCKA 5FYJH 4MA1C 4TVPE 1Z1WA 2B08A 4A7GF 3CLFL 2MTAA 1I1FA 2NYYD 1MLBB 3OKNA 5EUOE 3BGMB 2K7QA 1NL0L 5ALBL 4Z7OB 4Z7IA 5J6HB 3L4CA 3L7EA 3MFFB 3IRPX 4I9XA 1MJJB 2BY0A 1SMOA 2KLRA 3P4NA 2AK4A 15C8H 3P0VH 3QUHA 3H4FA 1R3IL 3FQWA 4BXSV 2OXGB 2A6IA 3L2NA 2Z0BA 5CILL 5EOTA 4OFKA 4NFDA 2ED8A 1V54B 1VERA 3VGBA 2WAHA 4YIQA 4GG6A 4L4JA 2D0GA 1UEMA 5FKAA 4BA0A 3NSJA 1YLBB 2CJTA 2RB8A 4AQAA 1IBZA 2YMOA 3KD4A 2VRQA 4EIUA 3QUMA 4TTDD 4Z95L 4QR7A 2VDRB 1LEIA 1F6LL 4JO1L 2QKIB 1URIA 4OLZH 3WKNA 1T1YA 3MV7E 1Q0XL 2Z93A 2GCYA 3LN5B 3N2JA 3SO3B 3FRUA 3RL1B 4FQ1H 4LHJB 2ATAA 3GXUB 3I9IA 4UZSA 4P9HL 2A6JA 3GI8L 4N90E 4L8SA 5ID0A 1RH8A 3PWLB 2W8CA 2DYRB 2H2PD 5L2JA 2YN5A 3NRQA 1AGFB 2FTAA 3MRGA 3ARTA 2BCKB 2NY7L 5EO1B 1URLA 2GY5A 4O2FA 3M8OH 4PIBA 4X98A 4YSCA 2NX5E 2CK2A 5K9OB 3I9GL 2VW6A 1X4ZA 3VACA 4XP1H 2YLKA 2ITFA 1EANA 2J7LA 3DXAB 3MV8D 4MD4A 2FL5B 5EN2B 5FKPB 4KKPA 5CCHE 3WNJA 3U7WL 3WN6A 1HOEA 3FOLA 3EHBB 2XA3A 4FRWA 1KCUH 4MXVF 1KULA 1IAKB 1KY6A 3IJSA 4I1RA 4P06A 4QXTA 2VISB 5AW7B 3ZX1A 4YEFA 3WUWA 3O9WB 3QC5X 4ONHA 3WIIL 4H26B 2Q87A 3VB9A 2AJSH 1NUFA 2YS4A 4WY7H 2EZ0C 4QAWA 5TF1L 2X9WA 5CAYB 2YUXA 1JI2A 1NGWB 3GPSA 4PAZA 3H3PH 2W60A 4TLTA 5I1IH 5EEYA 4BRVA 2V17L 4QHUA 3D39B 1MFVA 2GJPA 3MLXH 5KS9F 2EIEA 2ZOUA 3MUZ1 5GGQH 5HHNA 2BIPA 1EEZB 5IW3A 3ZYZA 1BFOB 2ZTBA 5ICYB 1IBFA 3DWTA 3T4AC 4ZS7L 3RU8H 3W9DB 1M4KA 4HLJA 2Y2YA 1USZA 4YE4H 5KSBF 3P77B 1FORH 2NXYB 1N4XL 1P1ZB 1KBGH 3GQFA 4UV4H 2XWJB 4W9DC 2ZT9C 1Q9LB 3NEOA 3SDXF 4NRZA 3N9GL 2QSTA 3APMA 3WI9A 1TEGA 2ATKB 4HPOL 3VD0A 2P47B 5LJYH 5T1LD 4RA3A 3PXHA 3H9YA 2A9NL 4JRYD 1UWEH 5KBMA 2QGDA 1RK0A 43CAB 1UASA 3RGVD 1QWUA 3P4MB 5IHUL 4Z7NF 1P5VB 4BGLA 5C0GB 1TVHB 5FYJL 3OKKA 5ABDE 3T8VA 1BIIA 4W9EC 5HHXL 3A6CL 2NY3D 1FLTX 1IM3D 3DMMD 3L3JB 4JFTA 5FFLA 4N0RA 5DMKB 4DOHE 1VLXA 2FLBT 2WNWA 3UPAA 4TSBH 4JPKL 1T20B 4H8HA 4KDWA 1T83A 5CEXA 1DANT 4PGCA 2TSBA 1UD4A 15C8L 2WLIA 3P0VL 4IOIA 4LNRA 4X6FA 1G7JA 2VDNB 4F92B 1U30A 3TZVA 2JJTA 1PKOA 4L3FA 4OCWH 1KJMA 3L5IA 4HCFA 4UINL 4GT7A 3QISA 4R7DB 3ZTJH 2CNZA 4Y9FA 1OGTB 4BQCA 2OR8A 3I6SA 2ZP8A 1V55B 5HVHB 2VLRD 4NZFA 3CFKB 4WI8A 4OZIA 4PJ9B 1CDUA 5DRXA 4U6YA 4EF3A 5DD5L 1DE4A 1AQDB 4JKWA 4M8QB 4X99A 1IAIH 5BVJB 3MOAH 4WU7A 1ASQA 2FIKA 1DUZB 4G8EA 3HS0B 3HKZA 3B6SA 3N0PB 4ICWA 4FADA 2YRBA 4GY4A 5T3XH 2FT6A 2IAMD 3KXFA 3HNTL 2B59A 5F7EL 4OVVA 4G6AD 4A7QA 2Y6TE 3OKOA 2FX7H 4JPQA 1R5IA 4RDQG 4EEEA 5FUCC 2X70B 1PAMA 1FFTB 5F71A 1AD9B 3M8OL 5I0DA 3ZOAA 4L3CB 2N1KA 4JFYB 2FO4A 1IILE 4JANB 3F84A 4XP1L 1VGKB 5INDB 3LD8C 4JO4H 4WHTB 5B4MC 1GS7A 4AMKH 2AJZB 2KPWA 1KCUL 3FTSA 3BP7B 1YYCA 2BZCA 1U6AL 4AV4A 2BWDA 3NQIA 2OMUB 5LWYH 4XAKD 3T77B 1J0YA 1U8MA 1MEXH 3B1UA 3UTSE 3QFDB 4WY7L 5AB1A 3GTVA 1BJMA 4Q8BA 3GMMA 4BEIA 1XB8A 4M6MH 2VLKE 4GSUA 4LPVA 5D5MA 5HYQB 3VXUA 3A67H 4K7PH 3TIDB 2ZX8A 3H3PL 1GS8A 3UTPE 1HDMA 2XTJC 3BWAB 4K15A 4P46D 3RY6A 5E7BA 3UL4A 5I1IL 1X6LA 4PWKA 4JVUA 5CU5A 4ZPVA 1I7ZB 3TIEA 5LKNA 4ZUUB 4JFHD 1JXDA 2QV2A 1JGEA 1AZBA 1LQBC 3JSSA 4WTWA 2TRHA 2WPGA 3CX5J 4HX1A 4RMQA 4RA0C 3RU8L 4AXWB 1QTSA 3WIHA 4YE4L 4S0SD 1B2WL 5SX4H 3V0VA 3LXCA 1FORL 4YDKH 4BUHA 4OUUB 2XBZA 5E08H 1KBGL 1IEAB 4KMLB 2EDNA 3TO4D 4ZSOB 4KNTA 2JTDA 3QXWA 1T1WA 5DO8A 1EHNA 2C9VA 1TLKA 3V0FA 3U6RB 3QIBD 3TYGL 5GS3A 1CE6A 3CFDA 1INQA 1TQVA 5C07D 5SX5H 3MRKA 1GYUA 1VFBB 3II2A 2G3ZA 4LSTL 2GUOA 1SJHB 4HSQA 1UWEL 3DK0A 1T03H 3GDBA 2BMKB 1FVEB 1XL4A 4DUWA 3FZUD 2PXYD 2G9HB 3NG5A 1JZ2A 5B1JA 4JE4B 1CFNA 1TCMA 2BHFA 3M7OA 4R97C 2X1OA 2WWNA 4C83B 5ANME 5D7LD 5I23A 1MH5B 4BXVA 3P11H 4FQJL 1JNHB 2DQIH 4UWQB 3TBSA 2AFNA 4X6DB 4QDGA 4TSBL 5D1QE 4MAYB 3CPLB 3GJFB 4YXKL 4U1JB 3RJDA 1OTSD 4D0DA 3EOTL 4F91B 4UT9A 5I1GL 3QA3A 1AIFA 1QI3A 2OQJB 4DHLA 3S3DB 4Y0GA 3HN8A 1O9ZA 5MP6H 3IVKB 3ZT6A 5PAZA 3VGHA 5C0EB 3QWQB 2DWDA 4HUWA 1O5PA 5F6HI 1F2QA 3L8QA 2ZE0A 2Q7YA 2WVVB 3T8XA 3U9UB 4A63A 1NMBL 1N8ZA 2CLRB 2H32A 4NQDD 4NPKA 5DZVA 4J3OH 4WJKB 3L1EA 4FHBD 2HRLA 4M4RA 3NK4A 3ZO0A 4OKVB 2QPSA 1QHQA 1HNYA 4ZFQA 3BZEA 3T6QC 1IAIL 3LHPL 3MOAL 3T4AB 1B4JH 5I18H 3WYRA 3RKDC 5HDLA 1XH3A 4IMLB 5DFVD 4KY1H 4HZLA 4NC2B 4LOUC 1I7UA 4S1RL 3L4ZA 4U1NB 1E8ZA 2FX7L 1MFBH 4W9ZA 4XN8A 5DJYA 4ZD3L 2NY4C 1F0LA 1KIRA 1L0XA 1IGCH 3ZKQD 1TZ8A 3ULVE 4YDJA 3Q1SH 4U1HB 4Z77B 3BP5B 4F8PA 4V1DE 1E4XL 2ARWA 1WA0X 5CR1A 4ZNEE 3QEUA 4P5TC 1CICB 2WKLA 4UIMA 3LDBB 1DJSA 1RFDL 3B9KD 4JO4L 4F7KA 3SKMA 4LESA 4J4PC 1YEJH 5F3BA 3ZKSD 3GEWB 2VDOB 1RXLA 5ABZA 1F3DH 3O8XB 5LWYL 2JCCA 4BFRA 1NGQH 3P9MB 4P2OD 2ZX9A 3C8DA 2WSDA 3AU0A 4KFZC 5C09B 1YUHA 4HWZA 12E8H 1HHHA 5BUAA 3VFOB 1CE1H 3GKWL 1P2CB 2I7SA 3A67L 4K7PL 4NEHB 1NCCH 3T2NH 1VKXA 1NAMH 4MNGE 1H5BA 3PFQA 3CHRA 2EVJA 3JWNG 4X7TA 3IWUA 3TJEL 4AJ0A 1D6VH 1P4LB 2YXFA 2VTFA 3FFOA 2CBOA 3QJXA 1R9FA 1AY1H 5HGGS 1SDAB 43C9A 1ITCA 3L3HB 3M88A 1A8ZA 1Y7VA 4LVOC 3BQVA 4NM4H 4C59B 4Z7QE 2P24A 4PJEE 4Z7VE 1TQUA 3TBYA 5AL0A 4YDKL 1F4AA 4YLQT 3BAIA 1G5GA 3DGGB 1KXQE 5E08L 2BDNH 3ARBD 4U1MA 2HA1A 5BZWA 1UH3A 1GKEA 4IBUA 5EH1A 3ALPA 5EIIG 5EZIH 3FCBA 1AS7A 5CP7B 4G8FB 4D2NA 5DHMC 5EG6C 3QCVH 3NIGF 1UH2A 2WLMA 4BE6A 3QEHB 4HCRL 1C7TA 3WHE1 3P54A 1T03L 2W0FA 1G9NC 4Y5YB 5DR5H 1NOFA 3I50H 4R7XA 1GR7A 1F4WL 2J6WA 2WVUA 5D2NE 1MIEL 3DSNA 1Q38A 2HWZL 4ODUA 3WGVB 5KJRH 4S2SA 2K70A 4LFHD 1GW0A 2Y1ZA 5SWSB 1I8MB 1DHKA 2A83A 2OZ4A 3BPLB 3P11L 2I9TB 2BVPB 3P30H 3LD8B 2R1YB 3PE9A 4L4TD 4ELMF 1R24A 5DTFA 1TU2B 1L6PA 4ONOA 1PLGH 3ASWA 1KTLB 4WU5A 4Y4FA 3E7JA 4TVPD 4PI2A 1MRFH 3L2MA 5HGAB 3W56A 1JTPA 2XWEA 5MP6L 4XTRD 2DQJH 5HYSA 4X0KA 3ARDC 3TVMD 3IPEA 2OYKA 2X4NA 3GJEA 4WFFE 3MHZA 5FGRA 5H2BB 3VWKD 3GEFA 2WZAA 2WZ6A 2XTJB 5CIPH 1RJZB 2K45A 4OGAD 5GZOC 3VB8A 4P3DA 2MCMA 3EUDA 3BRFA 1ZWIA 4GKOA 4CDGC 2FGWL 1YN7A 5I18L 2XX1A 3LN4A 2ZUTA 1OCWH 1UZ6F 3QQ4B 4QT5A 4EI0A 1LE9A 1RK7A 3QJTB 2NUTB 1MQ8A 4KY1L 1HZKA 4AVJA 4PJDF 2WNGA 1AD0A 1MFBL 3NCEB 4B9YA 1NCAH 2JV6A 4KV5E 4QRAA 3GUTB 1IGCL 1PLBA 3QEQA 2OMBA 3MV7D 4MNQE 2DTSA 5F88B 1P7HL 3GRWL 1O7DE 5EEZA 1MUJA 1X4XA 4TULL 1EUUA 4NO0D 3H2PA 2NDFA 4CGTA 3RWCA 1CLZL 4A1RA 1B90A 4N90D 1NCJA 1E28A 2QT6A 4PD4J 4KFMA 2J2ZA 4HT1L 4JFPB 3O45B 4EIGB 1NFAA 3U9WA 4JN2A 5DGQA 3F7VA 1SEQH 4WEEA 5H37A 4P2QB 4P5KA 5AB9A 4HS3A 4Y16A 2NX5D 4CW1B 12E8L 1KN2H 1CE1L 1PZ5B 4JY4B 5B39B 4OGXH 4NBXB 2FGZA 4KMQA 1NCCL 3HIZA 4X4YB 4JHVA 1AMXA 4NHCH 5BZDB 2AMUA 4FG6C 3GRGA 1OY3B 1G9NL 5A7BA 3PHAA 4MJHA 1N2RA 4PJ8C 4MMXB 4OCLC 4XOEA 2GUYA 4HCGA 1ZLVK 1EVUA 1LNUA 3LSOA 1W15A 3GXTA 5IW1B 1UCBH 4ZMXA 3GLAA 2OV0A 1IJNA 5JIIA 3W0WB 5HGDA 3PHOA 1ZHKB 4WO4A 1XIWD 3TA3D 3RGHA 3SDCD 4KKAD 4L9DA 5IW6A 2UZXB 4NFBA 4LK4A 1E27A 5AW1B 3WXVL 2H26B 1ACZA 3QCVL 4CC0A 3NIFE 4QO1A 2Y69B 3VFVB 1ZV9A 2P7TA 1SEBB 4FNTA 4KNUA 2FYVA 4NYLA 4BUQA 5GRUH 4XBEH 3DX7A 3ZDXB 3NZ8A 5IMLB 3TJHD 5A43C 1IBYA 1AO7B 2PCPA 3TN0B 1T1ZA 1JGLL 2HT2C 3I50L 4WDIB 1K2DA 3BCFA 3NA9H 5E24E 2H45A 4R96B 2NY4B 2L0DA 3B2PA 4Z1PA 5CCJA 2OMZA 4UTCA 4MDIA 3KLSA 5I75C 1UA7A 1II4E 5FW7A 3AUVA 3BP4B 5EWIH 5CEYB 4Z3TA 3SBQA 3GXMA 5JW3H 3DTDA 3E3QE 3PPEA 2YD5A 3QDJE 1VADB 1PLGL 4B9IA 4J8RA 3QORD 4FA7B 4BDVB 4GRWE 1P7QD 3SGJA 2XZQL 3CBRA 3T65B 3O2WH 4XNQB 2DQJL 5EOQL 2XG5B 1XH0A 2BINA 4GMTH 4NKQB 3WUZA 4PLNC 3W38A 2EUVA 4GEIA 4BSWB 1R0AL 1KJ2A 4KZEH 5JHDA 2YD3A 3C5ZB 2EDEA 2Y06H 1FGVH 1UT9A 1AQKH 2H4EA 2UY6B 4TL5A 2ZSVB 3ARFD 2BCMA 2OL3H 4F7CB 2DLEA 5KSVA 3SOBH 4BZ1A 4MX7A 4IK6A 2AV7B 1FRGL 3DV6B 2XLLA 3ARGB 5BXFA 3B8SA 3KWVA 4OM0H 4GJTB 5LO7A 3WIHH 4XMWA 3OQ3B 4B3VA 2X40A 3WTWA 3KPTA 4WV1C 5DD1L 3KZ8A 1K9TA 4Q6IA 3WNMA 1DJYA 4WLCA 5F9JA 4KK8C 1KLGA 4NQSB 5GGVY 4EI5D 2A1WH 3EJRA 1W0WB 3VD3A 2R0LH 3VH8A 4HUVB 3AQDA 1CFQB 4YEEA 1NCAL 3AS3A 4J2QA 1SQMA 1EJ6A 2EUXA 4JRXE 4ZZFA 4ABQA 4XN9A 1U95B 5JOPE 1GY2A 4HUCA 4YNYA 4Q89A 2VO5A 2EYSA 3H6AA 2BWIA 3KYKH 4Z0XB 5DHVB 4Y9EA 2YO3A 5DQ9A 4X4ME 4ALAC 2A73B 4E42A 3P9LA 5E8DL 4QWWC 1DL7L 4U6XB 4WFGE 3N44F 5I5JA 4YX2L 3GIZL 5IB5B 3NZHH 1EA9C 4J12A 5HVGB 1AGCA 1I85A 3THMH 2VLJA 1A3QA 2HKFL 2GAZB 1SEQL 3VRIA 1FYTA 3U1SL 3NJJA 2VAAA 1Q1JH 1BD2B 1A9BB 3RWEB 1LMIA 2ZKWA 2BOBA 3MXWL 3REWA 4YHYC 3AGVA 1JYNA 5A3ID 3PWPE 1KLUB 2H7WA 4OGXL 3MRJA 1U8LA 5C08B 5DJ2A 4HLEA 2B1AL 1JSYA 4PV8B 4Y1AD 2E9BA 4JM2D 1J5DA 1WT5A 3ZZQA 3FONB 2EINB 3AXIA 4KHXH 1VPOH 3Q7JA 2E0PA 4S1QL 4DO6A 3WEOA 2QVKA 2DLFL 3RB5A 2ADJA 2VLKD 4JG0H 3RVXD 1QLFA 4WCYL 4XMLH 1UCBL 4AGNA 3HC3H 4PV9B 4B3EA 2WQRA 4X83A 3UTPD 1W0YT 1I3RA 1U92B 3QDGE 4B53A 5IR1A 1IGYA 1J8HE 1F18A 1A4KA 5JHLH 2IDFA 3MRRA 2Z0UA 3TBWA 3L7FA 4KY2A 4F9PA 5AW2B 4NX0A 4BFBD 1JPEA 4KVPA 5HHOB 3CFEB 2BIQA 1ZMYA 2IADA 3TF7C 2QKSA 4XBEL 5GRUL 2IC2A 3CFJA 3ET9F 4H1LA 3MRCA 4HJGA 4PJIA 3T0BA 3V7MA 5KZCB 1OO2A 2I69A 5I1DA 3GGWB 1AC6A 2I9LB 2KPNA 5HJGA 3EJCA 4R0LB 2WZPD 2VUKA 1HIMH 3NA9L 5KBPA 4LAJH 2EEDA 4ZUSB 3X14A 2FX9H 4A66A 4WSJA 3PABA 4DGIH 2BS71 3OL2A 3VFTA 1N26A 4L8SC 2ERJC 3EXLA 1HOCB 2LQRA 5TK4A 3D3VA 5H94A 4PTUA 1X6NA 1Y1DA 2WQVA 4YSAA 2CAKA 5KBKA 2EDYA 2B8OT 3FQXB 3SE3A 5JW3L 3KM2A 2Q6WB 2YR3A 2DBLL 2H5UA 3HPJB 1AS8A 4HW6A 4XVJH 4BV1A 1XGQA 4F15B 4AJYV 3V4VA 4ACTA 2X3BA 1BCIA 3IJ9A 1IKNA 1T6VN 2G0LA 3ALXA 4HUXB 4IS6A 3BLKA 4CNIB 1R4XA 3KGTA 4ZO8A 4GMTL 5D72H 1JZFA 1V8HA 3ZDZF 3WTUA 4HXBH 5LN8A 3L3GA 4PP1D 3QIWC 1EBPA 3QGVA 1BF2A 3VO0A 5M95B 5F7DB 2G60H 3MLUH 1QFWI 2X2JA 2Y06L 1FGVL 1T21B 4BZ2H 2CMRH 4NO3A 4D9QE 2OL3L 4PHZA 1BF8A 5LGHL 3ZIYA 1BAFH 5DA0B 1UACL 2KS0A 2XDHA 2BVOA 4PJ8B 5LQBH 4Y2OA 4BELD 4B9ZA 3DVGB 1JGUH 3D1MC 3QUGA 4NNXA 3BX7C 2WKGA 1XTLA 3KS0H 4XRCA 2Z31A 5D1ZA 4ZPTB 4AITA 1CZ8H 2RCSH 5IJDC 3OGCB 4L4VE 2D9CA 1MFMA 2R0LL 2VRKA 3HA0A 4KRPC 4KK9D 3O3BB 3X1EA 5KYXB 1ZTXL 3L9RB 1E5BA 3CDCA 3KHQA 3P9WB 4FXGA 4FQXA 4LLAA 1N18A 2ICWJ 2OP4L 3S5LB 1GH7A 3QWRA 3TPKA 3KPQB 3V6ZB 4CSTA 3IJ7A 4GAGH 1EPFA 4KTEH 1W72H 3SPVA 5EF3A 4MJIB 5E8NA 3K2UH 5AZ2H 4K55A 4XCFH 1T1XA 3THML 1HQ4A 3ULVD 2WBJD 2A77H 3UPRA 3CFQA 4PJ5B 4QY8B 4JO8A 4V1DD 4S0HA 4K0OA 3ZE1F 4Y4HA 3TASA 2P8MB 4NNYA 5I75B 4ODWA 4X7CC 5E70A 1MI5A 5IB2A 3ZDYE 3ZKND 4LVHC 3F5WB 1DJWA 3QUML 2BHZA 3GD1C 1XT5A 4I3RH 4D9RE 1D5XA 1G0DA 1KEML 3QPKA 1BVLB 4YSUA 4KHXL 2VO8A 3DHMA 4V2CB 1FVDB 5JUEH 1VPOL 4EDWH 2R1WB 4IBVA 3V9FA 1ICTA 4TUJB 4TV3A 1HSBA 1MJUL 1BXUA 3TFKC 3DI3B 1KJVA 2ZP0T 4W68A 3HB3C 4A04A 1ZEAH 5IQNA 3IFNH 5JYLA 4XMLL 3HZMA 3HC3L 2WYIA 3TZVC 2GJ6D 2JJTC 3PGCB 2B4CC 1Z9OA 4I5BB 4HETA 5DSCB 4NRYA 1KCKA 5CFHA 3VDCA 3WJLA 3VXRA 1BVNP 4NLHA 1G9MC 1KXHA 3Q6FB 4I0PA 1UVQA 2X89A 2FCBA 2CUMA 1VJSA 4JG5A 3KPSB 3QZWA 3OAZK 4OZFG 4WV1B 4OFQA 5GJTL 2XKSA 2LT9A 3BYTA 1ZS2A 4KK6C 5FYLH 5DJXA 3NSYA 4XMPL 3RI5K 1B4LA 4U7KA 1EFXA 4P23D 5LBSA 3T4YA 4GLRI 3VXOA 3D9AH 5KW9L 1JVKA 2FX9L 4DGIL 2FBOJ 4MCMA 5HDQH 1WSST 3TJPA 2ADGB 2G3XA 4ZG1A 6TAAA 3G6JE 2XWRA 3ECQA 32C2B 3GZOA 4BQ8A 3EDDA 2J57A 1OSEA 1KGJA 1E2WA 1Q0EA 4IRZA 2WY3B 1LO3L 3O41A 1OGPA 2ZP9A 4ELMB 1MCOH 1J0HA 4ODSH 3DXAE 4LSUH 4PRHB 3BH4A 3U2JA 4K71B 1YQ2A 2VXTH 4XVJL 3ROOA 1JZIA 4PRBA 1IBBA 1T5XA 3FU7B 4EZLA 4WVRA 1CVRA 3QDAA 3O11A 4JHZA 3OJMB 1QKZH 1RY7B 1CCZA 4NRXA 3MBEB 1PSKL 4AYFB 1NDMB 5MEOA 1CTMA 1OALA 2FATH 3ESVF 3FCTB 1HHIA 2G60L 3MLUL 2W07B 5EZLB 1YPZA 2PPCA 1KPUA 1IEHA 2EDWA 2CMRL 2OMYA 2RQEA 1ZXQA 3TCLA 1B0GA 2X6CA 5CSZA 1I1FB 4YSOA 3SGKA 5I1JL 1TUPA 3CU7A 3Q06A 3AREB 3LRGA 3HG5A 4PJBA 4LLQA 5D2LE 4PWIA 4YDVA 1JGUL 2MQGA 3OLEA 3F58H 2R9HC 3RY6C 3P4NB 2Q0ZX 2A7BA 4YBLC 1FZJA 2AK4B 2WKOA 3FQWB 3K71A 1MCNA 3FRPG 3C08H 4TOYH 2GB2A 5AWNL 2WAQA 4JPVH 2O5ZH 2N4IA 4WQOA 4YIQB 3RVTD 2R69H 3TS8A 3WHXA 1Z66A 3DO3A 5DD3H 4YL4A 5FS5A 5FKAB 2EUZA 4AQAB 5E2JA 3HHRB 3KVQA 2PYFA 2ARJA 4POUB 1E3ZA 3BC9A 3ECUA 3QUMB 3H6JA 5CINH 5JLZA 2R4SL 4RMVA 4GAGL 3VXPA 4KTEL 3LB6D 4R4NC 4CU7A 1W72L 4QRRD 2NNRA 4U1IB 3LXAA 2Z93B 3K2UL 2ZWZA 5AZ2L 2GCYB 4UI2A 5B3NA 4N2HA 3VFSA 3ARSA 3FRUB 5E2UH 5KANI 4FNSA 3RNKA 2A77L 2ZNWA 1IL1A 3A4EA 4R5TA 2A6JB 3FT0A 1L9RA 3QUYD 4O9HL 4L8SB 2QSCL 2ERJB 1G9ML 2AERT 5HPOA 3PLYA 5HI4D 1OE1A 3ZPDA 1ACXA 3EYSH 3HBPA 1P4IH 4Q2ZB 3MV8A 1THAA 3DPBA 3SODB 4O2FB 4N0UA 2AQQA 4I3RL 4TYUA 3HOGA 1XZ0A 1DVFD 1MJ8H 5EULV 3EO0B 3WNIA 2OJZL 4QLWA 4EDWL 2MNJB 1AGBA 3U6XS 4BFGA 5I1EH 1A1NA 3RURA 1XTMA 1I3GL 4Q14A 3FOLB 5DK3A 1ZEAL 2N7SA 1DJGA 1C5DB 3IJSB 2A9ML 4CKVX 3BP6B 4WI0B 3WUWB 5CZKA 5C9KA 4MHHG 2GY7B 2V8LA 3VI4F 4IBLT 5EU3A 3EBAA 3AQYA 2B0SH 1NFIA 5F3FA 2YQ2A 1BQLH 4LQFL 2W60B 3MI6A 1QPKA 4QHUB 3FQ1A 5D7EA 1QPPA 2NY5C 5T33L 3N04A 4G6JH 1WHPA 1CC3A 4PJCA 5HHNB 4ZFOA 1KT2B 3ULSA 2V9TA 4PS4H 3ZHFA 3NGBC 3NUKA 4FJZA 3WLWD 1PG7H 5IVXA 2B20A 5AZEL 5KYWA 1JXJA 1LO2H 3NRPA 4W4OC 1R19A 2X53A 2K4AA 3T0VA 5ESVB 2DMKA 4CBPA 4GSRA 1P6AB 2MFNA 3WS3B 4JVPA 5T1LA 2PNDA 1A1MB 3H7LA 4JRYA 3GNMH 2AEIT 2XN9E 4LSUL 3RGVA 2P28B 3UGXA 2UWEF 5ADOL 3KWTA 2CUHA 3H7BB 5CEZD 1CTOA 2CK0H 1NJ9A 2RA1A 4K7PY 5LAPA 1QKZL 1QO3B 2KC0A 3UZQA 1IM3A 1CFVH 3DMMA 3O6LH 1ZSDB 4P99A 4K3HA 4PREA 3ULUH 2LLLA 4QHKJ 4PCKA 2FATL 3T3PE 1YEKH 5B38G 4RMBA 4L5FH 3VG9C 5DLMH 2IF7A 3VG0H 3OLGA 3QDJD 4JR9H 4NC1E 2Q5BA 3MFGB 3FQUA 1F3JB 1GMIA 3VQ1C 3QXTA 3FQRA 4YHLH 3IGLA 1OAZH 4HS8H 1XFPA 3F58L 1H5BC 3KYNA 4PGCB 4TQHA 2B16A 3OAUL 4XBPA 2OMVA 2WLIB 4X6FB 3KPLA 2EKJA 3UGEA 4UQ9A 5ACZA 3L3IA 3TZVB 5ILTH 4TOYL 3G08A 1G6RA 4PJXA 2VLRA 5C6WH 1HYSD 4JPVL 2O5ZL 4GS7C 2R69L 3HFFA 5DD3L 1NKGA 3MRHB 5C0AD 1QABA 3ULUC 4CN1A 1P4UA 2BRQA 2XXCB 1T80A 4LLDA 4OZIB 4LMQE 2QADD 5IHBA 4YL9A 1KWKA 5I6NA 3WFEL 5DRXB 2P9RA 3GMNA 1DE4B 1WAAA 2WO3B 2IAMA 3B8YA 4KI5E 5EU6E 2BNRD 4X99B 5FAAA 3E80A 4YGVA 5HHPA 1HJBC 3TBBA 1SUHA 1Z9MA 4FNPA 4G8EB 4KO6A 3HNSL 4JRXD 2XXGA 3MJ7A 3B6SB 4MMZA 1A6WH 3VSUA 1H3GA 1LK2A 3KXFB 4Z9KB 3CN0A 4XO8A 3ML8A 1E0OB 1CGYA 2DQUL 3OG6B 1L6XA 1R5IB 3ABLB 1A3ZA 3PRZA 4OCMC 4XE0A 1P4IL 1W6LA 2NY5L 2O5XH 4PJAE 4XN5A 3S35H 4GQ9H 3UG4A 4WFGD 2X9YA 3DO4A 1YEFH 3KGRA 4PJ7A 2CHNA 1ND0A 2FO4B 4ZX5A 2IMNA 4JMXA 4XPHH 3N1MC 5I1KH 5I1EL 1H3XA 5TDOA 2CCWA 3HI5H 1G84A 5C1MB 2MIZA 1E5ZA 2D3JA 2YKLH 1FFNA 1RU9H 3CZGA 3V6FA 3ZY7A 2OTWA 4Y4FC 5ITBH 1D5MB 3FQYA 2CO1A 4LB8A 5IJBC 1U8MB 1IM9D 4KX9A 4N26A 4H5SA 2VDLB 1NCWH 5D5MB 3CBJB 2ZJSL 3UJIL 1FO0H 3K91A 1EDYA 3MUGB 3ERXA 4HOXA 2GIMA 5EHFA 3IN0A 3N06B 4NERA 4TL4A 4AIXA 1A2YA 4CAGA 3HI6H 4PPTA 2P43B 5L8LB 3VI3E 4MQXC 5EOCL 4K9EC 1JGEB 1OAYH 1U8KA 3SJVB 4ZXBD 3QDGD 4PS4L 5DO2D 1J8HD 4HX1B 3TO4A 3ILEA 4BJLA 2YKKA 5H4ZA 4OZGF 1S7VA 5DT1L 4GW4B 1YAIA 2E76C 1EJFA 3V0VB 3ZQWA 3MUY1 3QIBA 1HAUA 3O4OB 5IMMA 4HJIA 1QYGH 3FB6A 5BVPL 4QJ5B 4LGSB 5C07A 4AIEA 2L04A 4WJ5B 1WZMA 1QVOA 1T1WB 4RZKA 5MEQB 3TESA 2BIHA 4Z5RA 3MODH 3RE0A 5C9JA 4OCRH 4GG8A 2BFVL 5IFAL 4AI7A 3CFDB 3IETB 2VN4A 2X0VA 2GUOB 2VLLA 4LHUG 1GYVA 3BT2L 3LRKA 5I28A 3ETBF 5IY5B 3CXHK 2O5YL 5D7LA 1CFVL 3O6LL 1U3HB 3ULUL 1Q4NX 2VM9A 1IO4C 2RHEA 3RB7A 4JO2H 4UBDD 2ESVB 4ENEC 4RCAA 5TE4H 2PW1A 3VG0L 4YC2C 4Y16C 5J1AA 1MCQA 4JR9L 1CDHA 4OGYH 1YUKB 2R2CA 4YHLL 4F7MB 3T5WA 1QLEB 4UT7L 4FXKA 3TBSB 4OLYL 4S1DD 4M56A 4IBZA 4XC3H 4BBWA 4M9PA 1A6TA 2CD0A 4GQQA 2LR4A 5KVGL 5JQHC 4D0DB 2KBGA 3QA3B 5ILTL 5J13B 4NQDA 1ZLUH 1O9VA 5FECB 1I7TA 3L6FB 1WD9A 1FAIL 4XNYH 2DWDB 2R0WH 4HUWB 4O58H 3LNEA 4X5WA 3WDIA 3ZE0F 3ZKMC 1JF1B 5TGBA 1N8ZB 2XI9A 2H32B 5TK2A 3UJJH 4WO4C 3RTLA 4MMYB 5DJZB 1ZGLP 4M4RB 1S7QA 2UVFA 3BZEB 2WSKA 4XNMA 1IGIH 3HFML 3NGBB 2BZ7A 5T1KA 4UNTA 1ROWA 3K8LA 1XH3B 3ZTCC 1FF5A 1JNLL 1GSKA 5FOBB 4D0CB 4G11A 4HZLB 2E7LC 1X7TA 5BOZG 1EXGA 3O2DH 4M8VA 4POZD 1I7UB 3VXMA 5DJYB 4FFWD 4S0TD 4NZRH 3QYCA 1DSYA 3HJ0A 3KWXA 2O5XL 1KIRB 3S35L 3SDAD 1ZIAA 1YEFL 4YDJB 2HLEB 1U8HA 4K9EL 3UBXG 4WUKH 5F3HA 3TU6A 4ZX4A 4QUOA 4JKMA 4XPHL 2OZNA 4YSSA 3QEUB 2DWEB 4P2OA 3EJQA 2I24N 3SKMB 3O4LE 4HIXH 1XZWA 3PNWA 4A2GA 2YKLL 2HXAA 1RU9L 3IF1B 4HUNB 3TOPA 5SWZB 4J27A 1F11A 1DBAH 5ELIA 3SGJC 1FGNH 5I5RA 1V27A 3STLA 2YAEA 1BEYH 5FX3A 4H7VA 4D9RD 1A4BA 3CQFA 4YHOL 4QJ4B 1YUHB 1V10A 4WF7A 4B95C 2C3GA 1HHHB 4Q7DA 3RWGA 1AIZA 3NQKA 5C3TA 3RUGF 5CF3A 4GOSA 1FO0L 3KH3A 1VKXB 4LMQI 1I9JH 4BFKA 1VZGA 3SDYL 1H5BB 3IPBA 5G55A 3CUPA 4YDMA 1S7TA 3HI6L 4X7TB 2BNQA 3K0YA 3R4RA 5C7ZA 3K6DA 3RLSA 1OAYL 2JMRA 43C9B 2CBMA 4AW7A 1U41A 5J6GA 3V0JA 3ARBA 2VSCA 5KVEH 4GS7B 2HJKA 3GRBA 1FCCA 1K8IA 2P24B 4LRNH 2HTLD 4A7TA 1LILA 3K81A 3FTYA 5DUJA 3TBYB 4IOFD 1HL5A 3FTWA 2FR4A 1QYGL 5DI8A 4EUPG 3KPNA 2ZONA 2DQGL 2V2WA 3FUFA 5FF6B 5BZWB 3EOAA 4NQXA 1U3NA 2GKIA 4MAZA 2BXYA 2OLDA 4FYQA 1SLWA 3CXDL 4CVZA 1A4JB 3W1ZA 3BAXA 5ID1B 3HAEG 4MXVE 2FEEI 5KG9B 4PLJD 4P2QE 2N1TE 4LU5L 3C5JB 3GM8A 1QFWH 4PG2A 2AEPH 3LKRA 2A2QT 3IDIA 1TLMA 4L4TA 3DSNB 1KF9B 1XB6A 1RI8A 3DXAD 1FZKA 3WEMA 5T3ZE 4NQCB 3QAZC 4XHQA 1RKRA 2G2NA 2WXLA 4OGYL 1ZS8A 2A83B 3DRQA 2P3YA 3VGGA 3AXLB 4ZS6C 5IP4A 3BT0A 5KS9E 4XC3L 3SYPA 1DLHA 1KV3A 1R24B 3O9WD 5DTFB 5EUOA 3DX0A 1HHGA 1G7PA 4RGNE 3TVMA 2J25A 1BFTA 1JRHH 2JIXD 3VWKA 4WU5B 4Y4FB 1ES0B 1OCCB 5I19H 4P4RA 5KSBE 1PCSA 4JFZH 3MRIA 4J3OF 1S7SA 1WIPA 5HYSB 4XNYL 1Q0YH 3ATDA 2CR3A 2R0WL 5EIQA 2X4NB 3WENA 5K9QG 4I85A 1DLFH 3SDXE 1WS7A 2V3EA 3JWDC 5AVZB 2QVFB 4W70A 4P3DB 5EBMB 3S4SA 4WGKA 3VQ2C 2D7PA 3VFMA 2HMID 4XHJD 1A64A 2WSPA 1ZWIB 3GMOA 2NXYD 1YN7B 2EXYC 3LN4B 4FMKA 4FC3E 3BYYA 4QT5B 1ZLWK 3ISYA 4DIXA 4HIIA 4Z7NE 1FNAA 3AABA 4TVUA 2VJXA 2VN5A 3MV7A 4YHNA 4IJTA 4YPGA 3V7AG 2EUWA 3NABH 3EGSA 3MGOB 1KJ2L 1BYNA 5L6YH 1KEGL 1XSOA 4NQVB 4NO0A 2CO4A 1C12B 1OTTC 4NZ8A 4AQZA 4Z3GA 2E8YA 1T0MA 3QEQB 4ZRGA 4BZ1L 4WUKL 3L3DA 3P3RA 1GXEA 4OLXH 4KO9A 3L5JA 4G8GE 3RWCB 4YHMH 1Q9WA 1UB6B 3FO2A 4FFTA 1NQBA 1E28B 5KBNC 2NX5A 4FCAA 3SE3C 2H1LM 4HIXL 2BS8A 1QSEE 2E7BA 4XNXH 1OXYA 4DPCX 3ALWA 3ZUNC 3KYOA 2C7FA 3R0MA 3SB3A 1Y6KR 4WIQA 2E7MA 1BEYL 3HRPA 4P5KB 1IKNC 4HS3B 2HX8A 4Y16B 1IUZA 1EMTH 5IOKA 4JNXA 1BA9A 1RUMH 2CLVA 4Y2NA 2ALWA 2NTFA 3NCMA 5GS0H 3K5RA 1I9JL 5ISZE 1GGIH 1RLBA 3BUQA 4WHYH 3T0AA 5ITFA 3KDMB 4GLRH 4TQEL 1N2RB 1P84J 5AYUH 5MENB 2YFOA 5KVEL 2LHAA 2QQKL 1M6OA 1XIWA 4LRNL 5CLZA 1LNUB 3TA3A 5D1ZC 3LSOB 1EO8H 3DV4A 3RGBA 2ZXAA 1AHWA 4G71B 3ZYIA 1VCBC 1CD0A 3NFSH 4I18C 4K3JH 1T6BX 3PHOB 2V2TA 4RIRA 5IW6B 1F00I 3PQYE 4FXGC 4FQXC 4ABWA 2EDKA 4LPYA 1OLZA 5C0CE 1EHLL 1KB5B 1AC0A 1DCEA 2VL5A 4QO1B 2P7TB 4N24A 4WTQA 1CI5A 4NYLB 3KVPA 3G5XA 3DX7B 3OWEA 4U05A 3CFTA 3NZ8B 4MAUH 1G9EA 2PCPB 3KLDA 1K4CA 3H85A 4Y8AA 3CDYA 4BFIA 4XP6H 4DVBA 1T1ZB 1BD2E 2DWXA 5GRZA 4P9MH 2AEPL 1G0YR 1K2DB 1JHTA 4FZEH 1T2QL 3MGTB 4BK4A 2ZUQC 3DARA 1YECH 3JWDL 1ZJAA 5E5MA 2XN9D 4LQ1A 4RX4D 3FW6A 3WL9B 2OMZB 3K6SA 4OGZA 4Y4HC 2ZKHH 4MDIB 5B8CA 4BKSC 3QORA 3P3TA 1KYOK 4M7KH 1ZSHA 1BPLB 3GSUA 1P7QA 1K3IA 2WINA 1GAFH 3NEEA 3JV4A 2Y72A 3CSFA 3GS0A 4YFLI 3W9EB 3CVBA 3QHTC 3V2AR 2R23A 1JRHL 4K73A 2EEFA 2EDDA 1DBMH 3H8NA 4QOKE 1K72A 4N8CH 4F58L 4YJZL 5HI5C 3NCCB 1INDH 1K5NA 4JFZL 3LKOB 3ARFA 3N42B 5CBAA 4BRJA 1JOIA 2X38A 3VTMA 1T7ZA 2WWMC 4V33A 1DLFL 4GQPH 3WY3A 1JPST 2ID5A 5AVWB 5HHOE 1NBQA 4M7JL 3WJLC 4PEEA 3QFGA 4MX7B 4AM0A 1TTBA 3VXRE 4EI5A 2HCZX 4G80B 4JZNA 4I0PC 5HI3D 2G2PA 1SYVA 3V4VL 1OPGH 2BSSB 4JQIA 4DEUA 5DD0H 3Q6GL 3VYOA 1DYZA 3FF7A 4PJHA 4FQIH 4Q6IB 2J8UA 1MW2A 4IBTA 5AB0A 1KLGB 4WKZB 2EJ1A 4LIQE 5DRWA 5L6YL 3VH8B 3RFZA 3IDJB 3IDMA 2H1PL 4AC4A 3D87B 2VZ1A 4N8VA 5E1QA 4KI5D 1P7BA 1JFHA 3V4UL 2X4TA 2H47C 1MCEA 5IB1B 4YNYB 4OLXL 2J88H 3ETTA 3GXPA 2M83A 3QRBA 5IOPB 5DQ9B 1G7MB 3BZDA 2VQTA 4E42B 1X3DA 4R7VA 4GKLA 4OI9A 1KBWA 1WV7T 2IV8A 2A9CA 1AGCB 2LOEA 2I60L 2VLJB 2X1WL 3VRIB 3MA7A 2VAAB 4Y1AA 4JM2A 1XEUA 1TTFA 1HESA 1EMTL 5A2IH 2NYYC 2YQGA 1YYML 1RJLA 1RUML 2R59A 1NAKH 4MAYD 3REWB 4OQ1A 3K6FA 1PKQE 1EZVX 2Z92B 3MRJB 3NVQA 5DJ2B 4FQCH 2X9ZA 4M61A 2VLKA 3SGKC 1JTTA 1ZLDA 4L2LA 4YAQB 1G7LB 1HTYA 5AYUL 5ICUA 2V2XA 3EUUA 4FFYA 4FMFA 2PR4H 5LG1A 1ZCRA 1UFGA 1BJ8A 3MRMA 2NXZB 4M29A 1QLFB 3BKMH 4FX5A 1AJ7H 4FI7A 3IU3A 5JIDA 2XBTA 5EV7A 3U2IA 4NDMB 1SXZA 3VWJD 5D7SH 1IGYB 4JZJA 4Y5XA 3WTYA 5D9SB 4JEGB 2KYIA 3HLAB 4HGMA 1KMGA 1OTUC 4KROD 2WZPA 1E5CA 4TNWF 4YXHH 4KH9A 3MREA 2IADB 4PJIB 4DP0X 4C56E 1QR4A 4MAUL 1EX0A 1WBXB 3ABZA 3EKCA 4AG4H 5I1DB 3V52L 4GRMA 1TEYA 3PJLA 4HWEH 1ZLEA 4XMUA 3VDBA 1FZOB 4JHBA 2VDKL 1FZMA 2H2PC 4D3CH 4FZEL 4OZHE 1U2CA 3FFCB 4EJ1C 3X14B 1N7ML 3PABB 1YECL 1CICD 2ZXWB 1CFMA 4HJ0D 3V8CA 3DECA 2ZKHL 4MZIA 1BV8A 4NXSA 5IG7B 3D3VB 5E4EC 5H94B 2QHRH 2WMPA 4CVUA 1GAFL 1OL0A 3O8XD 1FNEA 5I1HH 2QVIA 5ANMA 4MJ2A 1L9OA 3ECBB 5C09D 4ZFFB 1RJCA 1YEEL 4WFHE 1DBML 3MRFB 4X9FA 5LBSL 5HDBF 2JB5H 4LAQL 1MCLA 5BO0D 4AV5A 5B1CA 1ZHBA 2Q20A 4IS6B 2F18A 2VC2H 3UP1A 1JGVH 1WIUA 4X8CA 3QQNA 2A4CA 2HRPL 2YLHA 2YXWA 3GS4A 3MBXH 3C9NA 4HH9B 3HEIB 4YDIH 5DMGD 4JCMA 5I1LA 1P4BH 5JW4M 1MCPH 3HZKA 3NJHA 3CQPA 2OMXA 4M1CD 2V5RA 4Z7WF 3IU4H 4Y88A 1D9KB 3MROB 3NIGE 7PAZA 2BK8A 3FO1A 3QJOA 1XCQA 3M7FB 3P0YH 3CZKA 2BVOB 5BMFL 1EJ8A 4Y2OB 2QZ5A 1WC7B 1C16A 4NNXB 4NPJA 5DD0L 2Z31B 4FQIL 5D1ZB 4L29A 1SM3H 3JWNH 4OT1L 3F83A 3SPHA 1H3TA 1U3ZA 1PG7W 1FV1A 1UOVA 4W9GC 4HEMA 1IGTA 2DN7A 4OCSH 1E7UA 4CN6A 3UZEA 4PV1C 5CJOH 3CVHA 3D85B 5A2JH 4ELME 4Y5VA 5HHVH 1J1XL 4HWBH 1A7RH 1JVLA 3QW9A 2FWUA 2WBJA 1KCLA 3V5DA 3DUHA 4LXFA 3VA2C 1T04A 4V1DA 2VAJA 3RGVC 2AJUH 5I2IA 5E8NB 3G7TA 2CCVA 4MHHI 4X80H 4KHTH 4YUEH 5F89A 5AEAA 1LEKB 4ZNEA 1T1XB 1HQ4B 1LO4H 3GYRA 5BRZE 4YHKH 3CSTA 1V7ML 3MJ9H 1FJ1B 2NY3C 3DMMC 4NNYB 5D96B 4ODWB 4ZQTA 1MI5B 4N9GA 3RUGB 5KVDL 4MKTA 2FWLB 4GXVL 3O4LD 4E5XA 1D5ZA 3OAYK 3D5OF 3OVUB 1KXVC 3B7UX 2Y36L 3S7GA 1D5XB 2IBZY 1PD6A 1UZ6E 1A7QH 1LD9A 2Y1AA 2IBBA 2XPGA 3ATFA 1WLHA 2AKRA 4PJDE 5DEFB 4IU2B 1CU4H 4CMMA 3HZMB 2AZAA 4FI6A 2VMFA 2VT0A 4IGBD 1MFNA 4PJEA 4I4WA 4Z7VA 1UWXH 4NRYB 5HYFA 3EW3B 4QKTA 2QPEB 4GAAA 4A7SA 1PJWA 3I3DA 5BV7B 4P49A 1KXQA 4G1EA 1S7RA 3QFJB 4I0PB 2XRAH 4DQAA 1UVQB 4P23A 4YXHL 4F7PA 4HUMB 4LCIH 2HRHA 3CSPA 4UTAH 1NGXA 5IJKA 3NFPB 2Q8AL 1MVUA 3QZWB 1IQWH 2G2RB 2IAMC 4HWEL 5DJXB 4XB7A 4U3XA 1EFXB 1F1DA 2FJFA 4G6AC 3IT8D 4D3CL 3BIKA 3BO8A 2V5SA 3CZLA 1I1AB 3KBPA 2WXQA 1HWHB 2CHZA 2W88A 1JD9A 4NUQA 1URZA 4LLYB 5JMOC 5D2NA 4DP4X 1MWAH 2QHRL 2QGEA 3MV9B 5EZOL 4AQEA 3AQZA 3O41B 2WXRA 4ES8A 4P2QD 1TKWA 4HJJH 3BQUB 4AH2B 4BFNA 5F8QC 3K5SA 3RL2A 3QQDA 3OLDA 1Z5HA 1FIEA 2JB5L 5T3ZD 1T5XB 3S96A 3OG4B 3O11B 2VC2L 3FU3A 4NRXB 3JWOH 3L3OA 2IEPA 4DZBB 1ZY9A 1MCPL 4ZUVA 2FJHB 3UZVB 3HVDA 4P46C 2Y1YA 3IU4L 1QFWM 2OMYB 2UZYA 2X2HA 3TCLB 1B0GB 3DGDA 3IDGA 3ARPA 4HVBA 2AQSA 2AAVA 3RTQD 3WMPA 1GGTA 4G2AA 1JPTL 1OHQA 1MCFA 2IWKA 4RMSA 2R0ZH 1TQTA 2H2SD 5A2LH 1KGWA 1SM3L 1FFOB 3MLWH 1TVBA 3AT8A 3UIYA 2FX8H 3FBKA 2DM7A 3FT4A 4PVNA 1CF8L 1V3MA 4FKEA 3TO4C 1J9CT 3ELAT 5CJOL 3WHXB 3MYJA 1MFAH 3QIBC 2YAMA 5JPNA 1MW3A 3A4AA 1YEIL 3JWOC 3MRPA 3OB0H 4JREB 2BP8B 4YBQC 5HHVL 1A7RL 3RDTB 3TN0D 4NKOA 5HVWA 2ARJB 1OZTG 3CLEH 2QEJA 1ADWA 3VFPA 1JG9A 4LBAA 5L4IA 3VXPB 2BP3A 3QUYA 4U1LB 1KGCE 2ICWA 2AJUL 3FL7A 3UTQB 1MFDH 5E6UB 2DD8L 4GPVA 4KHTL 1PF3A 2NR6D 2SODB 5GJSH 3FZUC 2PXYC 3U83A 4KGLA 1LO4L 2AXGA 4MQ7A 5ECGA 1DJXA 3LY6A 4IDJH 4DK6A 3RNKB 1NAMB 3VXSE 3L45A 2Y24A 1QFOA 3VD7A 1AQHA 1DVFA 1A7BA 5I8CB 5E4EB 1CFTA 3PS6A 1S2EA 4ZMYA 4O4YL 1JFQH 3CHQA 2EDQA 3Q1EA 2KKQA 1DVTA 2YEQA 4JKPL 1CG9B 1NICA 4N0UB 4JFOA 1OTSC 3GSQA 1OAQH 1XZ0B 4L23A 2L7QA 5IVOA 4DP6X 2I26N 4APQD 1A7QL 1AGBB 1CDGA 2PKDA 4FXKC 5EA0L 1JJUA 5FA4A 1A1NB 3LEXA 3TH3T 3C5ZD 5HDOA 3FB8A 4JPIA 4OFIA 1THCA 3B1TA 5LNEA 1TQSA 2XV0A 1NLBH 1CU4L 1E50A 1HI6B 4LCYB 4DH2A 5ISZD 3ARGD 2X4QA 1HK6A 3KCWA 1I9IL 2Z8VC 3MJ8A 1J0KA 2YBRA 2ZYHA 5A2CA 2ITDA 4RAUA 4NKMA 5I0ZA 4JAMA 5KWYC 1DN2A 1NFIB 4QHPA 5D71L 2ZUSA 2K9UA 3K46A 4LCIL 4QRQA 3V7AE 3LHAA 1U0QA 1L7TH 5AZUA 4AENA 1G4MA 4M8UA 1KWGA 1IQWL 3EJPA 5EBGA 4MGXA 4H13C 5DFVC 4ZFOB 1JNNL 2KERA 2NNFA 4AK1A 1JPGA 3ULSB 1AQMA 4HS6B 4AIOA 4QIRA 5HXMA 5TD4A 4I89A 2EO1A 4NUMA 2ARJQ 1T3FB 3RDJA 2XA8H 1GC1H 3LS4L 3HRZB 4UAOC 5C0CD 5IQ9A 2AANA 3D34A 5GGRY 5T1LB 5DURD 3B9KC 4GKZB 4W6YB 1BQSA 1K6QH 3S34H 3ZHDA 4HJJL 1Y18A 3RGVB 1BD2D 2DYPD 2IVFC 1CQKA 5FGBA 3ZO9A 2K4WA 1FIGL 1NC4A 3ECVA 5EUKA 3ZRCC 2JKSA 5CBEA 1QSFE 4YFEA 5IUCA 1F58H 2VR3A 1NJ9B 4P2OC 5CIPB 1DO6A 3QDJA 3T0EB 3ZTJG 3UZQB 3JWOL 3OXSA 1IM3B 4PREB 2JKJA 3P73B 4D8PA 3RIAF 5G5DB 1TR7A 5I30L 1FSKC 1H3UA 2XWTA 1MFEL 3Q8BA 1RPQA 1WZKA 2V3FA 4N3TA 2YK1H 2JK5A 2Y7QA 4ANUA 1VGEH 2CIIA 4JFDE 4XPTH 3FQRB 1B4TA 5A40E 3KL0A 4GP4B 4ZT1A 3H54A 3COOA 4IOSD 5DYFA 3IGKA 4E0RB 2OMVB 4I48A 2Q76A 5IZ7A 5C0AA 2FX8L 4G6KH 5ACZB 3L3IB 3G08B 1NM9A 1G6RB 1OT1A 3ARBC 3H42H 4PJXB 4RMRA 4UM8A 1OE3A 5HHOD 3TNMB 3UBXI 3ZRSA 5F1OB 4GYBA 5KZCD 1OGAE 4TUOA 1MFAL 5IK3B 3DX6A 2IDQA 5CP3A 2FHCA 3ZW3A 3EO9H 1HH9A 2ADFL 3AT0A 4LLDB 4ELKA 1LJMA 2WXJA 1HHKA 3CLEL 1BAWA 2A6DB 4TRPH 4JRXA 2XU9A 3LPOA 4XVTH 3WFZA 1LWHA 1G4RA 3NTCL 3QSKB 5IIEA 3HHSA 3OMIB 1WH0A 1XCTA 5GJSL 3FUNA 4Z23A 3NPSC 4X6CF 3G5VA 3T2OA 1SXBA 1NEUA 2J4WL 4MS8D 4RETB 4TKWA 4X4MA 3UJTH 3NRFA 3MJ7B 4IDJL 3ZDZE 1DVSA 1L3NA 2ESVE 4MMZB 4NO2A 2W0LA 1LK2B 2XPYA 2XWXA 3X3FH 5IFHL 1E43A 3L13A 3C8KA 1BZ7A 4PG2C 1ILSA 4ZZKA 4CVWA 5SWQA 2YHGA 2ZG2A 3GSWA 3KR3H 3PDGA 4BH8A 1QHOA 1OAQL 1JZDC 1ND0B 4JKNA 5DWPA 4HKZA 2J73A 4I8DA 3QJHA 5TDOB 4ADGA 1YRKA 2DV6A 5DGRA 2YGPA 3FCSB 1IM9A 2NDGA 2NW2B 4XTRC 2DQHH 2FYYB 3RPBA 3TVMC 4IIQA 1NLBL 1I1RA 3V6FB 3VWKC 1DANU 2OTWB 1G43A 1X7QA 4UB0H 4OGAC 3BFQG 4B50A 2O4EA 5FGCE 4BFEA 1RZKC 2AVFA 2O26U 3ZDWA 2ADIA 3G9AB 3QDGA 3Q2NA 1NWOA 2PTUA 2X4SA 1J8HA 2BP0A 1L7TL 3PV6B 5EZJB 1NPJA 2FEEL 3F01A 4PB0L 1EJOH 1SDDA 4UU9A 8FABA 5JR1H 2MPAH 4XO9A 5JXAH 5B7MA 1XSJA 5I71B 1U8KB 4MS6A 1MW0A 3QIUD 4NQEB 5AW3B 2JE8A 2XIBA 4PRIB 3ZE1E 4F2MB 4OCYH 1S7VB 1RP8A 3GKZA 4M5ZH 1A6UH 3QIBB 5E8EA 5IMMB 1MG3C 3WJJA 4AGMA 3L5HA 4D0BA 5JXED 3GHEH 1WWWX 4LP5A 5I0XA 1XGRA 2Q3AA 2FNBA 1QVOB 3DDFA 1CXHA 3OAWA 3QB7C 1UG9A 4HFWA 3UEQA 4FKKA 4BWWA 1K6QL 3E8UL 5C9JB 3RWJA 2CRMA 2WWOA 4GG8B 4E41E 3ULUF 2R2EA 3TBVA 2NYZA 2WYZA 1F58L 5E4AA 1PZBA 2IXQB 3RX5A 4NIKB 3NCBB 4IBYA 4FCHA 3TT3H 4OVUA 4FTVE 1KB9K 1CJYA 5EPMA 1HZHH 3BPOB 2R4RL 4MLIA 5E1AA 2ZXGA 1DQVA 2PW1B 4J1UA 3SGDI 4J3OG 4W9IC 4KZDH 2HH0L 2YK1L 4KJPD 5DS2A 2WLLA 1FC2D 1VGEL 4G7QB 3BZ4B 4XPTL 2YEZA 2C9XA 2YZ1A 2O30A 4FXKB 3HVNA 4ORZC 3RILA 2YSSA 4LSPL 4UUJA 4ZAKB 3SYAA 1QTPA 3L4UA 1S78D 3ZHLA 3PP4L 3UX9B 1XR8A 2NQCA 5JIKA 1EGJH 1I7TB 1XIWC 2HT3D 3TA3C 3VD1A 1PTZA 4KKAC 4NKIL 3CVIL 3SDCC 4F20A 4KBPA 4UMSA 5BNXD 3GUFA 2JJWA 1AHWC 4TVPL 3EO9L 5IEKB 4Q4IA 5TGBB 4P48A 4TRPL 3A24A 3REVA 2LLGA 2ZSWA 2V7HA 3BJ91 1JK8B 4XVTL 1WA2X 3LZOA 1O6TA 5HGHA 3TJHC 4YSDA 2XZCL 2AJ3B 1M2OA 1ZXKA 4KUCF 1WFMA 3B9EA 3A6BH 1BMGA 5LGJB 1NH6A 5L2KE 2QGBA 2OJEB 3SDAA 5FYKE 3WKYA 5T1KB 4AGPA 4CRPA 1ZE3H 2P48B 5H35A 3IN2A 2DWYA 1NZRA 1RZKL 4LHUD 2XZAH 2X6UA 2DLGA 4NQCE 4Y2DC 5CKGA 3VXMB 1R3LB 2VQ4A 1KELH 1UADC 4P07A 4RFNC 3VFNA 4AUYA 5JW5B 2A5UA 5IUSA 3US1A 1TCRA 1R5WB 2BVTA 5B8CC 5F3HB 4ZW7A 3GHBH 1MLBA 3MBED 3PXLA 3N85H 3QORC 3RBGA 5DDHA 5BRZD 1HVXA 3BWUC 3OJVC 2DY2A 1BIHA 8CGTA 4BK8A 3ETSA 4PIRF 2IQ9H 2V8MA 3ML9A 5F70A 1E3FA 5I66A 4AT6B 2OXGA 3ARED 3F04A 1FSKB 4QRPE 4O51B 4UB0L 3TV3H 3HW7A 4O2CB 4NAJA 2Z8RA 1ZE3C 3ARFC 4DESA 2QR0A 1GTFA 2AK4D 1KPVA 2EDBA 3BVWA 4HKXA 3S2AA 1JMXA 4XXCA 1H3PH 1HX0A 2BNQB 5E5LA 1QFUH 2MPAL 2VDQH 2AJXH 1I8LA 1A5FL 5JXAL 4UQBA 4E68A 3B2XA 1PY9A 4J3XA 5J6GB 3ARBB 3CN4A 3LN5A 3L4WA 4FOMA 2HJKB 5DQDH 1JF5A 4MA7H 4OCYL 1QI5A 2GITB 3A22A 1JPSL 3IDYC 3N1QC 5DI8B 4NN7C 2R51A 2EXSA 1S3RA 2TAAA 2Z7UA 3QG7L 3RFZC 2V2WB 1X9RA 4FG0A 1AGFA 2NT1A 5DC9B 2BCKA 1KIQB 1RIUL 3G6JA 4TPRL 2MQ3A 4CVZB 3D8MA 5KAQF 1NMCC 7FABH 3NPSB 5B3JF 5CKAA 3EYVB 2NY0B 1P6WA 3DXAA 5FKPA 2FL5A 2PN5A 2RMNA 1GYAA 3C60D 4FQQA 1YEWA 1WZLA 3TT3L 3LKRB 3VI4E 2RFXA 1XGPA 5GS2D 1DEEA 1HZHL 2VISA 3B7RL 3LKPB 4L4TB 3O9WA 5JZ7D 4JM2C 1E90A 4KZDL 2G4GA 2WN3A 2JIXA 4G5AA 3DRQB 5ES4B 3TYFB 3ZMEA 2J21A 2WO2B 1NGWA 1DLHB 5MENE 5EUOB 3S3JA 3FH7A 3BDYH 4FL4C 5D2LA 3Q43A 3RVXC 2X4PA 1FFPB 2ZG1A 2VDMB 1UM4H 4HKJB 2YD1A 4OB5H 2OA9A 1BFOA 5ICYA 4P4RB 4BUGA 3HMXA 1EGJL 2VQ1B 1WK0A 1WCBB 2XV2A 4OD3H 3VM7A 3QXDA 5EIIA 4W4OA 3BSZA 2O6EA 1KGUA 4GXUM 4PBDA 4JZJC 4Y5XC 4H0HB 1MDAA 2UWEE 2XWJA 2MNWA 1QX1A 3MTRA 3ZTNH 1Q9LA 1SOXA 1TZOA 5FYJE 3VFMB 1ZHLA 3GB7B 4R90L 3L08A 1S5HB 3GMOB 3OV6A 3PWUB 4X7DC 2ATKA 4KRMB 1BBDH 4N2LA 4HIIB 3MV7B 2VKWA 2D7QA 4YPGB 3UTTB 1SJVA 3ZQXA 5EU7E 4YHNB 4W4NA 3RZCC 4ZUWA 43CAA 1JBJA 1H8OA 4JFFE 3P4MA 4B41A 4HPYH 4BE5A 3IKKA 3BZ5A 4OSUH 5C0GA 3TO2A 1S7XA 1KIUA 4IKNA 3SBWC 4C54A 5CJXA 1KGCD 5BPPA 4RWHA 2VDPB 5JIQA 5F7LB 3L3DB 3GHBL 2UUDH 1ULVA 3LXUX 2YZ8A 3VXSD 5DUMH 1ZGLA 2NX5B 2JKIS 3JQOB 3BDXA 1QASA 1RK1A 1OGSA 4EBQL 3NDZE 1TZHA 3EJZD 3X17A 4UV7H 2V33A 3W5MA 3TV3L 3HHMA 3S3SA 3NACL 2Z6FA 1CL7L 3ILQD 3B2DC 3U30B 2ZPKH 3GM0A 2NTFB 4OQTA 4XP5L 5MERA 4QXUL 4ZW8A 1GIGH 4DERA 3CFKA 4H8WC 4GINA 5ITFB 4DN4H 2LABA 1EEUA 2Z1PA 2F5AH 2EIMB 4DF9A 1CR9H 3BGFB 4NM8H 4KK9C 4MRBA 3SIKA 4XXWA 1HCYA 2DLTA 3TA3B 5B1BB 3KPRE 4WTXA 3CZNA 4X9HA 1B0IA 1YC8A 1O75A 2NCEA 1EZUA 5DC4B 4EXKA 1UWGH 4RAVA 2WQSA 2V2TB 2JJVA 4RIRB 4YDZA 3UZEC 3QO0B 3WU1A 4PR5A 3MACH 3GTTA 1GHFH 3NMEA 4Y5VC 3WBDA 4B9KC 2ZOLA 3KXFD 4OGQC 2VL5B 3WXWH 7FABL 5J11C 5EOCJ 3AB0B 3ULVC 3G5XB 2WBJC 4PS8A 2PCYA 1QOKA 2DL9A 1YNKL 2XN9A 4RX4A 2B2XH 5INDA 3RIKA 3U0PA 1FH2A 1WO2A 1BXVA 1K4CB 2ENQA 4BFIB 4DVBB 3BP7A 4U0QB 3V10A 3ZKNC 1GY1A 2CU9A 3DTXB 3AUWB 1A3RL 5E5MB 3IE4A 3D2UB 3K6SB 1NKRA 3RRQA 2O61A 4K3DH 2O6PA 3JUYA 1ODAA 1P7QB 3GSUB 1ZLUK 1PJ9A 3PUCA 2WINB 1TJMA 3JV4B 3QZMA 4OF0A 3BWAA 1VEMA 1N9PA 1I7ZA 4DOHB 4LHQB 4ZUUA 2R23B 5ADPL 5E2WH 3X13B 1JPFB 4OB5L 4OZGE 5KBDA 6CGTA 2YFNA 4H4NA 1L9SA 5I1CH 1R47A 4AXWA 1IGJA 5K1VA 3F05A 2LTQC 5PCYA 1JDAA 2QDWA 2DIJA 4JO3H 2QVTA 4R4FH 4OUUA 1XCWA 3SJVD 1I3UA 3HG0A 3FSAA 4YFDB 3MUJA 4ZSOA 3FQ2A 3KG5A 4PGDA 3BFWA 4KDVA 4EI5B 2HG0A 4XMVA 1ZLVH 1T66C 4P23C 3GXDA 1NBCA 4QMEA 1SYVB 3AG4B 5IJKC 4BQBA 2CZNA 1BBDL 1OGAD 5EN3A 5ESAA 4EOWH 4BGDA 5EU6A 3FFCE 4DKEL 4K8RD 2WXHA 3QJQB 4J3SA 1VAHA 3UAJD 3IDYB 5DRWB 4NN7B 2BMKA 2YPLB 3HUJE 4HPYL 4FA8A 4N2DA 3EH4B 5F8RC 1BQHB 4H8WL 5KTEH 4U3CA 1UTDA 1NMCB 4I88A 5D2NC 1U3HD 1MH5A 4PJAA 2PR9A 1DZBA 1JNHA 4UDTA 1G1KA 2ESVD 3H9SB 4DKFH 3T2QA 4L1DA 4PLOB 1CUOA 1A6AB 2HFTA 3CPLA 1RVFL 4IKJA 4LCWE 2YJLA 4MAYA 4UOW1 3SPJA 1UURA 2RJMA 2ZXEB 3CMOH 1DTUA 1OARH 1TXKA 2CKBA 3OMZA 2OQJA 5D6CA 3MA7B 4EZMA 1GZPB 5BJTA 4EXPX 3ZE0E 5KOVC 1JZ8A 3FJTA 3G6DH 4U4IA 35C8H 2HX9A 4BHUI 1RJLB 2ZPKL 5C0EA 5F7UA 3L3OC 4Y7MA 3WFHA 4K3GA 4BKTC 1TO5A 4Q6YA 3ULVL 3AMKA 1JV5A 1UQSB 2NMSA 5T3XE 3EH1A 3U9UA 3UTSB 1GIGL 2CLRA 4UOQA 3SKNB 4U0RC 2D7TH 4M61B 3GHPA 4DN4L 4FL4B 2VLKB 1IIIA 1OM3L 1CR9L 1WBYB 4OKVA 3WSQH 3VWJA 1P5UB 2PYEE 2V2XB 3LV3B 1AXTH 3RVTC 4NZJA 1ETJA 3GIVB 5F97E 3MRMB 3B9VA 3IMBA 3KEHA 2W9EH 1MXGA 3FO0H 4X50A 2LVCA 4YVNA 4U1NA 1J8RA 3PGFH 4W6XB 2MOGA 4Y5XB 3QULA 1ZV5A 3LB6C 2XQBL 4Z77A 5JPNC 3DHPA 2COVD 1HH6B 3B56A 1TJGL 1XF3B 4FD0A 3LKSA 1OPOA 3MREB 1HU8A 1QEWB 3LRLA 4FN0A 3BVXA 3E38A 4FHJA 1JL8A 1HEJC 2FT8A 5JYMA 1KENL 1YNLH 3C6LD 3QUYC 1BFVL 4GRMB 1O7DC 1IC5L 4L8DB 4OF8A 1RCYA 3TCXA 3HI1A 3OHMB 1VB9A 5F7YC 2DQDL 4NIYE 4J5VA 5GGTA 1TQWA 2EE2A 2N7AA 5I6MA 3O8XA 3BD3A 3HR5B 1RQ5A 3P9MA 4E41D 1C1EH 1EAOA 5C09A 2A99A 1MVYA 3Q8EA 1X5LA 3VFOA 1P2CA 5SWZD 4HBCH 1FNEB 1BM3L 2YD4A 3GPEA 2GQHA 3OPZH 3Q0HA 2G9KA 1BEXA 3UAAA 3KGUA 5D1QB 1CGXA 1QBMH 4L3EE 1NCBH 1ZHBB 4ZW6A 3L3HA 5I1CL 4AUUA 5FUOH 4ZO6A 5D93B 4DGUA 2CR0A 4R4FL 3STBA 3EYFB 3BWZA 5C0JA 3DGGA 3HZKB 2OMXB 3IMRA 3B43A 2WZ0A 3KEDA 3PYCA 3SCMD 4MRCA 2PWGA 4OCNC 3FO1B 1UOLA 1XCQB 2FQDA 1AKJB 3RWHB 4ZMLA 1ET8A 4Z7QB 1KCWA 3EJUA 4DETA 4Q9RL 3WLWC 4PWHA 3EDEA 4JFWA 2C9PA 3MQIA 5C6TH 5C8JA 1T2JA 5C92A 4TUKH 1CS6A 4Y5YA 3BUIA 4ZQKB 1FV1B 3NCJH 4IW4C 4KUZH 4F57H 1OP3K 5KTEL 3CVHB 5L88H 3MV9E 4A7GA 1NTDA 4Y5VB 1E4WL 1FDLH 2E9WA 4QRTB 1N5YL 1I8MA 5J11B 5FYKD 4C47A 5FM8A 3LVTA 2WBJB 3V5DB 1IAOB 1WFUA 2GC7C 3GINA 3QJFA 4KK5D 4NP4L 2W92A 1T04B 3NSXA 4V1DB 5KVFH 1TU2A 5GHWH 4NQCD 5FGBC 1WEJH 5F89B 3RWFA 1IJ9A 2XV6B 1G5AA 3O4LA 2BJMH 2IGTA 2F8XC 3E3QC 1NBVH 4OR1A 3G6DL 2DEWX 3WN5A 3E1F1 4IMKA 1QEXA 4HK0B 1HINL 1XF5A 4N9GB 5H2BA 3SE9H 2KH2B 1FNFA 3LZQA 3EYUH 1LE5A 1D5ZB 1ECZA 1ZOXA 2D7TL 3UDWC 2QGCA 2RIKA 1BZEA 4Y7OC 1A6VH 4LT7A 3KLAA 4QRPD 3JVGA 4MNGB 1LD9B 4IGBA 4JY5L 2NTSP 3K6IA 1HYSC 5DHDA 4L2YA 2B1HL 2VM3A 3WY4A 3QQ4A 2AKRB 2R27A 1BAGA 2AMGA 3DTUB 4B96A 2EH8H 3RYMA 1BJ1J 4QHLA 2W9EL 3FO0L 3O6ML 3FU0A 4PJEB 4I4WB 4FQPA 4H8VA 2QADC 4Z7VB 4AEIH 4MCYB 5GGUA 4AQ1A 5HYEA 2NLJB 3FT3B 5I6XC 3GUTA 3UABA 2IDCA 3GSNA 4UQCA 3V0HA 4B7LA 5F88A 4F7PB 4U1SA 4I1PA 5IQMA 1MVUB 1U3JA 4HWUA 3EGDA 3PHQA 3VJ6B 1YNLL 4XMKH 3HMWH 3SGDH 2FJFB 3O2VH 3DKHA 1IC1A 3BO8B 3FSVA 5TFSL 5KJ7E 4KQ3H 3TURA 4JMNA 4P2QA 3DUUA 1FG2A 2BVEA 1GOGA 1NGZB 4CW1A 2QZQA 1ET7A 5D2NB 2OJ1A 3MLVH 3V95A 1PZ5A 5HJ3A 5B39A 4HJTA 4AQEB 2FT7A 3KW8A 1TKWB 4G9FE 4JJOA 4XP9H 1DSFH 2IG2L 2Q3XA 2ZZUT 1NOLA 5BZDA 3NFNA 3RL2B 1R46A 5HP5A 3DSFL 3QQDB 5KS9A 2NW3A 1QBML 4GAFB 4GO9A 4MMXA 1NCBL 5LCVH 1AI1H 4DPRA 4P2RB 1E4XI 2J20A 2WQWA 5FUOL 4IIQC 1BZOA 3L3OB 3VRLF 4HEPA 2OR9H 3RTQA 1MAJA 5KSBA 1RIHH 5CEZL 4CVXA 5MEND 5GS1C 4WWKB 2R7EA 1KJ3H 2VMDA 2HKHL 1EWHA 3E2HC 5JPMB 1ZHKA 2EO9A 2UZYB 1S4IA 1KUMA 1A9VA 4OZFA 1WZAA 2UZXA 3SDXA 2H26A 4JX0A 4ZXBC 4NI6A 3SGEI 5DO2C 4WI7A 3KW7A 3T1FB 1F56A 1PU0A 3FSZA 4DW2L 2ENJA 2EIKB 5C6TL 4PLKD 1TVBB 3PAVA 3FT4B 1MWOA 4NUGH 5JW4Q 3I9PA 1BQKA 4R96A 5IBUB 4F57L 4FYTA 2FEDD 5FYJD 5L88L 1WIOA 1E67A 5JPNB 4YWGL 3MRPB 3OAZH 1R17A 2IH9A 3WJJC 4NKOB 4IIZA 4ODHH 5SX4I 5IESH 1TFPA 5CUSH 3VFPB 4MNQB 1GZHA 3AWFA 3QUYB 5KVFL 4JFFD 3ATBA 4WW2F 4DN3H 1WEJL 3T0EE 4ZX6A 3LKNA 2JJUA 1SVZA 4UBDC 1KBBA 1Y0LA 4IRSA 3O3EA 3ORJA 4A2DA 1WFJA 2BJML 1QSEA 1NBVL 4ZDHB 3Q2WA 2X4RB 1NIDA 2VR9A 1DVFB 1J5IA 2UXGA 1I8KB 2YPVH 1CFTB 4APQA 2EACA 3WHE0 4PGZA 4M00A 3GDCA 1PX8A 4S1DC 4S10A 5CD5D 3C5ZA 5FUZH 3IFPB 4A6YH 4JFOB 2GI0A 1A6VL 2MQ0A 2DH2A 4F7CA 2V37A 3MSPA 3DV6A 5ISZA 4OI8A 1JZJA 1R3HA 4HMCA 2WLKA 3FB8B 5EU5A 4MXWH 1F4YL 5CCGE 5A2AA 3CVCA 1PLCA 3I6GA 3QDME 2EZ0D 4NQSA 5IBLD 4MASA 1Z9LA 3LMJL 2VXQA 1W0WA 1KIPA 3OXRB 1VF5C 3IDNA 2A3TA 4OLWH 4NKMB 4RAUB 1FI8C 4JAMB 1BMZA 5I16B 3EDJA 1D2OA 4QRQB 2HX7A 1OP5K