1HEJC

C-terminal xylan binding domain from cellulomonas fimi xylanase 11a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
88
structure length
88
Chain Sequence
TGSCSVSAVRGEEWADRFNVTYSVSGSSSWVVTLGLNGGQSVQSSWNAALTGSSGTVTARPNGSGNSFGVTFYKNGSSATPGATCATG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evidence for Synergy between Family 2B Carbohydrate Binding Modules in Cellulomonas Fimi Xylanase 11A
pubmed doi rcsb
source organism Cellulomonas fimi
molecule tags Hydrolase(xylan degradation)
molecule keywords ENDO-1,4-BETA-XYLANASE D
total genus 9
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2000-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hejC00
1EXGA 2CZNA 1QBBA 1E5CA 1HEJC 3NDZE 3NDYE 1XBDA 1HEHC 1C7TA 1C7SA 2CWRA 1E5BA 2RTTA 2XBDA 5DHDA 5DHEA 1QBAA 1EXHA
chains in the Genus database with same CATH superfamily
3GSNH 2MNUA 1GR7A 5L2KA 2EDYA 2WP3T 1EAQA 3WFBH 3K4DA 2CDFB 1IIIA 5EF3A 1OLLA 1CI3M 3QDJB 4BKLA 5LXVA 2FB4L 2EECA 2Y07H 2EC8A 1ADQL 2DQTH 4J3BA 1BZQK 2G2NA 1GGUA 1KGIA 3D25A 3OAUH 3IJ7A 4K3JH 1MJJB 5HJGA 2CO7B 2V0AA 2NQCA 3C60C 4BKTC 1K85A 4MNGB 1TQWA 4BFRA 3FUEA 5CILH 1PQZB 3ZR5A 1SYVA 2XPGB 2CD0A 1LHZA 4AJWA 5ENWA 1IBHA 1VFMA 5T3XE 3T4AA 3HBPA 3BZEA 1AD9B 2JQAA 4QRAA 4QHMB 2NPLX 4ZUVB 2M8XA 3LN5B 4ES9A 2FGZA 1G7IA 4JRYB 1YC7A 4L3FA 5A16A 4DFIA 1RZIA 2X1QA 1I8KB 3GMMA 1QFWI 3FULA 3APCA 4KKNA 4R7DA 3QJSB 4X5XB 3VFVA 4AGLA 3MV8E 3T4YB 2Y1VA 1KFAL 5E8OA 4BINA 1NCNA 1QWUA 2TSBA 1CFVL 3L4TA 4L1DA 3U7AA 3CFDA 4NUJB 2APSA 4CVZA 2XWEA 2ENJA 3IMTA 2ED8A 3U6RB 5HDRA 1DSYA 3MGAA 3RWIB 1FNSH 3K6DA 3SHSA 1T5WB 5AVYB 1NGWB 2L7UA 4ZO8A 3BP7A 2AGJL 1KTCA 1UXLA 1F8TL 4AYID 2R23B 2YA2A 4OUUA 4JFXB 3WKMH 4EI6A 1FE8L 4PWJA 5IJCC 1QZ1A 4G8AC 3S36H 1ZPUA 2VXQL 2DIBA 1FZMA 4KMTH 1OQXA 2OMWB 4JEGB 2D31A 4OQTH 3NGBC 4DUXA 1PG7L 4F1SA 2C9QA 1WZKA 5IBTH 1X5KA 4MCMA 5JHDA 3NBNA 1D5MA 4OCSL 4BKLB 2H0FA 4ZO9A 3TJHC 2OL3H 3RPKA 4GMSL 1IAIM 2QADB 1BXUA 3GBML 4XVUD 1IB5A 2C9RA 3GDCA 2Z4QA 4N0CC 1WO2A 2V5SA 4WCYH 2HRGA 5A7BA 1MCWW 4HETA 2BSDA 3HE6C 1PSKL 3VVVA 1E43A 1XF5B 4JDTH 4MSWA 1GRWA 1JERA 3PAUA 1BECA 1KFAH 3KLAA 5CD5C 5E1IA 3SDXF 1GCYA 4N8CH 1U8LA 2DEXX 2MQ0A 1ZMYA 2KC0A 1WITA 3OKEA 2BNRA 5FYJH 4FABL 1W0WA 2HG5B 2NY2C 3NJMA 3OR7A 4AEFA 1RZIB 5F88B 5EH1A 3RRQA 4X7TB 3JV4B 3GXTA 5KYYA 5GGUA 3E38A 2D4FA 1M6UA 3ZU8A 4Y2DB 2Y3NA 3PHOB 1KDIA 5GGVL 2WJ5A 3F7QA 3G6AB 4OFIA 1PGRB 4BE5A 3KHQA 2F54A 3HE7D 1OXYA 5EZJA 2PPAA 3K6SA 1VFOA 3TCLB 1KEGH 2ENSA 4HBQA 5ID1A 2Y7NA 2FHBA 5C0BD 3B9DA 4ABVA 4K7PL 3H7BA 3N85H 4GLRI 3IDGB 2HT2D 2XG5A 3UADA 2D31B 5I75B 3K5RA 4AMWA 2NTSP 3F7YB 4NZUH 4KTEL 4FEIA 3CBKB 3LSOA 5KVFL 4MJJA 2X4UB 2VXTH 2UWEB 3RDTA 1FE8H 4B97A 3L2LA 2FLRT 3HJ0A 5I1KH 4KDTC 4LSQH 3QJUB 1MPAH 5FYLH 2G75B 3RIAK 5C0EB 2NY2B 3M88A 2AK4E 3RHWF 4UWQB 3S4SB 1HI6B 3EOAB 5KOVC 3KLSA 4PJ8D 3T8XA 1P84J 4KPHL 2JH2A 4ZOCA 2ARJA 4KKBD 1ASPA 4RDQF 3VTAA 4WHCA 4X7SL 1OCWL 5IEHA 1TITA 4P4KD 3VXUA 1LNUA 2VN4A 1DVFA 1I7ZA 1NMBH 3NJHA 5AVXB 1HK6A 5IROC 5IQNA 5F3HB 4FHBD 1TTFA 5T1KD 2HG5A 3OR7B 2DQGH 4KK5C 1IBFA 3KZ8A 2AXJA 2WV3A 3TVMB 4PS3A 1I9RH 1V7MH 5KYYB 5DVKA 3F04A 5ESVA 4TTGA 3QDGA 2FE0A 3I9GH 2AK4D 1E2ZA 2VW6A 3GMRB 3INUL 3BQUB 3NJFA 2UXTA 2Q0ZX 1BJMA 2IQ9H 1U9KA 3LKNA 2R1WA 1R5IB 5DJ8B 5DJDA 4NRXA 1OE2A 2IGTA 1I4FA 3H8NA 1BVKA 5D7JD 1UD5A 2YUWA 3PPSA 3ES6A 4DN3L 3TCLA 3VFTB 2XN9B 4N2KA 1PLGL 5GGSA 1D5RA 3TBTB 2G2RB 3TVMD 3D18A 4Z0XA 3IDMA 3KGTA 3OKOA 1S7VB 2J20A 3KNBB 4NQDB 2VM4A 2CQVA 1F4WH 4JFQB 1A2YA 1H5BC 5TQ2L 3RFZC 1UM5H 1N67A 2AK4B 2W88A 3N43F 4GO8A 3DX3A 2Y25A 5I71C 3BAEL 1W9XA 1P4LB 3EHBC 3HC4H 3AXHA 5F9WC 2VM3A 1JCVA 2BOBB 5FO7A 1MRCL 1LO0H 4N22A 2XQBL 1P4IL 3DUUB 2K6WA 4F33B 3D3VA 1O6SB 3G08A 1IGML 1M05B 3T0VA 5CJXA 4LSVL 4OF0A 3KMDA 1PKQB 5CS7A 2N4IA 5JW4R 3G9VA 1U8CB 3QARA 2H2PC 3AM8A 3X3GL 5KVDH 1OE1A 3QPQD 4CJ1A 1EUTA 3RWDB 3QZNA 1LP9E 2A77L 3TBVB 5ILTL 1M2VA 3PFQA 4AKQA 2FK9A 2JCCE 4BKSC 1MZYA 3RGVA 1AG6A 4LNRA 1ES0B 3EOTL 1YN7B 4CILA 4MD0B 2X6VA 4OUOA 4RGOH 5A2JH 3P4MA 5B1KA 1Y18A 5HJDA 4YSRA 1UB5B 4YMPA 3QDGB 4WWKC 3WO4B 2FYYA 3APNA 5FHBL 1TU2A 2J88L 2UXFA 1XR8B 3MOAL 2CRZA 3K6OA 3O41A 1KTJA 4YEFA 4XP1L 1FSKB 2PTVA 1SXBA 4Y5YA 4NRXB 1X5JA 4B95C 4A38A 1XGZA 1QACA 2IGLA 1Z3RA 2VR4A 1Z3GH 2NY7H 2WINB 3GEWB 3BFWA 4ZSOA 1CR9H 2X1OA 5DQ9B 2ORBL 3QDJA 3EXJA 3BUQA 1FNEA 2ZSVA 3MA7A 2B15A 1F3RB 4JM4L 2UZPA 3TZVD 3HRZC 2A9AA 4JDZA 1JNJA 4XP4H 4JB9H 1THAA 4LLQA 3RB7A 4N20A 2Q8BH 2O6PA 1KCRH 2D4DA 4ZYKA 3FRPA 3TJHD 2ZX8A 1CLYL 1F4HA 1BFSA 1KLGB 4DP0X 4UAHA 4C4KO 3KYMA 4PAZA 2GFBB 3H9YA 4CGTA 5KN5A 3RIKA 2GBTA 2Q1EA 2EE2A 4ODXA 2JB5H 2GC4C 2XFGB 3TFKC 3UZVB 4B5EA 4XXDB 4Q9RH 3MOBL 4Z7WE 2IQAA 4KV5F 2MIZA 5K9KB 4U4IA 1IQDA 4R7VA 1H3WM 1OE3A 3DX9A 4BZ2L 4XMTA 4FQ1L 1RHHA 4G1EA 5KW9L 4WWKD 2AQ2A 2CUHA 5SWSE 3S36L 3U83A 3NSFA 2KERA 2X44D 2YD8A 4Z7UF 3ZE2F 1NGWA 1U8PB 2WUCL 3MRNB 4GKSB 3JWNC 4CVZB 2XXMB 4OLWL 2QKIC 5CJ8A 2J55A 3ZHFA 3O9WD 1P1VA 1NEPA 2X53A 3EJZC 4JQIA 4PW4A 4NJAL 4U33A 1NGXB 3T8VA 1JGVL 3P40A 4AQOA 4ZS7L 4PJXE 3GDBA 2E47A 2P7TA 4G8FA 3NSDA 4HJIA 1YJDC 4WRLA 1GGBL 3DX0A 3SDDD 2VXVL 1YY8A 3TF4A 3JUZA 3MFFA 4HGKC 4Z3IA 3S88H 1YEHH 4ZUTA 4I18C 4RGND 1GPOH 5IB4B 1P0SE 1P84K 3U1SL 4NXSA 3VD9A 3NP4A 2GK0A 3E0GA 1NL0H 2BSBA 1A21A 1XF5A 1VHPA 5DHEA 2EINB 5F89A 3PU7A 3FTUA 1X6LA 2QPUA 3GBLA 4F1ZA 1LD9A 1MHHA 1YECH 4KTDH 2BJMH 1RURL 3G04B 4V2BA 1DSFL 1RSFA 3SCMB 4ODXB 2FB4H 1V27A 1M53A 3Q3GA 3CZFA 1Q0XH 1AS7A 3FB8B 5CP3H 4NDMB 2JELL 2UUDK 2WIMA 3AWEA 3WFEH 3WGUB 1F00I 1VIWA 3X3GH 3VWJC 4N2CA 4AMKH 1AI1H 1OZTG 3BMVA 3VDAA 4LVNB 3CC1A 2HSIA 1IBBA 4KK8C 2N59A 4KRPB 3FQRA 1JRHL 2F54B 3KCPB 3X2QB 4BSVB 4UQIM 4GW4A 2VZ1A 1BZ7B 1E5CA 2JKLA 3SPHA 2YR3A 3DV4A 2GEQA 2R2BB 2D0GA 2C7UA 1U8HA 3B6SA 3BIKB 3D48R 3EADA 4HDIB 4BSWB 5SV4A 4GP4B 3F6LA 2X3AA 4PB9L 2Z1PA 3FRUB 2LR4A 3NJGA 3BRFA 1EO8H 1NPUA 4U1JB 2P8MA 1QHQA 2DI7A 1YYCA 5TF1H 1F1GA 1JDCA 4HCRA 5GS1A 1I8AA 1TQTA 4N2HA 4NUGL 1S9WB 3ZMNA 5C1MB 2CCLA 4YSAA 2FX7L 4GI9A 1NBYB 2J1KA 3M86A 4IU2B 1B0RB 1X4XA 2X4OB 5T3ZE 3PNRB 1Q72L 1ZVSB 4MA8H 5CF3A 3T1WA 2F15A 4L8DB 1LK3L 3C5ZB 4B9GA 3WXVL 1QBLL 1TNMA 1OB1B 3MBEC 1Y0LB 3MV7A 1BJ1J 1AR1B 3LVTA 2D7TH 3ML8A 3UBHA 1H6EA 3O3DA 1L5GA 3DNKA 1FRGH 4ZW7A 2VH5L 1WBXA 2F0CA 5AVWB 4I1PA 3K80A 3AS0A 3VDBA 1KTDB 2DKMA 2ARJB 3ARBC 4YE0A 4UQAA 1IKFH 5EIQA 4H20H 4MB5A 3GMRA 1WZLA 2WVVB 1N6QH 3BUYA 1IJNA 5D7SH 4HK0B 1XTMA 4L3EB 5I18L 2CXKA 3HR5B 4TUKH 3ETBF 1AR1D 3RNKB 5FDYA 4MAZA 4QYAA 5EIIB 1QFHA 1ZGLM 3SO3B 1EANA 4X9GA 5J1SC 5CD5D 4PTTB 4C4KT 1AP2A 5C08A 5KBNC 4NQDA 4CKQA 2IANE 5IW3A 5IM7B 4IJ3B 3WHXB 4TSBL 2Q87A 4WUUE 5IMOB 3S36X 2H0PA 3BAJA 1RZJL 3LS5H 1E6OH 4JFWA 3L5XH 3RQ3A 4UYPA 4OZGB 1MIEH 2OMXA 1DUZB 1CLCA 3IU3B 4AGMA 3WEXB 2Z93B 4MB3A 3TA3C 3IDMB 1EJ8A 3LD8C 3TF7C 3AY4A 2BIPA 2PTTA 2BVPB 4NN5B 5G4MA 5JPNB 1L9PA 5D7IE 3LZOA 4PJDE 3GINA 5DRXA 5EU4B 2CMRL 2Z31A 2E0PA 3MZTA 4YXKL 4J3OC 4L0PB 2WVTA 4J3TA 4D7PA 1QLEH 3TT3L 4M7ZC 3C5ZA 3KPRA 5D55A 3PL6D 4NUQA 2VMEA 4OCXH 3TBVA 1O6SA 2V5TA 1NANI 2YQ3A 5DJ6A 2EEDA 2HT3C 2VXTL 2OX5B 4KY2A 1YN7A 3I75B 2YSSA 4K07A 3VQLA 5ICZA 3IU4L 1UTDA 2EDBA 1FYTA 5E1HB 4DT2A 5IQ9B 2Z64C 4IK6A 3WMQA 5HY9B 1E27A 2XJLA 1EBAA 4IIQB 2WYZA 4W81A 1RXLA 2IFFH 2JK5B 2PPFA 2NZ1A 4HAKA 4PM1A 1X5FA 3WIHL 2PW2A 4AYDC 1IAMA 1OHZA 2HCZX 4XNMB 1EHLL 1KBWA 1MFBL 4ZS6C 5C3TA 3RJDA 3VXUE 1KB5B 3LS5L 3T77A 3FN3A 4Z7VA 4PV1C 2WAQA 4OLZL 3RILA 2WN2A 4JG1L 2ADYA 2W1NA 1NWOA 1FH2A 3D0VB 3FU6A 2IDFA 3M17B 3MI6A 1A6PA 3BWUC 2ZOWA 4HT1L 4N9OB 1MG2C 4U1GC 4MWFB 3ZYIA 3NRQA 1QRKA 1U8NA 3FFCA 3CFJB 2GPZA 3W5NA 1N5AB 3LB6C 1DBAL 2Y7LA 1OSEA 4PCYA 4JG9A 4U3SB 1G0XA 2NUTA 2YMXL 3NCJL 1DUZA 1HYSD 4O5LL 5CGBA 3HPLB 1WFMA 2OULB 2TRHA 3GMPB 3BE1H 4XOEA 2PP7A 3CD4A 5FGRA 2WXNA 3JTSB 4N5UA 4JDZB 1WWBX 5HHQA 5IHLB 3NCXA 4MAUH 2QPEB 2XVLA 2J43A 1TQCB 2BSRB 1VACB 2DM7A 2H1LM 3EDFA 4P46C 2E27L 1BV8A 1XGTA 3G5ZB 1M7UA 4Q89A 4HCRH 1NC4B 3OKKA 4Y5XB 5TDPA 1P5VB 4JR9L 1X5HA 2ATPA 1KB5L 5DJ6B 4XHJC 3BKJH 2PO6C 3FK3A 3VFOB 4O00A 4I5BB 4PCSA 5AVUB 3ATFA 5HJBA 4XMKL 4LLWA 4GS7C 3PQYD 2YKLL 4FQJH 2WLJA 4N6QA 4M1CC 1BAWA 3QVAA 4X7CC 3B5TA 5D2LA 4JZJB 4ZNEA 2DWDA 1G6RL 4FL4B 5BRQA 1F42A 5DSCB 3ARTA 1J86A 2R69H 2O5NA 5DUPH 2FO4B 2MOGA 2V5YA 3BPNC 4P23D 1E67A 3MCLL 4OJFH 2I5YL 3ROOA 5GS0H 1CLOH 3U1SH 3EFOB 5AW3B 4I0PC 4KXCA 4KJPC 3N1GC 4MGXA 2P46B 4IDLA 5ICYB 4MZ3A 2PPEA 2H32B 2CUAA 5CP3A 1OSZA 4MLSA 5IB1A 2VDQH 1BCIA 4JFFA 2BY0A 3TH2T 1OPGH 2Y7QA 5I1IH 2ERJC 1P7KB 4OLVL 2EDFA 5EF1A 4M4RB 4UQ3A 1DE4A 2ZUWA 2E9GA 5F0JB 2E9WA 3BHBA 3HG0A 4DP4X 4IHOB 2NY0C 3FONA 5CKAA 4FYTA 3BQVA 3ZE0F 1HDMA 3DIFB 5J1AB 1TTCA 4PWKA 1I1FB 4QHPA 5EORL 2AQPA 1TJGH 1IKNA 1QFUH 1I1AB 1USZA 2X4TA 3G04A 3L3IA 1SOQA 4LCIH 4RGOL 5EBWA 5F93C 4R4FH 4BK5A 5HYJB 3T9WA 4W9KC 2OSXA 1MCLA 2Z7UA 1SDDA 3ZQXA 2R7EB 2C4FT 3LOWA 4GH7B 4DERA 5JLZA 1BQRA 5FYJD 1DVZA 3LNFA 5L2KD 4UV4L 1J8KA 1KN4H 2DMKA 4QHLA 3DJRA 1BFOA 2YOAA 4KMLB 1GJWA 4ZPVA 3SE9H 3QWNA 4JQIH 4ODUA 2NDGA 3QG6A 4JJ5A 4BK4A 1DJXA 4YE4H 4G5ZL 2CLVB 1KBBA 4H1LG 1F41A 3FB8A 3PIQA 4Q74A 5MEQB 4UUJA 3EGSA 4XRCB 3WSQH 2X1XR 2V4LA 1DJHA 3GJEA 3KYNB 1URZA 2A38A 2BP0A 5GIRB 4O9HL 3RVVD 3IMRA 2V37A 3TX4A 2YKLH 1DVFD 1AS6A 2ENYA 3GI9H 4G59C 1HNYA 2J72A 3AG1B 3RWJB 1SF5A 4MVBD 5ADPH 4P5SA 4EI6B 3D5OF 1T20A 1NPJA 3IXAA 5KYUA 4DN4H 1HWWA 4BSWA 3GUTB 3WS3A 3M7FB 3PGFH 1EAPA 1R24A 1HEZB 4KNSA 3Q2NA 1FIEA 3T8MA 1X4ZA 3AADB 5IVXF 2FVNA 3IMSA 1MCEA 1CVSC 1NLDL 4KK8D 3DA0A 1RY7B 3SGDI 2SEBA 3FN0H 2HB0A 3LEXA 2AJXL 3QNYA 4NC1E 1NAML 2QQKL 3GS0A 3S2AA 5MI0B 4UV7H 5LQBH 3UTSB 1DBAH 2BFVH 3LEYH 2FUTA 1U8IB 3L4UA 1NQBA 2FUQA 2VXQA 3VACA 4HKZB 3RIAF 2A83B 3JV6B 5E7BA 3AQXA 4BGLA 3KLAB 4PJDB 5F0LB 4RH4A 4OH2A 5IJVA 1BQKA 2ALAA 2TSAA 1DQQB 4J4PA 3OKEB 3FZUC 2VE6A 1BVNT 4FF9A 1PDKA 4IKIA 4HISA 5AW7B 1OD7A 1UHVA 3OKNA 3RX9A 2XY1A 4ERSH 1MFAL 1FIGL 4OLEA 3CGTA 5BW7C 2X4RA 2NY4B 1MNNA 1S9VA 4MYPA 5SWZD 2WVVA 3GXPA 3I02B 4X6DB 4Q4IA 4K9EL 4CN1A 3RVUD 3SQOL 5HHNB 4XPAL 4QT5A 4XCEA 4L9DA 4F15C 3FF8A 1O9ZA 4YBQD 2R39A 1DJZA 2N7AA 3RLSA 3RWEB 2ZG3A 1CD9B 2Y1AA 2CJ3A 3S37L 4IBYA 4FOMA 4FTVD 5AW9B 1AC6A 2NW2A 1UWGH 2W9DH 4AZ8B 32C2A 1YEGL 2ZCHL 3N5AA 4Z7UB 2X6AA 2XZCL 1YC8A 3ZE2B 1HILA 3MRQB 1NDTA 3VE0B 4HMEA 4YEEA 4L1SA 4HD9A 4OJFL 5MENB 3CN0A 3GQFA 1HE7A 4LE8A 1I1YA 1AHWB 2IXQA 4NO0A 4A2EA 1JPSL 3PWNA 1RIVH 1L6ZA 1FN4A 3EXLA 2YGOA 1JPGB 2KQMA 5GS1C 1QLEB 1N4XL 2JIXD 4KVNL 3VSTA 3QDHA 4FQJL 4KAQH 1ITCA 1HI6A 1X5YA 3VWKD 4I7ZC 2JJVA 3QZBA 2NT1A 3J8F7 4Q56A 1WEJL 2Z31B 1MIEL 2EC9U 3OMZA 4WLCA 5I8KH 1GYUA 2DWXA 2LU4A 1HOEA 3Q7JA 5B38A 2B9BA 4EDWH 1KZYA 1AKJB 1AIFA 3EYVA 1PSKH 5JHLL 5JTWA 5CSZA 3Q6GL 5I1LB 4GKLA 4KPHH 1FFNB 1AGEA 2R4RL 1LJMA 4XNMA 3FTZA 2IALB 2BIQA 3GF8A 3L7FB 3LS4H 5DK0B 1JDAA 1AQKH 1SY6L 4OKDA 3VWKB 4HK3J 4MJ2A 3B9VA 1E27B 4FULA 5ACZA 2ZCLH 4HIHB 1W8OA 2GC7C 1PG7H 2A4EA 3BH8B 1QR1A 3LNDA 2AC0A 3DLQR 3CFJA 2NCMA 1A8JH 1CDHA 1FDLH 1J10A 1LTXA 3NH7L 2P5WD 3FCSB 3I6GB 2VC2L 1NZRA 5HDBF 1KENH 3T0XA 2D03H 1ETZA 4WHTB 3TIDA 4PJHF 1A2YB 5C70A 4OZIA 1ZANL 4FA6A 2XYBA 2Z4TA 3CN3A 2ISDA 3WXVH 3OKLB 1I8MB 1KYDA 1HAUA 4TNFA 2DJSA 1AGBA 3LNEA 3V5DA 1I9EA 1T03H 3UBXA 5KBPA 4M1GH 1FG9C 1HHGA 4XAKE 3JWNH 4PTUB 2GHZA 3ZRSA 5KG9B 4WO0A 5EWIL 3VFOA 2DH3A 4N0YL 4HPYL 3TVMC 3C08H 2WUBH 1I31A 4XMWA 2IEPA 3W2DH 3G5ZA 3Q8BA 3EJCA 4JM2F 4XVTH 3DGGA 1YYMH 1L7IH 3CU1A 3L4ZA 2DWDB 5C0GB 5GSVA 4AZUA 4YXLH 4Q6YA 4HAFA 1V3KA 5JNYA 2HRLA 1RK0B 1ES0A 4CW1B 4A2HA 3ELAT 4ELMB 1KTLA 4HALA 2CHDA 4DP1X 4FZEL 3WE1A 2HFFA 1AXSA 1UB5A 4R7XA 1TEYA 1YRKA 1VPOL 4V1DD 4HIEB 5DXWA 5TQ0L 1CFBA 4FXKB 2O6CA 4FKHA 3MX0B 4X7DC 3FUDA 5DJAA 1C16A 3MV8D 3MRGA 3QZOA 2XPZA 3DXAA 4C56B 2Q86B 5LDUA 2CG9X 4UDTA 1MQ8A 1T6VN 1UZ8A 3OAYH 1CGSH 1EJOL 3R7RA 3WIHH 1QSVA 3SDAC 1JYWA 4L3AA 2GT9A 4QEGA 1YMHB 1CIDA 1NCGA 1X7QB 3UAJD 1FZJA 3MV01 1FNSL 3MTXA 3PV6B 3NZSA 2PWFA 1MCSA 2J2ZB 3NCBB 4AENA 3VI3E 3RDJA 1RULL 5IY5B 5IHUH 4LIQL 3U36A 1F4YL 4HH9B 1BYNA 1LLAA 1ZPLA 4N0UA 4D3CH 1T83C 2EEFA 4HH8A 4NN5C 1HHJA 3JZ7A 3RYMA 4PRNA 4AYFA 4NZRH 2B2XH 1E9QA 5D7KD 3V0DA 2A6JB 2XN2A 3EG9A 5DA0B 3ZQ9A 4Y9BA 2FATL 3MRIA 4PJ8C 1G9EA 2L0DA 1QNZH 2ZOOA 2NR6D 2OA9A 4CDHA 4H8HA 3DX9B 3EFFA 4JFPB 1RK0A 2FWSA 4G1EB 3GYRA 3ZE1B 3UJIL 4DN3H 4Z3TA 5I9QC 1EFQA 1JGLL 3MRKA 5FUCE 4RA3A 1UQSA 3I2CH 3CDZA 3A67L 4H25B 5IESH 4M5ZH 1IC7L 4NC1C 4P9ML 4AI7A 1F11A 3EGXA 4BZ1H 1A1OA 4DGIL 3VFSB 4BZ2H 4N26A 4D9LL 3EUUA 3CSTA 4FXKA 4P4KC 3DVFA 1DANT 2EDTA 1PFCA 1PZ5A 3MOBH 4JPIA 4BRVA 3ISRA 4F3FA 5J89A 3HZMA 1IAKA 4Z7NF 1W6LA 3US1A 2VW4A 3I6LE 1MCJA 3ZY7A 2OMVA 2X4NB 4LCWE 4RIRB 5A2IH 1DQLL 3G6DH 1A7NH 4RDBA 2WBJD 1IILE 3L48A 3G6JB 1TFPA 3LRSA 4HCIA 3FYEB 4ZMAT 1GW6A 1XWVA 2WK2A 4M7JL 3ASNB 4ZFZB 3ARZA 5PAZA 3KNBA 2VQ4A 3MBEB 4NZ8A 3U48A 4N2OA 4DAGL 4JM4H 5FR3A 2VSDA 2YSTA 1LO2L 3LNHA 1NBCA 2DQDH 3TJEL 3KYAA 5LGKA 1A7OL 1N2RB 1RUML 2ED6A 4DTGL 3DTUB 1MCDA 3GHBL 5A1AA 3KLDA 4LL4A 2HN7A 4MMYA 5T1DL 1I8LC 4M5ZL 2CUMA 4IKKA 1QD0A 3U9PL 1UD3A 5I16A 1A9VA 3ZRCC 4NM4H 5ALBH 1MW0A 2F1BA 3F58H 1EZVX 4NO0D 4ICXA 4NQDE 4L18A 2RD0A 1PS3A 1Y6KR 2P52A 4JFYA 4HKBB 5KVEH 1TNNA 3FQRB 5D1QC 5TTRA 1XTLA 5I24A 4X6CE 1G7LB 4FZ8L 4HIPA 1CT8A 4J2XA 5KSVB 4PI0A 5JQHC 2VAAA 2WSPA 1DDHA 3CLFH 4R4BB 4RAHA 3ZT5A 4A04A 1AH1A 1L9MA 4I0KA 4X6DA 3ATAA 2J6EA 2X1WL 5C3LD 1PPIA 4AMXA 1JZ7A 1AMYA 2BDNH 2W07A 4UQ2B 1J0JA 4YLCA 3TT1H 2Z35A 2BP8A 1WK0A 4JVWA 4L8CB 5CGYD 4NO0B 4GXUM 4B3VA 4MLIA 1NUNB 3KPRE 3ZDYB 2DJUA 2MH4A 4O02H 1VKXB 1KWKA 4OTXH 2YPLB 3BQUC 4KI5E 4F80A 1EJOH 4JRYD 1JBJA 1NCAH 1HAWA 3LN4B 5LNDA 5KAQG 1KG0B 1KJ2H 5KUMA 4ADJA 4C4BA 1YEHL 1XMWA 2VDKH 4CMHC 1AHMA 3GBNH 4RWHA 5AVQB 5E2WH 4R9HA 2IDCA 3M8OL 3F65A 1F4WL 4GRWB 2HVJB 1QPXA 3IXTA 4YHLH 5DTFA 4CRPA 1SYSA 3I6KB 4JUTA 3NSJA 2MPAH 2ARJQ 3V6ZB 3KGUA 3QHFH 3BPLB 3HUJB 1BP3B 2KDYA 1JTPA 4WTQA 1F0LA 4HCFA 4NFDA 5GPRA 3HI5H 3OPZL 3A6BL 3LHPL 2HXAA 3B2XA 3SE4C 1XGPA 4UANA 4AYSA 3EH5B 4XWGH 3IMVA 1S7SA 3H2PA 3MO1B 1AXTH 3UAEA 1RHHB 3JWOL 1XGYL 3N1FC 3GNMH 4RMBA 4XPFH 4HUCA 2R51A 2J25A 2UXGA 3DUHA 1I3RA 1A4KB 5D1XD 3EYUL 5DUBA 5F1NA 3ULUE 1L0QA 1ORSB 5FCUH 5FM4A 1N0LA 3UP6A 3N85L 5T1LD 5LJYH 4FXGC 1FLRH 4J6RL 3D51A 2MKLC 5CP7B 1SBSL 2X9WA 3UTQB 1XF4B 1GA2A 4OZGA 5L7XL 1P5UC 3QEHA 1GYAA 3GLZA 2OQJB 3OXSA 4J3OD 1XB6A 1CL7L 3ZIMA 2DMGA 1CFQB 2P80D 5KWYC 2Z3FA 3VG0L 3LHAA 3T6WA 1BGXH 3B7TA 5JPMC 5GRVL 1NMCB 1BBDL 4Q2ZA 2B59A 1FZKB 2O30A 1D3CA 5AKTA 4HLZH 2J4WH 5KTEH 3FCTA 1ZAGA 3N6YA 4I8DA 4K3GA 2NTFB 3ZDYE 4GXFA 3DVGA 3H6AA 1SN2A 4J3OF 5HJ3B 4YX2H 3MUZ1 5INCB 1CD1B 4LQFH 3F62A 5AL0A 4G7SB 1CFSB 5DURD 4R2GB 2CXGA 3TFBA 2AMGA 1O75A 3PL6C 2FTAA 3MRRB 5J3HC 4YQXL 4KUZH 1ND0A 3A4DA 4N25A 1MF2H 3RVTC 3SB3A 3HUJF 3VM7A 2DQUL 4N8VB 5ICXA 4EIZC 4TL5A 2WQ8A 1P6FA 2BXZA 4M7LH 1JP5A 4K3EL 2PNDA 3U1PA 2ZWLT 3D4ZA 4P9HL 3WJJC 4W70A 2V2XB 4N2NA 1C9SA 3VJ6A 1GTFA 1S7SB 3MRGB 3QO0B 1ZJBA 4UBDD 3CFDB 3TO2A 5KZCB 2EKSB 3CH1B 4C56A 2QGCA 3R19A 3AFLA 2PABA 3G6JF 2OZ4A 5BS0A 3LZLA 3HJEA 3IDNB 2IAMD 1ZCRA 4HJSA 1PZBA 1F6AA 3W1ZA 4Z7NB 1OF2B 2YGNA 4YDIL 4P57B 2Y2YA 1HH9B 1RIVL 3LDBC 4F7TA 4LGPB 4YLQT 2BX5A 1YNLL 1Q94A 2I26N 2G9KA 1IGMH 2Y0SA 5K9QI 1L4IA 1XZ0A 1U4FA 2WQUA 5B1BB 3SY6A 1PBYA 1CICB 3B3IB 4WK2B 1BAFL 3NFNB 5DMIL 5F7AA 3VH8A 3KLHD 1IE5A 2G60H 2PKDA 1EHAA 3ARBD 2XVBA 3QO1A 2YK1L 5K1JA 1UH3A 2OJ1A 2Q2EB 5CSGA 3EGDA 4HC1L 4YDJB 4RMSA 4J28A 5JHMA 4WW2F 1R3JB 1R3IL 4KDWA 3V4PH 3V6BR 1OQOA 1GOFA 5HI3D 1LO0L 2HJFB 3MV7B 3DIVA 4G7YL 4NN7C 2AQQA 4OGAD 1A7QL 4D9QD 2NYKA 1M7IB 5SV3A 4N8VG 1UOKA 2XTJE 5AZEL 2ZXBA 2AI0H 4NZTL 4RLDA 5GGUB 1IAOB 2WAHA 5ANME 3ENEA 1D7FA 3WTXA 5AFAA 3QO0A 2QDVA 1MCQA 2Y4SA 2AQ3A 3EYFB 5F96L 2EEXA 1UQSB 3FHAA 1RZGA 3E9UA 3V4PB 4PRHE 3KJ6H 2YD6A 4PJEF 3UO1L 3LKQA 4YHIA 4PGEA 2ITCB 3S2CA 2N1TE 4OZFA 2BS9A 1MCNA 2QZQA 5IW6A 4M4PA 3G6JA 2PYED 5BV7L 3LNGA 2H32A 5EZJB 1YQVL 3MCLH 4DGVH 5KBDA 4PEEA 4WI5A 5JW3H 4P04A 2JNZA 4JO4H 3HI1A 2NY3C 4M9PA 4BQCA 4IBUA 3BT2L 1RZ8A 5KSAD 5C0BE 1M7DB 5D71L 4G42B 2K4AA 4JPKH 5ITFB 1YSOA 2Q8BL 4JN1H 3KYKL 3NACH 1K2DB 3HW7A 5T1DH 4PRIE 1RPUA 3M45A 4MNQA 2X4UA 1HDMB 2R0LH 4HGMA 4LAQL 5J1AA 3SDXA 2X0WA 2YMXH 3NCJH 4QRRD 4XB7A 3A6CH 4AGNA 4U7MA 3TBBA 3CX5J 2J7LA 4KY1L 2JB6A 3PAVA 2PYEB 5E6IA 1FO0A 3SDDC 1KXVC 1KJ2B 3QDGD 5FUCC 2CKBB 4L4VA 2VRQA 2BRQA 2E4FA 4WFED 2DH2A 2FD6H 4RFOL 1PEZA 3QDMB 4WGKA 2A6IB 2DIEA 3P2BA 3QUZC 4BFFA 3M1BB 4OV5A 1BG1A 3DMMA 3HS0C 4XPHL 2BP5M 3FOLB 4KROD 4PWIA 4JHAL 3MOQA 2FT6A 1GC1C 4GBXD 3AUWB 4ORGB 5I16B 1Z66A 1CT8B 5ANHA 1N59B 3NYKA 2A74C 4RGNC 3IS1X 2RIKA 3OG4B 4M48L 3QR2A 1DQJA 3HFML 1IBGH 4H40A 2EH8H 5HYSA 5JOPD 3ROLB 2D7PA 5BVJB 2BNQE 4XZUA 2HUHA 4APQD 1CUOA 2VLRD 3L95B 5GSRB 5DD3H 3AT0A 4OU3A 3RURA 4G43A 2A9ML 1TSHA 1YVLA 4NWTL 1EHXA 5HDLA 1DDHB 2J12B 3ES6B 3I2CL 1LE5A 2IMNA 5CCJA 2OTWB 3VYOA 4Z7OB 2YPLA 4PLOB 3TA4D 5HGGS 1U95B 4G42A 1JNHA 4MHHG 1NCJA 2KL6A 5DUML 5J11B 1X3DA 2OL3A 1S5IH 1PJ9A 4PJFF 3VXMD 1T4KB 3OKDA 5K93A 3ZSTA 5I1IL 2YFOA 1MCWM 5L0QC 1C5DB 3SO3C 1QSEE 4QHUB 1YO4A 2WZPA 3HPLA 4M62L 2NNFA 4N9GB 2ZXEB 4JKPH 1FYHB 2HPOA 3AQDA 3B2VL 3KW7A 1KJ2A 4YC2B 4YSTA 3U2SA 4PJCE 2CKBA 5T33H 3HUJA 5MI0C 5D4HA 1MN4A 1BQ5A 3QJXA 3BCDA 3N42F 5IFHH 1NIEA 4P2QE 5E1AB 3ME0B 1FJ1B 5AKVA 5ENWB 3SGKA 3S35L 3QPXH 4XPGL 3IJEB 3H55A 4WTZA 2F5AL 2VQTA 1CMOA 3ELQA 2B0SH 3FTXA 4QO1B 2WQXA 5F6HI 3C9NB 3SPVA 4PRPE 4KRNA 3H2QA 4EBQH 2V9QA 4R7DB 2A6DA 4NKDA 5HI4C 4YSUA 1NDGA 1QX1A 2ADIA 2O72A 3REVA 4ZAKD 2FSDA 5JPMB 5E8OB 2Y7MA 3IFOB 3FOMB 2GJ6B 3P30H 1CBVH 1A6WH 3MMEB 1NSNH 3U6RA 4N2AA 4N2MA 3OGCB 3QEHB 5LN8A 3KXFA 1SM3H 2D7OA 2QSTA 5E5UB 1AHWC 4TOYH 3ULUF 1G7MA 1MJUL 4TULH 3BCFA 3WENA 1Q72H 1IKNC 2KZ1B 1OAZL 1DQML 2NXYB 2XKSA 3DRQA 3QJHA 4EAEA 1N70A 4WHYG 4HLZG 1R3LA 2WO4A 4R7LA 3TBSB 1ZLUK 4ZAKB 2MOQA 3WIFB 4WO4B 4N2EA 3DSFL 2M2DA 1C5DA 1N0XL 1UM4H 4FQCL 3WELA 5KVGH 2DQIH 5G5DB 1RL1A 1QYGL 4IRJA 1R3KA 2J8UB 4QOKA 1ECZA 5KVEL 3KYMB 2FJGA 2E6QA 3DOSB 1WCBB 3L3IB 4K3HA 3PP4H 2WBWB 3B9KC 3F7LA 1E4KA 1HH6A 4YBQC 3X1EA 2H8PB 1E8YA 3U0PB 3BESR 5C0AB 1J8HE 4FG0A 4TXVB 2FEEL 4GP8B 4P5RA 4FNSA 1OGTA 4MAYA 1P5UB 4GSQA 4HXBH 4NOFA 3FQUB 4JFHE 4ONHB 5E8PB 4ESKA 1HQRB 1MFDL 2F53E 4PJ6A 2F58L 3S3PA 1H3VA 4ODUB 2K4WA 4JJ5B 3QDAA 1TJIH 2WMPB 2V6HA 3FTSA 4DHLA 3ETBJ 1UENA 4YGVB 1CDGA 1FUNA 1RJCA 5GRJL 1S7RA 2E46A 1D5BB 1KJMB 4AV4A 5AOJA 4GNKB 5EIIG 4QY8B 3FOMA 5BVPL 2ZP8A 1FV1B 4XX1E 5B1CA 3DSNB 3FT9A 4MMXB 2ED9A 1SMDA 2R1XB 4XB3A 3VTTA 4UTBL 5DGRA 4DVRH 4KKBC 1BLIA 2R9HD 3HHMA 1K8DA 4PR5B 4TNVK 3AAZA 3JXAA 3NCYS 4Y19D 1CICA 4POZD 3WUWG 5DFTA 3MJ7B 3E3QC 4AIXA 4I1RA 2NZIA 3GEFA 1CK0H 4DKFH 3S0PA 3VI4F 4XMZA 5C71A 4K71C 1FFPB 1A6UH 1YEWA 2LU7A 5C0IB 2E7HA 5DRZA 2ZX5A 3C6LA 3K3QA 3RZCD 3NCYP 5KG9A 1PLBA 4GT0A 2ZWSA 1MFEL 1VGKA 1ASQA 3OWEA 1OP9A 4FTVA 1QRNB 3CIAA 4MJ6B 5ANMB 2P8LB 2DMBA 3U2IA 1KEMH 5ESQA 3DECA 3SPGA 5F9OH 5CJOH 3ARDB 4KO7A 4XVSH 4R90L 1XFPA 2Z92A 1MKFA 4HHGA 1NCTA 4ODVL 4QTFA 3QH3A 8CGTA 2VH5H 2I85A 3TEXA 4EKJA 4W9JC 2AXFA 2WTRB 5D6DA 3PFUA 3PHQA 1PZSA 4LASH 4Q8BA 3OX8B 3Q9PA 4NLAA 4ZFGL 4P2RD 3OTTA 3WNJA 1CE6B 5EEXA 3BWSA 1TETH 1RZ8B 3UJTL 3DROB 5I18H 4YJZL 1KNOB 4EO5A 5FAAA 1YNKL 3GUFA 4JVPA 3KPQA 2AP2A 2D3NA 3KD4A 4XO5A 3D0LA 4HJJH 5DDHB 2RGSA 1KV3A 3PXLA 4C56E 3P0VL 4N0CD 4N1EA 5ABZA 3EAKA 4M61A 2A0LD 3TBTA 1XH2A 4XO4A 1WFUA 1NCOA 32C2B 3G3LA 3IKKA 5L2JA 4Z7UA 1FO0H 5E6IB 3WDIA 1A9BA 1YEJL 4ETQA 4YFEA 1CTNA 4AQAA 4F7EA 1K2DA 1UWEH 2PCXA 2VC2H 3L3KB 2BHFA 5DJCB 4Z77B 3ABMB 2BFGA 2C3HA 2ITFA 4M29A 3MLPA 1PZAA 2ADGA 2YFNA 4JG0L 3D85B 4OGAC 4O2CB 1BQLH 1T0PB 1WFOA 1KIUB 2UZYA 4M00A 5CJ5A 4MJ4A 3MROB 4ZI8A 5TE6L 1KGWA 3GMNA 2NQDA 3TV8A 1D9KB 3DI2B 1NMAH 3BP5B 4M6NL 5K5YA 5F7LB 4J39A 4OZFH 2DQIL 4OD2B 2O26U 1HJBC 5HYSB 1M2VB 4WDIB 4JDEA 4BUGA 2NXYC 3VU2A 3RGVB 4OFQA 3TPUA 4HJUA 2XWDA 1ADWA 4WZ9A 1EPFA 2FYVA 3FB6B 1UC6A 2GITA 2J6EL 1FZOA 4OCLC 3PHAA 3B2UD 3S3SA 3QORB 3EBGA 3A6BH 3LHPH 2H3XC 3WKNA 1MCPL 4Y4HD 4PP1D 5LBGA 1DN0A 3MLWL 1PLAA 4KO5A 3B43A 1XR8A 1O9VA 3O41B 2X10A 3AXLB 2ROXA 4A6YL 1TCMA 3F7RA 4RRPG 5AD0A 2C34A 2X4NA 4C58B 2Q7NA 2OL3B 5LWYH 2EVFA 4OM1L 4LPWA 1CS6A 4OB5L 1MCOH 1T4KA 1INEH 2WINA 4PRDB 1EH9A 4A39A 3N1PC 2GYSA 2VERN 2NNXA 4PJAE 2WXFA 5DS8A 4ZFZA 3TEUA 5DR5L 3H0TB 4BHUI 4DP6X 2QGDA 4PG2A 2EXYC 5DHMC 3G6JE 4ZUWA 1FVCB 1CDBA 2C7FA 4F7EB 3L9BA 2P8PB 5IP4A 4NAMA 4WJKB 4ZW8A 2KDGA 2Y7OA 1IJ9A 2AJZB 4ILDA 2P44B 4M6NH 1WWCA 1H6FA 1ET8A 1OM3H 1KC5L 3D85A 5F9AC 2CH8A 1ZLUH 3P02A 2YD7A 3CFBA 1GVIA 4IOSA 4X5PA 2WVSA 2P80A 3NJJA 4UQDA 1BMWA 5DI8A 4LPXA 2WQRA 1A6TA 4QI3A 1PKQE 1JI2A 1KJ3L 2BO0A 2EZ0C 1XF3A 2YAOA 2BZCA 1GGCL 4HJGB 3VXRA 1XT5A 1A6UL 5F6HJ 1U3HB 3HNTH 4H1LB 3DMMC 5DZJA 1NBVH 4F8NA 5F70A 1LGVA 2VN6A 4NJAH 3S96B 3IPBA 3BP4B 4NBYB 4XNQA 3F5WB 3LYRA 1A4BA 4RGMB 3SPVB 4XCYB 3KEHA 4NPKA 4YHYC 1RJLA 5CR1A 3CFMA 4JLRA 4RISH 5I6MA 1QEWA 4PGDB 3BPCB 2B1HH 5DYFA 1DJWA 2W95A 3MJ9L 3Q1EA 4UNVA 3O0RH 3WE6A 2W07B 4UQ2A 1JNNL 2NR6A 1A22B 3CVBA 3P77A 4KJYB 4JM2C 4LEXL 2EADA 4ZTPL 4UDUB 2GTZA 4NX0A 5T5NG 3SGDH 2NY4C 1PIGA 3WY4A 3IAGC 2DD8L 1E8ZA 1DN2A 3WFCL 2XX1A 1N6UA 2RR3A 3LKRA 4O58L 4TVPH 2PO6A 4G8FB 3B2UC 4NZDA 4L4TB 1T1ZA 3P73A 4AEHH 1FVCA 4ZX3A 1Z3GL 2IANB 2NY7L 4XNDA 4HXBL 4HYTB 3L17A 1M7XA 4IBTA 4KH9A 3HLAB 2EJ1A 4X6BB 2WCSA 2IH8A 1SYVB 3UBXI 2OR9L 3IK2A 3BGMB 5G5DA 4AGOA 2F1AA 5EBGA 2CJUL 2NY5C 3TLRA 5I5MA 4IRJB 5TDPB 4HH9A 1GHFL 3TV3H 4XNUH 2B5IB 3X1FA 2X7LA 4KITB 3AWGA 1SN5A 8PAZA 4LLMA 1PZUB 4WV1B 2W8CA 3GK8H 3U25A 4LCUA 3W9DB 2WNXA 1Q0YL 3MACL 3U4KA 3ARFD 2NX5E 1QFWH 4F7CA 4AK2A 2WWKO 4V33A 5AOKA 3ULSA 1WC7A 4NDMA 2MPAL 4K9EC 3OKMA 4KZ0A 3SE9L 3ZZLA 2ICWA 5FYJL 4LLYB 1GGYA 4TMPA 3C6LD 5DT1L 4FNLH 1SBBA 4MQ7A 2C1OA 4K0OA 1I3RB 4ODWA 2A0LC 3US9A 4EN3C 3GXUB 3Q5YA 4PSPA 3RVWD 1QEWB 2F5AH 1A4CA 3BEWB 4IRSB 3FU7B 1XGUA 4QXVA 4YDKL 4QY8A 4B9YA 1F1AA 1JPSH 4MD5A 1WIUA 1MUJB 1NA8A 4JPIB 1X44A 3WKQA 4F37K 2ICEB 3HC4L 3QEUA 1IAKB 3FCUB 4PBDA 1W8NA 2LTQC 5FCUL 4I9WE 4JFED 3VRJB 6FABH 4S0HA 4TTDD 5D1QE 5GZOC 5ADPL 2UYLB 1FFTB 5BZZA 3TT1L 4F15B 3O3AB 2FH6A 2HAZA 2B5IC 3PJNA 5HGDA 5I75C 4XVSL 1FL3A 3F84A 5FDWB 3K81A 4OSUL 1CU4H 1WFTA 3D2UD 1BVZA 2VABB 1E4XH 4KQ3L 1E5ZA 1FG2A 1VADB 3EHBB 3FO2B 1BXAA 2WLNA 5E2UL 2CNYA 3DRTA 3N3EA 4JE4B 2ZUUA 3UYPB 4GKZA 2EDDA 1S4IA 4CSTA 1OWRM 3T3MB 3RB5A 4KQ4L 1XF1A 4PRHD 5D2NE 1EERB 3GXFA 5E23A 1GH7A 4WV1A 1AQ8A 4HOWA 1P4BL 3HOGA 1WEJH 4QCIA 3MBED 1IGJB 5BJTA 4WWPA 2WLIA 1TMCB 3CDGB 2E7BA 1RUPL 5F7YC 4PW9A 2IGFL 2XN1A 1KGUA 2GG1A 4ODSH 4F9PC 4AJVA 3WS6A 2LT9A 2ESVA 1V3JA 2X28A 1EGJH 3IRZA 1KB5H 1CYWA 5DZLA 3CVCA 5FUOL 3CFQA 4IW4C 4UMGA 3SKNA 5DHYB 3W11D 2QLYA 3R0MA 1UJ3B 4MNQE 3BH4A 3I9GL 2YXVA 4KXZI 5J6GB 3FU7A 1OW0A 4JPVL 4Q9BA 1T5XB 2GIMA 4WY7H 5ID1B 1MH5A 2AABL 2DTML 2VR3A 1S7WB 4MZIA 1PG7W 2WLZA 3V0AC 1KNOA 1FLRL 3G9AB 1FLTX 4M1GL 5IHBA 1Z9PA 1C5CH 3C8HA 4X8GA 3B3IA 3Q43A 3VWJA 2IWEA 1XCQB 2XXCB 3FO1B 5BXFB 5SX4I 5BS0D 2R0WH 5FKPB 3L7EB 2VXUH 5J11C 4O2CA 1K5NB 4KQ4H 4KKLD 2OBGA 4I0CC 3GBEA 4LLDA 2CDEB 4I3RL 4PJ9D 1O7SA 4TLKA 4XWOC 4PY7B 5F1OB 3P0VH 4O51B 2D0FA 4ZODA 2F7IA 1RK7A 2PUQT 5LCVL 2B1AH 1HSBB 5EZOL 3X14B 4AM0B 2W65A 5AOLA 2AS5M 3CBRA 2WZ0A 4J12A 4JDEB 4NYLB 1EGJL 1N3NA 3NMEA 4G80A 4YHPB 5F3HA 5FA4B 2OYKA 4JREB 1CDUA 4UIMB 2VE6B 2J4WL 3AWFA 4B9ZA 5KTEL 2VDMH 4R5TA 1UD4A 4UZSA 3EJPA 2BWIA 5FO2A 1BPLB 2PCPB 3FTYA 1EHNA 1AOZA 1E5BA 3RZCC 3A22A 1E40A 1X5XA 1NJ9B 3KWVA 1UUNA 4KXBA 2RQ8A 2JK5A 5IJDC 4FN0A 2HZHA 3ABZA 4UZGA 1FFRA 1L6PA 3MC0A 2ITCA 4QAWA 5I6LA 1RZKH 3E6FB 4ISVA 3QFJD 3GIVA 4QGYA 4G5ZH 1BM3L 1QW8A 2RALA 1CICC 1BXXA 7CGTA 1CF8L 3TN0C 2BK8A 3HHSA 2HH0L 2H7WA 3FT0A 3AVEA 1BQUA 5FYJU 4BFGA 5JXEA 4DEUA 4OZHE 1KYFA 3HB3B 4K5NA 1Z7JA 4Q52A 5ITFA 3VE0A 1HHIB 3SZKC 5MENA 4P59H 2X1PA 5L8KB 5IG7A 5E4AA 4W9LC 5J5EA 4E9LA 5E1QA 2OTUB 1R19A 2WXQA 3LPFA 3PWVB 3FO1A 3BN3B 3MJ8B 4PJAF 1IE4A 2OMYB 4KTDL 2OQJA 3UBXG 5C9JB 5FO8B 4KXDA 1U21A 1EK3A 1A6AB 1RUAH 2XTSA 3QAZB 2LW3A 5FHAL 4AY0A 2ZIDA 3D3VB 3G08B 1CE1L 4K3EH 1XO8A 4LLDB 4JY5H 4CUCA 4KTGA 5D72H 5CBEB 5C7XH 1H9VA 3KPOB 2K9FB 1C1EL 1WVZA 2ZXQA 2R69L 4HAGA 3TIEB 5FX3A 4WI6A 2QGBA 1HXYA 4LPYA 1T7VA 5IW1B 4CC4C 4A1RA 2J6WA 1NC4A 4Y5XA 2VW7A 4C59B 5B8CB 1CF1A 3CFBB 2FSEA 2ATPB 4JVUA 4FQ2H 4G7QB 1KIPB 5FF6B 43C9A 5C0BB 5EIVA 3QUXC 2O6DA 4OCXL 4UILH 3DOIA 3DWTA 3GO1L 4HGWA 3DJ9A 4G11A 4M8RA 2DD8H 3V6FB 2HLAB 3DJSA 3WJLA 1JGIA 3G5VA 2VMFA 2OI9C 5AW8B 3LNIA 1CFTB 4KTYA 1P2CB 3A47A 4ZZFA 5BCAA 4BFOA 3BDBA 2WGXA 1LP9B 1VGEL 3NJLA 1VRSA 2EDWA 3FL7A 4UT9A 3D6GA 2I9TB 2IFFL 1YEKL 3K0WA 3L3JB 4MCYB 1FVEB 4B9IA 1JCKA 5DRNA 3R1GH 2ZUQC 3WXWH 1NDMB 4DAGH 2CJSA 4UDUA 3RL1A 5H94B 1A1NA 4NZFA 3HRZB 5LBSA 4IKLA 2I25N 2XY2A 3OD3A 2X40A 5EUOF 1XL6A 4ZAKC 3UBXB 5HVHC 4H8QA 5FO8A 5AZEH 2UY6B 4LEXH 4N3UA 2F9BT 4GO6B 4PG2C 4LPVA 2Q7AA 2LU5A 3CFIC 3NZUA 2X4TB 1S7QA 3WEMA 2VDQB 4CU6A 5D70H 2YKKA 4N90E 2H32H 3KM1A 4FQQB 1ROWA 3O6LH 4J2QA 5E94A 4EOWH 4F7CB 3SYOA 2UY7B 5F6IC 1KCSL 4AQ8A 2IDTA 1U8QA 4HUKB 3QCVH 4Z7NE 4OI8A 3ATEA 5TD4A 2XZAH 5CFHA 2IH3B 3KAAA 4AQ1B 1LILA 4JANA 2GI7A 2GQHA 3T6ZA 3PWJA 3FT3B 4JAMA 2Y72A 2PETA 1RZQA 3UAJA 1E6JH 1WC7B 2YRLA 1IGFL 3QFDA 4OZ4B 1OAQL 3IFOA 2YRPA 1E4XI 1XX9C 3VXRE 3MX0A 3OZLA 3OLEA 3QQ4B 5C0CE 3MRFB 3MV7D 1IM3A 2FQFA 1BF5A 4NO3B 3K0YA 3NOIA 5D2NC 1NINA 2GEEA 3DX6A 4PJEB 2B39A 6CGTA 4OZFB 5IW6B 3WNOA 4XXCC 2GJZB 2R15A 3MRJA 1FDLL 2GT9B 1NCAL 5CNHA 1ZA3B 1T04B 4NPYB 1A6VL 3WNPA 4WI8A 2OMWA 1VSCA 4Y1AE 1D5IL 3R8BB 4LVHC 4HD5A 4JGMA 1AYRA 1YPZF 5LVEA 4K94L 2ZX9A 4DKEL 5K9OA 1BWMA 2MNJB 3VG9B 3PWPE 4L9LB 3VGAC 4G3YH 4P4RA 2FJHB 1HHKB 2DIJA 5D5ME 4ZO7A 1PYWA 4BSJA 5C0FA 3R4DA 5FOBB 3CNKA 4H8WC 4OKVA 1B9ZA 4K55A 5C0AA 1E9QB 4PJBF 4YDVA 5LGJA 3FFCD 2OJZH 3VFRA 3KL3A 4YFDB 1G43A 3HBGA 5H4ZA 1GKEA 3QDMA 1MFCH 5K69A 1SMAA 2NSQA 2VZSA 4W9IC 3SE6A 4URKA 5KVGL 2HTLD 2CK0L 3BUDA 4ORZC 3VQ1C 2G5UA 1TFHA 3SKNB 1RZ7L 2QHLA 4KK9D 3NDZE 35C8L 3S37X 4J3VA 1QTSA 3PWLB 5EZIL 2BNQD 1HL8A 4JZJC 1MXDA 2JTDA 2C7UB 3B6SB 3LKOB 3QZWG 1DEEB 3LTVA 4UNUA 2BH0A 2ZCZA 4JDVA 1SPDA 5FS5A 5BVJA 2BVTA 5GRJH 3PJSA 1RPKA 4BIKA 2R1YB 5AL8A 1CBVL 5J6GA 5K39A 2NY6D 2P28B 4XBGA 1XCQA 5BXFA 3BDYH 3CVIH 3JVFC 4AZ8A 2OTWA 4ODTL 1T4WA 1SLVA 2HJLB 3MRQA 2F2HA 1XCTA 3VFUB 1PCXA 1E5AA 2YAQA 3GSOA 4OFKA 3IB4A 3OB0K 4PYHA 5AVZB 1I1YB 5FV1L 1OM9A 2MFNA 3CVHH 1BBJA 3DO3A 5E5MA 3T08A 3MLXH 3RP1A 5D1QA 2XI9A 1N8OE 4J3WA 2CCWA 2AEOA 4HQQL 1H5BB 2VDOB 4KVCL 1EUUA 4BH7A 3PY9A 1AE6L 4JFFD 2H41A 3FUHA 5D7LD 2ZQKA 3HHRB 3TZVB 3C5SB 3U79A 1ORQA 3UH8A 1B4RA 2APVA 2Z92B 2K7QA 2FNBA 1HKFA 1MLBA 1QLRB 2WYIA 1W6WA 2CBMA 4C83A 2YXFA 3UTTD 4JPQA 3FTGB 4UIMA 3SDDB 1QOKA 1GJIA 3VFWB 1IM9B 3H4HA 2ZCKL 4QOKD 4XO3A 1C8QA 5C0RH 4QXTA 2LOEA 2YGVA 5J0BA 5ISZA 2PCPA 5HSFA 3BSZH 4JFUA 3V9FA 1DANU 3BQUA 5DLLA 2VAAB 2WHVA 4R4BA 1N5YH 4FHJA 3SKJL 3CZJA 1NAMA 1R5IA 2XWBB 3CX2A 5DJDB 4OAWA 2OJEB 4A7TA 1LWHA 3KPQB 2C4XA 4XHJD 4D9LH 5DURB 4LSTH 3H9HB 4HMCA 4AC4A 2ESVE 3P11L 4UM9D 3WUWA 2F6AA 2BC4A 4LEEA 2ILLA 1T2QH 5AZ2L 3WEXA 4MMZC 1HKLL 3QUML 4JFQA 2G4GA 3ZBMA 1FGNL 4OF3A 1TXKA 4D0DA 5FGBC 5EN2A 2YK1H 3RJQB 3QR1A 4P8QA 2MCPL 4P2RA 3MYJA 5HGBB 7PAZA 3WNIA 5JPNC 4ELMF 5CJXC 3NFSH 4JK0D 2EACA 1Y1UA 5GISL 2OTUA 4B7IA 1OT1A 3T0ED 5JOEA 1BVLA 4H7VA 2WXMA 3BVTA 4MQSB 5DEJA 3U9WA 7FABH 1IUZA 4ZX6A 5IW1A 1XIWA 5HYQA 1HHGB 3IFPB 4GIOA 4JPWL 5GRZA 2PO6D 4GRWF 1CQYA 1A6VH 5FGBA 4L9LA 4JQVC 3QUMA 3QZLA 5TQ0H 4GOSA 4BH7B 1W2KT 3GMNB 4K8RL 3ULUC 5KW9H 2FJGB 1VPOH 5BZDA 3UDWA 3EUDA 3DHJA 3MXVH 3VI3A 1LO5B 4F93B 4KAQL 3DI3B 3I9AA 4XP6L 3NSCA 3O4OC 1A25A 1JZ5A 3HE6A 1EO5A 3KPNA 4Q6IB 5E2JA 4G6KL 2R2HA 1NANH 2VO8A 2CDGB 1Y18B 1IM9A 1FZOB 3CXDL 2B1AL 5EZOH 4AV0A 3ML9A 5SWQB 1RAMA 4A2LA 4PJHB 2CK2A 4HGWB 4L0YA 1P1ZB 4YWGH 1OW0C 3L9EA 3BW9A 1D5BA 1KJMA 3K72B 1Q1PA 1OAXL 4HV8B 4PJ7E 1IT9H 4FZ8H 4WTXA 5CGYC 5C09D 4EQ2A 4M7KH 3N91A 5LN4A 2ZUXA 4BFNA 3RL1B 8FABA 1A1NB 4N24A 2DB8A 5HD8C 3KJ6L 1MIML 2BC4B 1A7PH 4UU9B 4E42A 1RQ5A 4PR5A 2P48B 1TT6A 3EO9H 2Q3AA 1FGVH 4FFYL 5F7EH 1SHWA 3DURA 5BO1H 1HEHC 1FYTD 5EC1A 4AQ1C 3B9AA 5KS9E 3BRDA 3MRMA 4Y9FA 4LLAA 2OSYA 4K3DH 4U2YA 4LLQB 5F21B 4ZUSB 5LCVH 2C9SA 4J1UB 4KHXL 4P06A 4X9HA 5CJBA 1INDL 1HNGA 6TAAA 4NXKA 2FQGA 2NDFA 3BLKA 1A1MB 1IVLA 1JHTA 1T21B 3OMAB 1VACA 3IDIA 4PUBL 3TGXA 3WN5A 1KUMA 3DVGB 3MAWA 4XPBH 4U6VH 1NLDH 2CPUA 3N42B 5LBSH 1NGZA 5T3ZH 4FA8A 4YXHL 2NSMA 3OAWA 2OP4L 2EEAA 4I4WA 3ET9F 3AJ7A 4UIKH 4M48H 2IAMA 2YPVA 5AZUA 1FAIL 1PKOA 4ONFH 5AWNH 3RJOA 5JW5B 2AXWA 2DEYX 2P8LA 2IQAB 3BDXA 3NIGE 4OFPA 4DJMA 5DMGC 5ALCH 5IR1A 5JR1H 4GAYA 2FGWL 4S2SB 1WIPA 2NNAB 4FJYA 1C1EH 3DETC 2H9GB 3NZ8B 3F7VA 1YNTF 4FYRA 3C5ZC 3FQNB 4HZLB 3DGCR 5EOCJ 3QJFB 5AB0A 3FFDA 4FQLH 4Y4FB 4JLRB 4OZIE 4GT7A 4FI6A 4QRRB 3RUGF 3V7MA 1U93B 1JXJA 1GCFA 3EGXB 4P5MB 2DL9A 2GJZA 3U46B 3BPOB 3ZTJH 3HN5A 2KLSA 4ODSL 4RETB 2JJUA 5EOTA 1SDAB 3CZLA 4N8PA 1PZ5B 2QQNH 3O2WL 5F1IA 2R0KL 2OI9B 2YBGA 5CCGE 3W39A 1VENA 4WTWA 3GSVA 4M4RA 1F6LL 2QHRL 3TASA 4U1MA 2APWA 1JUFA 1YY8B 2V7NA 5CKGA 1XR9B 4JO4L 4Y5VC 2DAVA 2XQYA 3LRKA 5T33L 2AK1H 3CHRA 1G5AA 2IBZX 4AT6A 4NGHH 1VZHA 4WVRA 1PVHA 2N7BA 2XJKA 4TF4A 4P3CL 1LO3L 3W3BA 5LGJB 3FN9A 1RJZB 1P9MA 3KPLA 4JZOB 4G82A 3HRPA 3MFGB 3UG5A 3STLA 3P3UA 3OZKA 4FA7B 2R59A 5AZ2H 1J1PL 4QHLB 5F71A 4HS8H 3QNXA 3SJVB 2HJFA 5KVEE 1J0KA 1U3NA 2D9QB 5AVVB 1AO7D 4U6TA 1NM9A 4X5XA 2XYCA 4HOXA 5BQ7A 1HWHB 5AG9A 1R75A 4N5ED 1SXZA 1OL0A 1JFQH 1L7TH 4PFEA 1BF2A 3KYNA 3AS1A 1BIHA 5F0PB 3ULVC 4HA1A 4UT6L 3G5XB 4MB4A 3KPTA 3TO4B 1IC4H 3PDGA 1MI5E 4R0LC 4FE9A 4HUUA 4UAOC 2KZWA 4HUVB 4HFUH 3I3EA 4CVXB 4S1RL 5KSVA 3O3EA 1CTOA 2X2JA 4FG4A 5EPMB 1PZ2A 2AVFA 1I7UB 1N0XH 3ZYOA 2HJLA 3SDYH 4JDVB 5SX5K 2R29A 2YEVB 4G6AC 1FFOA 3BFQG 3GFUA 4LCYB 4JRWA 1M1XA 2I5YH 3VU1A 5IBLC 1N8ZA 1U8MB 2HKFL 3K1DA 4W6YB 1KN2H 4OD1L 5GS1B 4N28A 4RFEA 5IHZA 4Y5YC 1BQHB 3UP1A 2I24N 1G1YA 4KBPA 1E9OB 4F5CA 5CEZE 4NQEE 4Y4HB 1TLMA 2LQRA 5AKRA 3NCEB 4BJLA 4FLSA 1MI5D 5D1QB 4XAWH 1IEBA 2WUBL 5DD5L 4MX7A 4PVMA 3K6FA 1ZT7B 3I3DA 5GZNC 1G84A 2IPUG 4KZDH 4OZGE 5I15H 2DQHL 5LGHH 1JF6A 4LSDA 3MV8A 1TLKA 2NRDA 2J8OA 5BV7B 3WHE1 3EZ8A 3U1QA 3UZQB 2BMKA 5EG6C 5FFLA 2AJSL 4DFHA 2VZUA 2FJFB 4JFVA 4EUPB 2AEWA 3VB8A 3DJTA 1IC4L 2XV6B 4WTZG 3A4EA 5C6WH 4ORGA 3SBWA 1FNFA 3EBIA 4Y2DA 4IMLA 2WN3A 4JCWA 2FIKB 3DVNB 3JWNE 3WKML 3ZTNH 4A37A 4OLZH 4QUOA 2APFA 4WW2A 5D7EA 1JF5A 3HN3A 3G6AA 1S3KL 2APBA 2DLFH 2K3HA 2IMMA 4QT5B 3GTVA 4L3CA 3O6KH 3NCMA 1AZZC 3B7SA 3VGEA 3EDKA 5TF1L 2MTAA 1Q1JH 3Q0HA 1AZVA 1BBDH 3O81A 3TFKD 1U3HD 3WHE0 4DP2X 4WV1C 3CAFA 3NQKA 3TN0B 2VIRA 3CHQA 1OP3H 4E0RB 3HN8A 5CM1A 3H9HA 3WFHB 1SUJA 1DR9A 3BD5A 1YDPA 2P47B 2YC1A 2NXZD 4W4NA 4D0DB 4LHUB 4XE5B 1L9SA 4I0PB 1UZ6E 1R9FA 4XGZB 1EMTH 3CCHA 5CZVH 4Q4EA 1G7QA 3FS9A 2V3FA 4HFWA 3ISYA 3TN0D 3X14A 1E0OB 2K9UA 1J11A 3PGDA 1CD1A 1D7CA 4PIBA 4P3CH 2VLJE 3TL5A 4OD3H 4GRWE 4PBVC 1J7VR 3QISA 4B0MM 4MXVF 1NAMH 3P3YA 4Y4KB 2R0ZL 2ZJSH 1ZS8B 2F54E 4LHUD 5SWQA 5I17B 4LLMB 5EO1A 5GS0L 2I32A 1Q0EA 3THMH 3HG1B 3MRHB 2PW2B 2EIZB 1N9PA 3NPZB 4HHWA 2QHRH 4OLVH 1OSYA 2R2HB 3DHMA 4R26H 4WKZA 4ABWA 5L9DL 1NAKL 1PY9A 2JCWA 1NOLA 3KDMB 5IBTL 1AYOA 4HHAA 2ICWB 1P4UA 3C5JA 3ARUA 3AU0A 1QPKA 3ZMEA 1DFXA 4MQ7B 3MTRA 2G2RA 2GSGB 1TQSA 4FYQA 5H2BB 1U3HC 2I7OA 4MWFA 3VSQA 4UM8B 4XPBL 1TKWA 2IV9A 3JWOH 2CPCA 5EC1B 3FSAA 2ZYSA 4HIIB 5FLUA 5LBSL 5T3XL 3C8KB 4HVBA 3F00A 3OJMB 5I1CL 2HTKD 2AEPH 5FO7B 2F19H 3RVUC 3U82B 1ZXQA 3DUUA 1PZCA 5DYOB 5M7QA 3RY6A 2YC1B 4LHUG 1BQLL 3O6FA 1GIGH 4DGVL 4NNYB 4GSDL 4NUGH 2WLKA 4BA0A 3TBYB 3Q5TA 3ESUF 5DQJB 1IEHA 2B4CL 4FQ1H 5I30L 1DBJH 2CGZA 4J1UA 2AV7A 2BSRA 2KUTA 4OCWL 3RE0A 5FYLE 3VXTB 1A1MA 3VX1A 2MQ3A 4MDJB 4EXKA 3D39A 3AY2A 5IV2B 4KI5C 1JPFA 3QUKA 4QHMA 1JVKA 2FWLB 2QPSA 3LN5A 5F6IB 1P5UA 4ONHA 4ELMA 1INDH 4GQQA 3FQNA 1I8KA 1HQRA 5J8OA 1DJYA 4MA3B 2Y5TB 3S5ZA 4X9FA 4JO3L 5DEFB 5BO0D 4U2ZA 5TE4L 4X0NA 2CHNA 3LZNA 1URIA 1SQMA 4S2SA 4YZFE 3ULVD 5EOTB 3LS4L 4F8LA 2QEJA 3ROOB 4Y1AA 1VJSA 5MP6H 5IMLB 1GPOL 2W0FA 4QHKJ 1NIBA 3W39B 4UDTB 1XF2A 2Q8AL 1MY5A 4FLOA 1JZGA 2BNRD 3EDEA 1MCCA 5DR5H 3I6SA 4PMFA 5DWUH 3QIWC 5IOPB 2D9CA 4JPWH 2IWFA 3SPIA 4HULB 5J12C 2BNQA 4A6YA 4YBLC 2Y2WA 5CLZA 4UQ3B 4J5VA 4JKWA 4KK6D 1S7WA 2ZNXA 1DSFH 1KC5H 2LVEA 4O02A 1PX4A 2WYTA 3J27A 3FONB 3O4LB 3CSYA 3RX8A 1V55B 4YHLL 2A74B 1ZSHA 3BAIA 1I1FA 4PSRA 3VMOA 3VWJB 1XR9A 4WEUD 3FNKA 3K74B 3SDXB 4X4XA 4AG4H 4UT9L 5DQJA 4LKCA 1ICTA 5F7UA 4WU5A 5IHHA 5KSBB 4CDGC 4DEPC 1JI1A 3ZO9A 4N6RB 1NM4A 2OZ4L 4FQQA 4XMUA 4LHJB 4JFDE 1SXCA 3DPBB 5HGAA 1LO2H 1E4HA 1H15B 5KSAC 1UA6L 3CXHK 4XN5A 1NBQA 1QLEL 3MCKA 5MEND 2XRAH 4ZUUA 4NEHB 1ZLDA 4JBSA 4O51A 4P5TA 5C7ZA 3U4BL 1QUNA 4OJYA 5J57B 5AAMA 5EUKB 2X4QB 1MHPH 4PS8A 4AV5A 4K9EH 5GS3A 3D8MA 4G8GB 4F9PA 3K71A 2XTJC 5IMMB 4K8RC 1ZTMA 1E65A 4PJIB 1UM5L 5E8EB 1IGYB 1B4TA 1JF1B 3F12A 4PV9A 5GS0C 4JW3A 1XXFC 3SDCC 3ROLA 4Q9RL 5EEWA 5JHDD 4Z7WF 1MWOA 4YUEL 5I2IB 3K6SB 4HU8A 4AL8C 3RWJA 2Z6FA 5C07D 3S5YA 3ZHDA 2XBDA 3C2AL 3MNZB 3OAZK 4YHZL 1ZT4B 1T20B 3IXAB 3V2AR 2DM2A 4MA8L 1EXUB 1OTSD 3VG0H 1TR7A 2P5PA 3MRJB 4P9HC 3N04A 4KC3B 5IB4A 3WL9B 5ID0A 2LFEA 2WUCH 5I1EL 3SGJA 1EZVY 4R84A 5L9DH 4RX4D 4DESA 1CGTA 3V5HB 4W93A 1U95A 1YQ2A 3BISA 2VRKA 3ZE1F 5T3XH 4P5KA 1D9KC 4L5FH 3DETD 1MHHB 3LV3A 3FTVA 3VAEA 4Z77A 2JXMA 3TH3T 5A6IA 3DYPA 3CSGA 2VMJA 3WXWL 4L37A 1LMKA 3HZKB 3KR3H 4MX7B 3WJJA 3FB7B 1MJ8H 2A6KB 1BSIA 5HGAB 1E3ZA 4FNUA 5LBVA 4MNHA 4LOUC 4UT9H 5DA4A 4OD2A 2X4QA 3N0PB 3QRBA 4KJWC 4QOKE 4YHMH 5DFVC 2QADD 3D3VD 4HKBA 4G3YL 4PS4L 1MRFL 3A4AA 1WH0A 3NK3A 5C0BA 5I28A 1JDDA 5E2VL 2XX0A 1C5BH 1KXTA 3ASOB 1DCEA 1RFDH 4QHNB 2EZ0D 3ZE0E 2OJZL 2WOBA 4HOMA 1QQDA 2JELH 1F90H 1K4DB 4X83A 3B2PA 2FR4A 4YVNA 4L8CA 3IPFA 3MNZA 4OIFA 2ZWKA 4R0LA 4WAFA 5ABAA 2GHWB 4Y7MA 4ABUA 4P46D 1ZTXH 4HSCX 2XZZA 4P0DA 4PRDA 4TVUA 3HNVH 5CEYA 1P69B 2JSFA 43CAB 2I9TA 1AZUA 5IMKA 2EAEA 3I85A 1MELA 3KW8A 1KCVL 3L3JA 4MCYA 3QQDB 4I0PA 5JQ6L 5LLIC 3ARGA 3QS2A 1ZVSA 4HUXA 2QPFA 4U6YB 5CWSA 1MZZA 4FXKC 4P4KA 4YXLL 2Q8AH 3WFHA 4A68A 3WIFA 4HFWB 3T04D 1U0QA 4TUUA 4WW2C 4GIAA 2IFGA 1CFMA 4Z23A 2LTQB 1WA2X 1KYOJ 2VT0A 4UNIA 4JZNB 5IVNA 3LMJH 1TSRA 1H5BA 1NFDF 3HG1E 5JIHA 3ULUH 1G7QB 1JPTH 2QVKA 4L48A 4NJ9L 1HH6B 3JTBA 4JDTL 3SIKA 3U0TA 1UD6A 2FJSA 3INUH 1WHPA 5T3ZL 3SDAA 2G0KA 2I60L 4JM2A 5E08H 4KRMB 1UT9A 3HG2A 4YZWA 2WWOA 2BIIA 4OGYL 4JFEB 4JS7A 4MXVE 1QG3A 3TCTA 3VWKA 3B9EA 3C5JB 4E9YA 5E6RB 3GHBH 1JZ2A 1GKOA 3T0AA 4HUWA 3IYLW 4F9LC 2IADB 3U0WH 2EDXA 2YOCA 3GMOB 1TVBA 4X6FA 1LP9F 3BAXA 3L08A 3V4UL 5DQDH 2XA3A 4PS4H 4YDNA 2UWEE 4DP8X 4ZSOB 1ZXKA 3O2VL 3WLBA 5JIIA 4XXWA 4O4YH 3I6GA 3PAYA 1LL1A 1DQIA 2JJWA 5D7SL 2LU3A 3T6QC 1XCXA 2CLZB 4UM8A 3UZEC 4PRHB 5JDJA 2CRYA 1JTOA 2GJ6E 4QIRA 5EU4A 3LQZB 1RP8A 5KBLA 4IS6B 4Y4HC 2X4SB 1LK2B 4HBCL 3CXHJ 4NSKB 3VXTA 3Q8CA 5F7DB 2H26B 1WG3A 3LXBA 2NTFA 3D2TA 1YEIH 2YPVL 2VC2B 2XTJB 4PTUA 1JPFB 5BOJA 5EHFA 2VDML 1MAJA 2XN9D 1M9SA 2XZQH 1WBZA 1B2YA 2N01B 1O7DC 3KPMA 5BUPA 1DQTA 1S9YB 4JRXE 5D9SB 1DHKA 5DHVB 2AV7B 3C2SA 5F3BA 3MPCA 1AY1L 4DKDC 3B2DC 5FOBA 5ICXB 3W9DA 5CCKH 2J5LB 5JNYB 1BREA 3KPSB 1KTLB 1J9SA 4ZTEA 4JFEA 5HHOD 1WIOA 3FFOA 2XTJD 4UOJA 1OTTD 1XIWD 1KCUL 2YMOA 4WI0A 1WT5A 2RCSL 2ZKHL 3JT2A 1I7TA 5IVXA 1RJYB 2EO1A 5GGTA 1ID5I 1YUHB 2CA4A 3GMQB 3O8XA 4U1SB 5I74B 3GMOA 2W91A 3BW9B 4UQEA 5IT2H 2VLMD 3PGCB 4HS3B 4X5WB 4MD4B 3Q06A 2VWEE 3CUPA 1S5IL 4CMMB 1G1CA 5D1ZA 2MJWA 5C86A 2W0FB 5DK2A 3ZZ1A 3RFZB 4S11A 4KI5F 3QCUH 3GMPA 3DX8B 1ZVHA 1EEZA 3VRJA 5DJYB 2AERT 5IUSA 5HHOB 5JXAH 1C08B 1RUAL 3P9LB 2FLMA 1FWXA 1UA6H 2VLKB 3D25B 1A6ZB 1S7UA 4JFZL 3RWGA 3VH8B 1NFAA 3CDYA 1XV8A 1J8HA 1FL3B 3SD5A 3S6CA 1DBBH 1C8PA 4N1HB 2JF1A 2FEDC 1XCTB 3VFUA 1BZOA 2J5LC 2WWMD 1CXHA 3S3CB 1G7JB 4PJDF 1PW3A 2G3NA 3TNNA 2VSKB 4EIUA 3GJFB 4S1QL 4XPGH 4WWKA 3EOBB 1HCYA 4I4WB 1HQ4B 3F3HA 4XTRC 4AM0Q 3S9DB 2SODB 2K6ZA 5D7LE 3JWOC 2YPLD 3T4YA 1QRNE 1MI5A 2DQHH 2XN0A 3MJ6A 4LEOB 5F7WC 1PJWA 5GISH 5C6TH 3V4VB 3WO4C 4QLWA 3EH3B 1TJHH 1UCTA 4OZHF 4OM0H 1SLXA 1R0AH 1IAOA 4AKOA 4W6XB 2AJSH 3F7VB 5L6YH 3MNDA 2E7LC 2CJUH 3SKMB 3EYFA 2D3LA 2XCMC 3LMJL 3L5IA 1ACCA 1RZGB 3D30A 5I1AB 3W0WD 2OP4H 4MJIE 4UIKL 4XNAA 5HHXH 5ALCL 1DQDH 5FW7A 5JR1L 4NI3A 2H2SD 3GK8L 3QORA 3RGHA 3KEDA 5DZOA 1DJIA 2Y7QB 4XO9A 3WFDH 1C12A 1IFHL 3JWNG 1FH5H 3BZDA 4M3JA 5MEOA 2Z8VC 1NAMB 2XWBA 5DJ0A 3KL5A 4RZKA 1MW3A 3GSQB 4XP1H 4FTVE 1ZT4A 5DMKB 1QKZH 1YG9A 1C08A 2ZX6A 4YSPA 4IOSD 1NCWH 3B9KA 3MLUH 3NIGB 4YR6A 2ZWYA 3WL9A 1I1AA 1TTBA 3OZ9H 3IDYB 1ZS2A 4OJAA 5JOFB 5EULV 3OHMB 2FL5B 4FFTA 3V5HA 3QIWB 5EN2B 4CJ0A 3V6OC 1FO0B 3MODL 3OQRA 1EDHA 1IC5L 4L4VB 5D2LE 1OB1A 1TZ8A 3IU4H 3KPLB 4NKQB 4PLKD 3TNNB 1F3JB 2GI0A 5LNEA 3D7PA 2BOCB 4AYGA 5B39A 1DBBL 5LGYA 3IRCA 3CPLA 1F02I 4NO5B 2F7QA 4KZCA 4FDWA 2R9HC 5CEXA 3HE7B 4PRIB 3LZPA 4E5XG 4ANUA 5TDNA 2GTQA 1EHLH 4UTBA 1B6DA 5JO5A 3WY1A 1KBPA 4FFWC 3WFDL 4GW1A 1OPGL 3WFBL 3HE6B 4HT1H 4Y88A 2EP6A 5D7IF 1Q9OA 4ZXBD 2XA8H 2VDLB 2EIEA 2YAMA 3K46A 2FO1A 4KO9A 2EYRB 4RVBA 1KCUH 3IN0A 3CZNA 3WS3B 1E2VA 3WSQL 3EJQA 3NA4A 2X3BA 1I7UA 5A2FA 4OR1A 5GXBB 1A4AA 4Z78A 3DBXB 4PREB 1HJCA 1OAUL 4ODHL 2MNWA 1JFQL 2MQGA 4WFHD 4AXWA 3C6EA 4NENB 4AW4A 3GIZH 1M1XB 3MUUA 4M1DH 3EO1B 3EYOB 4JY4B 4P4KB 1N5YL 3IU3A 3KWXA 5CUSL 4A2GA 3DX4A 4AX3A 3QEGL 2G3MA 2F54D 4UV4H 3IDXH 3PLYA 4RAVB 5JPNA 2BERA 4KNTA 3QQDA 4G2AA 1VZIA 2GJJA 2OMYA 1PAZA 3BLPX 1C7TA 2FL5A 3HMWH 5E4OA 3T8XB 4EN2A 4G70B 4L4TA 1U8IA 3L6FA 5DJ2B 3BKJL 2Z8SA 4BWUA 5C6PB 2CO7A 2VZVA 1A02N 1FQ9C 1ZDSA 1CK0L 2AQNA 5D8JL 4E41D 2P26A 2VNCA 5E0QA 5JXAL 3VD7A 3I50H 5JQ6H 4ZOBA 1HXYB 2W94A 4JHUA 2ZWZA 4M7LL 1FJ1A 1CLOL 2NW3B 4JM2B 5BW7A 2NZ9D 1KPVB 4XBPA 2OLDA 4TKWA 1CICD 1E4XL 1FCGA 4KQ3H 5CJQH 5IQ9A 5D70L 4YAQA 3RGBA 2EUZA 3C60B 1YZZA 2QT6A 1EO7A 3ARBB 4NIYE 3G5WA 4RFNB 5I5IA 4Y4KC 5JW5A 1V5JA 4AUYA 2D2OA 1WZAA 5E99H 3FUJA 4MJ5A 3GLAA 4TVPD 2J73A 5INDA 4YHZH 1KCKA 2WIIA 3W82A 1YEEH 5C8JB 3BVNA 3RG1C 4GSRA 2VR9A 1MWAA 3DK0A 1NTDA 1CLZL 3QZWB 1WCQA 1UH2A 3MMEA 4LLYA 4YDMA 5E5LA 4ADGA 2NW2B 4R4NC 1WUNT 5DO2D 4NPJA 3OJDB 5B1AB 3S3BB 2W60A 3ISWA 3QUZD 2N3JA 3CV5A 4N1CA 3M1OA 3S34L 3O4OB 5CP7A 4LCCA 3VXSA 5D5MB 5BNXD 4B7LA 2CO6A 2CE6A 2G9HA 3LY6A 4UT6H 1EFXA 5EU6E 4ZW6A 3VXOB 1HU8A 4P2OC 3MLXL 4U1GB 4L3ED 3QXDB 3E1F1 3GSVB 4P3DA 1HCFX 4GBXB 1VEPA 2W92A 3ZKXB 1T0NA 4U1IB 4V1DE 1AE6H 4QRPE 1N64H 2O6EA 1TCRA 1PZDA 2AJ3A 3WN5C 5BUGA 1SOXA 3KPSE 1WAPA 3QP3A 2F53B 4L1BA 4LSSL 5F7DA 1WWWX 4DUVA 2DQJH 3I84A 1BJ1H 2E8ZA 3FO2A 4GXVH 4W9HC 4HLJA 1JZ3A 2Z8WC 2ZPKL 4JGJA 3HA0A 5FUOH 3ZZSA 3W0WE 4XTRD 1UKQA 2AVGA 4FLRA 1AGEB 4DEPB 2JVUA 4GAJL 2PXYA 1ACYH 2UX7A 5ACMA 5H35A 2VN7A 4AH2A 4FMVA 5D2LB 2WWMC 5J9PB 2IG2H 4PJ5A 3GGWA 5FO9B 3EZJB 3H9ZA 4JY5L 1AGFA 3L2NA 5IZ7A 1H3PL 3STBA 5D1XE 1KGXA 2YXMA 5T5FH 3KGSA 3VRLE 1FBIH 2VDPL 2C3XA 1E2WA 2VXVH 5M94B 3VI4E 2CCVA 2EIDA 2D7MA 2HUEA 3QZWA 4PJBE 5DK2B 4QJ4B 2C3VA 1EEYB 1VERA 3GHPA 3OJDA 3LJ3A 4NO3A 5E99L 1P7QB 4D0BB 4Y7OC 2VJXA 5CD3A 2EH7H 5C3IA 5BOZG 1JNLL 1CXFA 2G5BB 2JKXA 4K71B 2YGQA 1LMIA 1X7TA 1DVFC 2IOOA 3MJ7A 4YSSA 1CURA 1Z5LA 2A7BA 2WCPA 3N55A 2XXFA 1BYOA 4HXAL 3PHSA 5IJKC 1HFUA 3QIBA 1SVBA 4NJ9H 5DLML 4FQXA 3H9SD 4NZRL 4EZMA 4KZEL 1UCBL 4HWEL 2UWEA 2VLRB 5BZWA 3RDTB 1E28B 3ULUL 3GMLB 4ANKA 3RKPA 3FUIA 3ZDXB 1A14H 2HT2C 2NY0B 2UVEA 3UZVA 2ZOKB 2XQ0A 3SE3C 4RX4A 4ZRGA 3S35X 2GAZA 5EU7E 5AVTB 2XBZA 5IROD 1OK0A 1UWXK 4H8WH 5IEHB 2OMUB 3IDXL 5AW5B 3CXFA 4RMRA 5GRXG 4Z5RB 1E30A 3CFUA 1QWHA 1OGAD 4UINH 4M6OL 4G9FD 5HBBA 2EDKA 3O6FD 4Y2OB 4CL7A 4U1KB 2JFCA 1N3NB 4G80B 1MI5B 1RK1A 2TRYA 3PP3K 3HVDA 2E9JA 1J8RA 3C09C 2XWJB 3R06B 3PP4L 4IGBA 2H1PL 1EHKB 2NY0D 3TONA 1UVQB 2YN5A 2WSKA 3EJSA 1QAWA 5AVRB 1BLNA 3KLHC 1FNGB 1YEDB 5DCCA 4LVHB 5CIPA 4AJYV 5I73B 3RVTD 4QKTA 3QA3A 3LKNB 3HPJA 4PGEB 3TCXA 1S9KC 1YYLL 2P7TB 1T1WA 5B3NA 4OJEH 5IB3A 4N85A 4G9FB 5EOCL 3IF1B 4I9WD 4JFEE 1ZLEA 4D0BA 3X12A 3MLWH 1LK3H 1RERA 1U6AL 1MNUH 4EE2A 4XC1L 1RUMH 4AENB 3TA3B 2ETWA 4KU1A 1EAJA 4M5YH 3CSYB 5LAXB 2K70A 2BS8A 4U6VL 5HTSA 1T1XA 5IG7B 1XQ4A 3TU6A 3WS6C 1MHEA 5F7BA 4EQ3A 2P4AB 2L04A 1A8ZA 4F33A 4HLEA 1BBJB 2ADGB 5ILTH 5EDXA 1M05A 5CCKL 2A6JA 4XPTH 1B4JH 2DBLL 3QUYB 1ZJAA 2V9RA 1KF9B 5EC2B 2Y9RT 2P45B 1H8SA 3NSYA 3DMMB 4ZMPA 3OZ9L 1X4YA 2P24B 3UPRA 1AQKL 5JIMA 1MEXH 2ZF9A 3TIEA 2QQQA 3P30L 3PE9A 4QWWD 1AGDA 3UTPE 1MLBB 1QLRA 1TO5A 4PVBA 3NCFB 5E9DD 3L54A 5DS2A 3GJFK 2PWEA 2ORBH 1KENL 3FT2B 4LCWB 4XN7A 2Q6WA 1QATA 2GITB 2XRAL 3HC0B 3MU3A 4MMZA 3NH7H 3MLZH 3CN4A 4ANVA 1IGYA 2V33A 4K7PX 3ASWA 3ZKXC 3DMMD 3MRHA 1P2CA 1OAZH 4NENA 6FABL 2FEJA 2NT0A 2F7RA 3U2JA 4BEIA 4DH2A 4EI5B 1EXGA 1AI1L 2XBTA 5AW4B 1S9WA 2UVFA 4JB9L 2APTA 4E9XA 4Q7DA 1ECYA 3GSWB 4IU2A 3GKZA 1D2OA 4YIQB 1YLBB 1ZT1A 4I18A 4UNTA 3QUYC 3FQYA 3MV11 1UACL 3P4NB 4ZOAA 3SKOA 4JFOA 4QDGA 3HG1D 2VDOH 4DGUA 5I9QB 2LFGA 4E68A 4E9VA 1K6QH 5KEZA 2P8PA 2JE8A 1JPGA 1X9LA 5CR8A 2GBVA 1J1XH 2CBOA 1GW0A 5C07A 1A3QA 4PVLA 5IREA 3NUKA 5CEZL 1AQDA 3FQXA 4PRAB 5FUZL 4ETYA 3M7OA 4NNYA 4TUJA 3J2PA 4KMTL 4XBPB 5IVZB 3TTSA 1A3LL 3SGKC 4L1TA 4Y8DC 2E4TA 1U3JA 3VXSD