1HEKA

Crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
b'AMADIGSMGDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWAISAVKMGLQINNVVDGKASFQLLRAKYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN, CORE PROTEIN P15
molecule tags Viral protein
source organism Equine infectious anemia virus
publication title Structure of Equine Infectious Anemia Virus Matrix Protein.
pubmed doi rcsb
total genus 30
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08723 Gag_p15 Gag protein p15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hekA00
1HEKA 2H3IA 1UPHA 2N1RA 2K4EA 2LYAA 4JMUA 2K4IA 2JMGA 2GOLA 2NV3A 2HMXA 4ICAA 2H3FA 2H3QA 1ED1A 1ECWA 1HIWA 2K4HA 1A6SA 1L6NA 4IC9A 2H3VA 2LYBA 1TAMA 2H3ZA
chains in the Genus database with same CATH superfamily
1N62A 2F2AB 1D9DA 4YCXA 4UAWA 5CA7A 3EPGA 4Y2QA 3G6YA 1ZQHA 5AK5A 7ICNA 4C4RA 3JPRA 3TFRA 5AK4A 2YX8A 9ICPA 2KIWA 1XSNA 7ICHA 3WK4A 4RNNA 4Z6EA 1L3TA 4IL6U 5DDMA 3T3FA 4YMMA 4B9UA 4NLCA 2BQUA 2IOFK 3SAFA 1Q8KA 5DG9A 4O3MA 5AKYA 1RYSA 4IQTA 2R8IA 1JIHA 4J9KA 1Q3UA 3V6JA 4NXZA 2I1QA 2XO7A 3JPQA 2L5YA 4QZAA 3Q8LA 2F3NA 2HMXA 1COOA 3NVVA 3KKAC 3JPTA 3SD7A 1SL2A 1OXJA 1A0PA 2JGAA 5D46A 4OJLA 2ZJAA 3UMCA 9ICJA 3RRGA 4EELA 2W9CA 3E58A 5EE9A 2ASLA 4DSFA 2C28A 1Z1BA 1NK9A 3H4BA 2JEIA 3TACB 5KAFU 4ECRA 3PNCA 5D49A 3IHQB 4R63A 2AU0A 2R8GA 3M9OB 5KFRA 9ICLA 2G5IB 4Y2VA 4NM2A 4PH5A 5CR0A 3SZ2A 1LVHA 3BQTA 4DOBA 5DB7A 1Z00A 4PGQA 1ZQCA 3TAPA 3IDWA 3SMVA 8ICHA 3GZFA 2UVRA 1SZHA 3KZXA 5D4BA 1ZRMA 2ESEA 4NLNA 3AEVA 1WCLA 4LZGA 4ED7A 4KLEA 2JEGA 2XGQA 4ECTA 2UVVA 3I1YA 4QZIA 3PMNA 1ZOLA 4DQRA 3LWLA 3IV6A 1S8OA 3WKDA 4YG2A 2PI5A 2JZBB 1ZQRA 1JRPA 3HWTA 4QWAA 2JZBA 3A0BU 2RRDA 1DGJA 4R64A 1ZQ1C 3V6HA 1T3QA 1UA1A 2VA8A 1KDHA 4PL2A 4Y2PA 4I2CA 2HHUA 2BR0A 2D8CA 3N7SC 4FFDA 4HAIA 3MGVA 5J2IA 4J9RA 2WAQF 3OTQA 4M0AA 4PGYA 3M1YA 4J9LA 4OJ6A 5KNIA 1JMSA 1H38A 4ED8A 4BUGA 2G09A 4KLQA 5G5HA 1L7MA 5AI0A 3K4GA 5ALXA 1JN3A 2AXTU 3M6KA 5IIIA 5BOMA 4B9TA 4U7CA 2QLTA 2W9MA 1OW5A 2E8NA 3M6ZA 2YMMA 3PSPA 1N60A 2VJ5A 1L3SA 4MFFA 1PK1A 2R18A 2RLTA 5TISU 4PPXA 2FMQA 3EPIA 1NKBA 3DDHA 5AM5A 3Q8PB 8ICMA 1ZQEA 4UAYA 2E8PA 3PVXA 4PHPA 2KFNA 2D3DA 5AI8A 1BPXA 2FJ6A 3GV5B 4F5RA 5DLGA 3GDXA 4DFPA 2KD1A 4O3QA 4UAZA 1CRXA 3OJUA 1S77D 4F50A 4EZ6A 4OJ5A 4I2AA 5AKHA 3QU5A 2ISPA 1V85A 2EDUA 4MEXA 1QSSA 5CHGA 3PW0A 2XY5A 1RYRA 1S5LU 2LYBA 5L1LA 4J9QA 2K8BB 4ACOA 2HHQA 3MR2A 1KRPA 1BNPA 3EWAA 5HHIA 4QWCA 5KFLA 2B0CA 4O3SA 5CP2A 4Q43A 3TADC 3RR8A 3G6VA 5ALPA 7ICEA 3T79A 5KFTA 2KHVA 3ICXA 4PHAA 3FM9A 1WCNA 4BX9C 1Y88A 1S0OA 1U45A 4C7ZA 4EYIB 4UB8U 1MSWD 1NZBA 3HKZC 5KFKA 4P4PA 1SV0C 3LK9A 3C2KA 4RNMA 2EZXA 5J2GA 2LPEA 3RB6A 3FAHA 1JROA 3OSNA 1QQ5A 3PO4A 2PKEA 9ICEA 4Y2SA 5KG6A 4F8RA 1TVAA 4J03A 2IOFA 2Y1IA 1ZQQA 4DL2A 4I29A 1S0VA 2KIVA 1ZJNA 3KFUF 3THVA 4CE6A 3L3FX 4Q8EA 4KLDA 1ZQNA 5AM0A 2W9BA 2WF7A 3WK7A 5J29A 2W7OA 1HUOA 9ICQA 5KFEA 4F5OA 1QCKA 5KFVA 4ZOHC 3BZKA 2W54A 3MR6A 2HHXA 2QB0A 3CP8A 2YB1A 5ALYA 5AM4A 1L3UA 1N56A 4RQ3A 1MA7A 1B43A 1V9PA 1T3NA 2KEYA 1K1SA 3V7JA 3OSPA 3SQIA 1VDVA 5KFDA 4MEYA 5KT5A 4J9MA 2MA1A 2Q4TA 4KN4A 2EH9A 4LZDA 2H3ZA 3C28A 3TAQA 1F0MA 4QZGA 4IR9A 4QZCA 2ATLA 4RPYA 3N28A 4J9SA 2BZFA 4PHEA 2G5HB 2LYHA 4C4SA 4ECYA 3F2CA 1WWUA 2OCEA 4TQSA 1URJA 8ICPA 1X9WA 2RHFA 3N97B 4Z6CA 3H0MB 1MC8A 2WF5A 3GILA 8ICYA 1JI7A 2EZYA 4JUZA 5KFPA 1PZNA 3ONNA 4GIBA 4ED6A 2EAOA 8ICWA 2BPGA 1ZQFA 2BCSA 2NYVA 1TAUA 5KFZA 3M9MB 4O3PA 5AI4A 5KFOA 5ALIA 8ICCA 2E3TA 1WYGA 2WAQC 4KX5A 2BPFA 2JEJA 3NRZA 2KJ9A 4TUPA 1S97A 1L8OA 2B21A 3MC1A 3RJKA 2R8KA 4G9BA 3WKEA 4YXJA 1VJ5A 4FS2A 1WG8A 5ALLA 4KLSA 5KFHA 2H5XA 2M9NA 1DOQA 2Y1JA 4R65A 5AICA 1Z00B 3RR7A 5IIKA 5J2BA 2BKEA 3GV8B 1BGXT 4CF4A 4RQ6A 2KG5A 2NRTA 2ZIXB 4ED3A 2HOIA 7ICQA 2HOFA 2OWOA 2UVUA 5G5GA 3UXPA 4ECUA 5JRTA 3UQ0A 3RF9A 9ICOA 2KMDA 1ZQTA 5KFCA 3TADA 2W9BB 2DPIA 2NO5A 1JX4A 3GIIA 2Y9TA 3FYHA 4KX3A 5J0OA 4M6WA 4Y2UA 4F5PA 4YVZA 4YD2A 3RJGA 2KE7A 4ZH4A 1S10A 5J0RA 4UATA 3H8MA 2YTUA 1NK4A 2J6TA 4CRXA 4KMOB 1RPLA 5F9LA 4JV0A 4ECXA 2ZJ5A 2WFAA 2J6UA 2YB4A 3NUQA 5ALDA 1QQ6A 3ED5A 4QZFA 2IHMA 5CB1A 4IRDA 3QEBZ 2MUTB 3D2NA 3RJJA 3UPQA 4MF2A 5ALUA 5KFIA 1NK6A 3MR5A 4Q44A 1SWVA 3IP4B 4DFDA 1TKDA 4DLGA 1SXDA 2MUTA 5H2FU 2UVWA 9ICBA 1B0XA 2HBLA 2YMLA 4BWMA 1N61A 4Z6DA 1SV4A 3QU2A 2VANA 2DKXA 5J2FA 4F4ZA 5KG4A 4YMOA 2BQRA 4C8KA 4KLIA 7ICJA 3JPPA 3D6JA 3QU7A 1ZQBA 4PJ0U 4EBDA 3QU4A 9ICKA 4B9VA 4R66A 2K4EA 2K8AA 3QXGA 1XU4A 4AYBC 1QH9A 1C7YA 5TZVA 1X6IA 5KG2A 5J0TA 5KT3A 9ICCA 5HP4A 2PFOA 5EWGA 2G06A 5IIMA 3SV3A 2FDRA 1PK1B 2VA3A 4FO6A 1IG6A 3O0FA 5DBCA 4QZDA 4JWNA 2DQNB 1NJZA 5ALMA 1SKWA 3ETLA 1WUDA 4UBCA 4QZEA 2P6RA 3Q8SB 3T5JA 1ZQJA 3GU3A 2JR5A 3WK6A 3KD3A 1D8LA 3C5GA 2E8OA 1UA0A 8ICZA 2DPJA 3KTQA 4DLEA 1UT5A 1X66A 4DQIA 5KT2A 1X42A 1IV8A 3MFIA 5DLFA 4A8EA 2BCUA 4BXOB 1V97A 1NJXA 5J8YA 2LMRA 5L1MA 1N5WA 3H8WA 5AKEA 2K60A 8ICTA 5L1KA 4EYHB 3C21A 3K1ZA 2AJQA 3H7IA 2K4PA 1KFDA 4RQ0A 2A1JA 2Y0SF 3IRUA 4XQ8A 3TFSA 2ASJA 1NKEA 4RT2A 4YR3A 4DL3A 3BQ2A 4I27A 4USAA 4CNQA 5J0SA 4DS5A 4PHDA 3AU6A 3GIMA 2BGWA 2ZG6A 1SZPA 1V38A 5CJ7A 4ELVA 5C0YA 1S0NA 3KHGA 2OHFA 4GC6A 2EZZA 5KFGA 3B0XA 5AKXA 2KNJA 4ECVA 3AMZA 4OO1J 2B6GA 2JXJA 1Z4NA 5HR7A 4Y2TA 2KICA 1DRGA 4OD0A 1MN8A 4KLGA 1S9FA 4P0QB 1KN5A 5HHHA 3QYPA 2FI1A 2R8JA 1RQNA 3WKAA 1BPBA 2F8KA 4G3IA 4C8LA 5AKZA 4GXIA 1SKRA 4DOAA 3SI8A 3A0HU 3F2DA 3L5KA 1KEJA 1PK3A 2DFLA 2RDIA 4O5EA 2H3FA 3AU2A 2XICA 2KKPA 1BPZA 1DK2A 2KTQA 2C22A 3C1YA 2JH7A 5KFJA 3EZ5A 1Q46A 4NY8A 2PFNA 2KZMA 3WK8A 5ALQA 4IQUA 1JXLA 2ZIVB 4K4GA 3QZ7A 2XC9A 3RAXA 4JV2A 4LVSA 2F76X 4DFKA 3F5EA 4QNLA 3HP6A 4QIWF 4IQWA 2XCPA 2Y9UA 1ECWA 1OUQA 4RUAA 4RPZA 4YR0A 4BJQA 2A1AA 4DF4A 2WTFA 5J2KA 2VKQA 1UT8A 3TARA 1S76D 4F4YA 5J2CA 3H0RB 2FMPA 1ZQXA 5C5JA 2NV3A 4YR2A 3H8JA 1HJPA 4NJ8A 2NRVA 4M2YA 5AKGA 1LKYB 1J2MA 4KLUA 2W8LA 1L7PA 5ALKA 1FIQA 5L9XA 4O3NA 3DEEA 7ICUA 5J2AA 2PMZC 3HJEA 5BOLA 4F5NA 8ICJA 3M8SA 4GXJA 1TK8A 4M9HA 1KL9A 1SGGA 1RG6A 2OXOA 2WF8A 4US8A 4JK1A 7ICVA 2QARA 1RXWA 1YZ7A 3NVWA 4M04A 2ALZA 5DB9A 4FBTA 1UCVA 5AIAA 5EWFA 4EENA 4RUCA 1U47A 1XSLA 4QIWC 4C7YA 3JPNA 3QUCA 3K1RB 5DQGA 4I2BA 3HRDD 2DF4B 2HBJA 4I2GA 1NK0A 3C2LA 4DSLA 2IHNA 3JPOA 1O03A 4NL9C 1QLNA 3PW2A 1NNLA 5J8YC 2HHSA 1QQ7A 4B6JA 4RNOA 2WB1F 2MSNA 2FPMA 3SEIA 2ZTCA 1DXSA 2JMGA 1ZQMA 5F9NA 3C1ZA 3RAQA 3QUQA 2K89A 2A1JB 1ED1A 8ICOA 2ZTDA 3ZDAA 1NKCA 4F71A 3IG8A 1L5UA 2Z7JA 2KV2A 3NGDA 1T8EA 2W43A 8ICLA 2AGOA 3SAGA 2F44A 3B0YA 1TAQA 2XCAA 3R9KA 3KOOA 5IILA 3RB4A 9ICGA 3PX6A 1TK5A 3MR3A 4DSJA 7ICMA 3LYSA 1T4GA 2G0AA 1B4FA 4DSEA 4RQNA 3ZI4A 5K4LA 5ALGA 4CCHA 2JHDA 2C2RA 4UBBA 4JWMA 2FLPA 1X40A 2HSZA 2O6KA 3NVZA 3BS5A 1FEZA 5AKLA 5KFBA 5J2DA 2Y0SC 1O08A 4IR1A 3MGHA 4M9JA 1K5OA 9ICRA 1ZQYA 5KG0A 2GO7A 3UXOA 2CXYA 4DEZA 1FFUA 2W55A 2KN7A 1COKA 7ICTA 4KMUA 1KQQA 3H0LB 3WKCA 5ALNA 9ICSA 7ICRA 3BS7A 2H3IA 3RH5A 4ELTA 3V7LA 3U26A 3N7RC 4B9SA 1PVQA 2KHQA 9ICUA 9ICXA 5IINA 1MQ2A 5JUMA 3ZDEA 4XUSA 1L6NA 1ZQLA 3PZPA 1TE2A 1FFVA 4Y2RA 2QARB 2E8MA 2WHEA 1U48A 3SV4A 5F3XB 2GLEA 4P0PB 3BQ0A 3J81j 5DGAA 3PR4A 4BWJA 3Q8RB 5KG3A 2CRXA 4F2SA 4ECQA 3MBYA 3WK9A 3F53A 1ZD4A 5AK6A 4F5QA 5IIJA 2OYYA 5J2JA 2WB1C 3C5FA 9ICNA 3LDAA 2W9CB 4GC7A 2XY7A 3ALRA 1ZQAA 2E1FA 2JRZA 5AI5A 3PX0A 1ZD5A 2FE9A 3OGUA 2DKZA 1NK5A 3UMGA 3WU2U 3OHAA 3ZDCA 5DDYA 3PW5A 4DQSA 2GOLA 2ZIVA 4U6PA 2KKVA 4QW9A 1NI3A 4UB4A 4QZHA 1KLNA 1ZQOA 4KLLA 5KG5A 4M9LA 2Q0ZX 1NK7A 1XO0A 4UB5A 9ICFA 4I2EA 2ZJ8A 1L8LA 8ICIA 2VA2A 3HPOA 4EEKA 4RU9A 4GXKA 3T5LA 4JMUA 1SWWA 2QB1A 2XGPA 4YN4A 4F2RA 3RJFA 1XS9D 4ELUA 2IOHA 3N4MB 3N7PD 5AK3A 2FLNA 3HW8A 2H3VA 1HUZA 3OHBA 1PVPA 2FMSA 4EX7A 1XWLA 3PSIA 4ECZA 4UARA 4MFAA 3K75D 1LB2B 3EYZA 2NRZA 1MQ3A 3PR5B 3OPXA 1A76A 4F72A 2H3QA 4KLHA 4YD1A 2AH5A 4KLJA 5KFSA 3PV8A 8ICSA 3MFHA 2P35A 3IG5A 4YP3A 2M0NA 1Z1VA 4P0PA 8ICNA 7ICSA 4K4IA 4QZ8A 2LM4A 1JXEA 4FZNA 4IS7A 4NM1A 4RT3A 2F1HA 1YT3A 4IQVA 4OCZA 9ICTA 4TQRA 1Z19A 4M9GA 1PUZA 9ICIA 2DUYA 2ISOA 1N63A 1ZETA 4CF3A 2LKYA 4Z6FA 5E79U 1N2XA 1HEKA 3QU9A 2HHTA 2DGZA 2ES6A 2DL0A 5AM3A 3MDCA 3KHLA 4R8UB 3ISCA 4O0IA 1F5SA 4AP9A 1N48A 4Y2XA 1SIJA 2ZUBA 1ZQPA 5J2HA 4P2HA 1X9SA 4RZRA 5DQHA 2KSOA 3PW7A 4ED0A 3BS5B 1NK8A 4AYBF 3Q8MA 3AQFA 5KFWA 4I28A 5AI9A 5AKKA 3QX7A 5KG7A 4F4XA 2XVTA 4I2IA 4NLZA 1N5XA 3LVVA 1DGSA 1AQ6A 3GQCA 3RBEA 4I2JA 3M8RA 4RQ5A 1IM4A 2W11A 2PI4A 2KK0A 1XC9A 4US9A 3H4DA 2KSOB 1TFRA 5DBAA 3SENA 4O9MA 1UPHA 4DL7A 1QSYA 2HW3A 3H40A 3C2MA 1ZD2P 8ICBA 2ZUCA 5GTHU 2F1IA 3KZIU 5DB8A 1ZQKA 5ALZA 1FO4A 2GWSA 2FPLA 4RQ4A 1J97A 4XA5A 2QB0B 3G6XA 4DF8A 3CYMA 1KW4A 3WK5A 1TK0A 8ICKA 3PW4A 2KFZA 4RPXA 3SAHA 2MU2A 3AM9A 3ISDA 9ICHA 5DG8A 9ICMA 3CRXA 3ZD9A 4DL5A 2W8KA 4P4OA 4UQGA 3ISBA 1U9LA 4DFJA 7ICKA 4NLGA 1NJYA 5ALOA 4QWBA 3QUTA 5KFNA 3GFKB 3UMBA 5KL1B 4J9NA 4KLTA 2ASDA 8ICXA 4F4KA 3IN5A 2ZXHA 3GIJA 1CUKA 4EEYA 4DOCA 2KJ5A 3UM9A 4KN7A 1A6SA 3BQ7A 3M7DA 4Q45A 4M9NA 2I6XA 3BQ1A 4EBEA 2CN1A 3CW2C 4DO9A 1UHUA 1IXRA 3MABA 4K4HA 2AGQA 3HX0A 1LKYA 5GTIU 5ALFA 3QUBA 4NL9A 2KVSA 3TQ1A 8ICEA 2IMWP 2V9WA 2IA6A 1KFTA 3RTVA 1TAMA 5ALRA 1NZPA 2WF9A 5J2EA 3WKBA 3PY8A 5J0QA 7ICIA 4DQPA 2K8CB 5JTIA 8ICQA 4KLFA 1B22A 1K1QA 3JPSA 5ALSA 3F2BA 4HYKA 2RP5A 3E2EA 4F91B 5KFQA 4J9PA 4RQMA 2MAXA 5AHXA 2BDPA 1RXVA 4ICAA 4UAUA 1SV0A 3QZ8A 3HILA 5AI6A 5AIBA 5JU5A 5KAIU 2W03A 1KFSA 5AM1A 5A0LA 1QSLA 4OJOA 2J6SA 4M47A 1D8YA 3AQEA 2ZIWB 1SB3C 4IRCA 2W04A 5DQIA 3PSFA 3AUOA 2XY6A 5ALJA 1X6JA 2LHTA 2E5SA 3AL0B 3VCBA 8ICVA 2BCQA 1ZQUA 8ICFA 2AQ4A 4P0QA 2BPCA 2IBKA 4C8OA 5ALEA 2YN4A 1IIPA 4RQ8A 5DB6A 3NVYA 5ALHA 2C2EA 1C20A 2HBKA 4UW9A 2DWQA 4NWIA 4JV1A 4UASA 1Z4OA 1ZQDA 3D2QA 3F5AA 2HHWA 4FE3A 1HIWA 2G08A 5CRXA 1ZD3A 2HOQA 4F93B 4C4TA 5IIOA 3UQ2A 1SKSA 4F92B 4KLMA 5J0WA 4PZOA 3GV7B 5J0PA 3NS1A 3Q8KA 5ALVA 5B5EU 2GH1A 2XI9A 1P7DA 3QEAZ 5B66U 4Y2YA 3BZCA 3TI0A 2LBOA 1L7OA 4JB3A 4YXMA 3NTUA 3HT3A 2HI0A 2NO4A 4QW8A 5EE3A 4DSIA 4E0DA 1T94A 2EAPA 2FLLA 2A19A 2KZ3A 3IM1A 1TV9A 2YMQA 2V4RA 4QJFB 8ICAA 4BXOA 7ICFA 3FC4A 1M6YA 4QWEA 2VIXA 5KFUA 4MFCA 1CEZA 1CI4A 1U49A 4NLKA 2N1RA 4R8UA 3PX4A 3NASA 2R8HA 2DBYA 1ZXIA 2OM6A 4TUQA 3RRHA 1AROP 3D2SA 3AN1A 4UB1A 2RQ5A 3RB0A 1S0MA 3LWMA 2F77X 4C0ZA 4ECSA 4I2HA 2XIDA 1KBUA 2CPRA 1WWVA 4IC9A 3QNMA 4MHVA 4KITB 4F3OA 1DK3A 1RM6C 4TUSA 2JV3A 2AGPA 4UB2A 1A77A 1XO1A 2HCFA 2BQ3A 9ICWA 5L1JA 2KJ8A 5DBBA 3UXNA 5EE1A 7ICGA 5KL8B 5KFYA 2ZIUA 4DL6A 4UB6U 4ED1A 3T5KA 8ICUA 1UQVA 4OJPA 1SL0A 5FP0A 1ZQGA 1XNSA 4FZMA 2FPKA 2P6UA 5KT7A 4O3OA 3OJSA 4C8MA 2JH1A 5L1IA 1ZYQA 3NRWA 1BPDA 2MRLA 4YMNA 1NOMA 4EX6A 3C23A 2W9AA 4DSKA 3EW9A 4O3RA 3TKAA 4KLOA 4KTQA 3RJIA 2F8LA 1ZJMA 4FZLA 3RFAA 2BCRA 4DFMA 3RH4A 2AHOB 4BDPA 4P4MA 1ZQWA 4ED2A 1GO3F 4RQ7A 1SL1A 4DL4A 5KFMA 2HVIA 4C80A 4DWIA 2K4HA 5J0UA 3ZDBA 3RH6A 4F4WA 4NLBA 4PGXA 3BJYA 2C2DA 4M6WB 1ZQIA 5J0YA 7ICPA 3ZDDA 2KVCA 3ZD8A 2ZIUB 1BPEA 3RB3A 5DG7A 2W3SA 9ICAA 2PMZF 5KT4A 5ALWA 3B9JA 2NRXA 5BPCA 4MF8A 1X9XA 2W7PA 4FS1A 2YY6A 8ICRA 5AKIA 4YFKA 5HMLA 3HKZF 2EAMA 3T5HA 2BDUA 3MGIA 5KFFA 2ZIXA 1ZQVA 2LYAA 2K4IA 4CGZA 3BDPA 2OH2A 4BGDA 3MDAA 3FDSA 3C29A 5HMMA 3TANA 1RYUA 1RZTA 5KFAA 2PXIA 2OEHA 1ZQZA 4XRHA 3S6JA 4QZ9A 9ICVA 3KKAA 3KBBA 5KT6A 1KSPA 4IRKA 1JUDA 3KHRA 4EBCA 2QKQA 2YMPA 1PVRA 2F1JA 2RDJA 4O5CA 3L4PA 3SR6A 3RJEA 2HBMA 1Z3EB 1KKXA 4TURA 2I9GA 1J2NA 2ZTEA 1L7NA 1ZRNA 4X5VA 2LI6A 3SYZA 4QZBA 2KZZA 2HDOA 4I2DA 4RQ2A 2G07A 4C8NA 2I5HA 4I2FA 1KTQA 1X9MA 1D9FA 3KHHA 1BNOA 5J0XA 3PSTA 4J9OA 2HHVA 3QE9Y 3I76A 2D6FC 3ETRA 2AQ0A 5AM2A 5KG1A 4RQ1A 1NJWA 3VC8A 4PZNA 1RDFA 1T7PA 4O5KA 1SXEA 3DV9A 5CWRA 3RJHA 4QWDA 3ORYA 3GIKA 1YZ6A 3H8SA 2YQEA 2E1EA 2EANA 1JALA 2JEFA 5HR6A 5KFXA 5DGBA 1LV5A 1BVSA 1EXNA 3V72A 2KOBA 1BPYA 4EZ9A 4WJ3B 3LVWA 2ODGA 2P66A 1D8BA 7ICOA 4PL1A 2EQYA 4ECWA 4DQQA 3PO5A 4DS4A 1VLBA 3CNHA 2BCVA 2BHNA 2ZUDA 4CDGA 3V6KA 4CF5A 2W3RA 5AKJA 5T14A 8ICGA 4YQWA 2V4QA 2PFPA 2PFQA 7ICLA 4FBUA 1U4BA 4GLXA 2ZIWA 3V7KA 1F44A 5HNKA 3RBDA 3Q8QB 2HVHA 4Y2JA 4B9LA 4UB3A 5DKWA 4GFJA 2ZXIA 2VJ4A 1ZQSA 4B9NA 1Q3VA 4LJXA 2LM1A 3E0FA 4UAVA 2NRWA 1L3VA 4B9MA 3EUB2 5EWEA 5CEHA 4Q8FA 2WF6A 1XSPA 5EE0A 4NV0A 1QTMA 5EOZA 3M9NB 3PMLA 5KTQA 5ALTA 1X2IA 2A3VA 2KP7A 4DCCA 1RQLA 3I28A
chains in the Genus database with same CATH topology
3AQEA 3CYMA 3CP8A 2Z7JA 2ZIWB 2YB1A 2F2AB 2W04A 2KV2A 3PSFA 2N1RA 4FZNA 2HBLA 2KD1A 2OYYA 2WB1C 1CRXA 3SAHA 3SAGA 3H0RB 2Y0SF 2LHTA 2E5SA 2KVCA 3VCBA 3AL0B 4OJ5A 2ZIUB 2NV3A 2OM6A 1YT3A 3D2SA 3SMVA 1MA7A 3GZFA 3LYSA 2E1EA 3CRXA 2YX8A 2KEYA 3ALRA 2PMZF 4P0QA 1Z19A 2F77X 2KIWA 3SQIA 4C0ZA 5HR6A 2G0AA 1SZHA 1IIPA 3KZXA 2XIDA 1KBUA 2CPRA 2E1FA 4IC9A 2MA1A 2Q4TA 2LKYA 2JHDA 2LYBA 2KOBA 2W7PA 2H3ZA 3C28A 2HBKA 2ZG6A 3HKZF 1HEKA 4WJ3B 3LVWA 5C0YA 2DGZA 2K8BB 4ACOA 2BDUA 3DEEA 4NWIA 4NLCA 1D8BA 2ZIXA 4PL1A 2ZIXB 2K4EA 2HOIA 2PMZC 2Y0SC 2LYAA 2K8AA 2KJ8A 3SAFA 2K4IA 2KNJA 2HOFA 5KL1B 4OO1J 3D2QA 4CGZA 2GOLA 2ZIVA 2OH2A 3F5AA 3IN5A 4O3MA 2G5HB 2KKVA 2OXOA 2ZXHA 4AYBC 4U6PA 5HR7A 2KICA 4FE3A 5KL8B 4CDGA 1DRGA 1HIWA 2KJ5A 2RRDA 5T14A 3C29A 2ZIUA 3T79A 1ZQ1C 2G08A 4P0QB 1A6SA 3RF9A 3M7DA 3F2CA 2KHVA 5CRXA 3ICXA 2HOQA 4OJPA 1XO0A 1Q3UA 2G06A 4PL2A 1URJA 2CN1A 4BX9C 3H0LB 2ZIWA 4AYBF 1XNSA 4FZMA 2H3IA 3AQFA 4QIWC 3O0FA 1F44A 4KX3A 2RHFA 2JH1A 3N7SC 3F2DA 3MGVA 3N7RC 4JMUA 2XVTA 1PVQA 1PVRA 2KHQA 2WAQF 1NZBA 3HKZC 3NRWA 3H0MB 2DQNB 2HMXA 3LVVA 2HBMA 1WUDA 2H3FA 2DF4B 4OJ6A 2MRLA 2XICA 2KKPA 2HBJA 4GFJA 2ZXIA 3N7PD 2VJ4A 4CRXA 2GH1A 2XI9A 4KMOB 1P7DA 1L6NA 2JH7A 1A0PA 2JGAA 2H3VA 3ONNA 3PZPA 4OJLA 1Q3VA 4BUGA 2G09A 3F53A 3GU3A 3E0FA 1TAMA 2F8LA 1PVPA 4FZLA 3RFAA 3M6KA 3PSIA 2YB4A 2K8CB 3NUQA 4U7CA 2ZIVB 2WB1F 2LBOA 1Z1BA 3KFUF 1UPHA 3F2BA 4P0PB 3M6ZA 3L3FX 2G07A 3PSPA 2RP5A 1GO3F 2JMGA 4A8EA 4NV0A 2F76X 3D2NA 3F5EA 4QNLA 1T94A 2VJ5A 3OPXA 4QIWF 4ICAA 2WAQC 4KX5A 2K89A 2H3QA 2KJ9A 1ED1A 2R18A 1ECWA 2W7OA 1OUQA 3PSTA 4QJFB 2K4HA 2W03A 2G5IB 4BJQA 2D6FC 2CRXA 3IG5A 3IG8A 2M0NA 5A0LA 3IP4B 2A3VA 2VIXA 4OJOA 4P0PA 4NLBA 2VKQA 3K1ZA 3VC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEK A;  2H3I A;  1UPH A;  2N1R A;  2K4E A;  2LYA A;  4JMU A;  2K4I A;  2JMG A;  2GOL A;  2NV3 A;  2HMX A;  4ICA A;  2H3F A;  2H3Q A;  1ED1 A;  1ECW A;  1HIW A;  2K4H A;  1A6S A;  1L6N A;  4IC9 A;  2H3V A;  2LYB A;  1TAM A;  2H3Z A; 
#chains in the Genus database with same CATH topology
 1N62 A;  2F2A B;  1D9D A;  4YCX A;  4UAW A;  5CA7 A;  3EPG A;  4Y2Q A;  3G6Y A;  1ZQH A;  5AK5 A;  7ICN A;  4C4R A;  3JPR A;  3TFR A;  5AK4 A;  2YX8 A;  9ICP A;  2KIW A;  1XSN A;  7ICH A;  3WK4 A;  4RNN A;  4Z6E A;  1L3T A;  4IL6 U;  5DDM A;  3T3F A;  4YMM A;  4B9U A;  4NLC A;  2BQU A;  2IOF K;  3SAF A;  1Q8K A;  5DG9 A;  4O3M A;  5AKY A;  1RYS A;  4IQT A;  2R8I A;  1JIH A;  4J9K A;  1Q3U A;  3V6J A;  4NXZ A;  2I1Q A;  2XO7 A;  3JPQ A;  2L5Y A;  4QZA A;  3Q8L A;  2F3N A;  2HMX A;  1COO A;  3NVV A;  3KKA C;  3JPT A;  3SD7 A;  1SL2 A;  1OXJ A;  1A0P A;  2JGA A;  5D46 A;  4OJL A;  2ZJA A;  3UMC A;  9ICJ A;  3RRG A;  4EEL A;  2W9C A;  3E58 A;  5EE9 A;  2ASL A;  4DSF A;  2C28 A;  1Z1B A;  1NK9 A;  3H4B A;  2JEI A;  3TAC B;  5KAF U;  4ECR A;  3PNC A;  5D49 A;  3IHQ B;  4R63 A;  2AU0 A;  2R8G A;  3M9O B;  5KFR A;  9ICL A;  2G5I B;  4Y2V A;  4NM2 A;  4PH5 A;  5CR0 A;  3SZ2 A;  1LVH A;  3BQT A;  4DOB A;  5DB7 A;  1Z00 A;  4PGQ A;  1ZQC A;  3TAP A;  3IDW A;  3SMV A;  8ICH A;  3GZF A;  2UVR A;  1SZH A;  3KZX A;  5D4B A;  1ZRM A;  2ESE A;  4NLN A;  3AEV A;  1WCL A;  4LZG A;  4ED7 A;  4KLE A;  2JEG A;  2XGQ A;  4ECT A;  2UVV A;  3I1Y A;  4QZI A;  3PMN A;  1ZOL A;  4DQR A;  3LWL A;  3IV6 A;  1S8O A;  3WKD A;  4YG2 A;  2PI5 A;  2JZB B;  1ZQR A;  1JRP A;  3HWT A;  4QWA A;  2JZB A;  3A0B U;  2RRD A;  1DGJ A;  4R64 A;  1ZQ1 C;  3V6H A;  1T3Q A;  1UA1 A;  2VA8 A;  1KDH A;  4PL2 A;  4Y2P A;  4I2C A;  2HHU A;  2BR0 A;  2D8C A;  3N7S C;  4FFD A;  4HAI A;  3MGV A;  5J2I A;  4J9R A;  2WAQ F;  3OTQ A;  4M0A A;  4PGY A;  3M1Y A;  4J9L A;  4OJ6 A;  5KNI A;  1JMS A;  1H38 A;  4ED8 A;  4BUG A;  2G09 A;  4KLQ A;  5G5H A;  1L7M A;  5AI0 A;  3K4G A;  5ALX A;  1JN3 A;  2AXT U;  3M6K A;  5III A;  5BOM A;  4B9T A;  4U7C A;  2QLT A;  2W9M A;  1OW5 A;  2E8N A;  3M6Z A;  2YMM A;  3PSP A;  1N60 A;  2VJ5 A;  1L3S A;  4MFF A;  1PK1 A;  2R18 A;  2RLT A;  5TIS U;  4PPX A;  2FMQ A;  3EPI A;  1NKB A;  3DDH A;  5AM5 A;  3Q8P B;  8ICM A;  1ZQE A;  4UAY A;  2E8P A;  3PVX A;  4PHP A;  2KFN A;  2D3D A;  5AI8 A;  1BPX A;  2FJ6 A;  3GV5 B;  4F5R A;  5DLG A;  3GDX A;  4DFP A;  2KD1 A;  4O3Q A;  4UAZ A;  1CRX A;  3OJU A;  1S77 D;  4F50 A;  4EZ6 A;  4OJ5 A;  4I2A A;  5AKH A;  3QU5 A;  2ISP A;  1V85 A;  2EDU A;  4MEX A;  1QSS A;  5CHG A;  3PW0 A;  2XY5 A;  1RYR A;  1S5L U;  2LYB A;  5L1L A;  4J9Q A;  2K8B B;  4ACO A;  2HHQ A;  3MR2 A;  1KRP A;  1BNP A;  3EWA A;  5HHI A;  4QWC A;  5KFL A;  2B0C A;  4O3S A;  5CP2 A;  4Q43 A;  3TAD C;  3RR8 A;  3G6V A;  5ALP A;  7ICE A;  3T79 A;  5KFT A;  2KHV A;  3ICX A;  4PHA A;  3FM9 A;  1WCN A;  4BX9 C;  1Y88 A;  1S0O A;  1U45 A;  4C7Z A;  4EYI B;  4UB8 U;  1MSW D;  1NZB A;  3HKZ C;  5KFK A;  4P4P A;  1SV0 C;  3LK9 A;  3C2K A;  4RNM A;  2EZX A;  5J2G A;  2LPE A;  3RB6 A;  3FAH A;  1JRO A;  3OSN A;  1QQ5 A;  3PO4 A;  2PKE A;  9ICE A;  4Y2S A;  5KG6 A;  4F8R A;  1TVA A;  4J03 A;  2IOF A;  2Y1I A;  1ZQQ A;  4DL2 A;  4I29 A;  1S0V A;  2KIV A;  1ZJN A;  3KFU F;  3THV A;  4CE6 A;  3L3F X;  4Q8E A;  4KLD A;  1ZQN A;  5AM0 A;  2W9B A;  2WF7 A;  3WK7 A;  5J29 A;  2W7O A;  1HUO A;  9ICQ A;  5KFE A;  4F5O A;  1QCK A;  5KFV A;  4ZOH C;  3BZK A;  2W54 A;  3MR6 A;  2HHX A;  2QB0 A;  3CP8 A;  2YB1 A;  5ALY A;  5AM4 A;  1L3U A;  1N56 A;  4RQ3 A;  1MA7 A;  1B43 A;  1V9P A;  1T3N A;  2KEY A;  1K1S A;  3V7J A;  3OSP A;  3SQI A;  1VDV A;  5KFD A;  4MEY A;  5KT5 A;  4J9M A;  2MA1 A;  2Q4T A;  4KN4 A;  2EH9 A;  4LZD A;  2H3Z A;  3C28 A;  3TAQ A;  1F0M A;  4QZG A;  4IR9 A;  4QZC A;  2ATL A;  4RPY A;  3N28 A;  4J9S A;  2BZF A;  4PHE A;  2G5H B;  2LYH A;  4C4S A;  4ECY A;  3F2C A;  1WWU A;  2OCE A;  4TQS A;  1URJ A;  8ICP A;  1X9W A;  2RHF A;  3N97 B;  4Z6C A;  3H0M B;  1MC8 A;  2WF5 A;  3GIL A;  8ICY A;  1JI7 A;  2EZY A;  4JUZ A;  5KFP A;  1PZN A;  3ONN A;  4GIB A;  4ED6 A;  2EAO A;  8ICW A;  2BPG A;  1ZQF A;  2BCS A;  2NYV A;  1TAU A;  5KFZ A;  3M9M B;  4O3P A;  5AI4 A;  5KFO A;  5ALI A;  8ICC A;  2E3T A;  1WYG A;  2WAQ C;  4KX5 A;  2BPF A;  2JEJ A;  3NRZ A;  2KJ9 A;  4TUP A;  1S97 A;  1L8O A;  2B21 A;  3MC1 A;  3RJK A;  2R8K A;  4G9B A;  3WKE A;  4YXJ A;  1VJ5 A;  4FS2 A;  1WG8 A;  5ALL A;  4KLS A;  5KFH A;  2H5X A;  2M9N A;  1DOQ A;  2Y1J A;  4R65 A;  5AIC A;  1Z00 B;  3RR7 A;  5IIK A;  5J2B A;  2BKE A;  3GV8 B;  1BGX T;  4CF4 A;  4RQ6 A;  2KG5 A;  2NRT A;  2ZIX B;  4ED3 A;  2HOI A;  7ICQ A;  2HOF A;  2OWO A;  2UVU A;  5G5G A;  3UXP A;  4ECU A;  5JRT A;  3UQ0 A;  3RF9 A;  9ICO A;  2KMD A;  1ZQT A;  5KFC A;  3TAD A;  2W9B B;  2DPI A;  2NO5 A;  1JX4 A;  3GII A;  2Y9T A;  3FYH A;  4KX3 A;  5J0O A;  4M6W A;  4Y2U A;  4F5P A;  4YVZ A;  4YD2 A;  3RJG A;  2KE7 A;  4ZH4 A;  1S10 A;  5J0R A;  4UAT A;  3H8M A;  2YTU A;  1NK4 A;  2J6T A;  4CRX A;  4KMO B;  1RPL A;  5F9L A;  4JV0 A;  4ECX A;  2ZJ5 A;  2WFA A;  2J6U A;  2YB4 A;  3NUQ A;  5ALD A;  1QQ6 A;  3ED5 A;  4QZF A;  2IHM A;  5CB1 A;  4IRD A;  3QEB Z;  2MUT B;  3D2N A;  3RJJ A;  3UPQ A;  4MF2 A;  5ALU A;  5KFI A;  1NK6 A;  3MR5 A;  4Q44 A;  1SWV A;  3IP4 B;  4DFD A;  1TKD A;  4DLG A;  1SXD A;  2MUT A;  5H2F U;  2UVW A;  9ICB A;  1B0X A;  2HBL A;  2YML A;  4BWM A;  1N61 A;  4Z6D A;  1SV4 A;  3QU2 A;  2VAN A;  2DKX A;  5J2F A;  4F4Z A;  5KG4 A;  4YMO A;  2BQR A;  4C8K A;  4KLI A;  7ICJ A;  3JPP A;  3D6J A;  3QU7 A;  1ZQB A;  4PJ0 U;  4EBD A;  3QU4 A;  9ICK A;  4B9V A;  4R66 A;  2K4E A;  2K8A A;  3QXG A;  1XU4 A;  4AYB C;  1QH9 A;  1C7Y A;  5TZV A;  1X6I A;  5KG2 A;  5J0T A;  5KT3 A;  9ICC A;  5HP4 A;  2PFO A;  5EWG A;  2G06 A;  5IIM A;  3SV3 A;  2FDR A;  1PK1 B;  2VA3 A;  4FO6 A;  1IG6 A;  3O0F A;  5DBC A;  4QZD A;  4JWN A;  2DQN B;  1NJZ A;  5ALM A;  1SKW A;  3ETL A;  1WUD A;  4UBC A;  4QZE A;  2P6R A;  3Q8S B;  3T5J A;  1ZQJ A;  3GU3 A;  2JR5 A;  3WK6 A;  3KD3 A;  1D8L A;  3C5G A;  2E8O A;  1UA0 A;  8ICZ A;  2DPJ A;  3KTQ A;  4DLE A;  1UT5 A;  1X66 A;  4DQI A;  5KT2 A;  1X42 A;  1IV8 A;  3MFI A;  5DLF A;  4A8E A;  2BCU A;  4BXO B;  1V97 A;  1NJX A;  5J8Y A;  2LMR A;  5L1M A;  1N5W A;  3H8W A;  5AKE A;  2K60 A;  8ICT A;  5L1K A;  4EYH B;  3C21 A;  3K1Z A;  2AJQ A;  3H7I A;  2K4P A;  1KFD A;  4RQ0 A;  2A1J A;  2Y0S F;  3IRU A;  4XQ8 A;  3TFS A;  2ASJ A;  1NKE A;  4RT2 A;  4YR3 A;  4DL3 A;  3BQ2 A;  4I27 A;  4USA A;  4CNQ A;  5J0S A;  4DS5 A;  4PHD A;  3AU6 A;  3GIM A;  2BGW A;  2ZG6 A;  1SZP A;  1V38 A;  5CJ7 A;  4ELV A;  5C0Y A;  1S0N A;  3KHG A;  2OHF A;  4GC6 A;  2EZZ A;  5KFG A;  3B0X A;  5AKX A;  2KNJ A;  4ECV A;  3AMZ A;  4OO1 J;  2B6G A;  2JXJ A;  1Z4N A;  5HR7 A;  4Y2T A;  2KIC A;  1DRG A;  4OD0 A;  1MN8 A;  4KLG A;  1S9F A;  4P0Q B;  1KN5 A;  5HHH A;  3QYP A;  2FI1 A;  2R8J A;  1RQN A;  3WKA A;  1BPB A;  2F8K A;  4G3I A;  4C8L A;  5AKZ A;  4GXI A;  1SKR A;  4DOA A;  3SI8 A;  3A0H U;  3F2D A;  3L5K A;  1KEJ A;  1PK3 A;  2DFL A;  2RDI A;  4O5E A;  2H3F A;  3AU2 A;  2XIC A;  2KKP A;  1BPZ A;  1DK2 A;  2KTQ A;  2C22 A;  3C1Y A;  2JH7 A;  5KFJ A;  3EZ5 A;  1Q46 A;  4NY8 A;  2PFN A;  2KZM A;  3WK8 A;  5ALQ A;  4IQU A;  1JXL A;  2ZIV B;  4K4G A;  3QZ7 A;  2XC9 A;  3RAX A;  4JV2 A;  4LVS A;  2F76 X;  4DFK A;  3F5E A;  4QNL A;  3HP6 A;  4QIW F;  4IQW A;  2XCP A;  2Y9U A;  1ECW A;  1OUQ A;  4RUA A;  4RPZ A;  4YR0 A;  4BJQ A;  2A1A A;  4DF4 A;  2WTF A;  5J2K A;  2VKQ A;  1UT8 A;  3TAR A;  1S76 D;  4F4Y A;  5J2C A;  3H0R B;  2FMP A;  1ZQX A;  5C5J A;  2NV3 A;  4YR2 A;  3H8J A;  1HJP A;  4NJ8 A;  2NRV A;  4M2Y A;  5AKG A;  1LKY B;  1J2M A;  4KLU A;  2W8L A;  1L7P A;  5ALK A;  1FIQ A;  5L9X A;  4O3N A;  3DEE A;  7ICU A;  5J2A A;  2PMZ C;  3HJE A;  5BOL A;  4F5N A;  8ICJ A;  3M8S A;  4GXJ A;  1TK8 A;  4M9H A;  1KL9 A;  1SGG A;  1RG6 A;  2OXO A;  2WF8 A;  4US8 A;  4JK1 A;  7ICV A;  2QAR A;  1RXW A;  1YZ7 A;  3NVW A;  4M04 A;  2ALZ A;  5DB9 A;  4FBT A;  1UCV A;  5AIA A;  5EWF A;  4EEN A;  4RUC A;  1U47 A;  1XSL A;  4QIW C;  4C7Y A;  3JPN A;  3QUC A;  3K1R B;  5DQG A;  4I2B A;  3HRD D;  2DF4 B;  2HBJ A;  4I2G A;  1NK0 A;  3C2L A;  4DSL A;  2IHN A;  3JPO A;  1O03 A;  4NL9 C;  1QLN A;  3PW2 A;  1NNL A;  5J8Y C;  2HHS A;  1QQ7 A;  4B6J A;  4RNO A;  2WB1 F;  2MSN A;  2FPM A;  3SEI A;  2ZTC A;  1DXS A;  2JMG A;  1ZQM A;  5F9N A;  3C1Z A;  3RAQ A;  3QUQ A;  2K89 A;  2A1J B;  1ED1 A;  8ICO A;  2ZTD A;  3ZDA A;  1NKC A;  4F71 A;  3IG8 A;  1L5U A;  2Z7J A;  2KV2 A;  3NGD A;  1T8E A;  2W43 A;  8ICL A;  2AGO A;  3SAG A;  2F44 A;  3B0Y A;  1TAQ A;  2XCA A;  3R9K A;  3KOO A;  5IIL A;  3RB4 A;  9ICG A;  3PX6 A;  1TK5 A;  3MR3 A;  4DSJ A;  7ICM A;  3LYS A;  1T4G A;  2G0A A;  1B4F A;  4DSE A;  4RQN A;  3ZI4 A;  5K4L A;  5ALG A;  4CCH A;  2JHD A;  2C2R A;  4UBB A;  4JWM A;  2FLP A;  1X40 A;  2HSZ A;  2O6K A;  3NVZ A;  3BS5 A;  1FEZ A;  5AKL A;  5KFB A;  5J2D A;  2Y0S C;  1O08 A;  4IR1 A;  3MGH A;  4M9J A;  1K5O A;  9ICR A;  1ZQY A;  5KG0 A;  2GO7 A;  3UXO A;  2CXY A;  4DEZ A;  1FFU A;  2W55 A;  2KN7 A;  1COK A;  7ICT A;  4KMU A;  1KQQ A;  3H0L B;  3WKC A;  5ALN A;  9ICS A;  7ICR A;  3BS7 A;  2H3I A;  3RH5 A;  4ELT A;  3V7L A;  3U26 A;  3N7R C;  4B9S A;  1PVQ A;  2KHQ A;  9ICU A;  9ICX A;  5IIN A;  1MQ2 A;  5JUM A;  3ZDE A;  4XUS A;  1L6N A;  1ZQL A;  3PZP A;  1TE2 A;  1FFV A;  4Y2R A;  2QAR B;  2E8M A;  2WHE A;  1U48 A;  3SV4 A;  5F3X B;  2GLE A;  4P0P B;  3BQ0 A;  3J81 j;  5DGA A;  3PR4 A;  4BWJ A;  3Q8R B;  5KG3 A;  2CRX A;  4F2S A;  4ECQ A;  3MBY A;  3WK9 A;  3F53 A;  1ZD4 A;  5AK6 A;  4F5Q A;  5IIJ A;  2OYY A;  5J2J A;  2WB1 C;  3C5F A;  9ICN A;  3LDA A;  2W9C B;  4GC7 A;  2XY7 A;  3ALR A;  1ZQA A;  2E1F A;  2JRZ A;  5AI5 A;  3PX0 A;  1ZD5 A;  2FE9 A;  3OGU A;  2DKZ A;  1NK5 A;  3UMG A;  3WU2 U;  3OHA A;  3ZDC A;  5DDY A;  3PW5 A;  4DQS A;  2GOL A;  2ZIV A;  4U6P A;  2KKV A;  4QW9 A;  1NI3 A;  4UB4 A;  4QZH A;  1KLN A;  1ZQO A;  4KLL A;  5KG5 A;  4M9L A;  2Q0Z X;  1NK7 A;  1XO0 A;  4UB5 A;  9ICF A;  4I2E A;  2ZJ8 A;  1L8L A;  8ICI A;  2VA2 A;  3HPO A;  4EEK A;  4RU9 A;  4GXK A;  3T5L A;  4JMU A;  1SWW A;  2QB1 A;  2XGP A;  4YN4 A;  4F2R A;  3RJF A;  1XS9 D;  4ELU A;  2IOH A;  3N4M B;  3N7P D;  5AK3 A;  2FLN A;  3HW8 A;  2H3V A;  1HUZ A;  3OHB A;  1PVP A;  2FMS A;  4EX7 A;  1XWL A;  3PSI A;  4ECZ A;  4UAR A;  4MFA A;  3K75 D;  1LB2 B;  3EYZ A;  2NRZ A;  1MQ3 A;  3PR5 B;  3OPX A;  1A76 A;  4F72 A;  2H3Q A;  4KLH A;  4YD1 A;  2AH5 A;  4KLJ A;  5KFS A;  3PV8 A;  8ICS A;  3MFH A;  2P35 A;  3IG5 A;  4YP3 A;  2M0N A;  1Z1V A;  4P0P A;  8ICN A;  7ICS A;  4K4I A;  4QZ8 A;  2LM4 A;  1JXE A;  4FZN A;  4IS7 A;  4NM1 A;  4RT3 A;  2F1H A;  1YT3 A;  4IQV A;  4OCZ A;  9ICT A;  4TQR A;  1Z19 A;  4M9G A;  1PUZ A;  9ICI A;  2DUY A;  2ISO A;  1N63 A;  1ZET A;  4CF3 A;  2LKY A;  4Z6F A;  5E79 U;  1N2X A;  1HEK A;  3QU9 A;  2HHT A;  2DGZ A;  2ES6 A;  2DL0 A;  5AM3 A;  3MDC A;  3KHL A;  4R8U B;  3ISC A;  4O0I A;  1F5S A;  4AP9 A;  1N48 A;  4Y2X A;  1SIJ A;  2ZUB A;  1ZQP A;  5J2H A;  4P2H A;  1X9S A;  4RZR A;  5DQH A;  2KSO A;  3PW7 A;  4ED0 A;  3BS5 B;  1NK8 A;  4AYB F;  3Q8M A;  3AQF A;  5KFW A;  4I28 A;  5AI9 A;  5AKK A;  3QX7 A;  5KG7 A;  4F4X A;  2XVT A;  4I2I A;  4NLZ A;  1N5X A;  3LVV A;  1DGS A;  1AQ6 A;  3GQC A;  3RBE A;  4I2J A;  3M8R A;  4RQ5 A;  1IM4 A;  2W11 A;  2PI4 A;  2KK0 A;  1XC9 A;  4US9 A;  3H4D A;  2KSO B;  1TFR A;  5DBA A;  3SEN A;  4O9M A;  1UPH A;  4DL7 A;  1QSY A;  2HW3 A;  3H40 A;  3C2M A;  1ZD2 P;  8ICB A;  2ZUC A;  5GTH U;  2F1I A;  3KZI U;  5DB8 A;  1ZQK A;  5ALZ A;  1FO4 A;  2GWS A;  2FPL A;  4RQ4 A;  1J97 A;  4XA5 A;  2QB0 B;  3G6X A;  4DF8 A;  3CYM A;  1KW4 A;  3WK5 A;  1TK0 A;  8ICK A;  3PW4 A;  2KFZ A;  4RPX A;  3SAH A;  2MU2 A;  3AM9 A;  3ISD A;  9ICH A;  5DG8 A;  9ICM A;  3CRX A;  3ZD9 A;  4DL5 A;  2W8K A;  4P4O A;  4UQG A;  3ISB A;  1U9L A;  4DFJ A;  7ICK A;  4NLG A;  1NJY A;  5ALO A;  4QWB A;  3QUT A;  5KFN A;  3GFK B;  3UMB A;  5KL1 B;  4J9N A;  4KLT A;  2ASD A;  8ICX A;  4F4K A;  3IN5 A;  2ZXH A;  3GIJ A;  1CUK A;  4EEY A;  4DOC A;  2KJ5 A;  3UM9 A;  4KN7 A;  1A6S A;  3BQ7 A;  3M7D A;  4Q45 A;  4M9N A;  2I6X A;  3BQ1 A;  4EBE A;  2CN1 A;  3CW2 C;  4DO9 A;  1UHU A;  1IXR A;  3MAB A;  4K4H A;  2AGQ A;  3HX0 A;  1LKY A;  5GTI U;  5ALF A;  3QUB A;  4NL9 A;  2KVS A;  3TQ1 A;  8ICE A;  2IMW P;  2V9W A;  2IA6 A;  1KFT A;  3RTV A;  1TAM A;  5ALR A;  1NZP A;  2WF9 A;  5J2E A;  3WKB A;  3PY8 A;  5J0Q A;  7ICI A;  4DQP A;  2K8C B;  5JTI A;  8ICQ A;  4KLF A;  1B22 A;  1K1Q A;  3JPS A;  5ALS A;  3F2B A;  4HYK A;  2RP5 A;  3E2E A;  4F91 B;  5KFQ A;  4J9P A;  4RQM A;  2MAX A;  5AHX A;  2BDP A;  1RXV A;  4ICA A;  4UAU A;  1SV0 A;  3QZ8 A;  3HIL A;  5AI6 A;  5AIB A;  5JU5 A;  5KAI U;  2W03 A;  1KFS A;  5AM1 A;  5A0L A;  1QSL A;  4OJO A;  2J6S A;  4M47 A;  1D8Y A;  3AQE A;  2ZIW B;  1SB3 C;  4IRC A;  2W04 A;  5DQI A;  3PSF A;  3AUO A;  2XY6 A;  5ALJ A;  1X6J A;  2LHT A;  2E5S A;  3AL0 B;  3VCB A;  8ICV A;  2BCQ A;  1ZQU A;  8ICF A;  2AQ4 A;  4P0Q A;  2BPC A;  2IBK A;  4C8O A;  5ALE A;  2YN4 A;  1IIP A;  4RQ8 A;  5DB6 A;  3NVY A;  5ALH A;  2C2E A;  1C20 A;  2HBK A;  4UW9 A;  2DWQ A;  4NWI A;  4JV1 A;  4UAS A;  1Z4O A;  1ZQD A;  3D2Q A;  3F5A A;  2HHW A;  4FE3 A;  1HIW A;  2G08 A;  5CRX A;  1ZD3 A;  2HOQ A;  4F93 B;  4C4T A;  5IIO A;  3UQ2 A;  1SKS A;  4F92 B;  4KLM A;  5J0W A;  4PZO A;  3GV7 B;  5J0P A;  3NS1 A;  3Q8K A;  5ALV A;  5B5E U;  2GH1 A;  2XI9 A;  1P7D A;  3QEA Z;  5B66 U;  4Y2Y A;  3BZC A;  3TI0 A;  2LBO A;  1L7O A;  4JB3 A;  4YXM A;  3NTU A;  3HT3 A;  2HI0 A;  2NO4 A;  4QW8 A;  5EE3 A;  4DSI A;  4E0D A;  1T94 A;  2EAP A;  2FLL A;  2A19 A;  2KZ3 A;  3IM1 A;  1TV9 A;  2YMQ A;  2V4R A;  4QJF B;  8ICA A;  4BXO A;  7ICF A;  3FC4 A;  1M6Y A;  4QWE A;  2VIX A;  5KFU A;  4MFC A;  1CEZ A;  1CI4 A;  1U49 A;  4NLK A;  2N1R A;  4R8U A;  3PX4 A;  3NAS A;  2R8H A;  2DBY A;  1ZXI A;  2OM6 A;  4TUQ A;  3RRH A;  1ARO P;  3D2S A;  3AN1 A;  4UB1 A;  2RQ5 A;  3RB0 A;  1S0M A;  3LWM A;  2F77 X;  4C0Z A;  4ECS A;  4I2H A;  2XID A;  1KBU A;  2CPR A;  1WWV A;  4IC9 A;  3QNM A;  4MHV A;  4KIT B;  4F3O A;  1DK3 A;  1RM6 C;  4TUS A;  2JV3 A;  2AGP A;  4UB2 A;  1A77 A;  1XO1 A;  2HCF A;  2BQ3 A;  9ICW A;  5L1J A;  2KJ8 A;  5DBB A;  3UXN A;  5EE1 A;  7ICG A;  5KL8 B;  5KFY A;  2ZIU A;  4DL6 A;  4UB6 U;  4ED1 A;  3T5K A;  8ICU A;  1UQV A;  4OJP A;  1SL0 A;  5FP0 A;  1ZQG A;  1XNS A;  4FZM A;  2FPK A;  2P6U A;  5KT7 A;  4O3O A;  3OJS A;  4C8M A;  2JH1 A;  5L1I A;  1ZYQ A;  3NRW A;  1BPD A;  2MRL A;  4YMN A;  1NOM A;  4EX6 A;  3C23 A;  2W9A A;  4DSK A;  3EW9 A;  4O3R A;  3TKA A;  4KLO A;  4KTQ A;  3RJI A;  2F8L A;  1ZJM A;  4FZL A;  3RFA A;  2BCR A;  4DFM A;  3RH4 A;  2AHO B;  4BDP A;  4P4M A;  1ZQW A;  4ED2 A;  1GO3 F;  4RQ7 A;  1SL1 A;  4DL4 A;  5KFM A;  2HVI A;  4C80 A;  4DWI A;  2K4H A;  5J0U A;  3ZDB A;  3RH6 A;  4F4W A;  4NLB A;  4PGX A;  3BJY A;  2C2D A;  4M6W B;  1ZQI A;  5J0Y A;  7ICP A;  3ZDD A;  2KVC A;  3ZD8 A;  2ZIU B;  1BPE A;  3RB3 A;  5DG7 A;  2W3S A;  9ICA A;  2PMZ F;  5KT4 A;  5ALW A;  3B9J A;  2NRX A;  5BPC A;  4MF8 A;  1X9X A;  2W7P A;  4FS1 A;  2YY6 A;  8ICR A;  5AKI A;  4YFK A;  5HML A;  3HKZ F;  2EAM A;  3T5H A;  2BDU A;  3MGI A;  5KFF A;  2ZIX A;  1ZQV A;  2LYA A;  2K4I A;  4CGZ A;  3BDP A;  2OH2 A;  4BGD A;  3MDA A;  3FDS A;  3C29 A;  5HMM A;  3TAN A;  1RYU A;  1RZT A;  5KFA A;  2PXI A;  2OEH A;  1ZQZ A;  4XRH A;  3S6J A;  4QZ9 A;  9ICV A;  3KKA A;  3KBB A;  5KT6 A;  1KSP A;  4IRK A;  1JUD A;  3KHR A;  4EBC A;  2QKQ A;  2YMP A;  1PVR A;  2F1J A;  2RDJ A;  4O5C A;  3L4P A;  3SR6 A;  3RJE A;  2HBM A;  1Z3E B;  1KKX A;  4TUR A;  2I9G A;  1J2N A;  2ZTE A;  1L7N A;  1ZRN A;  4X5V A;  2LI6 A;  3SYZ A;  4QZB A;  2KZZ A;  2HDO A;  4I2D A;  4RQ2 A;  2G07 A;  4C8N A;  2I5H A;  4I2F A;  1KTQ A;  1X9M A;  1D9F A;  3KHH A;  1BNO A;  5J0X A;  3PST A;  4J9O A;  2HHV A;  3QE9 Y;  3I76 A;  2D6F C;  3ETR A;  2AQ0 A;  5AM2 A;  5KG1 A;  4RQ1 A;  1NJW A;  3VC8 A;  4PZN A;  1RDF A;  1T7P A;  4O5K A;  1SXE A;  3DV9 A;  5CWR A;  3RJH A;  4QWD A;  3ORY A;  3GIK A;  1YZ6 A;  3H8S A;  2YQE A;  2E1E A;  2EAN A;  1JAL A;  2JEF A;  5HR6 A;  5KFX A;  5DGB A;  1LV5 A;  1BVS A;  1EXN A;  3V72 A;  2KOB A;  1BPY A;  4EZ9 A;  4WJ3 B;  3LVW A;  2ODG A;  2P66 A;  1D8B A;  7ICO A;  4PL1 A;  2EQY A;  4ECW A;  4DQQ A;  3PO5 A;  4DS4 A;  1VLB A;  3CNH A;  2BCV A;  2BHN A;  2ZUD A;  4CDG A;  3V6K A;  4CF5 A;  2W3R A;  5AKJ A;  5T14 A;  8ICG A;  4YQW A;  2V4Q A;  2PFP A;  2PFQ A;  7ICL A;  4FBU A;  1U4B A;  4GLX A;  2ZIW A;  3V7K A;  1F44 A;  5HNK A;  3RBD A;  3Q8Q B;  2HVH A;  4Y2J A;  4B9L A;  4UB3 A;  5DKW A;  4GFJ A;  2ZXI A;  2VJ4 A;  1ZQS A;  4B9N A;  1Q3V A;  4LJX A;  2LM1 A;  3E0F A;  4UAV A;  2NRW A;  1L3V A;  4B9M A;  3EUB 2;  5EWE A;  5CEH A;  4Q8F A;  2WF6 A;  1XSP A;  5EE0 A;  4NV0 A;  1QTM A;  5EOZ A;  3M9N B;  3PML A;  5KTQ A;  5ALT A;  1X2I A;  2A3V A;  2KP7 A;  4DCC A;  1RQL A;  3I28 A; 
#chains in the Genus database with same CATH homology
 3AQE A;  3CYM A;  3CP8 A;  2Z7J A;  2ZIW B;  2YB1 A;  2F2A B;  2W04 A;  2KV2 A;  3PSF A;  2N1R A;  4FZN A;  2HBL A;  2KD1 A;  2OYY A;  2WB1 C;  1CRX A;  3SAH A;  3SAG A;  3H0R B;  2Y0S F;  2LHT A;  2E5S A;  2KVC A;  3VCB A;  3AL0 B;  4OJ5 A;  2ZIU B;  2NV3 A;  2OM6 A;  1YT3 A;  3D2S A;  3SMV A;  1MA7 A;  3GZF A;  3LYS A;  2E1E A;  3CRX A;  2YX8 A;  2KEY A;  3ALR A;  2PMZ F;  4P0Q A;  1Z19 A;  2F77 X;  2KIW A;  3SQI A;  4C0Z A;  5HR6 A;  2G0A A;  1SZH A;  1IIP A;  3KZX A;  2XID A;  1KBU A;  2CPR A;  2E1F A;  4IC9 A;  2MA1 A;  2Q4T A;  2LKY A;  2JHD A;  2LYB A;  2KOB A;  2W7P A;  2H3Z A;  3C28 A;  2HBK A;  2ZG6 A;  3HKZ F;  1HEK A;  4WJ3 B;  3LVW A;  5C0Y A;  2DGZ A;  2K8B B;  4ACO A;  2BDU A;  3DEE A;  4NWI A;  4NLC A;  1D8B A;  2ZIX A;  4PL1 A;  2ZIX B;  2K4E A;  2HOI A;  2PMZ C;  2Y0S C;  2LYA A;  2K8A A;  2KJ8 A;  3SAF A;  2K4I A;  2KNJ A;  2HOF A;  5KL1 B;  4OO1 J;  3D2Q A;  4CGZ A;  2GOL A;  2ZIV A;  2OH2 A;  3F5A A;  3IN5 A;  4O3M A;  2G5H B;  2KKV A;  2OXO A;  2ZXH A;  4AYB C;  4U6P A;  5HR7 A;  2KIC A;  4FE3 A;  5KL8 B;  4CDG A;  1DRG A;  1HIW A;  2KJ5 A;  2RRD A;  5T14 A;  3C29 A;  2ZIU A;  3T79 A;  1ZQ1 C;  2G08 A;  4P0Q B;  1A6S A;  3RF9 A;  3M7D A;  3F2C A;  2KHV A;  5CRX A;  3ICX A;  2HOQ A;  4OJP A;  1XO0 A;  1Q3U A;  2G06 A;  4PL2 A;  1URJ A;  2CN1 A;  4BX9 C;  3H0L B;  2ZIW A;  4AYB F;  1XNS A;  4FZM A;  2H3I A;  3AQF A;  4QIW C;  3O0F A;  1F44 A;  4KX3 A;  2RHF A;  2JH1 A;  3N7S C;  3F2D A;  3MGV A;  3N7R C;  4JMU A;  2XVT A;  1PVQ A;  1PVR A;  2KHQ A;  2WAQ F;  1NZB A;  3HKZ C;  3NRW A;  3H0M B;  2DQN B;  2HMX A;  3LVV A;  2HBM A;  1WUD A;  2H3F A;  2DF4 B;  4OJ6 A;  2MRL A;  2XIC A;  2KKP A;  2HBJ A;  4GFJ A;  2ZXI A;  3N7P D;  2VJ4 A;  4CRX A;  2GH1 A;  2XI9 A;  4KMO B;  1P7D A;  1L6N A;  2JH7 A;  1A0P A;  2JGA A;  2H3V A;  3ONN A;  3PZP A;  4OJL A;  1Q3V A;  4BUG A;  2G09 A;  3F53 A;  3GU3 A;  3E0F A;  1TAM A;  2F8L A;  1PVP A;  4FZL A;  3RFA A;  3M6K A;  3PSI A;  2YB4 A;  2K8C B;  3NUQ A;  4U7C A;  2ZIV B;  2WB1 F;  2LBO A;  1Z1B A;  3KFU F;  1UPH A;  3F2B A;  4P0P B;  3M6Z A;  3L3F X;  2G07 A;  3PSP A;  2RP5 A;  1GO3 F;  2JMG A;  4A8E A;  4NV0 A;  2F76 X;  3D2N A;  3F5E A;  4QNL A;  1T94 A;  2VJ5 A;  3OPX A;  4QIW F;  4ICA A;  2WAQ C;  4KX5 A;  2K89 A;  2H3Q A;  2KJ9 A;  1ED1 A;  2R18 A;  1ECW A;  2W7O A;  1OUQ A;  3PST A;  4QJF B;  2K4H A;  2W03 A;  2G5I B;  4BJQ A;  2D6F C;  2CRX A;  3IG5 A;  3IG8 A;  2M0N A;  5A0L A;  3IP4 B;  2A3V A;  2VIX A;  4OJO A;  4P0P A;  4NLB A;  2VKQ A;  3K1Z A;  3VC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...