1HEKA

Crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
AMADIGSMGDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWAISAVKMGLQINNVVDGKASFQLLRAKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN, CORE PROTEIN P15
publication title Structure of Equine Infectious Anemia Virus Matrix Protein.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
total genus 30
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08723 Gag_p15 Gag protein p15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hekA00
2LYAA 2K4IA 1HEKA 1HIWA 2K4EA 2HMXA 1A6SA 2H3ZA 2N1RA 4JMUA 1UPHA 1ECWA 1L6NA 2H3IA 1TAMA 2H3VA 2LYBA 2GOLA 2K4HA 2NV3A 4ICAA 2H3QA 1ED1A 2H3FA 2JMGA 4IC9A
chains in the Genus database with same CATH superfamily
2DKZA 4QNLA 2JEIA 1L5UA 3NRWA 3ISDA 2OHFA 2W9BA 4RQ8A 1D9DA 1JI7A 5DB9A 5JTIA 4J9RA 1S8OA 1TK5A 4JWNA 5KG4A 2RLTA 5DLFA 4R65A 2IOHA 4Y2VA 9ICWA 4NLBA 3NVYA 1RM6C 4BWMA 4E0DA 3WKAA 1N63A 3SAFA 3SAGA 1LV5A 4ED1A 5ALXA 3Q8KA 5KFKA 3GIMA 2PKEA 2FMQA 3SV4A 3HKZF 2E3TA 3A0HU 4IRDA 3T5LA 2W03A 3IN5A 4UB4A 8ICJA 1XWLA 5G5HA 1ZQQA 2ZIWB 5ALWA 1WWUA 3H0LB 3NVWA 2M9NA 3TADA 5EE1A 5KG2A 3C2LA 3V72A 4CDGA 2WB1C 4I2GA 1N62A 4QWAA 3T5KA 5EWEA 1Z1VA 2HBJA 2EQYA 7ICMA 4UB1A 2OWOA 3I76A 5D46A 3RB0A 4NY8A 2Y0SC 2NRVA 4O5CA 4PH5A 4PGXA 2AGOA 5ALQA 3B9JA 9ICUA 5AKKA 4EENA 2Q0ZX 4TURA 1LKYA 2D3DA 4RZRA 4F92B 4RT2A 2ZJ5A 3EUB2 2FMSA 1T7PA 2BQUA 4I2CA 1ZQYA 4NLGA 3C21A 4MEYA 4O3OA 4RUAA 4FZLA 4PZNA 2ZTEA 3NUQA 5ALMA 3QEBZ 4FS1A 1XO0A 5AKLA 2BZFA 4BGDA 4NM2A 5DLGA 5AKGA 2K60A 1QH9A 5BOLA 4Q45A 2BR0A 2DF4B 2WHEA 3M9NB 4RNOA 3MR6A 4ED7A 3DDHA 3AUOA 2DUYA 4RPXA 4ELVA 2VANA 5AIBA 2XGQA 4F5NA 1O03A 4B9SA 2KP7A 4CE6A 1FO4A 2I9GA 5DBAA 3LWLA 2BGWA 1BNOA 3MC1A 5CA7A 5J2KA 5KT7A 3KKAC 1NK9A 2FLLA 4DQPA 3TAQA 2FDRA 2BHNA 4AYBF 1UA1A 3ZI4A 4QZAA 4ACOA 2L5YA 1N48A 5J2DA 3GILA 1CEZA 4RQ7A 1Q3VA 3UXOA 2JRZA 5L1JA 5C0YA 3WKBA 2EAMA 3M1YA 3N7PD 1DGSA 2BPGA 1NJZA 1L3SA 5AKXA 3H4BA 4JV0A 1DGJA 2ZIVA 9ICSA 4F4YA 2IHNA 2CRXA 1KW4A 4PGYA 1WG8A 2IBKA 1S0VA 1MQ2A 4USAA 8ICQA 4I2AA 3UMCA 1YZ6A 4PPXA 4RNMA 2DBYA 2QARB 1NK0A 2Q4TA 1UQVA 4FZMA 2ZUBA 2KIWA 1NK4A 3QE9Y 2P6UA 3RJJA 1BPXA 9ICEA 4J9KA 3JPRA 4MEXA 2F3NA 3F5AA 1ZQKA 3WK4A 5KFEA 1X6JA 4QZ9A 3L3FX 1M6YA 1C7YA 5KL1B 2G0AA 8ICLA 3ZDBA 2RDJA 4ED2A 4F50A 9ICJA 3PSPA 4J9NA 2PXIA 1ZQ1C 1TAUA 4B9LA 4KLDA 8ICPA 3G6VA 1JX4A 2BCQA 1V97A 4PZOA 4C8NA 2F76X 3H4DA 3ETLA 2VA8A 3I28A 4EYIB 4CF5A 4XRHA 3TFSA 4O3MA 5KG7A 1KL9A 2JR5A 2DKXA 3RR8A 1JMSA 2YMLA 1DXSA 2NRTA 4KN4A 5KFSA 2WB1F 1TK8A 3M6KA 4Y2SA 3TQ1A 4UAUA 1QQ7A 3GFKB 4J9QA 2C2RA 2YQEA 3IV6A 4QZDA 4RQNA 2FPMA 4I2JA 5DKWA 1XSNA 4KMOB 3UQ0A 5J0QA 3KTQA 2EZYA 3QXGA 4QZHA 3GU3A 4Y2QA 2J6TA 4IL6U 1U48A 2G5HB 5HR6A 9ICLA 3RB6A 2PFOA 3QU2A 2F8KA 5CJ7A 1ED1A 5CHGA 1T8EA 2GH1A 4C8KA 2NRZA 1X6IA 1D9FA 1B43A 2LBOA 5F9LA 3SV3A 4M9GA 4ECRA 3PW4A 2PI5A 3ZDEA 4JB3A 2AU0A 2W3SA 4R63A 3JPTA 4Y2PA 5HHIA 4M9NA 1RPLA 4UAZA 4CCHA 4IR9A 5KT4A 4CF3A 9ICPA 5DDYA 2NV3A 1OXJA 1B4FA 3H8SA 2KK0A 2YX8A 5J2JA 4LVSA 1UT5A 3ZDDA 5F3XB 4NWIA 4K4GA 2HHXA 2NYVA 1Y88A 1XC9A 3ZD9A 2ZIVB 1ZQVA 9ICOA 3BQ7A 3PMLA 2RHFA 2XVTA 1SV0A 5IILA 2XIDA 4F3OA 1HEKA 4M6WA 4CGZA 4EX7A 5AI6A 4B9MA 5L1IA 3AL0B 4UB8U 2H3IA 5DBCA 5J0WA 3JPQA 2W8KA 2BCSA 3HRDD 3WK9A 3C5GA 2V4QA 1MQ3A 4DL4A 2ZJAA 1UT8A 1S5LU 3UPQA 3H0RB 4DSEA 2K8BB 2JZBA 4QJFB 2W9MA 1RQLA 4ECVA 8ICUA 1QCKA 3PZPA 2HOFA 9ICVA 4F71A 5DG7A 4KN7A 2HBMA 4ECWA 5ALTA 2YMQA 1LB2B 5J2BA 5KT2A 4PHAA 5IINA 2W9CB 2PFQA 1ZQOA 4NL9A 4OJ5A 4DQIA 1L7OA 4EEYA 1XO1A 2BQRA 3SD7A 3PX4A 2ZUDA 1COKA 2MRLA 5KFBA 4UAYA 1VJ5A 2KEYA 4RQ4A 2WTFA 1NZBA 3PR4A 3GV7B 4YD1A 3TAPA 5ALZA 4F72A 2VJ4A 2BKEA 5KFOA 1X9MA 4OJ6A 2XI9A 2K4IA 4J03A 3V7JA 4KLOA 3B0YA 3QUQA 1ZQRA 1ZQAA 4Q43A 2IMWP 1QQ6A 3NRZA 4NJ8A 2C2DA 4UB5A 2GOLA 3NVVA 4BJQA 3HWTA 5AHXA 3RH5A 4Z6EA 1L7NA 4PHEA 1WYGA 3ISBA 3TADC 3RTVA 4PHPA 4NV0A 4F5QA 5DB6A 1ZQPA 1KFDA 5BOMA 1J2MA 1OW5A 2R18A 9ICAA 7ICIA 4R64A 3BJYA 3MDCA 9ICCA 1SXDA 3MR3A 1X9XA 3UM9A 2WAQC 1S97A 2HBLA 2JEJA 1SKWA 4YG2A 2E5SA 4O5KA 4GC6A 1KKXA 1QTMA 2ZIXA 5ALFA 3GIIA 2M0NA 1X9WA 4PHDA 1A6SA 2XO7A 4DS4A 3H40A 4I2FA 4HAIA 3K1ZA 5J8YC 1X40A 1KRPA 3AEVA 2I6XA 2FJ6A 7ICHA 3QUTA 1ZD5A 8ICYA 5EWGA 3RJKA 1RYSA 1ZJMA 4DOAA 1PK3A 3F2BA 5AKHA 4IQVA 3C1ZA 2KNJA 3QZ8A 4A8EA 1NKCA 1TVAA 2JXJA 1T94A 5KFYA 4QZBA 2KMDA 4Y2XA 9ICFA 2H3QA 3AM9A 5T14A 2WF9A 3MBYA 2LYAA 5ALRA 1B0XA 3N7SC 9ICRA 5E79U 2J6SA 2BQ3A 3FYHA 1QLNA 4M9JA 5J0PA 2B21A 5KFXA 2PMZF 4CNQA 4R8UB 5KFLA 2R8IA 1QQ5A 2CXYA 4YXJA 4OD0A 3RAQA 3RJGA 1BVSA 2EZZA 4QZEA 2DL0A 1PK1A 1CRXA 3T5JA 5KFIA 1L8OA 4MFCA 4F91B 5D49A 2F1HA 5CB1A 2A1JA 1K5OA 5F9NA 1Z3EB 4XUSA 4P0QB 3TKAA 3TANA 1S9FA 5J2EA 2J6UA 2P6RA 1S0MA 2KVCA 3PW2A 2W7PA 5ALOA 5KFUA 7ICOA 2KSOA 1RXWA 3SEIA 3BZCA 4NXZA 7ICPA 5KAIU 4YR0A 1EXNA 4O5EA 2VA2A 2B0CA 4YN4A 3ONNA 2ESEA 4EZ9A 5KFHA 2KZ3A 4P0PA 3PSIA 2ASLA 2BCVA 3IHQB 1QSSA 5EWFA 2C2EA 3RBDA 7ICQA 4B6JA 3RRGA 1U9LA 2HSZA 1FEZA 5AICA 3WKEA 4EEKA 4UB2A 2R8JA 3H0MB 4UB6U 7ICKA 3WK5A 4O3SA 1FFUA 1S0OA 4RUCA 2ALZA 3AMZA 5KFQA 2OCEA 3RB3A 1NJWA 1L7PA 2EDUA 2WF6A 3EWAA 5GTIU 1U47A 2UVVA 1J2NA 3RRHA 4F2RA 3M7DA 3WKCA 5HMMA 1N56A 4RT3A 2CPRA 1Q8KA 4YMNA 3PW7A 2V9WA 3TFRA 2YY6A 3QUCA 4JV2A 2ZTDA 2DPIA 8ICIA 2LKYA 1ZQLA 2H3VA 3N7RC 1C20A 5JU5A 3TARA 2IA6A 1DRGA 5KFRA 4DQQA 2DWQA 2DQNB 2Z7JA 1HUOA 2LYHA 2VJ5A 5J0TA 2QLTA 4ED8A 4QWBA 4KITB 5IIIA 4Q8EA 1ZQSA 1F0MA 3QU9A 3PW0A 4B9TA 2RRDA 2NO5A 1RQNA 5KFTA 5AM5A 3Q8SB 3GV8B 2HOIA 4F8RA 5J0RA 1U4BA 3EYZA 4GLXA 3PR5B 3NS1A 3Q8QB 5CP2A 4JK1A 4YCXA 5AI4A 4CF4A 1A77A 1S10A 3SZ2A 3MGVA 1WCNA 2LM4A 4O9MA 3PNCA 4OJOA 2KFNA 2LMRA 4QWDA 3RH4A 4MF8A 3UMBA 1SZHA 4YMOA 4US9A 2MUTB 4DL7A 1NKBA 3OSNA 3K4GA 1N5WA 3THVA 5HP4A 2YB4A 5CWRA 1V9PA 2QB1A 2F1JA 1X66A 3S6JA 3J81j 2W9BB 4F4ZA 3CP8A 8ICVA 3KBBA 5AKYA 2KKPA 3F5EA 2CN1A 1SKSA 4NLZA 4M47A 5IIOA 3Q8PB 5KG0A 5HNKA 5FP0A 3RR7A 5AKJA 2G09A 2RP5A 2C28A 1Q46A 8ICWA 3NGDA 8ICMA 2E8MA 4BXOA 4P4PA 3N28A 2A1JB 5DGBA 5G5GA 3IRUA 3IDWA 3PV8A 8ICBA 4F5RA 3RJIA 1MSWD 2KJ5A 1O08A 1TKDA 1T3QA 4NLKA 5JRTA 5ALKA 3MGHA 1XS9D 5J2CA 1Z1BA 1L8LA 4DL6A 2BPFA 1ZQCA 1JALA 5ALUA 4UAWA 4DF8A 1SV0C 4DFJA 1FFVA 2HMXA 3SMVA 1NZPA 1IXRA 3SYZA 1ZQHA 1COOA 2K89A 1V85A 2LI6A 4C7ZA 2GO7A 1KBUA 5HMLA 2H5XA 3SR6A 3MFHA 5L1LA 3ALRA 4JUZA 3T79A 7ICEA 1LKYB 4M0AA 4Z6DA 1N60A 3ZDCA 3GQCA 2OH2A 4RQ0A 4J9LA 4Y2TA 2PI4A 1KEJA 4QIWC 3KHHA 4DSIA 2R8HA 3HILA 3HW8A 5KFDA 2D6FC 3D2SA 7ICRA 3Q8LA 2FMPA 2Y0SF 3CRXA 2Y9UA 8ICFA 4GFJA 2H3ZA 2BCUA 5KFWA 4KLFA 3GDXA 3WK7A 2XCPA 4PJ0U 1A76A 4IQUA 3F53A 2ES6A 4DFDA 5AI5A 2KJ8A 3NASA 5A0LA 1KFTA 3KKAA 2OM6A 2F8LA 4YXMA 3WKDA 5J0UA 4QZIA 2ASDA 4RNNA 4Y2UA 2KFZA 2F44A 3DEEA 4EYHB 2AHOB 4IQTA 3C28A 5DQHA 1KQQA 1ZQWA 2XGPA 2LM1A 1ZQMA 4P4OA 1K1QA 5DDMA 3M6ZA 5DGAA 3IP4B 3MR5A 1J97A 2VKQA 4UBCA 4CRXA 8ICOA 1JIHA 3AQEA 1YZ7A 5KT6A 5KFJA 5ALYA 1JXLA 2G5IB 4KX5A 3EPIA 2KHQA 2FPKA 4DOCA 1PVRA 1AQ6A 4EBCA 5CRXA 1MA7A 4UB3A 1TK0A 2XY6A 9ICQA 4GXJA 2BPCA 2GLEA 4M9HA 4F5PA 5ALDA 1NK6A 3PO4A 1RG6A 4KLMA 2MA1A 2B6GA 3GIJA 1NK8A 1BPYA 3K1RB 5DG9A 5J0OA 4K4IA 5AKIA 3HKZC 2HHWA 3N97B 1U45A 2XY7A 2A1AA 1SL0A 2PFNA 1ZQBA 5KFPA 1K1SA 1RZTA 5DBBA 3AU6A 3OSPA 2HDOA 1MC8A 3LDAA 8ICTA 4EZ6A 5HHHA 5HR7A 4RQ3A 4DQSA 1TE2A 4UARA 3RH6A 3QUBA 2XC9A 2C22A 3IG8A 9ICKA 3E0FA 4I2IA 4I29A 4BDPA 4IQWA 4WJ3B 4IS7A 2HOQA 4KLIA 2EAPA 1ZQXA 4RU9A 1KDHA 3IG5A 5B5EU 3B0XA 1ZQFA 4DS5A 1JN3A 2W7OA 5H2FU 5AM0A 4EELA 1IIPA 1VDVA 2ZIWA 4UQGA 3D6JA 3RF9A 2IHMA 1S77D 3FC4A 3HT3A 1N2XA 1CI4A 4US8A 2UVWA 3KZXA 4AP9A 3H8WA 8ICKA 1IV8A 3RAXA 4ELUA 4GXIA 1XU4A 2RQ5A 5KFAA 5KG6A 3ZDAA 1BNPA 5ALVA 4ED0A 4DSKA 4I28A 2KKVA 4EX6A 4QZGA 3ORYA 4DL5A 2JMGA 2YTUA 3D2NA 4YVZA 2OXOA 3OTQA 3PO5A 1S0NA 4C8OA 5K4LA 3BQ2A 1QSLA 5ALNA 4DF4A 1ECWA 1TFRA 1Z00A 1H38A 4DL3A 2ISOA 1RDFA 1L3VA 3FDSA 4ICAA 3L5KA 3JPPA 1BPBA 2FE9A 1UCVA 3PMNA 3LYSA 4NLNA 3BZKA 2W9AA 2N1RA 5DB8A 2ZXIA 2A3VA 2LYBA 3NTUA 4AYBC 5GTHU 3MFIA 4RQ2A 4G3IA 4J9OA 1BPEA 1ZQZA 1L3UA 3PY8A 4C80A 4G9BA 3MABA 2WF8A 2AQ4A 3F2DA 1B22A 1ZJNA 1SV4A 2Y9TA 4C7YA 3FAHA 7ICUA 8ICHA 4B9VA 2K4PA 3BDPA 4RPZA 1ZD3A 1NK7A 2NRXA 2E1FA 3SAHA 2PFPA 2NO4A 2P66A 4Y2JA 4C8MA 2KJ9A 1MN8A 4F4XA 7ICFA 4UATA 2F2AB 2QB0A 4ELTA 4FBTA 4M6WB 2DGZA 2JH7A 4GC7A 7ICNA 4O0IA 5KAFU 8ICZA 3UXNA 4FZNA 3CYMA 2OYYA 2VIXA 5J29A 1NKEA 1GO3F 1LVHA 3T3FA 4JV1A 3WK6A 2JHDA 3QNMA 5ALGA 2R8GA 4ECQA 4KX3A 1YT3A 2EANA 1ZRMA 4Z6CA 1X9SA 2EZXA 3WK8A 5KL8B 4DLGA 3RFAA 1DK3A 7ICLA 2JZBB 1PVQA 2AJQA 4DLEA 4OJPA 4RQMA 5KNIA 4KMUA 4YR3A 3M8RA 1SZPA 8ICSA 4YQWA 4O3PA 5KFMA 2KZZA 2I5HA 5B66U 3PX0A 2QARA 4PGQA 3M9MB 1XSPA 4KLUA 4BUGA 2KN7A 3H8MA 1UA0A 2JGAA 4QZFA 5TISU 3KZIU 1BPDA 4TUSA 4OCZA 5BPCA 3EZ5A 4J9MA 5AM3A 3ZD8A 1PZNA 2AQ0A 5DQGA 4I27A 4ECYA 5KFVA 4KLJA 3VC8A 1XNSA 1WUDA 9ICNA 3K75D 5EE9A 3DV9A 5J2IA 2KHVA 3RJHA 1AROP 1D8LA 8ICNA 3CW2C 4OJLA 5KFCA 5J2AA 1NOMA 4RQ5A 5L9XA 4J9PA 3WU2U 3FM9A 4UASA 5AM1A 5IIJA 2WFAA 2HBKA 4ECZA 2WF5A 1T4GA 2KTQA 9ICIA 3E2EA 1SXEA 2EH9A 3NVZA 2F77X 5J8YA 4BX9C 1Z00B 3OPXA 2DFLA 2JH1A 2ZTCA 2ZJ8A 2VA3A 2E1EA 8ICRA 2W04A 2ZIXB 2K4HA 9ICMA 2MU2A 2AGPA 3M8SA 4K4HA 5J0YA 1NI3A 4F4WA 4TQRA 4LZGA 3JPNA 4MF2A 2FLPA 1SIJA 1OUQA 4DL2A 3V6KA 4XA5A 8ICAA 2ZIUA 2W8LA 5IIMA 3Q8RB 2FI1A 3PVXA 5KFZA 4YFKA 3QU4A 2WAQF 3ETRA 4BWJA 1KSPA 4DFPA 2DPJA 4FE3A 2ASJA 4PL1A 5IIKA 3G6XA 5AK6A 2G08A 4ZOHC 7ICSA 3QU7A 4GXKA 1F44A 2LHTA 1TV9A 4DWIA 3GV5B 1ZD2P 2E8NA 2BCRA 2QB0B 5KTQA 2KG5A 5ALPA 2HW3A 3JPSA 4IRCA 3ISCA 2K8AA 4PL2A 5AM4A 2YN4A 1SL2A 4KTQA 7ICTA 2OEHA 5J2FA 1BPZA 4Q8FA 4U7CA 2V4RA 3RJEA 1QSYA 2KZMA 2P35A 5ALJA 3HX0A 1SWWA 1PK1B 4QW9A 3KHGA 4IC9A 2AH5A 3Q8MA 4QZCA 2KOBA 2FPLA 4TQSA 1TAQA 4UW9A 2K4EA 7ICVA 5AI9A 1KFSA 4KLTA 5TZVA 4UBBA 5KFFA 4M2YA 2BDPA 2KSOB 1FIQA 4FS2A 2YB1A 1ZXIA 4ECTA 4QWCA 3BS7A 3D2QA 2AGQA 1A0PA 4P0PB 3O0FA 8ICXA 4Z6FA 4DO9A 4TUQA 2MAXA 2KV2A 4QW8A 2W11A 4RQ6A 4TUPA 1NJYA 3LVVA 2ZUCA 2XY5A 2HVHA 1KTQA 2W9CA 4MHVA 2HHVA 2WF7A 3M9OB 3UXPA 4C0ZA 4JWMA 5J0XA 1Z4OA 1L6NA 2W54A 1ZRNA 9ICXA 5ALLA 2F1IA 3V7KA 2UVUA 3L4PA 3KHLA 5AKZA 2Y1JA 3CNHA 4DQRA 3MDAA 2HI0A 3MGIA 4FO6A 4DSFA 4NL9C 1RXVA 5KFGA 2GWSA 1Z4NA 2HHQA 5JUMA 1S76D 3H8JA 1ZQGA 1JROA 2FLNA 1VLBA 3OJUA 8ICGA 5KT5A 4RPYA 2KE7A 4DCCA 3SENA 4EBDA 3QZ7A 9ICGA 4Y2YA 2IOFK 4KLGA 3GIKA 2HHTA 5EE3A 2LPEA 1U49A 9ICTA 3PSFA 3H7IA 4P2HA 5KG3A 4P4MA 4ZH4A 3TI0A 2A19A 4B9NA 5AI0A 1ZQEA 4IR1A 3TACB 4Y2RA 4M04A 1URJA 4O3RA 2ZIUB 5EOZA 1TAMA 4X5VA 3QU5A 1SGGA 1D8BA 4O3QA 3UMGA 4KLEA 3BS5A 4LZDA 2H3FA 3V7LA 5ALEA 3SQIA 2E8OA 3A0BU 4FFDA 4C4SA 4IRKA 1RYUA 4Q44A 1KN5A 3C2MA 1ZQUA 2JEGA 3GZFA 1UHUA 1PUZA 2IOFA 5DG8A 1CUKA 2RDIA 4FBUA 1BGXT 4DFKA 2HHUA 4DSJA 1ZYQA 4GIBA 2PMZC 5L1MA 1NJXA 5J2HA 5DB7A 4ECUA 3JPOA 9ICBA 2ZG6A 4NM1A 1P7DA 1IG6A 1NK5A 1IM4A 3SI8A 3AU2A 1L7MA 3OGUA 2I1QA 2O6KA 2Y1IA 1Q3UA 3EW9A 2D8CA 4YP3A 4ED3A 3N4MB 3U26A 4BXOB 4F4KA 3G6YA 1XSLA 5ALSA 1NNLA 5DQIA 3AN1A 2HHSA 3R9KA 5AK5A 4RQ1A 4M9LA 4KLHA 4I2DA 2ODGA 2NRWA 2K8CB 3QX7A 4JMUA 4HYKA 3MR2A 3C23A 4R8UA 5EE0A 4C8LA 2QKQA 1HUZA 4EBEA 3EPGA 2EAOA 3ED5A 2YMMA 4I2HA 4J9SA 2KICA 2W3RA 4U6PA 4C4RA 1ZQNA 3PSTA 4P0QA 3RBEA 2HCFA 2G06A 4DSLA 2UVRA 1ZQIA 5AK4A 4QZ8A 2ATLA 1WWVA 4F5OA 3KOOA 2JV3A 3C29A 5KT3A 1WCLA 3PX6A 4F2SA 2R8KA 5AKEA 2ISPA 1KLNA 3I1YA 2BDUA 3OJSA 1RYRA 4I2BA 7ICJA 2JEFA 1JUDA 4LJXA 4O3NA 5J0SA 3F2CA 4UAVA 5ALIA 5KG5A 5AK3A 5D4BA 4XQ8A 2KIVA 3BQ0A 7ICGA 2HVIA 1HIWA 3V6HA 1X2IA 1N61A 2ZXHA 3IM1A 4OO1J 5CEHA 4KLLA 3ICXA 4YD2A 1F5SA 8ICCA 1SWVA 5KG1A 5L1KA 1UPHA 5J2GA 4C4TA 2MSNA 4R66A 4KLQA 1JXEA 3LVWA 1SB3C 3AQFA 1T3NA 4QIWF 4F93B 1JRPA 4MFFA 3E58A 1PVPA 3OHBA 3UQ2A 1ZOLA 1ZQJA 2XICA 2W55A 1SL1A 1N5XA 4DEZA 3LWMA 2G07A 3V6JA 1DK2A 4MFAA 2YMPA 4NLCA 3PW5A 1DOQA 3BS5B 3OHAA 3HJEA 2E8PA 1Z19A 1ZQTA 4ECXA 4I2EA 5AM2A 2XCAA 3QEAZ 2W43A 1V38A 5ALHA 3BQTA 3BQ1A 4DFMA 4YR2A 4KLSA 3T5HA 4DOBA 5CR0A 1SKRA 2KVSA 3C5FA 3VCBA 3C1YA 1ZETA 4B9UA 1HJPA 5AI8A 1L3TA 3C2KA 1X42A 2KD1A 3HP6A 1D8YA 8ICEA 3HPOA 5AIAA 4ECSA 3RJFA 1ZD4A 1ZQDA 3QYPA 4QWEA 5KFNA 4ED6A 3KD3A 5C5JA 3RB4A 3KHRA 3KFUF 9ICHA 3LK9A 2MUTA 4YMMA 2AXTU
chains in the Genus database with same CATH topology
2GH1A 2WAQF 3D2SA 4QNLA 3NUQA 2LBOA 3F2BA 1HIWA 3NRWA 2PMZC 3LYSA 2Y0SF 3CP8A 2ZXHA 4OJ5A 4BUGA 1XO0A 3CRXA 4OO1J 4FE3A 2KKPA 2JGAA 4GFJA 2H3ZA 2N1RA 3F5EA 2CN1A 2KNJA 2ZG6A 2ZXIA 3ICXA 4PL1A 1P7DA 2A3VA 2MRLA 4C0ZA 1UPHA 2KEYA 2G08A 4A8EA 1L6NA 3F5AA 2LYBA 1NZBA 3M7DA 2G09A 1T94A 4AYBC 2DF4B 3L3FX 4NLBA 2LHTA 2RP5A 3F53A 1Q3UA 1F44A 5HR7A 2NV3A 2KJ8A 3LVWA 5KL1B 2H3QA 2VJ4A 5A0LA 3AQFA 3SAFA 2OM6A 3SAGA 2G0AA 2CPRA 5T14A 2F8LA 4OJ6A 2YX8A 3IG8A 4QIWF 2XI9A 2LYAA 3E0FA 2K4IA 3F2DA 1PVPA 3VC8A 3PSPA 1XNSA 1WUDA 2K8AA 3N7SC 4NWIA 4WJ3B 1ZQ1C 3DEEA 2KHVA 2XICA 2HOQA 3HKZF 4PL2A 2K8CB 4JMUA 3C28A 4OJLA 2KJ5A 2G07A 2W03A 3IN5A 2LKYA 3IG5A 2H3VA 3N7RC 4U7CA 2GOLA 4BJQA 2E1FA 2PMZF 4NLCA 3SAHA 1Z1BA 2W7OA 2F76X 2ZIVB 2KJ9A 2HBKA 2ZIWB 1DRGA 1IIPA 2F2AB 2ZIWA 3H0LB 2RHFA 2XVTA 3PSFA 2DQNB 2Z7JA 4NV0A 1Z19A 1CRXA 4IC9A 2VJ5A 3RF9A 3M6ZA 2DGZA 2XIDA 4O3MA 2JH7A 4CDGA 2R18A 1HEKA 2KOBA 2WB1C 4AYBF 3IP4B 2K4EA 4CGZA 2HMXA 3SMVA 4U6PA 2F77X 2KICA 2HBJA 2RRDA 4ACOA 4FZNA 3CYMA 2OYYA 4P0QB 2VKQA 2VIXA 3PSTA 4BX9C 4CRXA 4P0QA 3KZXA 1GO3F 3AQEA 1URJA 3OPXA 2KVCA 3AL0B 2ZIUB 2JH1A 2K89A 2WAQC 2H3IA 1TAMA 2G06A 2HBLA 2JHDA 2WB1F 2W7PA 3M6KA 2E1EA 1Q3VA 2G5IB 2HOIA 3VCBA 2Y0SC 2E5SA 5C0YA 2W04A 3N7PD 4KX5A 4KX3A 2KKVA 1KBUA 1YT3A 2ZIXB 2K4HA 2D6FC 1D8BA 2KHQA 2ZIXA 2ZIVA 2M0NA 1PVRA 2H3FA 2YB1A 5KL8B 1A6SA 2JMGA 3ALRA 3C29A 5CRXA 1MA7A 2KD1A 3SQIA 2CRXA 3T79A 3RFAA 3D2NA 3H0RB 2K8BB 2OXOA 4KMOB 3D2QA 1PVQA 3K1ZA 3MGVA 1A0PA 3ONNA 4OJPA 2OH2A 2BDUA 4QJFB 4P0PB 3GU3A 4OJOA 3O0FA 4P0PA 3PSIA 4QIWC 2G5HB 1ECWA 1OUQA 2MA1A 3PZPA 3GZFA 2HOFA 5HR6A 3F2CA 2ZIUA 1SZHA 2KV2A 3KFUF 2HBMA 2Q4TA 3HKZC 3LVVA 4ICAA 4FZMA 1ED1A 2YB4A 2KIWA 3H0MB 4FZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYA A;  2K4I A;  1HEK A;  1HIW A;  2K4E A;  2HMX A;  1A6S A;  2H3Z A;  2N1R A;  4JMU A;  1UPH A;  1ECW A;  1L6N A;  2H3I A;  1TAM A;  2H3V A;  2LYB A;  2GOL A;  2K4H A;  2NV3 A;  4ICA A;  2H3Q A;  1ED1 A;  2H3F A;  2JMG A;  4IC9 A; 
#chains in the Genus database with same CATH topology
 2DKZ A;  4QNL A;  2JEI A;  1L5U A;  3NRW A;  3ISD A;  2OHF A;  2W9B A;  4RQ8 A;  1D9D A;  1JI7 A;  5DB9 A;  5JTI A;  4J9R A;  1S8O A;  1TK5 A;  4JWN A;  5KG4 A;  2RLT A;  5DLF A;  4R65 A;  2IOH A;  4Y2V A;  9ICW A;  4NLB A;  3NVY A;  1RM6 C;  4BWM A;  4E0D A;  3WKA A;  1N63 A;  3SAF A;  3SAG A;  1LV5 A;  4ED1 A;  5ALX A;  3Q8K A;  5KFK A;  3GIM A;  2PKE A;  2FMQ A;  3SV4 A;  3HKZ F;  2E3T A;  3A0H U;  4IRD A;  3T5L A;  2W03 A;  3IN5 A;  4UB4 A;  8ICJ A;  1XWL A;  5G5H A;  1ZQQ A;  2ZIW B;  5ALW A;  1WWU A;  3H0L B;  3NVW A;  2M9N A;  3TAD A;  5EE1 A;  5KG2 A;  3C2L A;  3V72 A;  4CDG A;  2WB1 C;  4I2G A;  1N62 A;  4QWA A;  3T5K A;  5EWE A;  1Z1V A;  2HBJ A;  2EQY A;  7ICM A;  4UB1 A;  2OWO A;  3I76 A;  5D46 A;  3RB0 A;  4NY8 A;  2Y0S C;  2NRV A;  4O5C A;  4PH5 A;  4PGX A;  2AGO A;  5ALQ A;  3B9J A;  9ICU A;  5AKK A;  4EEN A;  2Q0Z X;  4TUR A;  1LKY A;  2D3D A;  4RZR A;  4F92 B;  4RT2 A;  2ZJ5 A;  3EUB 2;  2FMS A;  1T7P A;  2BQU A;  4I2C A;  1ZQY A;  4NLG A;  3C21 A;  4MEY A;  4O3O A;  4RUA A;  4FZL A;  4PZN A;  2ZTE A;  3NUQ A;  5ALM A;  3QEB Z;  4FS1 A;  1XO0 A;  5AKL A;  2BZF A;  4BGD A;  4NM2 A;  5DLG A;  5AKG A;  2K60 A;  1QH9 A;  5BOL A;  4Q45 A;  2BR0 A;  2DF4 B;  2WHE A;  3M9N B;  4RNO A;  3MR6 A;  4ED7 A;  3DDH A;  3AUO A;  2DUY A;  4RPX A;  4ELV A;  2VAN A;  5AIB A;  2XGQ A;  4F5N A;  1O03 A;  4B9S A;  2KP7 A;  4CE6 A;  1FO4 A;  2I9G A;  5DBA A;  3LWL A;  2BGW A;  1BNO A;  3MC1 A;  5CA7 A;  5J2K A;  5KT7 A;  3KKA C;  1NK9 A;  2FLL A;  4DQP A;  3TAQ A;  2FDR A;  2BHN A;  4AYB F;  1UA1 A;  3ZI4 A;  4QZA A;  4ACO A;  2L5Y A;  1N48 A;  5J2D A;  3GIL A;  1CEZ A;  4RQ7 A;  1Q3V A;  3UXO A;  2JRZ A;  5L1J A;  5C0Y A;  3WKB A;  2EAM A;  3M1Y A;  3N7P D;  1DGS A;  2BPG A;  1NJZ A;  1L3S A;  5AKX A;  3H4B A;  4JV0 A;  1DGJ A;  2ZIV A;  9ICS A;  4F4Y A;  2IHN A;  2CRX A;  1KW4 A;  4PGY A;  1WG8 A;  2IBK A;  1S0V A;  1MQ2 A;  4USA A;  8ICQ A;  4I2A A;  3UMC A;  1YZ6 A;  4PPX A;  4RNM A;  2DBY A;  2QAR B;  1NK0 A;  2Q4T A;  1UQV A;  4FZM A;  2ZUB A;  2KIW A;  1NK4 A;  3QE9 Y;  2P6U A;  3RJJ A;  1BPX A;  9ICE A;  4J9K A;  3JPR A;  4MEX A;  2F3N A;  3F5A A;  1ZQK A;  3WK4 A;  5KFE A;  1X6J A;  4QZ9 A;  3L3F X;  1M6Y A;  1C7Y A;  5KL1 B;  2G0A A;  8ICL A;  3ZDB A;  2RDJ A;  4ED2 A;  4F50 A;  9ICJ A;  3PSP A;  4J9N A;  2PXI A;  1ZQ1 C;  1TAU A;  4B9L A;  4KLD A;  8ICP A;  3G6V A;  1JX4 A;  2BCQ A;  1V97 A;  4PZO A;  4C8N A;  2F76 X;  3H4D A;  3ETL A;  2VA8 A;  3I28 A;  4EYI B;  4CF5 A;  4XRH A;  3TFS A;  4O3M A;  5KG7 A;  1KL9 A;  2JR5 A;  2DKX A;  3RR8 A;  1JMS A;  2YML A;  1DXS A;  2NRT A;  4KN4 A;  5KFS A;  2WB1 F;  1TK8 A;  3M6K A;  4Y2S A;  3TQ1 A;  4UAU A;  1QQ7 A;  3GFK B;  4J9Q A;  2C2R A;  2YQE A;  3IV6 A;  4QZD A;  4RQN A;  2FPM A;  4I2J A;  5DKW A;  1XSN A;  4KMO B;  3UQ0 A;  5J0Q A;  3KTQ A;  2EZY A;  3QXG A;  4QZH A;  3GU3 A;  4Y2Q A;  2J6T A;  4IL6 U;  1U48 A;  2G5H B;  5HR6 A;  9ICL A;  3RB6 A;  2PFO A;  3QU2 A;  2F8K A;  5CJ7 A;  1ED1 A;  5CHG A;  1T8E A;  2GH1 A;  4C8K A;  2NRZ A;  1X6I A;  1D9F A;  1B43 A;  2LBO A;  5F9L A;  3SV3 A;  4M9G A;  4ECR A;  3PW4 A;  2PI5 A;  3ZDE A;  4JB3 A;  2AU0 A;  2W3S A;  4R63 A;  3JPT A;  4Y2P A;  5HHI A;  4M9N A;  1RPL A;  4UAZ A;  4CCH A;  4IR9 A;  5KT4 A;  4CF3 A;  9ICP A;  5DDY A;  2NV3 A;  1OXJ A;  1B4F A;  3H8S A;  2KK0 A;  2YX8 A;  5J2J A;  4LVS A;  1UT5 A;  3ZDD A;  5F3X B;  4NWI A;  4K4G A;  2HHX A;  2NYV A;  1Y88 A;  1XC9 A;  3ZD9 A;  2ZIV B;  1ZQV A;  9ICO A;  3BQ7 A;  3PML A;  2RHF A;  2XVT A;  1SV0 A;  5IIL A;  2XID A;  4F3O A;  1HEK A;  4M6W A;  4CGZ A;  4EX7 A;  5AI6 A;  4B9M A;  5L1I A;  3AL0 B;  4UB8 U;  2H3I A;  5DBC A;  5J0W A;  3JPQ A;  2W8K A;  2BCS A;  3HRD D;  3WK9 A;  3C5G A;  2V4Q A;  1MQ3 A;  4DL4 A;  2ZJA A;  1UT8 A;  1S5L U;  3UPQ A;  3H0R B;  4DSE A;  2K8B B;  2JZB A;  4QJF B;  2W9M A;  1RQL A;  4ECV A;  8ICU A;  1QCK A;  3PZP A;  2HOF A;  9ICV A;  4F71 A;  5DG7 A;  4KN7 A;  2HBM A;  4ECW A;  5ALT A;  2YMQ A;  1LB2 B;  5J2B A;  5KT2 A;  4PHA A;  5IIN A;  2W9C B;  2PFQ A;  1ZQO A;  4NL9 A;  4OJ5 A;  4DQI A;  1L7O A;  4EEY A;  1XO1 A;  2BQR A;  3SD7 A;  3PX4 A;  2ZUD A;  1COK A;  2MRL A;  5KFB A;  4UAY A;  1VJ5 A;  2KEY A;  4RQ4 A;  2WTF A;  1NZB A;  3PR4 A;  3GV7 B;  4YD1 A;  3TAP A;  5ALZ A;  4F72 A;  2VJ4 A;  2BKE A;  5KFO A;  1X9M A;  4OJ6 A;  2XI9 A;  2K4I A;  4J03 A;  3V7J A;  4KLO A;  3B0Y A;  3QUQ A;  1ZQR A;  1ZQA A;  4Q43 A;  2IMW P;  1QQ6 A;  3NRZ A;  4NJ8 A;  2C2D A;  4UB5 A;  2GOL A;  3NVV A;  4BJQ A;  3HWT A;  5AHX A;  3RH5 A;  4Z6E A;  1L7N A;  4PHE A;  1WYG A;  3ISB A;  3TAD C;  3RTV A;  4PHP A;  4NV0 A;  4F5Q A;  5DB6 A;  1ZQP A;  1KFD A;  5BOM A;  1J2M A;  1OW5 A;  2R18 A;  9ICA A;  7ICI A;  4R64 A;  3BJY A;  3MDC A;  9ICC A;  1SXD A;  3MR3 A;  1X9X A;  3UM9 A;  2WAQ C;  1S97 A;  2HBL A;  2JEJ A;  1SKW A;  4YG2 A;  2E5S A;  4O5K A;  4GC6 A;  1KKX A;  1QTM A;  2ZIX A;  5ALF A;  3GII A;  2M0N A;  1X9W A;  4PHD A;  1A6S A;  2XO7 A;  4DS4 A;  3H40 A;  4I2F A;  4HAI A;  3K1Z A;  5J8Y C;  1X40 A;  1KRP A;  3AEV A;  2I6X A;  2FJ6 A;  7ICH A;  3QUT A;  1ZD5 A;  8ICY A;  5EWG A;  3RJK A;  1RYS A;  1ZJM A;  4DOA A;  1PK3 A;  3F2B A;  5AKH A;  4IQV A;  3C1Z A;  2KNJ A;  3QZ8 A;  4A8E A;  1NKC A;  1TVA A;  2JXJ A;  1T94 A;  5KFY A;  4QZB A;  2KMD A;  4Y2X A;  9ICF A;  2H3Q A;  3AM9 A;  5T14 A;  2WF9 A;  3MBY A;  2LYA A;  5ALR A;  1B0X A;  3N7S C;  9ICR A;  5E79 U;  2J6S A;  2BQ3 A;  3FYH A;  1QLN A;  4M9J A;  5J0P A;  2B21 A;  5KFX A;  2PMZ F;  4CNQ A;  4R8U B;  5KFL A;  2R8I A;  1QQ5 A;  2CXY A;  4YXJ A;  4OD0 A;  3RAQ A;  3RJG A;  1BVS A;  2EZZ A;  4QZE A;  2DL0 A;  1PK1 A;  1CRX A;  3T5J A;  5KFI A;  1L8O A;  4MFC A;  4F91 B;  5D49 A;  2F1H A;  5CB1 A;  2A1J A;  1K5O A;  5F9N A;  1Z3E B;  4XUS A;  4P0Q B;  3TKA A;  3TAN A;  1S9F A;  5J2E A;  2J6U A;  2P6R A;  1S0M A;  2KVC A;  3PW2 A;  2W7P A;  5ALO A;  5KFU A;  7ICO A;  2KSO A;  1RXW A;  3SEI A;  3BZC A;  4NXZ A;  7ICP A;  5KAI U;  4YR0 A;  1EXN A;  4O5E A;  2VA2 A;  2B0C A;  4YN4 A;  3ONN A;  2ESE A;  4EZ9 A;  5KFH A;  2KZ3 A;  4P0P A;  3PSI A;  2ASL A;  2BCV A;  3IHQ B;  1QSS A;  5EWF A;  2C2E A;  3RBD A;  7ICQ A;  4B6J A;  3RRG A;  1U9L A;  2HSZ A;  1FEZ A;  5AIC A;  3WKE A;  4EEK A;  4UB2 A;  2R8J A;  3H0M B;  4UB6 U;  7ICK A;  3WK5 A;  4O3S A;  1FFU A;  1S0O A;  4RUC A;  2ALZ A;  3AMZ A;  5KFQ A;  2OCE A;  3RB3 A;  1NJW A;  1L7P A;  2EDU A;  2WF6 A;  3EWA A;  5GTI U;  1U47 A;  2UVV A;  1J2N A;  3RRH A;  4F2R A;  3M7D A;  3WKC A;  5HMM A;  1N56 A;  4RT3 A;  2CPR A;  1Q8K A;  4YMN A;  3PW7 A;  2V9W A;  3TFR A;  2YY6 A;  3QUC A;  4JV2 A;  2ZTD A;  2DPI A;  8ICI A;  2LKY A;  1ZQL A;  2H3V A;  3N7R C;  1C20 A;  5JU5 A;  3TAR A;  2IA6 A;  1DRG A;  5KFR A;  4DQQ A;  2DWQ A;  2DQN B;  2Z7J A;  1HUO A;  2LYH A;  2VJ5 A;  5J0T A;  2QLT A;  4ED8 A;  4QWB A;  4KIT B;  5III A;  4Q8E A;  1ZQS A;  1F0M A;  3QU9 A;  3PW0 A;  4B9T A;  2RRD A;  2NO5 A;  1RQN A;  5KFT A;  5AM5 A;  3Q8S B;  3GV8 B;  2HOI A;  4F8R A;  5J0R A;  1U4B A;  3EYZ A;  4GLX A;  3PR5 B;  3NS1 A;  3Q8Q B;  5CP2 A;  4JK1 A;  4YCX A;  5AI4 A;  4CF4 A;  1A77 A;  1S10 A;  3SZ2 A;  3MGV A;  1WCN A;  2LM4 A;  4O9M A;  3PNC A;  4OJO A;  2KFN A;  2LMR A;  4QWD A;  3RH4 A;  4MF8 A;  3UMB A;  1SZH A;  4YMO A;  4US9 A;  2MUT B;  4DL7 A;  1NKB A;  3OSN A;  3K4G A;  1N5W A;  3THV A;  5HP4 A;  2YB4 A;  5CWR A;  1V9P A;  2QB1 A;  2F1J A;  1X66 A;  3S6J A;  3J81 j;  2W9B B;  4F4Z A;  3CP8 A;  8ICV A;  3KBB A;  5AKY A;  2KKP A;  3F5E A;  2CN1 A;  1SKS A;  4NLZ A;  4M47 A;  5IIO A;  3Q8P B;  5KG0 A;  5HNK A;  5FP0 A;  3RR7 A;  5AKJ A;  2G09 A;  2RP5 A;  2C28 A;  1Q46 A;  8ICW A;  3NGD A;  8ICM A;  2E8M A;  4BXO A;  4P4P A;  3N28 A;  2A1J B;  5DGB A;  5G5G A;  3IRU A;  3IDW A;  3PV8 A;  8ICB A;  4F5R A;  3RJI A;  1MSW D;  2KJ5 A;  1O08 A;  1TKD A;  1T3Q A;  4NLK A;  5JRT A;  5ALK A;  3MGH A;  1XS9 D;  5J2C A;  1Z1B A;  1L8L A;  4DL6 A;  2BPF A;  1ZQC A;  1JAL A;  5ALU A;  4UAW A;  4DF8 A;  1SV0 C;  4DFJ A;  1FFV A;  2HMX A;  3SMV A;  1NZP A;  1IXR A;  3SYZ A;  1ZQH A;  1COO A;  2K89 A;  1V85 A;  2LI6 A;  4C7Z A;  2GO7 A;  1KBU A;  5HML A;  2H5X A;  3SR6 A;  3MFH A;  5L1L A;  3ALR A;  4JUZ A;  3T79 A;  7ICE A;  1LKY B;  4M0A A;  4Z6D A;  1N60 A;  3ZDC A;  3GQC A;  2OH2 A;  4RQ0 A;  4J9L A;  4Y2T A;  2PI4 A;  1KEJ A;  4QIW C;  3KHH A;  4DSI A;  2R8H A;  3HIL A;  3HW8 A;  5KFD A;  2D6F C;  3D2S A;  7ICR A;  3Q8L A;  2FMP A;  2Y0S F;  3CRX A;  2Y9U A;  8ICF A;  4GFJ A;  2H3Z A;  2BCU A;  5KFW A;  4KLF A;  3GDX A;  3WK7 A;  2XCP A;  4PJ0 U;  1A76 A;  4IQU A;  3F53 A;  2ES6 A;  4DFD A;  5AI5 A;  2KJ8 A;  3NAS A;  5A0L A;  1KFT A;  3KKA A;  2OM6 A;  2F8L A;  4YXM A;  3WKD A;  5J0U A;  4QZI A;  2ASD A;  4RNN A;  4Y2U A;  2KFZ A;  2F44 A;  3DEE A;  4EYH B;  2AHO B;  4IQT A;  3C28 A;  5DQH A;  1KQQ A;  1ZQW A;  2XGP A;  2LM1 A;  1ZQM A;  4P4O A;  1K1Q A;  5DDM A;  3M6Z A;  5DGA A;  3IP4 B;  3MR5 A;  1J97 A;  2VKQ A;  4UBC A;  4CRX A;  8ICO A;  1JIH A;  3AQE A;  1YZ7 A;  5KT6 A;  5KFJ A;  5ALY A;  1JXL A;  2G5I B;  4KX5 A;  3EPI A;  2KHQ A;  2FPK A;  4DOC A;  1PVR A;  1AQ6 A;  4EBC A;  5CRX A;  1MA7 A;  4UB3 A;  1TK0 A;  2XY6 A;  9ICQ A;  4GXJ A;  2BPC A;  2GLE A;  4M9H A;  4F5P A;  5ALD A;  1NK6 A;  3PO4 A;  1RG6 A;  4KLM A;  2MA1 A;  2B6G A;  3GIJ A;  1NK8 A;  1BPY A;  3K1R B;  5DG9 A;  5J0O A;  4K4I A;  5AKI A;  3HKZ C;  2HHW A;  3N97 B;  1U45 A;  2XY7 A;  2A1A A;  1SL0 A;  2PFN A;  1ZQB A;  5KFP A;  1K1S A;  1RZT A;  5DBB A;  3AU6 A;  3OSP A;  2HDO A;  1MC8 A;  3LDA A;  8ICT A;  4EZ6 A;  5HHH A;  5HR7 A;  4RQ3 A;  4DQS A;  1TE2 A;  4UAR A;  3RH6 A;  3QUB A;  2XC9 A;  2C22 A;  3IG8 A;  9ICK A;  3E0F A;  4I2I A;  4I29 A;  4BDP A;  4IQW A;  4WJ3 B;  4IS7 A;  2HOQ A;  4KLI A;  2EAP A;  1ZQX A;  4RU9 A;  1KDH A;  3IG5 A;  5B5E U;  3B0X A;  1ZQF A;  4DS5 A;  1JN3 A;  2W7O A;  5H2F U;  5AM0 A;  4EEL A;  1IIP A;  1VDV A;  2ZIW A;  4UQG A;  3D6J A;  3RF9 A;  2IHM A;  1S77 D;  3FC4 A;  3HT3 A;  1N2X A;  1CI4 A;  4US8 A;  2UVW A;  3KZX A;  4AP9 A;  3H8W A;  8ICK A;  1IV8 A;  3RAX A;  4ELU A;  4GXI A;  1XU4 A;  2RQ5 A;  5KFA A;  5KG6 A;  3ZDA A;  1BNP A;  5ALV A;  4ED0 A;  4DSK A;  4I28 A;  2KKV A;  4EX6 A;  4QZG A;  3ORY A;  4DL5 A;  2JMG A;  2YTU A;  3D2N A;  4YVZ A;  2OXO A;  3OTQ A;  3PO5 A;  1S0N A;  4C8O A;  5K4L A;  3BQ2 A;  1QSL A;  5ALN A;  4DF4 A;  1ECW A;  1TFR A;  1Z00 A;  1H38 A;  4DL3 A;  2ISO A;  1RDF A;  1L3V A;  3FDS A;  4ICA A;  3L5K A;  3JPP A;  1BPB A;  2FE9 A;  1UCV A;  3PMN A;  3LYS A;  4NLN A;  3BZK A;  2W9A A;  2N1R A;  5DB8 A;  2ZXI A;  2A3V A;  2LYB A;  3NTU A;  4AYB C;  5GTH U;  3MFI A;  4RQ2 A;  4G3I A;  4J9O A;  1BPE A;  1ZQZ A;  1L3U A;  3PY8 A;  4C80 A;  4G9B A;  3MAB A;  2WF8 A;  2AQ4 A;  3F2D A;  1B22 A;  1ZJN A;  1SV4 A;  2Y9T A;  4C7Y A;  3FAH A;  7ICU A;  8ICH A;  4B9V A;  2K4P A;  3BDP A;  4RPZ A;  1ZD3 A;  1NK7 A;  2NRX A;  2E1F A;  3SAH A;  2PFP A;  2NO4 A;  2P66 A;  4Y2J A;  4C8M A;  2KJ9 A;  1MN8 A;  4F4X A;  7ICF A;  4UAT A;  2F2A B;  2QB0 A;  4ELT A;  4FBT A;  4M6W B;  2DGZ A;  2JH7 A;  4GC7 A;  7ICN A;  4O0I A;  5KAF U;  8ICZ A;  3UXN A;  4FZN A;  3CYM A;  2OYY A;  2VIX A;  5J29 A;  1NKE A;  1GO3 F;  1LVH A;  3T3F A;  4JV1 A;  3WK6 A;  2JHD A;  3QNM A;  5ALG A;  2R8G A;  4ECQ A;  4KX3 A;  1YT3 A;  2EAN A;  1ZRM A;  4Z6C A;  1X9S A;  2EZX A;  3WK8 A;  5KL8 B;  4DLG A;  3RFA A;  1DK3 A;  7ICL A;  2JZB B;  1PVQ A;  2AJQ A;  4DLE A;  4OJP A;  4RQM A;  5KNI A;  4KMU A;  4YR3 A;  3M8R A;  1SZP A;  8ICS A;  4YQW A;  4O3P A;  5KFM A;  2KZZ A;  2I5H A;  5B66 U;  3PX0 A;  2QAR A;  4PGQ A;  3M9M B;  1XSP A;  4KLU A;  4BUG A;  2KN7 A;  3H8M A;  1UA0 A;  2JGA A;  4QZF A;  5TIS U;  3KZI U;  1BPD A;  4TUS A;  4OCZ A;  5BPC A;  3EZ5 A;  4J9M A;  5AM3 A;  3ZD8 A;  1PZN A;  2AQ0 A;  5DQG A;  4I27 A;  4ECY A;  5KFV A;  4KLJ A;  3VC8 A;  1XNS A;  1WUD A;  9ICN A;  3K75 D;  5EE9 A;  3DV9 A;  5J2I A;  2KHV A;  3RJH A;  1ARO P;  1D8L A;  8ICN A;  3CW2 C;  4OJL A;  5KFC A;  5J2A A;  1NOM A;  4RQ5 A;  5L9X A;  4J9P A;  3WU2 U;  3FM9 A;  4UAS A;  5AM1 A;  5IIJ A;  2WFA A;  2HBK A;  4ECZ A;  2WF5 A;  1T4G A;  2KTQ A;  9ICI A;  3E2E A;  1SXE A;  2EH9 A;  3NVZ A;  2F77 X;  5J8Y A;  4BX9 C;  1Z00 B;  3OPX A;  2DFL A;  2JH1 A;  2ZTC A;  2ZJ8 A;  2VA3 A;  2E1E A;  8ICR A;  2W04 A;  2ZIX B;  2K4H A;  9ICM A;  2MU2 A;  2AGP A;  3M8S A;  4K4H A;  5J0Y A;  1NI3 A;  4F4W A;  4TQR A;  4LZG A;  3JPN A;  4MF2 A;  2FLP A;  1SIJ A;  1OUQ A;  4DL2 A;  3V6K A;  4XA5 A;  8ICA A;  2ZIU A;  2W8L A;  5IIM A;  3Q8R B;  2FI1 A;  3PVX A;  5KFZ A;  4YFK A;  3QU4 A;  2WAQ F;  3ETR A;  4BWJ A;  1KSP A;  4DFP A;  2DPJ A;  4FE3 A;  2ASJ A;  4PL1 A;  5IIK A;  3G6X A;  5AK6 A;  2G08 A;  4ZOH C;  7ICS A;  3QU7 A;  4GXK A;  1F44 A;  2LHT A;  1TV9 A;  4DWI A;  3GV5 B;  1ZD2 P;  2E8N A;  2BCR A;  2QB0 B;  5KTQ A;  2KG5 A;  5ALP A;  2HW3 A;  3JPS A;  4IRC A;  3ISC A;  2K8A A;  4PL2 A;  5AM4 A;  2YN4 A;  1SL2 A;  4KTQ A;  7ICT A;  2OEH A;  5J2F A;  1BPZ A;  4Q8F A;  4U7C A;  2V4R A;  3RJE A;  1QSY A;  2KZM A;  2P35 A;  5ALJ A;  3HX0 A;  1SWW A;  1PK1 B;  4QW9 A;  3KHG A;  4IC9 A;  2AH5 A;  3Q8M A;  4QZC A;  2KOB A;  2FPL A;  4TQS A;  1TAQ A;  4UW9 A;  2K4E A;  7ICV A;  5AI9 A;  1KFS A;  4KLT A;  5TZV A;  4UBB A;  5KFF A;  4M2Y A;  2BDP A;  2KSO B;  1FIQ A;  4FS2 A;  2YB1 A;  1ZXI A;  4ECT A;  4QWC A;  3BS7 A;  3D2Q A;  2AGQ A;  1A0P A;  4P0P B;  3O0F A;  8ICX A;  4Z6F A;  4DO9 A;  4TUQ A;  2MAX A;  2KV2 A;  4QW8 A;  2W11 A;  4RQ6 A;  4TUP A;  1NJY A;  3LVV A;  2ZUC A;  2XY5 A;  2HVH A;  1KTQ A;  2W9C A;  4MHV A;  2HHV A;  2WF7 A;  3M9O B;  3UXP A;  4C0Z A;  4JWM A;  5J0X A;  1Z4O A;  1L6N A;  2W54 A;  1ZRN A;  9ICX A;  5ALL A;  2F1I A;  3V7K A;  2UVU A;  3L4P A;  3KHL A;  5AKZ A;  2Y1J A;  3CNH A;  4DQR A;  3MDA A;  2HI0 A;  3MGI A;  4FO6 A;  4DSF A;  4NL9 C;  1RXV A;  5KFG A;  2GWS A;  1Z4N A;  2HHQ A;  5JUM A;  1S76 D;  3H8J A;  1ZQG A;  1JRO A;  2FLN A;  1VLB A;  3OJU A;  8ICG A;  5KT5 A;  4RPY A;  2KE7 A;  4DCC A;  3SEN A;  4EBD A;  3QZ7 A;  9ICG A;  4Y2Y A;  2IOF K;  4KLG A;  3GIK A;  2HHT A;  5EE3 A;  2LPE A;  1U49 A;  9ICT A;  3PSF A;  3H7I A;  4P2H A;  5KG3 A;  4P4M A;  4ZH4 A;  3TI0 A;  2A19 A;  4B9N A;  5AI0 A;  1ZQE A;  4IR1 A;  3TAC B;  4Y2R A;  4M04 A;  1URJ A;  4O3R A;  2ZIU B;  5EOZ A;  1TAM A;  4X5V A;  3QU5 A;  1SGG A;  1D8B A;  4O3Q A;  3UMG A;  4KLE A;  3BS5 A;  4LZD A;  2H3F A;  3V7L A;  5ALE A;  3SQI A;  2E8O A;  3A0B U;  4FFD A;  4C4S A;  4IRK A;  1RYU A;  4Q44 A;  1KN5 A;  3C2M A;  1ZQU A;  2JEG A;  3GZF A;  1UHU A;  1PUZ A;  2IOF A;  5DG8 A;  1CUK A;  2RDI A;  4FBU A;  1BGX T;  4DFK A;  2HHU A;  4DSJ A;  1ZYQ A;  4GIB A;  2PMZ C;  5L1M A;  1NJX A;  5J2H A;  5DB7 A;  4ECU A;  3JPO A;  9ICB A;  2ZG6 A;  4NM1 A;  1P7D A;  1IG6 A;  1NK5 A;  1IM4 A;  3SI8 A;  3AU2 A;  1L7M A;  3OGU A;  2I1Q A;  2O6K A;  2Y1I A;  1Q3U A;  3EW9 A;  2D8C A;  4YP3 A;  4ED3 A;  3N4M B;  3U26 A;  4BXO B;  4F4K A;  3G6Y A;  1XSL A;  5ALS A;  1NNL A;  5DQI A;  3AN1 A;  2HHS A;  3R9K A;  5AK5 A;  4RQ1 A;  4M9L A;  4KLH A;  4I2D A;  2ODG A;  2NRW A;  2K8C B;  3QX7 A;  4JMU A;  4HYK A;  3MR2 A;  3C23 A;  4R8U A;  5EE0 A;  4C8L A;  2QKQ A;  1HUZ A;  4EBE A;  3EPG A;  2EAO A;  3ED5 A;  2YMM A;  4I2H A;  4J9S A;  2KIC A;  2W3R A;  4U6P A;  4C4R A;  1ZQN A;  3PST A;  4P0Q A;  3RBE A;  2HCF A;  2G06 A;  4DSL A;  2UVR A;  1ZQI A;  5AK4 A;  4QZ8 A;  2ATL A;  1WWV A;  4F5O A;  3KOO A;  2JV3 A;  3C29 A;  5KT3 A;  1WCL A;  3PX6 A;  4F2S A;  2R8K A;  5AKE A;  2ISP A;  1KLN A;  3I1Y A;  2BDU A;  3OJS A;  1RYR A;  4I2B A;  7ICJ A;  2JEF A;  1JUD A;  4LJX A;  4O3N A;  5J0S A;  3F2C A;  4UAV A;  5ALI A;  5KG5 A;  5AK3 A;  5D4B A;  4XQ8 A;  2KIV A;  3BQ0 A;  7ICG A;  2HVI A;  1HIW A;  3V6H A;  1X2I A;  1N61 A;  2ZXH A;  3IM1 A;  4OO1 J;  5CEH A;  4KLL A;  3ICX A;  4YD2 A;  1F5S A;  8ICC A;  1SWV A;  5KG1 A;  5L1K A;  1UPH A;  5J2G A;  4C4T A;  2MSN A;  4R66 A;  4KLQ A;  1JXE A;  3LVW A;  1SB3 C;  3AQF A;  1T3N A;  4QIW F;  4F93 B;  1JRP A;  4MFF A;  3E58 A;  1PVP A;  3OHB A;  3UQ2 A;  1ZOL A;  1ZQJ A;  2XIC A;  2W55 A;  1SL1 A;  1N5X A;  4DEZ A;  3LWM A;  2G07 A;  3V6J A;  1DK2 A;  4MFA A;  2YMP A;  4NLC A;  3PW5 A;  1DOQ A;  3BS5 B;  3OHA A;  3HJE A;  2E8P A;  1Z19 A;  1ZQT A;  4ECX A;  4I2E A;  5AM2 A;  2XCA A;  3QEA Z;  2W43 A;  1V38 A;  5ALH A;  3BQT A;  3BQ1 A;  4DFM A;  4YR2 A;  4KLS A;  3T5H A;  4DOB A;  5CR0 A;  1SKR A;  2KVS A;  3C5F A;  3VCB A;  3C1Y A;  1ZET A;  4B9U A;  1HJP A;  5AI8 A;  1L3T A;  3C2K A;  1X42 A;  2KD1 A;  3HP6 A;  1D8Y A;  8ICE A;  3HPO A;  5AIA A;  4ECS A;  3RJF A;  1ZD4 A;  1ZQD A;  3QYP A;  4QWE A;  5KFN A;  4ED6 A;  3KD3 A;  5C5J A;  3RB4 A;  3KHR A;  3KFU F;  9ICH A;  3LK9 A;  2MUT A;  4YMM A;  2AXT U; 
#chains in the Genus database with same CATH homology
 2GH1 A;  2WAQ F;  3D2S A;  4QNL A;  3NUQ A;  2LBO A;  3F2B A;  1HIW A;  3NRW A;  2PMZ C;  3LYS A;  2Y0S F;  3CP8 A;  2ZXH A;  4OJ5 A;  4BUG A;  1XO0 A;  3CRX A;  4OO1 J;  4FE3 A;  2KKP A;  2JGA A;  4GFJ A;  2H3Z A;  2N1R A;  3F5E A;  2CN1 A;  2KNJ A;  2ZG6 A;  2ZXI A;  3ICX A;  4PL1 A;  1P7D A;  2A3V A;  2MRL A;  4C0Z A;  1UPH A;  2KEY A;  2G08 A;  4A8E A;  1L6N A;  3F5A A;  2LYB A;  1NZB A;  3M7D A;  2G09 A;  1T94 A;  4AYB C;  2DF4 B;  3L3F X;  4NLB A;  2LHT A;  2RP5 A;  3F53 A;  1Q3U A;  1F44 A;  5HR7 A;  2NV3 A;  2KJ8 A;  3LVW A;  5KL1 B;  2H3Q A;  2VJ4 A;  5A0L A;  3AQF A;  3SAF A;  2OM6 A;  3SAG A;  2G0A A;  2CPR A;  5T14 A;  2F8L A;  4OJ6 A;  2YX8 A;  3IG8 A;  4QIW F;  2XI9 A;  2LYA A;  3E0F A;  2K4I A;  3F2D A;  1PVP A;  3VC8 A;  3PSP A;  1XNS A;  1WUD A;  2K8A A;  3N7S C;  4NWI A;  4WJ3 B;  1ZQ1 C;  3DEE A;  2KHV A;  2XIC A;  2HOQ A;  3HKZ F;  4PL2 A;  2K8C B;  4JMU A;  3C28 A;  4OJL A;  2KJ5 A;  2G07 A;  2W03 A;  3IN5 A;  2LKY A;  3IG5 A;  2H3V A;  3N7R C;  4U7C A;  2GOL A;  4BJQ A;  2E1F A;  2PMZ F;  4NLC A;  3SAH A;  1Z1B A;  2W7O A;  2F76 X;  2ZIV B;  2KJ9 A;  2HBK A;  2ZIW B;  1DRG A;  1IIP A;  2F2A B;  2ZIW A;  3H0L B;  2RHF A;  2XVT A;  3PSF A;  2DQN B;  2Z7J A;  4NV0 A;  1Z19 A;  1CRX A;  4IC9 A;  2VJ5 A;  3RF9 A;  3M6Z A;  2DGZ A;  2XID A;  4O3M A;  2JH7 A;  4CDG A;  2R18 A;  1HEK A;  2KOB A;  2WB1 C;  4AYB F;  3IP4 B;  2K4E A;  4CGZ A;  2HMX A;  3SMV A;  4U6P A;  2F77 X;  2KIC A;  2HBJ A;  2RRD A;  4ACO A;  4FZN A;  3CYM A;  2OYY A;  4P0Q B;  2VKQ A;  2VIX A;  3PST A;  4BX9 C;  4CRX A;  4P0Q A;  3KZX A;  1GO3 F;  3AQE A;  1URJ A;  3OPX A;  2KVC A;  3AL0 B;  2ZIU B;  2JH1 A;  2K89 A;  2WAQ C;  2H3I A;  1TAM A;  2G06 A;  2HBL A;  2JHD A;  2WB1 F;  2W7P A;  3M6K A;  2E1E A;  1Q3V A;  2G5I B;  2HOI A;  3VCB A;  2Y0S C;  2E5S A;  5C0Y A;  2W04 A;  3N7P D;  4KX5 A;  4KX3 A;  2KKV A;  1KBU A;  1YT3 A;  2ZIX B;  2K4H A;  2D6F C;  1D8B A;  2KHQ A;  2ZIX A;  2ZIV A;  2M0N A;  1PVR A;  2H3F A;  2YB1 A;  5KL8 B;  1A6S A;  2JMG A;  3ALR A;  3C29 A;  5CRX A;  1MA7 A;  2KD1 A;  3SQI A;  2CRX A;  3T79 A;  3RFA A;  3D2N A;  3H0R B;  2K8B B;  2OXO A;  4KMO B;  3D2Q A;  1PVQ A;  3K1Z A;  3MGV A;  1A0P A;  3ONN A;  4OJP A;  2OH2 A;  2BDU A;  4QJF B;  4P0P B;  3GU3 A;  4OJO A;  3O0F A;  4P0P A;  3PSI A;  4QIW C;  2G5H B;  1ECW A;  1OUQ A;  2MA1 A;  3PZP A;  3GZF A;  2HOF A;  5HR6 A;  3F2C A;  2ZIU A;  1SZH A;  2KV2 A;  3KFU F;  2HBM A;  2Q4T A;  3HKZ C;  3LVV A;  4ICA A;  4FZM A;  1ED1 A;  2YB4 A;  2KIW A;  3H0M B;  4FZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...