1HEKA

Crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
AMADIGSMGDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWAISAVKMGLQINNVVDGKASFQLLRAKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Equine Infectious Anemia Virus Matrix Protein.
pubmed doi rcsb
molecule keywords GAG POLYPROTEIN, CORE PROTEIN P15
molecule tags Viral protein
source organism Equine infectious anemia virus
total genus 30
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08723 Gag_p15 Gag protein p15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hekA00
2H3FA 2LYAA 2H3IA 2K4IA 4ICAA 2K4EA 1A6SA 2HMXA 4JMUA 2NV3A 1ED1A 1UPHA 2LYBA 2K4HA 2H3VA 1ECWA 1L6NA 2H3ZA 2H3QA 1HEKA 2GOLA 4IC9A 1TAMA 2N1RA 1HIWA 2JMGA
chains in the Genus database with same CATH superfamily
1U48A 8ICWA 4JV2A 4OJLA 2CXYA 5J2GA 2DUYA 2HBLA 3QUCA 3HP6A 5CB1A 3OTQA 4RQ5A 1WWUA 2KVCA 3PW2A 2LYBA 2Y9UA 2ALZA 1L7NA 2AJQA 7ICHA 2GOLA 1JI7A 3RJGA 4BXOA 5KT4A 2GH1A 2KZZA 2ZJ5A 1MQ3A 1UCVA 2EAMA 2AU0A 1XC9A 2QKQA 5AK3A 5KFMA 1X2IA 4BDPA 4J9NA 2UVVA 2AXTU 4JMUA 2Y0SC 4RU9A 1ECWA 3F2BA 1KSPA 7ICEA 2D6FC 4PZOA 4B9VA 1S10A 5J0QA 1V85A 4NL9C 5J2IA 4J9RA 2JGAA 3TACB 4M0AA 4ECVA 3NRWA 5AIAA 2IA6A 4MHVA 5C5JA 4Y2JA 2E1FA 5ALLA 2ZUCA 2W11A 3ZDAA 4J03A 2KTQA 2RRDA 2KSOA 1NZPA 3GIKA 1FFUA 2W9CA 3PW0A 2HBJA 4CRXA 4PGXA 1Z1BA 1NZBA 3THVA 1ZD2P 4DQRA 4GFJA 2ISPA 4AP9A 4OJ5A 4F2SA 4HAIA 5AK6A 5KT5A 1CRXA 1C20A 2FPLA 3BZCA 2KVSA 2K8BB 4F3OA 4QZ9A 2ZXIA 5DB8A 3IN5A 4IR9A 1D8BA 3S6JA 1ZQUA 3KD3A 2LM4A 5EWFA 5KFYA 4ECQA 4PL1A 1NI3A 4RNNA 8ICBA 1XSLA 4UB3A 8ICAA 2Q4TA 1RPLA 3MGIA 2RDIA 3CYMA 4FBUA 5ALQA 3IHQB 1OW5A 2BPCA 2P6UA 5GTIU 1M6YA 3H0MB 5J0WA 4KLSA 2KSOB 1UPHA 4ED2A 5AI9A 2HVIA 5HMMA 3PNCA 3QU5A 2KG5A 1QCKA 3C1YA 3PZPA 1TKDA 3M6KA 4B9NA 2UVWA 2WAQC 1BPDA 2LM1A 4YXJA 5J0RA 5D49A 3TQ1A 5D4BA 5BOLA 4DFMA 2VA3A 3BQ7A 9ICPA 2MSNA 2F8LA 4QIWF 5ALRA 8ICHA 4O9MA 3KTQA 4DOAA 3U26A 8ICGA 3SEIA 4J9MA 5HHIA 5DG8A 7ICQA 4C80A 1ZQCA 2DL0A 3IG8A 3JPNA 4J9OA 4KLHA 1XWLA 2NRTA 3GILA 1Z4NA 1TAUA 4Q45A 2KIWA 2KHQA 3GU3A 3JPOA 2JH1A 4MFCA 2FDRA 3OPXA 1BPBA 3WKCA 2NO5A 3H8WA 4UARA 2K4PA 1ZQDA 5ALDA 5ALJA 7ICKA 2VJ5A 8ICTA 1VJ5A 1TE2A 2HHQA 5KG3A 5KG4A 2BZFA 2DF4B 3CW2C 2H3ZA 3LWMA 2HVHA 4PL2A 2IOHA 2FPMA 3HKZC 5ALNA 3DDHA 2G5HB 1CUKA 3G6YA 4DL3A 9ICLA 2HHUA 3G6XA 4YR0A 4KLJA 8ICCA 1ZQIA 3CRXA 3NUQA 1ZJNA 3MGHA 2DKXA 1N56A 5JTIA 1X9SA 4C7ZA 4RQ0A 5CHGA 2ZTEA 1TK0A 4K4GA 2R8IA 3FDSA 2P66A 5L1KA 5J2KA 4F5RA 4PHDA 3H4DA 2WF9A 1N2XA 3ISBA 3ETLA 1UT8A 1KTQA 5KT2A 2KFZA 1ZD3A 3RB4A 3RR7A 7ICJA 4OJ6A 3H8SA 5J0UA 3AM9A 1S0MA 1TK5A 4O5KA 4QWAA 4ECTA 3KHLA 3SI8A 3H8JA 2ZTCA 1JMSA 3H8MA 3PMNA 3M9MB 3QU7A 5KFIA 4NWIA 1QQ6A 3RBEA 4OD0A 2A3VA 3EPIA 5AK5A 9ICOA 2BKEA 4NM2A 7ICRA 5KL8B 4O5CA 5KFTA 3K4GA 3LVVA 5KFZA 2WF7A 2G0AA 3PW7A 5KG7A 5AM2A 1N5WA 4F4ZA 1K1SA 4ACOA 1OUQA 3M7DA 4RUCA 4DQQA 4DL6A 2FLNA 3N28A 3PO4A 1WCLA 4Z6DA 3RJJA 4DS5A 3A0HU 5K4LA 4RNMA 3MABA 4Q43A 4ED0A 1SZPA 3N7PD 2MRLA 3F5EA 4F5OA 3GV8B 2XI9A 2ASDA 2LKYA 1JROA 5G5GA 2HBMA 3ZDBA 5IILA 5AM1A 3TFRA 4XQ8A 4UB5A 4I2IA 4NV0A 2E8OA 2E3TA 1KQQA 3QUBA 1JIHA 5KFBA 1ZQMA 2AGOA 2XY5A 3AQEA 2HOIA 3NTUA 2OM6A 1D9DA 2PI5A 2HHXA 2BQUA 5L1IA 5DQIA 1NKBA 4ED6A 4BX9C 3SYZA 2YN4A 3SAFA 3PR5B 3UXOA 3RB6A 3WK5A 3J81j 3N97B 8ICUA 1F0MA 2C2EA 5HR6A 3HPOA 1RYUA 3MDCA 3N7SC 3EWAA 1VLBA 1DK2A 4R8UA 3MFIA 9ICAA 3JPQA 4ECWA 1MSWD 1LV5A 2NRVA 3L4PA 3LDAA 5KFDA 3QUTA 2PFQA 4I28A 4RPZA 2W9AA 2Y0SF 1IG6A 1A77A 3MC1A 4P4MA 2HOFA 4I29A 4M9JA 1FFVA 1Q46A 2K4IA 5IIMA 4Y2QA 3AUOA 2BQ3A 4US8A 4NL9A 1IXRA 2KEYA 1GO3F 2A1JA 4GC7A 5DBBA 3QU2A 3RTVA 5F3XB 8ICVA 3BS5A 4GLXA 2RP5A 4CDGA 2LHTA 3MFHA 2MAXA 5KFUA 1SGGA 4RQMA 5J2FA 1S0NA 2Y9TA 5KTQA 3KHHA 2WHEA 2OYYA 4AYBF 5IIIA 3O0FA 5J0PA 1SKSA 5ALMA 2DBYA 4MFFA 4F91B 4IQTA 1WG8A 1S5LU 2BCUA 1J2MA 3ZI4A 2DQNB 2JMGA 3WK6A 3ICXA 7ICTA 8ICOA 4Y2RA 2YB1A 4DCCA 1NJZA 5ALOA 1ZQFA 3T3FA 4IRDA 4PPXA 8ICQA 1ED1A 1DOQA 2OHFA 9ICKA 4RQ7A 3UMCA 4KLQA 1QTMA 1DGSA 4IC9A 5ALGA 9ICQA 5J2AA 3PX4A 3VC8A 2HOQA 1SIJA 3PW5A 4R64A 4CNQA 5KFEA 4BGDA 2W3RA 4UW9A 2KJ9A 3EW9A 4IQUA 4KX5A 8ICPA 2XVTA 4US9A 5AKYA 2GO7A 1TAMA 5AKIA 1D9FA 5E79U 2MUTA 3LYSA 2YQEA 4Y2XA 7ICVA 3NVYA 3KFUF 4F5NA 1X42A 4DEZA 3ORYA 4FBTA 4RT3A 4KTQA 1BPEA 1SL1A 1DRGA 2B21A 3PW4A 3RJKA 2N1RA 1XO1A 1XS9D 5J0YA 3KHGA 2P6RA 3BJYA 2ZIXA 1HJPA 1XNSA 1KW4A 1U4BA 1AROP 1K1QA 5BOMA 3M8SA 3HT3A 4ELUA 4NLBA 3DV9A 3B0XA 4NJ8A 3ISCA 4FE3A 4DFKA 3Q8KA 3PSIA 1F44A 4Z6FA 3PY8A 2H3FA 1QLNA 3QZ7A 1S8OA 3RH4A 1WCNA 2HI0A 5KNIA 1ZYQA 1XO0A 1ZQXA 3PVXA 1ZQTA 2XICA 4QW8A 3KBBA 2NV3A 2BDPA 5KFLA 3GDXA 3NS1A 2K4HA 2G08A 4I2EA 1P7DA 1L8LA 1RYRA 4KLDA 2F2AB 5IIKA 4O3PA 3M9NB 1RDFA 3QXGA 1ZQJA 3RAXA 1TK8A 1PK3A 2R8JA 5DBCA 4F4WA 3SV3A 9ICSA 1Z1VA 2ZIXB 4JWMA 4Q8FA 2HHTA 3RAQA 2JZBA 7ICIA 3TFSA 1PUZA 1LKYA 4NXZA 4UATA 2AGQA 2FE9A 1A0PA 1RG6A 3WK9A 3E2EA 4ED8A 1K5OA 4U7CA 2V9WA 2H3IA 3WK7A 2MU2A 2W3SA 3JPPA 2K60A 3C28A 2QB0A 4KLGA 1JXLA 3AU6A 2WF6A 1ZQYA 5KFKA 1B4FA 1UA0A 1ZQVA 5CWRA 4JK1A 4RQ8A 2JZBB 2YX8A 3CNHA 1LKYB 2KZ3A 3ONNA 1HUZA 2E8PA 4YMNA 5DGBA 4KITB 1ZRMA 9ICWA 4C4RA 1T8EA 9ICCA 1RXVA 2F8KA 4KLIA 4EENA 1U9LA 4QJFB 1V97A 1WUDA 3ED5A 1SZHA 1A76A 3PSTA 1PK1B 2QB1A 4IQWA 2QB0B 5CA7A 4UAYA 2KV2A 3HWTA 5HP4A 1L6NA 5KT6A 2H3QA 1QSSA 2IOFK 3H0LB 4MF8A 4O3NA 4J9PA 3BZKA 2F77X 3C5GA 4G9BA 5KFHA 4UAVA 4LZDA 5KFAA 4I2CA 1ZD5A 4I2FA 2VJ4A 3D2NA 4ICAA 5ALEA 2JEJA 4UBCA 3GQCA 4DQIA 4C7YA 1N48A 2K89A 3SAGA 4UBBA 5DKWA 2FI1A 3A0BU 1S0OA 1ZETA 4EX6A 3OJSA 1TV9A 2VA8A 3TADC 2R8GA 4NLGA 2NYVA 4DO9A 7ICMA 1WWVA 2XGQA 4F4XA 3IDWA 5AHXA 5AK4A 1URJA 2KD1A 2ZUBA 4YD2A 2EANA 3ETRA 2BCVA 3EUB2 2EH9A 4YVZA 4FZLA 2GLEA 4YQWA 1S77D 5TISU 5B66U 4YFKA 4P4PA 2ZIWB 7ICLA 2R18A 3NASA 1B43A 1X66A 1UHUA 2ATLA 3T5KA 4YG2A 4I2DA 4RNOA 4I27A 5J29A 4ZOHC 2QARB 5CP2A 4IS7A 2Y1IA 5KFJA 2KP7A 2BR0A 2Y1JA 4O0IA 4B9UA 3BS7A 4BJQA 5ALHA 3RJHA 3F53A 2RDJA 4WJ3B 4UB2A 2AGPA 3K75D 2YB4A 1NJWA 2ASJA 1C7YA 2FMQA 2W8KA 2M0NA 4RT2A 3NVZA 2RQ5A 3NGDA 1RQLA 5KFGA 2VANA 4GIBA 2PKEA 3SZ2A 1ZQLA 9ICMA 2IOFA 1NK0A 3LWLA 2XCPA 2WF5A 1NK7A 2H5XA 3F2DA 2EQYA 4R66A 1MQ2A 3QYPA 3EYZA 1NOMA 3CP8A 1WYGA 5JRTA 4UAUA 4F4KA 4P0PA 4DQSA 3TAPA 5ALPA 1SKWA 3D2QA 1Y88A 4RQ6A 5F9NA 1FIQA 1YZ6A 9ICIA 1JX4A 2NRWA 4B9SA 1D8YA 1L3UA 4KMUA 2VIXA 4M9GA 3AQFA 4KLMA 5A0LA 4J9LA 2ZJAA 3T5JA 5KFCA 5HR7A 3BQ2A 9ICTA 1Z4OA 2JEGA 4EX7A 3OGUA 2DKZA 5HHHA 7ICGA 4X5VA 3RJFA 3OHAA 2QLTA 2PI4A 2WF8A 3UXPA 8ICKA 4Y2PA 3V6JA 4GXJA 5DBAA 9ICVA 4DF8A 4I2BA 3WU2U 4P0PB 4B9TA 2XY7A 4UB1A 3C2MA 1MA7A 3M8RA 4IR1A 3FYHA 2W9BA 1NK5A 1VDVA 4CGZA 2BPGA 2ODGA 3N7RC 3EPGA 2C28A 4F5QA 4ED3A 8ICFA 4DFDA 5ALWA 1J97A 2L5YA 3T79A 2KIVA 4KMOB 3WK8A 4JB3A 3SENA 4F4YA 2UVRA 4NLKA 2BCSA 3H40A 2XO7A 4EELA 5AM0A 2I9GA 2F1IA 5DDYA 3RH5A 2H3VA 4C8LA 1N63A 5J2BA 4QZFA 1TFRA 4Y2VA 2IMWP 3FC4A 1H38A 2UVUA 2ZTDA 3L3FX 4C0ZA 1X6JA 4NM1A 2W9BB 3RB3A 2V4QA 3QX7A 1U45A 1ZQBA 2LI6A 1L7PA 1JRPA 2B0CA 5AICA 5AM4A 5ALYA 4LVSA 4KLFA 4DF4A 4C8OA 3JPRA 3T5HA 5EOZA 2CPRA 3I28A 2VKQA 3TARA 3PSFA 1DXSA 2J6SA 4QIWC 3OJUA 5EE1A 4DL2A 5L9XA 5AKJA 2AQ4A 3WKEA 4Y2TA 4DFJA 5JU5A 3ZDEA 4GC6A 3LK9A 4RZRA 8ICYA 2F44A 1L7OA 2IHNA 3RF9A 9ICBA 4BUGA 1HEKA 1B22A 8ICLA 2W7OA 2OH2A 1PVRA 2BGWA 9ICJA 4EZ9A 4KLEA 4C8KA 2EAPA 2R8KA 9ICFA 5EE9A 4PGYA 1KFTA 2CN1A 4UB6U 4F2RA 3HW8A 4M9HA 2YMMA 2HSZA 1KDHA 5J0XA 3BQTA 2BCQA 4UQGA 1JUDA 3WKDA 5J0OA 5KG1A 2DPIA 8ICIA 1S76D 3PX6A 4F50A 1X9WA 2I5HA 3WK4A 2I6XA 1SWWA 2J6UA 1RM6C 1SV0C 5ALIA 2C2RA 4U6PA 2FLPA 3Q8LA 2XC9A 1V38A 4TUSA 2ZG6A 1NJYA 3QU4A 3MR2A 2DFLA 5J2JA 4UASA 2PFNA 1SB3C 4A8EA 4GXIA 4Y2UA 4UAZA 2XY6A 1RQNA 2K4EA 5FP0A 1Z19A 2EDUA 1QH9A 3I1YA 1CEZA 1XU4A 1SWVA 2VA2A 3ALRA 3GIMA 4PJ0U 1B0XA 2ASLA 2F76X 4PHPA 3PX0A 3AU2A 4QWEA 2J6TA 4M9NA 3HILA 4KX3A 1EXNA 3IP4B 4JUZA 4EBEA 4RQNA 2ZIUB 4JV0A 5DLFA 2G06A 1NKCA 4TUPA 2WAQF 4DQPA 4EZ6A 3EZ5A 3UQ2A 5F9LA 4ELVA 1ZQZA 2OWOA 4EBCA 1RXWA 3AEVA 2EZYA 2DPJA 2Q0ZX 1KLNA 2HDOA 1Z3EB 1Q3UA 8ICJA 4F8RA 2JV3A 4PGQA 2ZUDA 3OHBA 4QZ8A 2W04A 3AMZA 4B9MA 4IQVA 3RFAA 3T5LA 3KZIU 3TADA 5JUMA 1NK9A 1COKA 4RUAA 2JEFA 3HRDD 5AKZA 4O3OA 2HHSA 3TI0A 1AQ6A 5DB7A 3M6ZA 4QZBA 2G5IB 4B9LA 5IIJA 2YMQA 2B6GA 2JXJA 5AM5A 4QZDA 1COOA 3PR4A 4PZNA 2FJ6A 9ICNA 2IHMA 5CR0A 2D3DA 2OXOA 1SXDA 2PFOA 3QE9Y 5KL1B 5J8YC 1LB2B 3C29A 5CJ7A 3V72A 1KL9A 2BQRA 3QUQA 5ALFA 4M2YA 1NK6A 4BWMA 3HKZF 4RQ2A 2YTUA 1N62A 1X6IA 4QZAA 4DWIA 4YCXA 4RQ3A 4MEYA 4DSIA 1FEZA 4FS2A 2PFPA 4M04A 3MR5A 3RRHA 3BQ0A 3GZFA 5KFSA 1FO4A 5J2EA 2R8HA 3F2CA 1ZQHA 2PMZC 5AKLA 3TKAA 4FO6A 9ICUA 2OCEA 3QEBZ 5KFWA 3GIIA 1T7PA 1HUOA 5DB9A 7ICSA 2JHDA 2K8AA 7ICPA 2KFNA 3UMGA 7ICOA 3TAQA 1SV4A 5KG6A 4YMOA 5KG0A 4GXKA 4O3RA 1T94A 3UPQA 5KFFA 5DG7A 4KLOA 1PK1A 3Q8PB 2WB1C 2D8CA 2LYHA 2V4RA 2YMPA 1MC8A 4C8NA 8ICRA 4DSEA 5ALUA 1BPXA 5KT7A 1J2NA 1ZOLA 3Q8QB 4QNLA 3HX0A 1ZRNA 3BQ1A 1JN3A 4IRCA 7ICNA 2C22A 3ZD8A 4QZHA 3QZ8A 3V7KA 1A6SA 2KN7A 3GV7B 4IRKA 2W03A 4BXOB 4CF5A 4EYHB 4R65A 3MGVA 5AKKA 4O5EA 4YXMA 1N60A 1UT5A 4UB8U 4Y2SA 5KFOA 5J0TA 2G07A 4AYBC 1KKXA 3UMBA 2I1QA 5EWEA 1RZTA 4F72A 2BPFA 1X9MA 4M47A 1SXEA 2HBKA 3KOOA 1PVQA 3HJEA 2KKVA 2NRXA 2KKPA 3MR3A 4YN4A 5J0SA 5EE0A 7ICUA 5CRXA 3ZDCA 1ZXIA 5ALKA 4F5PA 2KJ8A 4C4TA 4CF3A 3GIJA 2ZIWA 1ZD4A 2FMSA 2Z7JA 3L5KA 5ALTA 1OXJA 3KKAC 2W8LA 3JPTA 8ICZA 4OO1J 2KICA 4YR3A 4UAWA 9ICEA 1KFDA 4EEYA 2NRZA 3TANA 2QARA 1NK4A 2XGPA 3IV6A 9ICGA 2W9CB 5DB6A 3SMVA 3BDPA 5AKHA 2O6KA 4ECUA 3DEEA 4YD1A 5ALVA 1O03A 4LZGA 2CRXA 4TQRA 1IV8A 3E0FA 4C4SA 1XSPA 1S97A 3UQ0A 1ZQSA 5HNKA 1QQ5A 2BHNA 4ECXA 1ZQQA 1KEJA 1SL0A 4Y2YA 4ELTA 5J2DA 3RJIA 4JV1A 5KT3A 3VCBA 4J9KA 4DOBA 1IIPA 2YMLA 4P2HA 1L7MA 1BNOA 4F71A 4DL4A 4FS1A 3V7LA 1KRPA 5GTHU 2HCFA 1UQVA 1ZJMA 1QSLA 4KLLA 2F1HA 2W55A 3MBYA 2BCRA 3K1ZA 2BDUA 5L1JA 5D46A 5AIBA 5G5HA 3C21A 4OJOA 1TAQA 5J2HA 4NY8A 2W54A 4ECRA 3RRGA 4QZGA 5AI0A 5H2FU 4O3SA 5ALXA 4EYIB 4B6JA 2EAOA 5IINA 5DQGA 4CCHA 2F3NA 4DLGA 1SV0A 4RQ4A 4YP3A 3RB0A 5KFPA 4DL5A 3C5FA 4FZNA 4DLEA 5TZVA 1N61A 1HIWA 1XSNA 1ZQKA 4USAA 2HHVA 4I2AA 3H4BA 2EZZA 3K1RB 5DLGA 4MEXA 2HW3A 5AI5A 5AM3A 3F5AA 2W43A 2JRZA 1T3NA 2A1AA 4KN4A 1ZQPA 5B5EU 4DSFA 1N5XA 2HHWA 5CEHA 1Q8KA 2GWSA 2FMPA 5KFRA 3NVWA 4K4HA 2KOBA 2KE7A 1QSYA 4J9SA 2HMXA 2LMRA 7ICFA 1ZQNA 4EBDA 5DDMA 5KFXA 1S9FA 3MR6A 3FM9A 2P35A 1D8LA 1IM4A 2ES6A 4C8MA 5KFQA 3QU9A 2OEHA 1L3VA 1YT3A 1QQ7A 4OJPA 3IM1A 5AI8A 3UXNA 2F1JA 4JWNA 5EE3A 2FPKA 2XCAA 5AI6A 8ICSA 3JPSA 2MA1A 1SKRA 1CI4A 3RBDA 1ZQRA 2KNJA 3V6HA 2AH5A 3KZXA 3SR6A 4PHEA 2ESEA 1S0VA 4F92B 2A19A 4NLCA 4KN7A 4G3IA 2K8CB 3C2LA 1BPZA 2WTFA 1ZQ1C 4P4OA 2E1EA 5KG5A 3Q8MA 3MDAA 2G09A 4TUQA 2JEIA 4M6WA 2EZXA 2PXIA 4FZMA 2AHOB 5C0YA 3E58A 3G6VA 3D6JA 5J8YA 1Q3VA 1LVHA 2LPEA 4CF4A 1L5UA 1L8OA 1TVAA 4E0DA 4QZEA 5ALZA 1KBUA 8ICXA 5ALSA 1DK3A 1RYSA 1NNLA 2E8MA 4P0QA 4OCZA 1ZQEA 4M9LA 3V7JA 2W7PA 2PMZF 5IIOA 3V6KA 5KAIU 3C2KA 1V9PA 4HYKA 1PZNA 1T3QA 3SD7A 3B0YA 4O3MA 1PVPA 2ZIVA 3PSPA 4PH5A 3QEAZ 2NO4A 2WFAA 4XA5A 4M6WB 4R63A 4ECZA 4BWJA 9ICHA 2YY6A 5L1LA 9ICXA 5AI4A 3ZD9A 5KFNA 3M1YA 4DS4A 4FFDA 3ISDA 5DQHA 3SQIA 5BPCA 3R9KA 1KN5A 1X40A 5KAFU 1U47A 5DGAA 1L3TA 4DSJA 5HMLA 2WB1F 3PO5A 4QWDA 4NLZA 3FAHA 3D2SA 3ZDDA 4P0QB 4TQSA 4QW9A 4QZCA 4I2GA 3RR8A 5AKEA 2DGZA 3Q8SB 1UA1A 2ZIUA 2E8NA 5T14A 8ICNA 2ZIVB 1YZ7A 2E5SA 1MN8A 5J2CA 3Q8RB 4R8UB 4YR2A 3KHRA 2ZJ8A 8ICEA 2JH7A 2IBKA 1O08A 4YMMA 1ZQAA 4KLTA 3GV5B 1ZQGA 2ZXHA 3C1ZA 4ZH4A 5AKGA 1JXEA 1L3SA 3N4MB 3AN1A 3I76A 3UM9A 4J9QA 1KFSA 2LBOA 3B9JA 3IRUA 2KHVA 2RLTA 4I2HA 2A1JB 3NRZA 8ICMA 4ED1A 3BS5B 1NKEA 1JALA 3WKBA 1BPYA 4RPXA 4K4IA 3PV8A 4DSKA 4MFAA 3KKAA 3WKAA 2XIDA 5KFVA 4XUSA 3M9OB 3RJEA 3C23A 4QZIA 1Z00A 1BNPA 1SL2A 2LYAA 1ZQWA 4O3QA 3H7IA 3LVWA 1DGJA 4ECYA 4IL6U 4RQ1A 4ECSA 3SV4A 2DWQA 3GFKB 4MF2A 2C2DA 2KZMA 4F93B 2AQ0A 3OSNA 2W9MA 3QNMA 4RPYA 4DFPA 3AL0B 3PMLA 4UB4A 5DG9A 4Z6EA 4LJXA 4Z6CA 3IG5A 9ICRA 1NJXA 5KG2A 4DSLA 2RHFA 4QWBA 2KMDA 1X9XA 3RH6A 4Q8EA 4ED7A 2JR5A 4EEKA 5L1MA 1T4GA 2KK0A 3NVVA 3H0RB 4KLUA 4XRHA 4I2JA 3SAHA 1Z00B 1ZQOA 4PHAA 2KJ5A 4TURA 2M9NA 4CE6A 1BVSA 4DOCA 1NK8A 1F5SA 4NLNA 1U49A 4Q44A 1BGXT 4DL7A 4QWCA 2MUTB 3OSPA 2ISOA 5EWGA 5AKXA 2FLLA
chains in the Genus database with same CATH topology
2Q4TA 1MA7A 2KHVA 1T94A 3CYMA 2W04A 4OJLA 2ZIXA 2YX8A 2W7PA 2KOBA 1XNSA 2PMZF 4CGZA 3RFAA 2HBLA 3CRXA 3N7RC 3NUQA 2OYYA 3H0MB 4AYBF 3ONNA 3O0FA 2HMXA 3N7PD 2MRLA 3F5EA 3VCBA 1UPHA 2KVCA 1IIPA 2LYBA 2WB1C 2XI9A 4NLBA 4BJQA 3F53A 2LKYA 4O3MA 4WJ3B 3T79A 4KMOB 2YB4A 1PVPA 2ZIVA 2HBMA 3M6ZA 2GOLA 3PSPA 2G5IB 2XIDA 3PZPA 2GH1A 4NV0A 4FE3A 2M0NA 3M6KA 3PSIA 1YT3A 1F44A 4QJFB 2DQNB 2JMGA 2H3FA 1WUDA 2WAQC 4OJPA 4QNLA 3ICXA 4U6PA 1SZHA 2LYAA 3PSTA 1XO0A 2YB1A 3SQIA 3AQEA 2HOIA 3LVWA 2OM6A 1A6SA 2XICA 2F8LA 4JMUA 4QIWF 2NV3A 1ED1A 2OXOA 3K1ZA 2BDUA 2Y0SC 2KV2A 2K4HA 2G08A 1ECWA 2H3VA 2ZG6A 3F2BA 1L6NA 1P7DA 2W03A 4BX9C 2H3QA 3F2DA 2D6FC 3H0LB 2F77X 5KL1B 2F2AB 2WB1F 3SAFA 3MGVA 4IC9A 4OJOA 3D2SA 3C29A 2JGAA 5HR6A 4OJ6A 4P0QB 3AL0B 3N7SC 3L3FX 3CP8A 4C0ZA 3NRWA 2ZIXB 2MA1A 4A8EA 2G07A 4AYBC 4P0PA 2KNJA 2VJ4A 3D2NA 3IG5A 4ICAA 2K4EA 2HBKA 3HKZF 3IG8A 3VC8A 3KZXA 1Z19A 2HOQA 2E1FA 1PVQA 2RHFA 2DGZA 3D2QA 2KKVA 2K89A 2ZIUA 2KKPA 3SAGA 2KJ9A 5HR7A 5T14A 2KIWA 2KHQA 2ZIVB 4KX5A 4NLCA 2RRDA 2XVTA 3GU3A 4NWIA 2JH1A 2K8CB 3ALRA 5CRXA 3OPXA 1A0PA 1ZQ1C 2Y0SF 3H0RB 2F76X 2E5SA 2HBJA 2E1EA 4CRXA 1Z1BA 1TAMA 2KJ8A 4FZNA 1NZBA 2HOFA 3SAHA 2CPRA 3GZFA 2VIXA 2ZIWA 3AQFA 2G09A 4GFJA 3F2CA 2A3VA 4OJ5A 2VKQA 1HIWA 4KX3A 2Z7JA 2PMZC 3IP4B 5A0LA 4U7CA 3PSFA 1URJA 3LYSA 2KD1A 4FZMA 5KL8B 4QIWC 2H3IA 5C0YA 2JH7A 2K4IA 2VJ5A 1CRXA 2KJ5A 2ZIUB 3LVVA 4OO1J 2KICA 3KFUF 2G06A 1Q3VA 2KEYA 2G0AA 2WAQF 1GO3F 3C28A 2K8BB 4FZLA 2ZXIA 2ZXHA 3F5AA 2DF4B 3IN5A 4ACOA 2H3ZA 3SMVA 1DRGA 3RF9A 4BUGA 1D8BA 1HEKA 4P0QA 1OUQA 3M7DA 2RP5A 2JHDA 2ZIWB 3DEEA 2W7OA 2OH2A 4PL1A 2K8AA 4PL2A 2R18A 4CDGA 2LHTA 1PVRA 1KBUA 2N1RA 1Q3UA 4P0PB 3HKZC 2CRXA 3E0FA 2CN1A 2G5HB 2LBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3F A;  2LYA A;  2H3I A;  2K4I A;  4ICA A;  2K4E A;  1A6S A;  2HMX A;  4JMU A;  2NV3 A;  1ED1 A;  1UPH A;  2LYB A;  2K4H A;  2H3V A;  1ECW A;  1L6N A;  2H3Z A;  2H3Q A;  1HEK A;  2GOL A;  4IC9 A;  1TAM A;  2N1R A;  1HIW A;  2JMG A; 
#chains in the Genus database with same CATH topology
 1U48 A;  8ICW A;  4JV2 A;  4OJL A;  2CXY A;  5J2G A;  2DUY A;  2HBL A;  3QUC A;  3HP6 A;  5CB1 A;  3OTQ A;  4RQ5 A;  1WWU A;  2KVC A;  3PW2 A;  2LYB A;  2Y9U A;  2ALZ A;  1L7N A;  2AJQ A;  7ICH A;  2GOL A;  1JI7 A;  3RJG A;  4BXO A;  5KT4 A;  2GH1 A;  2KZZ A;  2ZJ5 A;  1MQ3 A;  1UCV A;  2EAM A;  2AU0 A;  1XC9 A;  2QKQ A;  5AK3 A;  5KFM A;  1X2I A;  4BDP A;  4J9N A;  2UVV A;  2AXT U;  4JMU A;  2Y0S C;  4RU9 A;  1ECW A;  3F2B A;  1KSP A;  7ICE A;  2D6F C;  4PZO A;  4B9V A;  1S10 A;  5J0Q A;  1V85 A;  4NL9 C;  5J2I A;  4J9R A;  2JGA A;  3TAC B;  4M0A A;  4ECV A;  3NRW A;  5AIA A;  2IA6 A;  4MHV A;  5C5J A;  4Y2J A;  2E1F A;  5ALL A;  2ZUC A;  2W11 A;  3ZDA A;  4J03 A;  2KTQ A;  2RRD A;  2KSO A;  1NZP A;  3GIK A;  1FFU A;  2W9C A;  3PW0 A;  2HBJ A;  4CRX A;  4PGX A;  1Z1B A;  1NZB A;  3THV A;  1ZD2 P;  4DQR A;  4GFJ A;  2ISP A;  4AP9 A;  4OJ5 A;  4F2S A;  4HAI A;  5AK6 A;  5KT5 A;  1CRX A;  1C20 A;  2FPL A;  3BZC A;  2KVS A;  2K8B B;  4F3O A;  4QZ9 A;  2ZXI A;  5DB8 A;  3IN5 A;  4IR9 A;  1D8B A;  3S6J A;  1ZQU A;  3KD3 A;  2LM4 A;  5EWF A;  5KFY A;  4ECQ A;  4PL1 A;  1NI3 A;  4RNN A;  8ICB A;  1XSL A;  4UB3 A;  8ICA A;  2Q4T A;  1RPL A;  3MGI A;  2RDI A;  3CYM A;  4FBU A;  5ALQ A;  3IHQ B;  1OW5 A;  2BPC A;  2P6U A;  5GTI U;  1M6Y A;  3H0M B;  5J0W A;  4KLS A;  2KSO B;  1UPH A;  4ED2 A;  5AI9 A;  2HVI A;  5HMM A;  3PNC A;  3QU5 A;  2KG5 A;  1QCK A;  3C1Y A;  3PZP A;  1TKD A;  3M6K A;  4B9N A;  2UVW A;  2WAQ C;  1BPD A;  2LM1 A;  4YXJ A;  5J0R A;  5D49 A;  3TQ1 A;  5D4B A;  5BOL A;  4DFM A;  2VA3 A;  3BQ7 A;  9ICP A;  2MSN A;  2F8L A;  4QIW F;  5ALR A;  8ICH A;  4O9M A;  3KTQ A;  4DOA A;  3U26 A;  8ICG A;  3SEI A;  4J9M A;  5HHI A;  5DG8 A;  7ICQ A;  4C80 A;  1ZQC A;  2DL0 A;  3IG8 A;  3JPN A;  4J9O A;  4KLH A;  1XWL A;  2NRT A;  3GIL A;  1Z4N A;  1TAU A;  4Q45 A;  2KIW A;  2KHQ A;  3GU3 A;  3JPO A;  2JH1 A;  4MFC A;  2FDR A;  3OPX A;  1BPB A;  3WKC A;  2NO5 A;  3H8W A;  4UAR A;  2K4P A;  1ZQD A;  5ALD A;  5ALJ A;  7ICK A;  2VJ5 A;  8ICT A;  1VJ5 A;  1TE2 A;  2HHQ A;  5KG3 A;  5KG4 A;  2BZF A;  2DF4 B;  3CW2 C;  2H3Z A;  3LWM A;  2HVH A;  4PL2 A;  2IOH A;  2FPM A;  3HKZ C;  5ALN A;  3DDH A;  2G5H B;  1CUK A;  3G6Y A;  4DL3 A;  9ICL A;  2HHU A;  3G6X A;  4YR0 A;  4KLJ A;  8ICC A;  1ZQI A;  3CRX A;  3NUQ A;  1ZJN A;  3MGH A;  2DKX A;  1N56 A;  5JTI A;  1X9S A;  4C7Z A;  4RQ0 A;  5CHG A;  2ZTE A;  1TK0 A;  4K4G A;  2R8I A;  3FDS A;  2P66 A;  5L1K A;  5J2K A;  4F5R A;  4PHD A;  3H4D A;  2WF9 A;  1N2X A;  3ISB A;  3ETL A;  1UT8 A;  1KTQ A;  5KT2 A;  2KFZ A;  1ZD3 A;  3RB4 A;  3RR7 A;  7ICJ A;  4OJ6 A;  3H8S A;  5J0U A;  3AM9 A;  1S0M A;  1TK5 A;  4O5K A;  4QWA A;  4ECT A;  3KHL A;  3SI8 A;  3H8J A;  2ZTC A;  1JMS A;  3H8M A;  3PMN A;  3M9M B;  3QU7 A;  5KFI A;  4NWI A;  1QQ6 A;  3RBE A;  4OD0 A;  2A3V A;  3EPI A;  5AK5 A;  9ICO A;  2BKE A;  4NM2 A;  7ICR A;  5KL8 B;  4O5C A;  5KFT A;  3K4G A;  3LVV A;  5KFZ A;  2WF7 A;  2G0A A;  3PW7 A;  5KG7 A;  5AM2 A;  1N5W A;  4F4Z A;  1K1S A;  4ACO A;  1OUQ A;  3M7D A;  4RUC A;  4DQQ A;  4DL6 A;  2FLN A;  3N28 A;  3PO4 A;  1WCL A;  4Z6D A;  3RJJ A;  4DS5 A;  3A0H U;  5K4L A;  4RNM A;  3MAB A;  4Q43 A;  4ED0 A;  1SZP A;  3N7P D;  2MRL A;  3F5E A;  4F5O A;  3GV8 B;  2XI9 A;  2ASD A;  2LKY A;  1JRO A;  5G5G A;  2HBM A;  3ZDB A;  5IIL A;  5AM1 A;  3TFR A;  4XQ8 A;  4UB5 A;  4I2I A;  4NV0 A;  2E8O A;  2E3T A;  1KQQ A;  3QUB A;  1JIH A;  5KFB A;  1ZQM A;  2AGO A;  2XY5 A;  3AQE A;  2HOI A;  3NTU A;  2OM6 A;  1D9D A;  2PI5 A;  2HHX A;  2BQU A;  5L1I A;  5DQI A;  1NKB A;  4ED6 A;  4BX9 C;  3SYZ A;  2YN4 A;  3SAF A;  3PR5 B;  3UXO A;  3RB6 A;  3WK5 A;  3J81 j;  3N97 B;  8ICU A;  1F0M A;  2C2E A;  5HR6 A;  3HPO A;  1RYU A;  3MDC A;  3N7S C;  3EWA A;  1VLB A;  1DK2 A;  4R8U A;  3MFI A;  9ICA A;  3JPQ A;  4ECW A;  1MSW D;  1LV5 A;  2NRV A;  3L4P A;  3LDA A;  5KFD A;  3QUT A;  2PFQ A;  4I28 A;  4RPZ A;  2W9A A;  2Y0S F;  1IG6 A;  1A77 A;  3MC1 A;  4P4M A;  2HOF A;  4I29 A;  4M9J A;  1FFV A;  1Q46 A;  2K4I A;  5IIM A;  4Y2Q A;  3AUO A;  2BQ3 A;  4US8 A;  4NL9 A;  1IXR A;  2KEY A;  1GO3 F;  2A1J A;  4GC7 A;  5DBB A;  3QU2 A;  3RTV A;  5F3X B;  8ICV A;  3BS5 A;  4GLX A;  2RP5 A;  4CDG A;  2LHT A;  3MFH A;  2MAX A;  5KFU A;  1SGG A;  4RQM A;  5J2F A;  1S0N A;  2Y9T A;  5KTQ A;  3KHH A;  2WHE A;  2OYY A;  4AYB F;  5III A;  3O0F A;  5J0P A;  1SKS A;  5ALM A;  2DBY A;  4MFF A;  4F91 B;  4IQT A;  1WG8 A;  1S5L U;  2BCU A;  1J2M A;  3ZI4 A;  2DQN B;  2JMG A;  3WK6 A;  3ICX A;  7ICT A;  8ICO A;  4Y2R A;  2YB1 A;  4DCC A;  1NJZ A;  5ALO A;  1ZQF A;  3T3F A;  4IRD A;  4PPX A;  8ICQ A;  1ED1 A;  1DOQ A;  2OHF A;  9ICK A;  4RQ7 A;  3UMC A;  4KLQ A;  1QTM A;  1DGS A;  4IC9 A;  5ALG A;  9ICQ A;  5J2A A;  3PX4 A;  3VC8 A;  2HOQ A;  1SIJ A;  3PW5 A;  4R64 A;  4CNQ A;  5KFE A;  4BGD A;  2W3R A;  4UW9 A;  2KJ9 A;  3EW9 A;  4IQU A;  4KX5 A;  8ICP A;  2XVT A;  4US9 A;  5AKY A;  2GO7 A;  1TAM A;  5AKI A;  1D9F A;  5E79 U;  2MUT A;  3LYS A;  2YQE A;  4Y2X A;  7ICV A;  3NVY A;  3KFU F;  4F5N A;  1X42 A;  4DEZ A;  3ORY A;  4FBT A;  4RT3 A;  4KTQ A;  1BPE A;  1SL1 A;  1DRG A;  2B21 A;  3PW4 A;  3RJK A;  2N1R A;  1XO1 A;  1XS9 D;  5J0Y A;  3KHG A;  2P6R A;  3BJY A;  2ZIX A;  1HJP A;  1XNS A;  1KW4 A;  1U4B A;  1ARO P;  1K1Q A;  5BOM A;  3M8S A;  3HT3 A;  4ELU A;  4NLB A;  3DV9 A;  3B0X A;  4NJ8 A;  3ISC A;  4FE3 A;  4DFK A;  3Q8K A;  3PSI A;  1F44 A;  4Z6F A;  3PY8 A;  2H3F A;  1QLN A;  3QZ7 A;  1S8O A;  3RH4 A;  1WCN A;  2HI0 A;  5KNI A;  1ZYQ A;  1XO0 A;  1ZQX A;  3PVX A;  1ZQT A;  2XIC A;  4QW8 A;  3KBB A;  2NV3 A;  2BDP A;  5KFL A;  3GDX A;  3NS1 A;  2K4H A;  2G08 A;  4I2E A;  1P7D A;  1L8L A;  1RYR A;  4KLD A;  2F2A B;  5IIK A;  4O3P A;  3M9N B;  1RDF A;  3QXG A;  1ZQJ A;  3RAX A;  1TK8 A;  1PK3 A;  2R8J A;  5DBC A;  4F4W A;  3SV3 A;  9ICS A;  1Z1V A;  2ZIX B;  4JWM A;  4Q8F A;  2HHT A;  3RAQ A;  2JZB A;  7ICI A;  3TFS A;  1PUZ A;  1LKY A;  4NXZ A;  4UAT A;  2AGQ A;  2FE9 A;  1A0P A;  1RG6 A;  3WK9 A;  3E2E A;  4ED8 A;  1K5O A;  4U7C A;  2V9W A;  2H3I A;  3WK7 A;  2MU2 A;  2W3S A;  3JPP A;  2K60 A;  3C28 A;  2QB0 A;  4KLG A;  1JXL A;  3AU6 A;  2WF6 A;  1ZQY A;  5KFK A;  1B4F A;  1UA0 A;  1ZQV A;  5CWR A;  4JK1 A;  4RQ8 A;  2JZB B;  2YX8 A;  3CNH A;  1LKY B;  2KZ3 A;  3ONN A;  1HUZ A;  2E8P A;  4YMN A;  5DGB A;  4KIT B;  1ZRM A;  9ICW A;  4C4R A;  1T8E A;  9ICC A;  1RXV A;  2F8K A;  4KLI A;  4EEN A;  1U9L A;  4QJF B;  1V97 A;  1WUD A;  3ED5 A;  1SZH A;  1A76 A;  3PST A;  1PK1 B;  2QB1 A;  4IQW A;  2QB0 B;  5CA7 A;  4UAY A;  2KV2 A;  3HWT A;  5HP4 A;  1L6N A;  5KT6 A;  2H3Q A;  1QSS A;  2IOF K;  3H0L B;  4MF8 A;  4O3N A;  4J9P A;  3BZK A;  2F77 X;  3C5G A;  4G9B A;  5KFH A;  4UAV A;  4LZD A;  5KFA A;  4I2C A;  1ZD5 A;  4I2F A;  2VJ4 A;  3D2N A;  4ICA A;  5ALE A;  2JEJ A;  4UBC A;  3GQC A;  4DQI A;  4C7Y A;  1N48 A;  2K89 A;  3SAG A;  4UBB A;  5DKW A;  2FI1 A;  3A0B U;  1S0O A;  1ZET A;  4EX6 A;  3OJS A;  1TV9 A;  2VA8 A;  3TAD C;  2R8G A;  4NLG A;  2NYV A;  4DO9 A;  7ICM A;  1WWV A;  2XGQ A;  4F4X A;  3IDW A;  5AHX A;  5AK4 A;  1URJ A;  2KD1 A;  2ZUB A;  4YD2 A;  2EAN A;  3ETR A;  2BCV A;  3EUB 2;  2EH9 A;  4YVZ A;  4FZL A;  2GLE A;  4YQW A;  1S77 D;  5TIS U;  5B66 U;  4YFK A;  4P4P A;  2ZIW B;  7ICL A;  2R18 A;  3NAS A;  1B43 A;  1X66 A;  1UHU A;  2ATL A;  3T5K A;  4YG2 A;  4I2D A;  4RNO A;  4I27 A;  5J29 A;  4ZOH C;  2QAR B;  5CP2 A;  4IS7 A;  2Y1I A;  5KFJ A;  2KP7 A;  2BR0 A;  2Y1J A;  4O0I A;  4B9U A;  3BS7 A;  4BJQ A;  5ALH A;  3RJH A;  3F53 A;  2RDJ A;  4WJ3 B;  4UB2 A;  2AGP A;  3K75 D;  2YB4 A;  1NJW A;  2ASJ A;  1C7Y A;  2FMQ A;  2W8K A;  2M0N A;  4RT2 A;  3NVZ A;  2RQ5 A;  3NGD A;  1RQL A;  5KFG A;  2VAN A;  4GIB A;  2PKE A;  3SZ2 A;  1ZQL A;  9ICM A;  2IOF A;  1NK0 A;  3LWL A;  2XCP A;  2WF5 A;  1NK7 A;  2H5X A;  3F2D A;  2EQY A;  4R66 A;  1MQ2 A;  3QYP A;  3EYZ A;  1NOM A;  3CP8 A;  1WYG A;  5JRT A;  4UAU A;  4F4K A;  4P0P A;  4DQS A;  3TAP A;  5ALP A;  1SKW A;  3D2Q A;  1Y88 A;  4RQ6 A;  5F9N A;  1FIQ A;  1YZ6 A;  9ICI A;  1JX4 A;  2NRW A;  4B9S A;  1D8Y A;  1L3U A;  4KMU A;  2VIX A;  4M9G A;  3AQF A;  4KLM A;  5A0L A;  4J9L A;  2ZJA A;  3T5J A;  5KFC A;  5HR7 A;  3BQ2 A;  9ICT A;  1Z4O A;  2JEG A;  4EX7 A;  3OGU A;  2DKZ A;  5HHH A;  7ICG A;  4X5V A;  3RJF A;  3OHA A;  2QLT A;  2PI4 A;  2WF8 A;  3UXP A;  8ICK A;  4Y2P A;  3V6J A;  4GXJ A;  5DBA A;  9ICV A;  4DF8 A;  4I2B A;  3WU2 U;  4P0P B;  4B9T A;  2XY7 A;  4UB1 A;  3C2M A;  1MA7 A;  3M8R A;  4IR1 A;  3FYH A;  2W9B A;  1NK5 A;  1VDV A;  4CGZ A;  2BPG A;  2ODG A;  3N7R C;  3EPG A;  2C28 A;  4F5Q A;  4ED3 A;  8ICF A;  4DFD A;  5ALW A;  1J97 A;  2L5Y A;  3T79 A;  2KIV A;  4KMO B;  3WK8 A;  4JB3 A;  3SEN A;  4F4Y A;  2UVR A;  4NLK A;  2BCS A;  3H40 A;  2XO7 A;  4EEL A;  5AM0 A;  2I9G A;  2F1I A;  5DDY A;  3RH5 A;  2H3V A;  4C8L A;  1N63 A;  5J2B A;  4QZF A;  1TFR A;  4Y2V A;  2IMW P;  3FC4 A;  1H38 A;  2UVU A;  2ZTD A;  3L3F X;  4C0Z A;  1X6J A;  4NM1 A;  2W9B B;  3RB3 A;  2V4Q A;  3QX7 A;  1U45 A;  1ZQB A;  2LI6 A;  1L7P A;  1JRP A;  2B0C A;  5AIC A;  5AM4 A;  5ALY A;  4LVS A;  4KLF A;  4DF4 A;  4C8O A;  3JPR A;  3T5H A;  5EOZ A;  2CPR A;  3I28 A;  2VKQ A;  3TAR A;  3PSF A;  1DXS A;  2J6S A;  4QIW C;  3OJU A;  5EE1 A;  4DL2 A;  5L9X A;  5AKJ A;  2AQ4 A;  3WKE A;  4Y2T A;  4DFJ A;  5JU5 A;  3ZDE A;  4GC6 A;  3LK9 A;  4RZR A;  8ICY A;  2F44 A;  1L7O A;  2IHN A;  3RF9 A;  9ICB A;  4BUG A;  1HEK A;  1B22 A;  8ICL A;  2W7O A;  2OH2 A;  1PVR A;  2BGW A;  9ICJ A;  4EZ9 A;  4KLE A;  4C8K A;  2EAP A;  2R8K A;  9ICF A;  5EE9 A;  4PGY A;  1KFT A;  2CN1 A;  4UB6 U;  4F2R A;  3HW8 A;  4M9H A;  2YMM A;  2HSZ A;  1KDH A;  5J0X A;  3BQT A;  2BCQ A;  4UQG A;  1JUD A;  3WKD A;  5J0O A;  5KG1 A;  2DPI A;  8ICI A;  1S76 D;  3PX6 A;  4F50 A;  1X9W A;  2I5H A;  3WK4 A;  2I6X A;  1SWW A;  2J6U A;  1RM6 C;  1SV0 C;  5ALI A;  2C2R A;  4U6P A;  2FLP A;  3Q8L A;  2XC9 A;  1V38 A;  4TUS A;  2ZG6 A;  1NJY A;  3QU4 A;  3MR2 A;  2DFL A;  5J2J A;  4UAS A;  2PFN A;  1SB3 C;  4A8E A;  4GXI A;  4Y2U A;  4UAZ A;  2XY6 A;  1RQN A;  2K4E A;  5FP0 A;  1Z19 A;  2EDU A;  1QH9 A;  3I1Y A;  1CEZ A;  1XU4 A;  1SWV A;  2VA2 A;  3ALR A;  3GIM A;  4PJ0 U;  1B0X A;  2ASL A;  2F76 X;  4PHP A;  3PX0 A;  3AU2 A;  4QWE A;  2J6T A;  4M9N A;  3HIL A;  4KX3 A;  1EXN A;  3IP4 B;  4JUZ A;  4EBE A;  4RQN A;  2ZIU B;  4JV0 A;  5DLF A;  2G06 A;  1NKC A;  4TUP A;  2WAQ F;  4DQP A;  4EZ6 A;  3EZ5 A;  3UQ2 A;  5F9L A;  4ELV A;  1ZQZ A;  2OWO A;  4EBC A;  1RXW A;  3AEV A;  2EZY A;  2DPJ A;  2Q0Z X;  1KLN A;  2HDO A;  1Z3E B;  1Q3U A;  8ICJ A;  4F8R A;  2JV3 A;  4PGQ A;  2ZUD A;  3OHB A;  4QZ8 A;  2W04 A;  3AMZ A;  4B9M A;  4IQV A;  3RFA A;  3T5L A;  3KZI U;  3TAD A;  5JUM A;  1NK9 A;  1COK A;  4RUA A;  2JEF A;  3HRD D;  5AKZ A;  4O3O A;  2HHS A;  3TI0 A;  1AQ6 A;  5DB7 A;  3M6Z A;  4QZB A;  2G5I B;  4B9L A;  5IIJ A;  2YMQ A;  2B6G A;  2JXJ A;  5AM5 A;  4QZD A;  1COO A;  3PR4 A;  4PZN A;  2FJ6 A;  9ICN A;  2IHM A;  5CR0 A;  2D3D A;  2OXO A;  1SXD A;  2PFO A;  3QE9 Y;  5KL1 B;  5J8Y C;  1LB2 B;  3C29 A;  5CJ7 A;  3V72 A;  1KL9 A;  2BQR A;  3QUQ A;  5ALF A;  4M2Y A;  1NK6 A;  4BWM A;  3HKZ F;  4RQ2 A;  2YTU A;  1N62 A;  1X6I A;  4QZA A;  4DWI A;  4YCX A;  4RQ3 A;  4MEY A;  4DSI A;  1FEZ A;  4FS2 A;  2PFP A;  4M04 A;  3MR5 A;  3RRH A;  3BQ0 A;  3GZF A;  5KFS A;  1FO4 A;  5J2E A;  2R8H A;  3F2C A;  1ZQH A;  2PMZ C;  5AKL A;  3TKA A;  4FO6 A;  9ICU A;  2OCE A;  3QEB Z;  5KFW A;  3GII A;  1T7P A;  1HUO A;  5DB9 A;  7ICS A;  2JHD A;  2K8A A;  7ICP A;  2KFN A;  3UMG A;  7ICO A;  3TAQ A;  1SV4 A;  5KG6 A;  4YMO A;  5KG0 A;  4GXK A;  4O3R A;  1T94 A;  3UPQ A;  5KFF A;  5DG7 A;  4KLO A;  1PK1 A;  3Q8P B;  2WB1 C;  2D8C A;  2LYH A;  2V4R A;  2YMP A;  1MC8 A;  4C8N A;  8ICR A;  4DSE A;  5ALU A;  1BPX A;  5KT7 A;  1J2N A;  1ZOL A;  3Q8Q B;  4QNL A;  3HX0 A;  1ZRN A;  3BQ1 A;  1JN3 A;  4IRC A;  7ICN A;  2C22 A;  3ZD8 A;  4QZH A;  3QZ8 A;  3V7K A;  1A6S A;  2KN7 A;  3GV7 B;  4IRK A;  2W03 A;  4BXO B;  4CF5 A;  4EYH B;  4R65 A;  3MGV A;  5AKK A;  4O5E A;  4YXM A;  1N60 A;  1UT5 A;  4UB8 U;  4Y2S A;  5KFO A;  5J0T A;  2G07 A;  4AYB C;  1KKX A;  3UMB A;  2I1Q A;  5EWE A;  1RZT A;  4F72 A;  2BPF A;  1X9M A;  4M47 A;  1SXE A;  2HBK A;  3KOO A;  1PVQ A;  3HJE A;  2KKV A;  2NRX A;  2KKP A;  3MR3 A;  4YN4 A;  5J0S A;  5EE0 A;  7ICU A;  5CRX A;  3ZDC A;  1ZXI A;  5ALK A;  4F5P A;  2KJ8 A;  4C4T A;  4CF3 A;  3GIJ A;  2ZIW A;  1ZD4 A;  2FMS A;  2Z7J A;  3L5K A;  5ALT A;  1OXJ A;  3KKA C;  2W8L A;  3JPT A;  8ICZ A;  4OO1 J;  2KIC A;  4YR3 A;  4UAW A;  9ICE A;  1KFD A;  4EEY A;  2NRZ A;  3TAN A;  2QAR A;  1NK4 A;  2XGP A;  3IV6 A;  9ICG A;  2W9C B;  5DB6 A;  3SMV A;  3BDP A;  5AKH A;  2O6K A;  4ECU A;  3DEE A;  4YD1 A;  5ALV A;  1O03 A;  4LZG A;  2CRX A;  4TQR A;  1IV8 A;  3E0F A;  4C4S A;  1XSP A;  1S97 A;  3UQ0 A;  1ZQS A;  5HNK A;  1QQ5 A;  2BHN A;  4ECX A;  1ZQQ A;  1KEJ A;  1SL0 A;  4Y2Y A;  4ELT A;  5J2D A;  3RJI A;  4JV1 A;  5KT3 A;  3VCB A;  4J9K A;  4DOB A;  1IIP A;  2YML A;  4P2H A;  1L7M A;  1BNO A;  4F71 A;  4DL4 A;  4FS1 A;  3V7L A;  1KRP A;  5GTH U;  2HCF A;  1UQV A;  1ZJM A;  1QSL A;  4KLL A;  2F1H A;  2W55 A;  3MBY A;  2BCR A;  3K1Z A;  2BDU A;  5L1J A;  5D46 A;  5AIB A;  5G5H A;  3C21 A;  4OJO A;  1TAQ A;  5J2H A;  4NY8 A;  2W54 A;  4ECR A;  3RRG A;  4QZG A;  5AI0 A;  5H2F U;  4O3S A;  5ALX A;  4EYI B;  4B6J A;  2EAO A;  5IIN A;  5DQG A;  4CCH A;  2F3N A;  4DLG A;  1SV0 A;  4RQ4 A;  4YP3 A;  3RB0 A;  5KFP A;  4DL5 A;  3C5F A;  4FZN A;  4DLE A;  5TZV A;  1N61 A;  1HIW A;  1XSN A;  1ZQK A;  4USA A;  2HHV A;  4I2A A;  3H4B A;  2EZZ A;  3K1R B;  5DLG A;  4MEX A;  2HW3 A;  5AI5 A;  5AM3 A;  3F5A A;  2W43 A;  2JRZ A;  1T3N A;  2A1A A;  4KN4 A;  1ZQP A;  5B5E U;  4DSF A;  1N5X A;  2HHW A;  5CEH A;  1Q8K A;  2GWS A;  2FMP A;  5KFR A;  3NVW A;  4K4H A;  2KOB A;  2KE7 A;  1QSY A;  4J9S A;  2HMX A;  2LMR A;  7ICF A;  1ZQN A;  4EBD A;  5DDM A;  5KFX A;  1S9F A;  3MR6 A;  3FM9 A;  2P35 A;  1D8L A;  1IM4 A;  2ES6 A;  4C8M A;  5KFQ A;  3QU9 A;  2OEH A;  1L3V A;  1YT3 A;  1QQ7 A;  4OJP A;  3IM1 A;  5AI8 A;  3UXN A;  2F1J A;  4JWN A;  5EE3 A;  2FPK A;  2XCA A;  5AI6 A;  8ICS A;  3JPS A;  2MA1 A;  1SKR A;  1CI4 A;  3RBD A;  1ZQR A;  2KNJ A;  3V6H A;  2AH5 A;  3KZX A;  3SR6 A;  4PHE A;  2ESE A;  1S0V A;  4F92 B;  2A19 A;  4NLC A;  4KN7 A;  4G3I A;  2K8C B;  3C2L A;  1BPZ A;  2WTF A;  1ZQ1 C;  4P4O A;  2E1E A;  5KG5 A;  3Q8M A;  3MDA A;  2G09 A;  4TUQ A;  2JEI A;  4M6W A;  2EZX A;  2PXI A;  4FZM A;  2AHO B;  5C0Y A;  3E58 A;  3G6V A;  3D6J A;  5J8Y A;  1Q3V A;  1LVH A;  2LPE A;  4CF4 A;  1L5U A;  1L8O A;  1TVA A;  4E0D A;  4QZE A;  5ALZ A;  1KBU A;  8ICX A;  5ALS A;  1DK3 A;  1RYS A;  1NNL A;  2E8M A;  4P0Q A;  4OCZ A;  1ZQE A;  4M9L A;  3V7J A;  2W7P A;  2PMZ F;  5IIO A;  3V6K A;  5KAI U;  3C2K A;  1V9P A;  4HYK A;  1PZN A;  1T3Q A;  3SD7 A;  3B0Y A;  4O3M A;  1PVP A;  2ZIV A;  3PSP A;  4PH5 A;  3QEA Z;  2NO4 A;  2WFA A;  4XA5 A;  4M6W B;  4R63 A;  4ECZ A;  4BWJ A;  9ICH A;  2YY6 A;  5L1L A;  9ICX A;  5AI4 A;  3ZD9 A;  5KFN A;  3M1Y A;  4DS4 A;  4FFD A;  3ISD A;  5DQH A;  3SQI A;  5BPC A;  3R9K A;  1KN5 A;  1X40 A;  5KAF U;  1U47 A;  5DGA A;  1L3T A;  4DSJ A;  5HML A;  2WB1 F;  3PO5 A;  4QWD A;  4NLZ A;  3FAH A;  3D2S A;  3ZDD A;  4P0Q B;  4TQS A;  4QW9 A;  4QZC A;  4I2G A;  3RR8 A;  5AKE A;  2DGZ A;  3Q8S B;  1UA1 A;  2ZIU A;  2E8N A;  5T14 A;  8ICN A;  2ZIV B;  1YZ7 A;  2E5S A;  1MN8 A;  5J2C A;  3Q8R B;  4R8U B;  4YR2 A;  3KHR A;  2ZJ8 A;  8ICE A;  2JH7 A;  2IBK A;  1O08 A;  4YMM A;  1ZQA A;  4KLT A;  3GV5 B;  1ZQG A;  2ZXH A;  3C1Z A;  4ZH4 A;  5AKG A;  1JXE A;  1L3S A;  3N4M B;  3AN1 A;  3I76 A;  3UM9 A;  4J9Q A;  1KFS A;  2LBO A;  3B9J A;  3IRU A;  2KHV A;  2RLT A;  4I2H A;  2A1J B;  3NRZ A;  8ICM A;  4ED1 A;  3BS5 B;  1NKE A;  1JAL A;  3WKB A;  1BPY A;  4RPX A;  4K4I A;  3PV8 A;  4DSK A;  4MFA A;  3KKA A;  3WKA A;  2XID A;  5KFV A;  4XUS A;  3M9O B;  3RJE A;  3C23 A;  4QZI A;  1Z00 A;  1BNP A;  1SL2 A;  2LYA A;  1ZQW A;  4O3Q A;  3H7I A;  3LVW A;  1DGJ A;  4ECY A;  4IL6 U;  4RQ1 A;  4ECS A;  3SV4 A;  2DWQ A;  3GFK B;  4MF2 A;  2C2D A;  2KZM A;  4F93 B;  2AQ0 A;  3OSN A;  2W9M A;  3QNM A;  4RPY A;  4DFP A;  3AL0 B;  3PML A;  4UB4 A;  5DG9 A;  4Z6E A;  4LJX A;  4Z6C A;  3IG5 A;  9ICR A;  1NJX A;  5KG2 A;  4DSL A;  2RHF A;  4QWB A;  2KMD A;  1X9X A;  3RH6 A;  4Q8E A;  4ED7 A;  2JR5 A;  4EEK A;  5L1M A;  1T4G A;  2KK0 A;  3NVV A;  3H0R B;  4KLU A;  4XRH A;  4I2J A;  3SAH A;  1Z00 B;  1ZQO A;  4PHA A;  2KJ5 A;  4TUR A;  2M9N A;  4CE6 A;  1BVS A;  4DOC A;  1NK8 A;  1F5S A;  4NLN A;  1U49 A;  4Q44 A;  1BGX T;  4DL7 A;  4QWC A;  2MUT B;  3OSP A;  2ISO A;  5EWG A;  5AKX A;  2FLL A; 
#chains in the Genus database with same CATH homology
 2Q4T A;  1MA7 A;  2KHV A;  1T94 A;  3CYM A;  2W04 A;  4OJL A;  2ZIX A;  2YX8 A;  2W7P A;  2KOB A;  1XNS A;  2PMZ F;  4CGZ A;  3RFA A;  2HBL A;  3CRX A;  3N7R C;  3NUQ A;  2OYY A;  3H0M B;  4AYB F;  3ONN A;  3O0F A;  2HMX A;  3N7P D;  2MRL A;  3F5E A;  3VCB A;  1UPH A;  2KVC A;  1IIP A;  2LYB A;  2WB1 C;  2XI9 A;  4NLB A;  4BJQ A;  3F53 A;  2LKY A;  4O3M A;  4WJ3 B;  3T79 A;  4KMO B;  2YB4 A;  1PVP A;  2ZIV A;  2HBM A;  3M6Z A;  2GOL A;  3PSP A;  2G5I B;  2XID A;  3PZP A;  2GH1 A;  4NV0 A;  4FE3 A;  2M0N A;  3M6K A;  3PSI A;  1YT3 A;  1F44 A;  4QJF B;  2DQN B;  2JMG A;  2H3F A;  1WUD A;  2WAQ C;  4OJP A;  4QNL A;  3ICX A;  4U6P A;  1SZH A;  2LYA A;  3PST A;  1XO0 A;  2YB1 A;  3SQI A;  3AQE A;  2HOI A;  3LVW A;  2OM6 A;  1A6S A;  2XIC A;  2F8L A;  4JMU A;  4QIW F;  2NV3 A;  1ED1 A;  2OXO A;  3K1Z A;  2BDU A;  2Y0S C;  2KV2 A;  2K4H A;  2G08 A;  1ECW A;  2H3V A;  2ZG6 A;  3F2B A;  1L6N A;  1P7D A;  2W03 A;  4BX9 C;  2H3Q A;  3F2D A;  2D6F C;  3H0L B;  2F77 X;  5KL1 B;  2F2A B;  2WB1 F;  3SAF A;  3MGV A;  4IC9 A;  4OJO A;  3D2S A;  3C29 A;  2JGA A;  5HR6 A;  4OJ6 A;  4P0Q B;  3AL0 B;  3N7S C;  3L3F X;  3CP8 A;  4C0Z A;  3NRW A;  2ZIX B;  2MA1 A;  4A8E A;  2G07 A;  4AYB C;  4P0P A;  2KNJ A;  2VJ4 A;  3D2N A;  3IG5 A;  4ICA A;  2K4E A;  2HBK A;  3HKZ F;  3IG8 A;  3VC8 A;  3KZX A;  1Z19 A;  2HOQ A;  2E1F A;  1PVQ A;  2RHF A;  2DGZ A;  3D2Q A;  2KKV A;  2K89 A;  2ZIU A;  2KKP A;  3SAG A;  2KJ9 A;  5HR7 A;  5T14 A;  2KIW A;  2KHQ A;  2ZIV B;  4KX5 A;  4NLC A;  2RRD A;  2XVT A;  3GU3 A;  4NWI A;  2JH1 A;  2K8C B;  3ALR A;  5CRX A;  3OPX A;  1A0P A;  1ZQ1 C;  2Y0S F;  3H0R B;  2F76 X;  2E5S A;  2HBJ A;  2E1E A;  4CRX A;  1Z1B A;  1TAM A;  2KJ8 A;  4FZN A;  1NZB A;  2HOF A;  3SAH A;  2CPR A;  3GZF A;  2VIX A;  2ZIW A;  3AQF A;  2G09 A;  4GFJ A;  3F2C A;  2A3V A;  4OJ5 A;  2VKQ A;  1HIW A;  4KX3 A;  2Z7J A;  2PMZ C;  3IP4 B;  5A0L A;  4U7C A;  3PSF A;  1URJ A;  3LYS A;  2KD1 A;  4FZM A;  5KL8 B;  4QIW C;  2H3I A;  5C0Y A;  2JH7 A;  2K4I A;  2VJ5 A;  1CRX A;  2KJ5 A;  2ZIU B;  3LVV A;  4OO1 J;  2KIC A;  3KFU F;  2G06 A;  1Q3V A;  2KEY A;  2G0A A;  2WAQ F;  1GO3 F;  3C28 A;  2K8B B;  4FZL A;  2ZXI A;  2ZXH A;  3F5A A;  2DF4 B;  3IN5 A;  4ACO A;  2H3Z A;  3SMV A;  1DRG A;  3RF9 A;  4BUG A;  1D8B A;  1HEK A;  4P0Q A;  1OUQ A;  3M7D A;  2RP5 A;  2JHD A;  2ZIW B;  3DEE A;  2W7O A;  2OH2 A;  4PL1 A;  2K8A A;  4PL2 A;  2R18 A;  4CDG A;  2LHT A;  1PVR A;  1KBU A;  2N1R A;  1Q3U A;  4P0P B;  3HKZ C;  2CRX A;  3E0F A;  2CN1 A;  2G5H B;  2LBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...