1HEKA

Crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
AMADIGSMGDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWAISAVKMGLQINNVVDGKASFQLLRAKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN, CORE PROTEIN P15
publication title Structure of Equine Infectious Anemia Virus Matrix Protein.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
total genus 30
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08723 Gag_p15 Gag protein p15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hekA00
2K4HA 4JMUA 2K4EA 2H3QA 1ECWA 2GOLA 2NV3A 1HEKA 1ED1A 2N1RA 2HMXA 2H3FA 2LYBA 4IC9A 1TAMA 2K4IA 2LYAA 4ICAA 2H3ZA 1L6NA 1UPHA 1HIWA 2H3IA 2JMGA 2H3VA 1A6SA
chains in the Genus database with same CATH superfamily
1S5LU 2JH1A 8ICWA 1NKEA 1ZOLA 1MN8A 4QZFA 4ACOA 3GDXA 4EEYA 5AK5A 4ELTA 4YR3A 5L9XA 1CI4A 2B0CA 4PHAA 4YR2A 3RR7A 2HVIA 2Q4TA 4CRXA 3FM9A 2YMPA 4UARA 5AHXA 1V85A 1ZQKA 8ICHA 2EANA 4J9QA 4DO9A 1X6JA 4KMUA 4YMNA 3SI8A 4Q8FA 1ZQRA 3SAGA 5J0WA 2CPRA 3GIIA 2ISPA 1ZD2P 4JWNA 2VA2A 1ZQFA 4ECZA 2IMWP 2ZXIA 5J2IA 3UM9A 4JWMA 4C8KA 7ICLA 5KFFA 4RQNA 4O3OA 5HHIA 4PHEA 2PFPA 3BQ7A 3UPQA 3AL0B 4M2YA 5B66U 3PW7A 4C8OA 4Z6EA 2HCFA 3THVA 1BNOA 3UQ2A 4R63A 1QSLA 2KE7A 1SXDA 1XSLA 2ESEA 5AKJA 3PV8A 3IP4B 4P4PA 2Q0ZX 1N48A 2DWQA 4RQ5A 4J9SA 1XNSA 3TAPA 2FPMA 5ALHA 4JV1A 3ZDDA 2XC9A 4NM2A 1T4GA 3SQIA 2IHNA 4Z6DA 1X66A 2IHMA 2H3QA 2P35A 3OPXA 1K1SA 4ECVA 3M8SA 4IQWA 4KLDA 5EWFA 4O9MA 8ICIA 4DOCA 2QKQA 3DV9A 1QQ6A 4Z6CA 2AH5A 2A1AA 1A77A 3QU9A 4YP3A 4QWCA 3BZCA 4KLUA 4RQ3A 4DSKA 2KHVA 3C23A 1D8BA 2W9CB 3MDCA 5ALRA 2ODGA 1X9XA 2G07A 2ZTCA 2RHFA 2WF5A 8ICUA 2IOFK 5ALXA 3T3FA 3RJKA 5JU5A 2XGQA 1CUKA 1LKYB 1WG8A 5DQGA 2CXYA 5KFTA 4RZRA 2KN7A 9ICKA 2D6FC 8ICLA 4FZLA 5CEHA 4UB4A 5J29A 3JPNA 3K75D 3F2BA 1T94A 4EZ9A 1NNLA 5AKLA 4JV0A 4B9TA 4IQUA 2JRZA 3WU2U 2NRXA 4EBCA 1XO0A 3IG5A 3N97B 3F5AA 7ICPA 1UT8A 1BPEA 5KAIU 2Y1JA 4PL1A 5AM1A 4O3QA 5DBAA 1VDVA 3QUTA 3V7KA 2IA6A 3O0FA 1QH9A 2LKYA 3PSIA 5HMMA 3S6JA 5J0XA 5BOLA 2JHDA 2WAQF 5HHHA 3MABA 4GXIA 1LKYA 2W03A 4CF5A 3F5EA 2AGOA 2WF7A 5KFDA 1F0MA 4R65A 3RJGA 1N5WA 4F4XA 5C5JA 5DB8A 2D8CA 1ZQWA 2A3VA 5DGBA 2WF9A 4DL4A 3NTUA 4NL9A 1T7PA 4DQQA 2K4HA 3G6XA 2YQEA 3PMLA 4YMOA 1Z4NA 5AK4A 3H8JA 1N2XA 3FAHA 3WKCA 1RM6C 3QE9Y 2C2DA 3PW0A 3K4GA 2JZBB 1LVHA 3HW8A 4BX9C 1ZQEA 3Q8QB 4XRHA 3MFHA 1XC9A 2I6XA 4RQ7A 2ZIWB 2KIWA 5KTQA 3V7LA 2HOFA 8ICSA 1DRGA 4FS1A 5IIKA 2HHXA 5KFSA 4K4HA 4J03A 8ICXA 3ORYA 4MHVA 3NVZA 4ZOHC 4US8A 4DLGA 1PZNA 3M6ZA 5ALMA 4CGZA 2E8MA 2F3NA 2IOFA 5H2FU 4DSIA 3OSPA 9ICNA 5AKYA 3SMVA 2ZIVB 1KTQA 3PX6A 4QZHA 3PVXA 5DDMA 3SV3A 3A0HU 1N62A 1FO4A 2UVVA 2JZBA 2W9BB 1BPXA 4BDPA 4BXOB 2L5YA 8ICNA 3ETRA 3BDPA 3WK9A 4QZIA 1NK5A 1U4BA 4IRCA 2R8JA 1AROP 2E3TA 1NJWA 2VIXA 2W55A 5JRTA 4F71A 2FJ6A 2R8IA 1S77D 5DGAA 1O08A 3IN5A 4DF8A 2H3ZA 1WCLA 2ZJAA 3BQ2A 1XU4A 3C21A 2W7PA 1QLNA 2ZTEA 4Y2XA 9ICJA 2FLLA 2NRTA 4M6WB 2NO5A 4M04A 2W11A 3V6JA 3SD7A 2K60A 1IM4A 5JUMA 2ZIVA 4QNLA 3T79A 4NLCA 4EX6A 4G9BA 1IIPA 1NKCA 7ICMA 1TV9A 2HVHA 2EQYA 2W9BA 4DL6A 5ALTA 5IIMA 8ICJA 1ZQYA 4BXOA 2AHOB 4F93B 1NJYA 1RQLA 1L3SA 4AYBC 7ICOA 3GIMA 3AU2A 1KW4A 3QZ8A 5ALUA 1NOMA 5AM2A 2E5SA 5CA7A 4TQRA 3PX0A 5A0LA 7ICJA 3KZXA 2ES6A 8ICRA 1CRXA 1RXWA 4M6WA 5ALJA 3ZDAA 4ELUA 5KG1A 1RYRA 3RB3A 3CP8A 1RYUA 2B6GA 1GO3F 4PJ0U 2YB1A 2ISOA 5J8YC 1P7DA 5GTHU 7ICTA 4UW9A 4MF8A 2KTQA 4GLXA 2VANA 3UQ0A 2Y9TA 4J9MA 2KZMA 9ICRA 1DXSA 3ISCA 2R8HA 8ICYA 2F76X 4U6PA 2F1HA 2V9WA 1JRPA 2NV3A 2QLTA 2HDOA 1VJ5A 5ALEA 2PMZF 2HHQA 4KLQA 2CN1A 2OHFA 1S76D 3N7SC 3CRXA 4F92B 3KKAC 4ED8A 5KFMA 3JPRA 5CP2A 4F5OA 5KFQA 3JPTA 3ZDCA 1PVRA 1ZQPA 3SV4A 1BNPA 2HSZA 2JEIA 4QJFB 1D8YA 7ICFA 3HWTA 2FE9A 3N7PD 2XY6A 3AQFA 1BGXT 1KFTA 2HHWA 2HHUA 4GXKA 1L7OA 5D4BA 2KKVA 3IV6A 2FPLA 1BVSA 3C5GA 5KT3A 3BJYA 2ZG6A 4ED3A 3GIKA 4LZDA 4QZDA 4IQTA 4YFKA 3PX4A 4RQ2A 3RAQA 4DCCA 4FZNA 3KOOA 3EWAA 2Y1IA 3J81j 3KBBA 3UMBA 4KTQA 4MFAA 2FPKA 4DEZA 3PY8A 2ZXHA 2E1EA 3M8RA 2UVUA 1KDHA 1F5SA 4IS7A 5KFKA 4R64A 5G5GA 2PI4A 3Q8SB 3OHAA 1X40A 5AKIA 4EELA 2C28A 2HMXA 1XSPA 2BCRA 4DOBA 5AI8A 5ALVA 5KFBA 3GV5B 3EPIA 3QYPA 4RT2A 4M0AA 2NRVA 2K8CB 3BQ1A 2F2AB 3AMZA 3BS5B 3WK5A 1A76A 4YQWA 1WUDA 1ZRMA 3H4DA 2BPFA 5J0YA 4PHDA 1TE2A 5BPCA 5KT7A 3GFKB 4TUSA 1B22A 5DG8A 5DQHA 2LM4A 3LVVA 1JXLA 2F1IA 9ICOA 3WK4A 1S0VA 2R18A 3RF9A 2GWSA 4PZOA 5TISU 1T8EA 4F4KA 3Q8MA 4Y2RA 4DQPA 5KFOA 4TQSA 4F91B 2EAMA 8ICBA 2HHVA 8ICZA 5KL1B 9ICWA 2OXOA 2C2RA 3BS5A 3PW4A 2OH2A 3TARA 4F4WA 5J0PA 5D49A 4I27A 1ZQNA 4O3RA 3QU5A 4QWBA 2QARB 2RP5A 4DQRA 2LYBA 3KFUF 2XIDA 3SENA 3PSTA 2KP7A 1ZQCA 4ED2A 2HBJA 3ISBA 3BS7A 4R8UB 4NY8A 3ALRA 5ALWA 1YZ6A 2BPCA 3C29A 4CNQA 1KFSA 2ASDA 1V9PA 2K4EA 4KLLA 1S10A 1T3NA 4DFPA 5KT2A 1XWLA 1ZQGA 3M6KA 4ECWA 2G06A 5DB9A 4MFCA 4YN4A 3RRGA 4OD0A 3KHHA 5HP4A 1ZQMA 1UT5A 1SZPA 2XY5A 1B0XA 3ETLA 2ZUCA 3ONNA 2H3VA 5KFVA 1MC8A 4MF2A 2P66A 1ZQXA 4FBTA 2Z7JA 2N1RA 1Z19A 3C5FA 4Y2PA 1L7NA 1J2MA 1KSPA 4CE6A 1SXEA 1S8OA 2MA1A 1K1QA 4QWDA 7ICSA 1KRPA 2K8BB 4KX5A 2E8OA 2KK0A 4KITB 4PPXA 5KFAA 3TADA 3C28A 2PI5A 1QQ5A 7ICGA 4MFFA 2EZXA 3PNCA 2EAOA 4PGXA 5J2HA 7ICRA 5DDYA 4RPZA 1B43A 5KT4A 1OXJA 3HPOA 2Y0SC 4NWIA 2E8NA 3M9OB 4PGYA 4RNNA 1YT3A 2YMLA 5AM3A 1CEZA 1RYSA 4JK1A 2XCPA 3MR6A 4UAYA 9ICPA 4YXMA 3JPOA 5AM0A 2BQRA 3KZIU 5KG0A 2EAPA 4DWIA 4ECRA 2YN4A 9ICLA 4ELVA 2BCUA 4F5NA 4DL5A 7ICQA 4P0PB 2NRZA 3GILA 5KT6A 1J2NA 2J6UA 4QWEA 2DPIA 5DLGA 1KQQA 1WWVA 4BUGA 4I2IA 1TFRA 4LJXA 1ZQBA 4UASA 1X9MA 3TACB 1HJPA 5G5HA 1U47A 2W9CA 2RQ5A 5KFUA 4RPXA 4KLHA 5AI5A 3SYZA 5DB7A 1ECWA 4C8MA 2V4RA 2KIVA 3C1ZA 1D8LA 4ECYA 5GTIU 4OO1J 4EYIB 5KFLA 5J2CA 5IILA 1UHUA 1V97A 8ICFA 1SV4A 4KN4A 1X9WA 2PFNA 1L6NA 3HX0A 5AKZA 4ZH4A 9ICFA 2KSOB 1TAQA 5L1IA 2I1QA 3KHGA 3EYZA 3AUOA 4PZNA 5KFWA 4DS4A 3NS1A 1U49A 4IR1A 3DDHA 4C7YA 4NM1A 1KLNA 4JV2A 3UXPA 4TUPA 3WK8A 4RQ1A 9ICGA 5J2FA 5IIOA 8ICOA 4P0QB 9ICSA 4PHPA 4I2JA 1HIWA 1Q46A 4QW9A 1JMSA 5DLFA 2H5XA 3HILA 1ZQTA 2JMGA 2MU2A 2BCVA 4UQGA 2AJQA 1ZD5A 2OM6A 3F2CA 4XQ8A 3NASA 4UBCA 1BPYA 2IOHA 4M9HA 1ZYQA 3M1YA 2BCSA 1N5XA 2RLTA 2RDIA 1NK6A 5FP0A 1UCVA 1X2IA 1ZQAA 5J2EA 3OGUA 4XA5A 3QEBZ 2KSOA 3VC8A 1VLBA 4F2RA 5EWEA 3F2DA 5KG7A 1QTMA 3QU4A 3RJHA 4ECTA 1SV0C 1XS9D 2HW3A 2FMSA 4B9LA 3QXGA 4UAWA 2F1JA 1OW5A 4G3IA 4UATA 4DFKA 4Y2UA 2BR0A 4AYBF 3QX7A 5AI9A 3ZD8A 4USAA 3G6VA 3PW5A 5ALIA 4F72A 4P0QA 4RU9A 3A0BU 5AIBA 3TQ1A 8ICGA 2I9GA 4F3OA 5T14A 4C8NA 2DKZA 5ALGA 2G0AA 3FDSA 3NUQA 4QZCA 2QB1A 1V38A 3SR6A 4PH5A 5CJ7A 5J2AA 2W8LA 2YB4A 3Q8KA 2KMDA 4E0DA 5KNIA 3GU3A 2H3FA 5J2KA 3IG8A 2FI1A 1AQ6A 2EZYA 2ALZA 3NVWA 4I2CA 4GXJA 4YXJA 3AN1A 4EENA 1TKDA 3RH4A 2ZIWA 4NLNA 1NK4A 5ALNA 3R9KA 5J0UA 1ZJNA 5F3XB 2F44A 5AI4A 3WK7A 4QWAA 4BJQA 4O5CA 2PFOA 4PGQA 5DKWA 2W9MA 1S0MA 4EX7A 2A19A 4Q8EA 1N61A 1JN3A 4TURA 3LWMA 1DK2A 2XI9A 2KD1A 1H38A 4O3SA 3EPGA 2AU0A 4F4YA 2KVSA 3PW2A 2B21A 1Q3UA 1J97A 2BDUA 2BHNA 5KFPA 4ECQA 4YVZA 4FO6A 4YD2A 3GV7B 2M9NA 3IM1A 2D3DA 3AEVA 3H7IA 3GQCA 1NK0A 1NK7A 4B9VA 3HRDD 5E79U 3JPQA 3NVVA 4IRDA 1HEKA 2WF8A 1ZQVA 2JR5A 5DBCA 4Y2QA 3ZI4A 3TFRA 2VA3A 3PZPA 4CF4A 3L5KA 1F44A 3PO4A 2I5HA 8ICMA 1SGGA 2KEYA 4DFMA 4J9PA 3CYMA 5ALDA 2W9AA 4R66A 1UQVA 1L3VA 4FE3A 2OWOA 4NLKA 2MUTB 4OJPA 4RQ4A 3K1ZA 1JUDA 2MRLA 4Y2TA 1BPZA 7ICKA 5CB1A 1LV5A 1NJXA 4DF4A 1PK3A 3JPSA 4RT3A 4J9OA 3MR2A 5ALOA 1SZHA 2XICA 5KG4A 2GO7A 1ZQZA 1L7PA 4ED6A 5DG9A 5L1LA 1SL0A 1QCKA 4IQVA 2KJ5A 2LMRA 2O6KA 3RB6A 4DQIA 4UAUA 1ZRNA 4F4ZA 3V72A 4M9NA 4I2BA 3RJJA 3MFIA 4C7ZA 5J0TA 4RQ0A 2JH7A 8ICKA 4ED7A 4Y2YA 4HAIA 4Y2JA 4QZAA 5J2BA 2BQUA 5AKEA 2W3RA 2AQ4A 3D2SA 3H8WA 5HR7A 4Y2VA 5EE3A 4F5QA 3D6JA 1NZPA 5AIAA 3V7JA 4OCZA 2H3IA 5F9LA 4K4IA 4Q43A 2VJ4A 3HP6A 4KLMA 4JB3A 4KLOA 2LHTA 2G5HB 3D2NA 3TI0A 8ICAA 4J9LA 3QZ7A 1NKBA 1IG6A 2EDUA 1Z3EB 4UB6U 5KFYA 4BGDA 1FFVA 1UA0A 1FEZA 2W8KA 1ZD3A 4UB3A 2R8GA 3N28A 5F9NA 1BPBA 4YMMA 4DSFA 4I29A 1JROA 1QSSA 1ED1A 2ASLA 4DSEA 5DBBA 1Z1VA 5AKKA 3TFSA 1ZQLA 2DFLA 2KKPA 4F5RA 3RFAA 1TK5A 1D9DA 5KFCA 1ZQQA 4DS5A 5EE1A 8ICEA 3T5JA 4JMUA 2JXJA 3KTQA 4LZGA 2GOLA 5ALYA 2DGZA 4M9JA 1MQ2A 3SEIA 2G5IB 5ALZA 2LYAA 4QIWF 2WTFA 3UMGA 3G6YA 3QUQA 2A1JB 2DF4B 3TADC 5BOMA 2LBOA 2KJ9A 2JEFA 3RBEA 3RBDA 2EZZA 4EBEA 5AK6A 3V6HA 2F8LA 5ALLA 1FFUA 3E58A 3LDAA 1WWUA 4O3NA 2HOIA 1ZQUA 4QZBA 2AQ0A 4B9UA 5K4LA 1SKSA 2XY7A 1SKRA 4TUQA 4KLFA 4O5KA 1NZBA 5AM5A 2WB1C 4QZ8A 4EEKA 5IIJA 4CF3A 3KKAA 4O3MA 1Z4OA 3F53A 2WF6A 3AQEA 4Q44A 5AI6A 4O0IA 4CDGA 1RG6A 5ALQA 2Y0SF 2K89A 4Q45A 4EBDA 4MEXA 3ZD9A 3ED5A 3QUCA 9ICXA 3N7RC 2A1JA 3C2LA 3TAQA 4UB8U 3RH6A 4DQSA 5J2DA 1ZD4A 5HNKA 1RZTA 5KG6A 3M9MB 1SKWA 3HJEA 1L5UA 4I28A 5EE0A 4NLZA 2QB0B 4RQ6A 1D9FA 3TANA 2VJ5A 9ICHA 5KG3A 2G08A 1JXEA 4UB2A 3T5KA 5DQIA 3SAHA 5J0QA 1NK9A 4QIWC 3DEEA 7ICNA 4KLEA 1Q3VA 2HBLA 4UAVA 5D46A 3QU2A 1A0PA 4KX3A 3RJEA 5KT5A 1SL1A 2ZIUB 3FYHA 5AM4A 2QARA 2OCEA 2LI6A 5CR0A 2KZ3A 2JGAA 4YG2A 4UB5A 3L4PA 3SZ2A 9ICUA 3MBYA 2BQ3A 1COOA 4P4OA 4R8UA 5C0YA 4M9GA 4GIBA 3C2KA 3MDAA 3HKZC 5L1KA 2AXTU 3AU6A 3H8SA 4IRKA 2QB0A 1L8LA 5AKGA 4K4GA 4NL9C 4IC9A 4ED0A 1IV8A 3CW2C 1PK1B 3H0LB 2K8AA 2JEGA 2E1FA 3PSFA 2J6SA 3KD3A 3WKDA 4RQMA 3RR8A 3RJFA 2BGWA 4NJ8A 1IXRA 3UXNA 1S97A 2HI0A 2WHEA 2ZIUA 5B5EU 1C20A 3NRWA 9ICBA 4ICAA 4BWJA 5KFGA 2KOBA 2G09A 3L3FX 2E8PA 3WKBA 4U7CA 2HBMA 3Q8LA 1SWWA 5AKXA 5EOZA 5KFEA 2WFAA 4NV0A 4J9NA 5ALKA 2W7OA 4F50A 1MA7A 1TK0A 3UMCA 2CRXA 2FLNA 1KL9A 4F8RA 7ICEA 3D2QA 1JI7A 2UVWA 1WYGA 1Q8KA 8ICQA 1PK1A 4PL2A 1ZJMA 3NRZA 2RRDA 3ISDA 4QZ9A 2PKEA 2K4PA 4BWMA 3WKAA 4RQ8A 3GV8B 2AGQA 1T3QA 2XO7A 2C2EA 2MSNA 4P2HA 2LPEA 2MAXA 8ICPA 4X5VA 3BQ0A 3H4BA 2YMMA 2LM1A 2DBYA 2ZUBA 4J9RA 1DK3A 1COKA 4RNMA 4I2FA 4P0PA 4GFJA 1ZQ1C 4Y2SA 1RPLA 4RNOA 1KFDA 1KBUA 3T5LA 4B9SA 2FLPA 5IIIA 2BZFA 4FFDA 1TVAA 2R8KA 4DOAA 4WJ3B 4MEYA 2JEJA 3LWLA 5J2JA 5KAFU 8ICVA 9ICIA 2ZTDA 2VKQA 3BQTA 4KLJA 1O03A 1Z00B 3BZKA 2PXIA 2YY6A 3LVWA 4UAZA 4FBUA 3OSNA 3EW9A 1JX4A 1U45A 1JIHA 1L7MA 4C0ZA 2BPGA 2NYVA 3B0YA 3E2EA 4B6JA 2FDRA 5KFRA 3NGDA 1WCNA 1KN5A 3GZFA 2ZUDA 3I1YA 2GH1A 1ZETA 1URJA 1N60A 3PR5B 3T5HA 4I2GA 9ICEA 1ZQJA 1PVPA 2YMQA 5KG2A 2DL0A 3H0RB 5CHGA 3ZDBA 1X6IA 5CRXA 4B9NA 3H40A 1HUOA 5AKHA 4Z6FA 2KFZA 5KFIA 1JALA 1SIJA 3C1YA 4I2DA 5KFZA 3RB4A 3OJSA 1Z00A 2WAQC 2P6UA 2KZZA 4EZ6A 1L8OA 3M7DA 5AI0A 2UVRA 4C8LA 1L3TA 3MR3A 5KFXA 1RDFA 2F8KA 3MGHA 4M47A 4FZMA 4DFDA 2XGPA 2W54A 1SWVA 3NVYA 1UPHA 2EH9A 3RJIA 1ZQIA 4YCXA 5L1MA 5KFHA 5CWRA 2ZIXB 2HOQA 1FIQA 3EUB2 4RUCA 4RUAA 1DOQA 4XUSA 4OJ6A 1SL2A 1MSWD 5J0OA 4C4RA 3UXOA 2KICA 3KHRA 4KLIA 3GIJA 3QUBA 4O3PA 5J0RA 1U48A 3CNHA 1YZ7A 2LYHA 5TZVA 5KG5A 1N63A 2OYYA 5EE9A 1MQ3A 3HT3A 3E0FA 4F5PA 9ICVA 1XO1A 3QEAZ 1TAMA 1HUZA 3RTVA 4NXZA 2YX8A 3RB0A 1X9SA 3QNMA 4P4MA 1S0OA 5ALPA 2NRWA 3Q8RB 3C2MA 2ZIXA 4KLSA 3B0XA 4DSLA 1K5OA 3IRUA 1QSYA 3WKEA 3WK6A 3SAFA 4DLEA 4M9LA 1SV0A 4JUZA 4I2HA 1ZXIA 1PUZA 4J9KA 3H0MB 1ZQDA 4HYKA 1NK8A 2KHQA 2FMPA 4I2AA 4OJLA 4C4TA 5J2GA 3IHQB 1U9LA 4DL3A 2F77X 9ICAA 3V6KA 1N56A 4KLGA 4UB1A 4KN7A 2NO4A 4DL7A 4C4SA 2BDPA 2PFQA 4RPYA 4O5EA 4QZEA 4YR0A 8ICTA 4C80A 4ECUA 2DPJA 3KHLA 7ICUA 1S9FA 5AK3A 5JTIA 4DSJA 3IDWA 8ICCA 4CCHA 1BPDA 4GC7A 1SB3C 4OJOA 2GLEA 2W3SA 2V4QA 3LK9A 2VA8A 7ICIA 5HR6A 2W43A 2DKXA 3RH5A 1NI3A 3OHBA 2MUTA 1UA1A 9ICMA 4IR9A 2KFNA 4GC6A 3K1RB 4NLBA 4ECSA 3H8MA 3AM9A 2P6RA 4ECXA 2BCQA 9ICCA 3QU7A 1EXNA 1QQ7A 2ASJA 1XSNA 3PSPA 1RQNA 1C7YA 3U26A 5EWGA 3TKAA 3I76A 3EZ5A 1ZQOA 2WB1F 1OUQA 1TK8A 2DQNB 2BKEA 9ICTA 1X42A 1A6SA 5ALSA 2HHTA 1M6YA 1KEJA 2W04A 2YTUA 5KFNA 4NLGA 2RDJA 3Q8PB 5L1JA 2K4IA 5DG7A 4EYHB 1NJZA 2Y9UA 2C22A 2OEHA 3RAXA 5KFJA 4QW8A 2J6TA 1LB2B 1ZQHA 4YD1A 4B9MA 4UBBA 4KMOB 3JPPA 1Y88A 3OJUA 3VCBA 4FS2A 4DL2A 3ZDEA 4F2SA 2M0NA 1TAUA 2PMZC 7ICVA 2KVCA 2XCAA 4QZGA 1DGSA 4ED1A 3ICXA 2ZJ8A 2XVTA 2KG5A 5J8YA 3MGIA 7ICHA 3LYSA 2ZJ5A 3PO5A 4DFJA 1RXVA 2ATLA 4KLTA 2KV2A 4I2EA 3OTQA 5DB6A 5IINA 2HBKA 1B4FA 5ALFA 2IBKA 4LVSA 3HKZF 9ICQA 1ZQSA 3M9NB 4IL6U 2JV3A 1PVQA 4A8EA 3FC4A 5KL8B 3RRHA 3B9JA 2DUYA 3MR5A 4OJ5A 1KKXA 2HHSA 3N4MB 3PMNA 1L3UA 2AGPA 5HMLA 3PR4A 2KNJA 2FMQA 3I28A 4US9A 1DGJA 3MGVA 5J0SA 2KJ8A 5AICA 1S0NA 4AP9A 1Z1BA 3MC1A
chains in the Genus database with same CATH topology
3RF9A 2JH1A 3N7PD 1Q3VA 2HBLA 2K4HA 2ZIWA 2G07A 2K8BB 4JMUA 4KX5A 3AQFA 2ZIXA 2W04A 2GOLA 2RHFA 3H0RB 4ACOA 1A0PA 3C28A 2ZIVA 4QNLA 3T79A 4NLCA 2DGZA 4KX3A 2KKVA 1IIPA 1SZHA 2XICA 2Q4TA 3SAFA 4CRXA 2ZIUB 2G5IB 5CRXA 4BJQA 2K4IA 2LYAA 4QIWF 2JGAA 2KJ5A 2ZG6A 4P0QB 1HIWA 4BX9C 3H0MB 2DF4B 5KL1B 4AYBC 2Y0SC 4NWIA 2OXOA 2LBOA 2JMGA 2KJ9A 5C0YA 2KHQA 2WAQC 2ZIWB 3SAGA 2KIWA 4OJLA 2OH2A 1YT3A 2CPRA 2XI9A 2HOFA 2D6FC 2KD1A 3HKZC 2F77X 2F8LA 1DRGA 4FZNA 2JH7A 2OM6A 4FZLA 3M7DA 3F2CA 4KMOB 4QIWC 3VCBA 2HOIA 4P0PA 1Q3UA 2BDUA 2RP5A 2LYBA 2ZXIA 4GFJA 4IC9A 2E5SA 3F2BA 1ZQ1C 1T94A 3KFUF 2M0NA 2XIDA 1KBUA 5A0LA 4FZMA 3PSTA 2PMZC 2KVCA 1UPHA 3ICXA 3D2SA 2HBJA 1NZBA 3AL0B 5HR7A 3M6ZA 1XO0A 2XVTA 2ZXHA 2E1EA 2WB1C 3KZXA 3IG5A 4CGZA 3H0LB 3F5AA 3VC8A 2K8AA 1CRXA 2H3IA 3LYSA 2VJ4A 2E1FA 3ALRA 3PSFA 3C29A 4PL1A 4O3MA 3F2DA 3F53A 2ZIXB 2LHTA 2G5HB 2KV2A 2HOQA 2K4EA 3AQEA 3D2NA 3SMVA 1HEKA 2ZIVB 4OJOA 4WJ3B 3CP8A 4P0PB 4OJ6A 2HMXA 1GO3F 3O0FA 2YB1A 3IP4B 3PSIA 2LKYA 3M6KA 2ZIUA 4CDGA 1P7DA 5HR6A 2G06A 2KICA 2HBKA 2Y0SF 4AYBF 3NRWA 2K89A 4BUGA 4ICAA 2JHDA 2WAQF 3PZPA 2KOBA 4P0QA 2G09A 1XNSA 2VKQA 2K8CB 2W03A 2F2AB 3HKZF 3L3FX 3F5EA 3N7RC 4NLBA 1F44A 5T14A 3ONNA 2H3VA 2F76X 2KEYA 3SQIA 4U7CA 4U6PA 3LVWA 2G0AA 1WUDA 3CYMA 2HBMA 2OYYA 3NUQA 3PSPA 1ECWA 2H3QA 2NV3A 3OPXA 4A8EA 2Z7JA 1PVQA 4C0ZA 1ED1A 2N1RA 2YB4A 5KL8B 2PMZF 3E0FA 4OJ5A 3GU3A 1Z19A 2VIXA 4NV0A 2CN1A 2H3FA 4FE3A 2WB1F 3IG8A 2VJ5A 4OO1J 4OJPA 1TAMA 2W7OA 3IN5A 3GZFA 3N7SC 1OUQA 2G08A 1MA7A 2A3VA 3CRXA 2GH1A 2H3ZA 2CRXA 2DQNB 1URJA 3LVVA 2KNJA 2YX8A 1L6NA 3K1ZA 2KKPA 2W7PA 2MRLA 3D2QA 1A6SA 3RFAA 2MA1A 3SAHA 3MGVA 1PVRA 2KJ8A 2KHVA 1D8BA 4PL2A 4QJFB 1PVPA 2R18A 1Z1BA 2RRDA 3DEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K4H A;  4JMU A;  2K4E A;  2H3Q A;  1ECW A;  2GOL A;  2NV3 A;  1HEK A;  1ED1 A;  2N1R A;  2HMX A;  2H3F A;  2LYB A;  4IC9 A;  1TAM A;  2K4I A;  2LYA A;  4ICA A;  2H3Z A;  1L6N A;  1UPH A;  1HIW A;  2H3I A;  2JMG A;  2H3V A;  1A6S A; 
#chains in the Genus database with same CATH topology
 1S5L U;  2JH1 A;  8ICW A;  1NKE A;  1ZOL A;  1MN8 A;  4QZF A;  4ACO A;  3GDX A;  4EEY A;  5AK5 A;  4ELT A;  4YR3 A;  5L9X A;  1CI4 A;  2B0C A;  4PHA A;  4YR2 A;  3RR7 A;  2HVI A;  2Q4T A;  4CRX A;  3FM9 A;  2YMP A;  4UAR A;  5AHX A;  1V85 A;  1ZQK A;  8ICH A;  2EAN A;  4J9Q A;  4DO9 A;  1X6J A;  4KMU A;  4YMN A;  3SI8 A;  4Q8F A;  1ZQR A;  3SAG A;  5J0W A;  2CPR A;  3GII A;  2ISP A;  1ZD2 P;  4JWN A;  2VA2 A;  1ZQF A;  4ECZ A;  2IMW P;  2ZXI A;  5J2I A;  3UM9 A;  4JWM A;  4C8K A;  7ICL A;  5KFF A;  4RQN A;  4O3O A;  5HHI A;  4PHE A;  2PFP A;  3BQ7 A;  3UPQ A;  3AL0 B;  4M2Y A;  5B66 U;  3PW7 A;  4C8O A;  4Z6E A;  2HCF A;  3THV A;  1BNO A;  3UQ2 A;  4R63 A;  1QSL A;  2KE7 A;  1SXD A;  1XSL A;  2ESE A;  5AKJ A;  3PV8 A;  3IP4 B;  4P4P A;  2Q0Z X;  1N48 A;  2DWQ A;  4RQ5 A;  4J9S A;  1XNS A;  3TAP A;  2FPM A;  5ALH A;  4JV1 A;  3ZDD A;  2XC9 A;  4NM2 A;  1T4G A;  3SQI A;  2IHN A;  4Z6D A;  1X66 A;  2IHM A;  2H3Q A;  2P35 A;  3OPX A;  1K1S A;  4ECV A;  3M8S A;  4IQW A;  4KLD A;  5EWF A;  4O9M A;  8ICI A;  4DOC A;  2QKQ A;  3DV9 A;  1QQ6 A;  4Z6C A;  2AH5 A;  2A1A A;  1A77 A;  3QU9 A;  4YP3 A;  4QWC A;  3BZC A;  4KLU A;  4RQ3 A;  4DSK A;  2KHV A;  3C23 A;  1D8B A;  2W9C B;  3MDC A;  5ALR A;  2ODG A;  1X9X A;  2G07 A;  2ZTC A;  2RHF A;  2WF5 A;  8ICU A;  2IOF K;  5ALX A;  3T3F A;  3RJK A;  5JU5 A;  2XGQ A;  1CUK A;  1LKY B;  1WG8 A;  5DQG A;  2CXY A;  5KFT A;  4RZR A;  2KN7 A;  9ICK A;  2D6F C;  8ICL A;  4FZL A;  5CEH A;  4UB4 A;  5J29 A;  3JPN A;  3K75 D;  3F2B A;  1T94 A;  4EZ9 A;  1NNL A;  5AKL A;  4JV0 A;  4B9T A;  4IQU A;  2JRZ A;  3WU2 U;  2NRX A;  4EBC A;  1XO0 A;  3IG5 A;  3N97 B;  3F5A A;  7ICP A;  1UT8 A;  1BPE A;  5KAI U;  2Y1J A;  4PL1 A;  5AM1 A;  4O3Q A;  5DBA A;  1VDV A;  3QUT A;  3V7K A;  2IA6 A;  3O0F A;  1QH9 A;  2LKY A;  3PSI A;  5HMM A;  3S6J A;  5J0X A;  5BOL A;  2JHD A;  2WAQ F;  5HHH A;  3MAB A;  4GXI A;  1LKY A;  2W03 A;  4CF5 A;  3F5E A;  2AGO A;  2WF7 A;  5KFD A;  1F0M A;  4R65 A;  3RJG A;  1N5W A;  4F4X A;  5C5J A;  5DB8 A;  2D8C A;  1ZQW A;  2A3V A;  5DGB A;  2WF9 A;  4DL4 A;  3NTU A;  4NL9 A;  1T7P A;  4DQQ A;  2K4H A;  3G6X A;  2YQE A;  3PML A;  4YMO A;  1Z4N A;  5AK4 A;  3H8J A;  1N2X A;  3FAH A;  3WKC A;  1RM6 C;  3QE9 Y;  2C2D A;  3PW0 A;  3K4G A;  2JZB B;  1LVH A;  3HW8 A;  4BX9 C;  1ZQE A;  3Q8Q B;  4XRH A;  3MFH A;  1XC9 A;  2I6X A;  4RQ7 A;  2ZIW B;  2KIW A;  5KTQ A;  3V7L A;  2HOF A;  8ICS A;  1DRG A;  4FS1 A;  5IIK A;  2HHX A;  5KFS A;  4K4H A;  4J03 A;  8ICX A;  3ORY A;  4MHV A;  3NVZ A;  4ZOH C;  4US8 A;  4DLG A;  1PZN A;  3M6Z A;  5ALM A;  4CGZ A;  2E8M A;  2F3N A;  2IOF A;  5H2F U;  4DSI A;  3OSP A;  9ICN A;  5AKY A;  3SMV A;  2ZIV B;  1KTQ A;  3PX6 A;  4QZH A;  3PVX A;  5DDM A;  3SV3 A;  3A0H U;  1N62 A;  1FO4 A;  2UVV A;  2JZB A;  2W9B B;  1BPX A;  4BDP A;  4BXO B;  2L5Y A;  8ICN A;  3ETR A;  3BDP A;  3WK9 A;  4QZI A;  1NK5 A;  1U4B A;  4IRC A;  2R8J A;  1ARO P;  2E3T A;  1NJW A;  2VIX A;  2W55 A;  5JRT A;  4F71 A;  2FJ6 A;  2R8I A;  1S77 D;  5DGA A;  1O08 A;  3IN5 A;  4DF8 A;  2H3Z A;  1WCL A;  2ZJA A;  3BQ2 A;  1XU4 A;  3C21 A;  2W7P A;  1QLN A;  2ZTE A;  4Y2X A;  9ICJ A;  2FLL A;  2NRT A;  4M6W B;  2NO5 A;  4M04 A;  2W11 A;  3V6J A;  3SD7 A;  2K60 A;  1IM4 A;  5JUM A;  2ZIV A;  4QNL A;  3T79 A;  4NLC A;  4EX6 A;  4G9B A;  1IIP A;  1NKC A;  7ICM A;  1TV9 A;  2HVH A;  2EQY A;  2W9B A;  4DL6 A;  5ALT A;  5IIM A;  8ICJ A;  1ZQY A;  4BXO A;  2AHO B;  4F93 B;  1NJY A;  1RQL A;  1L3S A;  4AYB C;  7ICO A;  3GIM A;  3AU2 A;  1KW4 A;  3QZ8 A;  5ALU A;  1NOM A;  5AM2 A;  2E5S A;  5CA7 A;  4TQR A;  3PX0 A;  5A0L A;  7ICJ A;  3KZX A;  2ES6 A;  8ICR A;  1CRX A;  1RXW A;  4M6W A;  5ALJ A;  3ZDA A;  4ELU A;  5KG1 A;  1RYR A;  3RB3 A;  3CP8 A;  1RYU A;  2B6G A;  1GO3 F;  4PJ0 U;  2YB1 A;  2ISO A;  5J8Y C;  1P7D A;  5GTH U;  7ICT A;  4UW9 A;  4MF8 A;  2KTQ A;  4GLX A;  2VAN A;  3UQ0 A;  2Y9T A;  4J9M A;  2KZM A;  9ICR A;  1DXS A;  3ISC A;  2R8H A;  8ICY A;  2F76 X;  4U6P A;  2F1H A;  2V9W A;  1JRP A;  2NV3 A;  2QLT A;  2HDO A;  1VJ5 A;  5ALE A;  2PMZ F;  2HHQ A;  4KLQ A;  2CN1 A;  2OHF A;  1S76 D;  3N7S C;  3CRX A;  4F92 B;  3KKA C;  4ED8 A;  5KFM A;  3JPR A;  5CP2 A;  4F5O A;  5KFQ A;  3JPT A;  3ZDC A;  1PVR A;  1ZQP A;  3SV4 A;  1BNP A;  2HSZ A;  2JEI A;  4QJF B;  1D8Y A;  7ICF A;  3HWT A;  2FE9 A;  3N7P D;  2XY6 A;  3AQF A;  1BGX T;  1KFT A;  2HHW A;  2HHU A;  4GXK A;  1L7O A;  5D4B A;  2KKV A;  3IV6 A;  2FPL A;  1BVS A;  3C5G A;  5KT3 A;  3BJY A;  2ZG6 A;  4ED3 A;  3GIK A;  4LZD A;  4QZD A;  4IQT A;  4YFK A;  3PX4 A;  4RQ2 A;  3RAQ A;  4DCC A;  4FZN A;  3KOO A;  3EWA A;  2Y1I A;  3J81 j;  3KBB A;  3UMB A;  4KTQ A;  4MFA A;  2FPK A;  4DEZ A;  3PY8 A;  2ZXH A;  2E1E A;  3M8R A;  2UVU A;  1KDH A;  1F5S A;  4IS7 A;  5KFK A;  4R64 A;  5G5G A;  2PI4 A;  3Q8S B;  3OHA A;  1X40 A;  5AKI A;  4EEL A;  2C28 A;  2HMX A;  1XSP A;  2BCR A;  4DOB A;  5AI8 A;  5ALV A;  5KFB A;  3GV5 B;  3EPI A;  3QYP A;  4RT2 A;  4M0A A;  2NRV A;  2K8C B;  3BQ1 A;  2F2A B;  3AMZ A;  3BS5 B;  3WK5 A;  1A76 A;  4YQW A;  1WUD A;  1ZRM A;  3H4D A;  2BPF A;  5J0Y A;  4PHD A;  1TE2 A;  5BPC A;  5KT7 A;  3GFK B;  4TUS A;  1B22 A;  5DG8 A;  5DQH A;  2LM4 A;  3LVV A;  1JXL A;  2F1I A;  9ICO A;  3WK4 A;  1S0V A;  2R18 A;  3RF9 A;  2GWS A;  4PZO A;  5TIS U;  1T8E A;  4F4K A;  3Q8M A;  4Y2R A;  4DQP A;  5KFO A;  4TQS A;  4F91 B;  2EAM A;  8ICB A;  2HHV A;  8ICZ A;  5KL1 B;  9ICW A;  2OXO A;  2C2R A;  3BS5 A;  3PW4 A;  2OH2 A;  3TAR A;  4F4W A;  5J0P A;  5D49 A;  4I27 A;  1ZQN A;  4O3R A;  3QU5 A;  4QWB A;  2QAR B;  2RP5 A;  4DQR A;  2LYB A;  3KFU F;  2XID A;  3SEN A;  3PST A;  2KP7 A;  1ZQC A;  4ED2 A;  2HBJ A;  3ISB A;  3BS7 A;  4R8U B;  4NY8 A;  3ALR A;  5ALW A;  1YZ6 A;  2BPC A;  3C29 A;  4CNQ A;  1KFS A;  2ASD A;  1V9P A;  2K4E A;  4KLL A;  1S10 A;  1T3N A;  4DFP A;  5KT2 A;  1XWL A;  1ZQG A;  3M6K A;  4ECW A;  2G06 A;  5DB9 A;  4MFC A;  4YN4 A;  3RRG A;  4OD0 A;  3KHH A;  5HP4 A;  1ZQM A;  1UT5 A;  1SZP A;  2XY5 A;  1B0X A;  3ETL A;  2ZUC A;  3ONN A;  2H3V A;  5KFV A;  1MC8 A;  4MF2 A;  2P66 A;  1ZQX A;  4FBT A;  2Z7J A;  2N1R A;  1Z19 A;  3C5F A;  4Y2P A;  1L7N A;  1J2M A;  1KSP A;  4CE6 A;  1SXE A;  1S8O A;  2MA1 A;  1K1Q A;  4QWD A;  7ICS A;  1KRP A;  2K8B B;  4KX5 A;  2E8O A;  2KK0 A;  4KIT B;  4PPX A;  5KFA A;  3TAD A;  3C28 A;  2PI5 A;  1QQ5 A;  7ICG A;  4MFF A;  2EZX A;  3PNC A;  2EAO A;  4PGX A;  5J2H A;  7ICR A;  5DDY A;  4RPZ A;  1B43 A;  5KT4 A;  1OXJ A;  3HPO A;  2Y0S C;  4NWI A;  2E8N A;  3M9O B;  4PGY A;  4RNN A;  1YT3 A;  2YML A;  5AM3 A;  1CEZ A;  1RYS A;  4JK1 A;  2XCP A;  3MR6 A;  4UAY A;  9ICP A;  4YXM A;  3JPO A;  5AM0 A;  2BQR A;  3KZI U;  5KG0 A;  2EAP A;  4DWI A;  4ECR A;  2YN4 A;  9ICL A;  4ELV A;  2BCU A;  4F5N A;  4DL5 A;  7ICQ A;  4P0P B;  2NRZ A;  3GIL A;  5KT6 A;  1J2N A;  2J6U A;  4QWE A;  2DPI A;  5DLG A;  1KQQ A;  1WWV A;  4BUG A;  4I2I A;  1TFR A;  4LJX A;  1ZQB A;  4UAS A;  1X9M A;  3TAC B;  1HJP A;  5G5H A;  1U47 A;  2W9C A;  2RQ5 A;  5KFU A;  4RPX A;  4KLH A;  5AI5 A;  3SYZ A;  5DB7 A;  1ECW A;  4C8M A;  2V4R A;  2KIV A;  3C1Z A;  1D8L A;  4ECY A;  5GTI U;  4OO1 J;  4EYI B;  5KFL A;  5J2C A;  5IIL A;  1UHU A;  1V97 A;  8ICF A;  1SV4 A;  4KN4 A;  1X9W A;  2PFN A;  1L6N A;  3HX0 A;  5AKZ A;  4ZH4 A;  9ICF A;  2KSO B;  1TAQ A;  5L1I A;  2I1Q A;  3KHG A;  3EYZ A;  3AUO A;  4PZN A;  5KFW A;  4DS4 A;  3NS1 A;  1U49 A;  4IR1 A;  3DDH A;  4C7Y A;  4NM1 A;  1KLN A;  4JV2 A;  3UXP A;  4TUP A;  3WK8 A;  4RQ1 A;  9ICG A;  5J2F A;  5IIO A;  8ICO A;  4P0Q B;  9ICS A;  4PHP A;  4I2J A;  1HIW A;  1Q46 A;  4QW9 A;  1JMS A;  5DLF A;  2H5X A;  3HIL A;  1ZQT A;  2JMG A;  2MU2 A;  2BCV A;  4UQG A;  2AJQ A;  1ZD5 A;  2OM6 A;  3F2C A;  4XQ8 A;  3NAS A;  4UBC A;  1BPY A;  2IOH A;  4M9H A;  1ZYQ A;  3M1Y A;  2BCS A;  1N5X A;  2RLT A;  2RDI A;  1NK6 A;  5FP0 A;  1UCV A;  1X2I A;  1ZQA A;  5J2E A;  3OGU A;  4XA5 A;  3QEB Z;  2KSO A;  3VC8 A;  1VLB A;  4F2R A;  5EWE A;  3F2D A;  5KG7 A;  1QTM A;  3QU4 A;  3RJH A;  4ECT A;  1SV0 C;  1XS9 D;  2HW3 A;  2FMS A;  4B9L A;  3QXG A;  4UAW A;  2F1J A;  1OW5 A;  4G3I A;  4UAT A;  4DFK A;  4Y2U A;  2BR0 A;  4AYB F;  3QX7 A;  5AI9 A;  3ZD8 A;  4USA A;  3G6V A;  3PW5 A;  5ALI A;  4F72 A;  4P0Q A;  4RU9 A;  3A0B U;  5AIB A;  3TQ1 A;  8ICG A;  2I9G A;  4F3O A;  5T14 A;  4C8N A;  2DKZ A;  5ALG A;  2G0A A;  3FDS A;  3NUQ A;  4QZC A;  2QB1 A;  1V38 A;  3SR6 A;  4PH5 A;  5CJ7 A;  5J2A A;  2W8L A;  2YB4 A;  3Q8K A;  2KMD A;  4E0D A;  5KNI A;  3GU3 A;  2H3F A;  5J2K A;  3IG8 A;  2FI1 A;  1AQ6 A;  2EZY A;  2ALZ A;  3NVW A;  4I2C A;  4GXJ A;  4YXJ A;  3AN1 A;  4EEN A;  1TKD A;  3RH4 A;  2ZIW A;  4NLN A;  1NK4 A;  5ALN A;  3R9K A;  5J0U A;  1ZJN A;  5F3X B;  2F44 A;  5AI4 A;  3WK7 A;  4QWA A;  4BJQ A;  4O5C A;  2PFO A;  4PGQ A;  5DKW A;  2W9M A;  1S0M A;  4EX7 A;  2A19 A;  4Q8E A;  1N61 A;  1JN3 A;  4TUR A;  3LWM A;  1DK2 A;  2XI9 A;  2KD1 A;  1H38 A;  4O3S A;  3EPG A;  2AU0 A;  4F4Y A;  2KVS A;  3PW2 A;  2B21 A;  1Q3U A;  1J97 A;  2BDU A;  2BHN A;  5KFP A;  4ECQ A;  4YVZ A;  4FO6 A;  4YD2 A;  3GV7 B;  2M9N A;  3IM1 A;  2D3D A;  3AEV A;  3H7I A;  3GQC A;  1NK0 A;  1NK7 A;  4B9V A;  3HRD D;  5E79 U;  3JPQ A;  3NVV A;  4IRD A;  1HEK A;  2WF8 A;  1ZQV A;  2JR5 A;  5DBC A;  4Y2Q A;  3ZI4 A;  3TFR A;  2VA3 A;  3PZP A;  4CF4 A;  3L5K A;  1F44 A;  3PO4 A;  2I5H A;  8ICM A;  1SGG A;  2KEY A;  4DFM A;  4J9P A;  3CYM A;  5ALD A;  2W9A A;  4R66 A;  1UQV A;  1L3V A;  4FE3 A;  2OWO A;  4NLK A;  2MUT B;  4OJP A;  4RQ4 A;  3K1Z A;  1JUD A;  2MRL A;  4Y2T A;  1BPZ A;  7ICK A;  5CB1 A;  1LV5 A;  1NJX A;  4DF4 A;  1PK3 A;  3JPS A;  4RT3 A;  4J9O A;  3MR2 A;  5ALO A;  1SZH A;  2XIC A;  5KG4 A;  2GO7 A;  1ZQZ A;  1L7P A;  4ED6 A;  5DG9 A;  5L1L A;  1SL0 A;  1QCK A;  4IQV A;  2KJ5 A;  2LMR A;  2O6K A;  3RB6 A;  4DQI A;  4UAU A;  1ZRN A;  4F4Z A;  3V72 A;  4M9N A;  4I2B A;  3RJJ A;  3MFI A;  4C7Z A;  5J0T A;  4RQ0 A;  2JH7 A;  8ICK A;  4ED7 A;  4Y2Y A;  4HAI A;  4Y2J A;  4QZA A;  5J2B A;  2BQU A;  5AKE A;  2W3R A;  2AQ4 A;  3D2S A;  3H8W A;  5HR7 A;  4Y2V A;  5EE3 A;  4F5Q A;  3D6J A;  1NZP A;  5AIA A;  3V7J A;  4OCZ A;  2H3I A;  5F9L A;  4K4I A;  4Q43 A;  2VJ4 A;  3HP6 A;  4KLM A;  4JB3 A;  4KLO A;  2LHT A;  2G5H B;  3D2N A;  3TI0 A;  8ICA A;  4J9L A;  3QZ7 A;  1NKB A;  1IG6 A;  2EDU A;  1Z3E B;  4UB6 U;  5KFY A;  4BGD A;  1FFV A;  1UA0 A;  1FEZ A;  2W8K A;  1ZD3 A;  4UB3 A;  2R8G A;  3N28 A;  5F9N A;  1BPB A;  4YMM A;  4DSF A;  4I29 A;  1JRO A;  1QSS A;  1ED1 A;  2ASL A;  4DSE A;  5DBB A;  1Z1V A;  5AKK A;  3TFS A;  1ZQL A;  2DFL A;  2KKP A;  4F5R A;  3RFA A;  1TK5 A;  1D9D A;  5KFC A;  1ZQQ A;  4DS5 A;  5EE1 A;  8ICE A;  3T5J A;  4JMU A;  2JXJ A;  3KTQ A;  4LZG A;  2GOL A;  5ALY A;  2DGZ A;  4M9J A;  1MQ2 A;  3SEI A;  2G5I B;  5ALZ A;  2LYA A;  4QIW F;  2WTF A;  3UMG A;  3G6Y A;  3QUQ A;  2A1J B;  2DF4 B;  3TAD C;  5BOM A;  2LBO A;  2KJ9 A;  2JEF A;  3RBE A;  3RBD A;  2EZZ A;  4EBE A;  5AK6 A;  3V6H A;  2F8L A;  5ALL A;  1FFU A;  3E58 A;  3LDA A;  1WWU A;  4O3N A;  2HOI A;  1ZQU A;  4QZB A;  2AQ0 A;  4B9U A;  5K4L A;  1SKS A;  2XY7 A;  1SKR A;  4TUQ A;  4KLF A;  4O5K A;  1NZB A;  5AM5 A;  2WB1 C;  4QZ8 A;  4EEK A;  5IIJ A;  4CF3 A;  3KKA A;  4O3M A;  1Z4O A;  3F53 A;  2WF6 A;  3AQE A;  4Q44 A;  5AI6 A;  4O0I A;  4CDG A;  1RG6 A;  5ALQ A;  2Y0S F;  2K89 A;  4Q45 A;  4EBD A;  4MEX A;  3ZD9 A;  3ED5 A;  3QUC A;  9ICX A;  3N7R C;  2A1J A;  3C2L A;  3TAQ A;  4UB8 U;  3RH6 A;  4DQS A;  5J2D A;  1ZD4 A;  5HNK A;  1RZT A;  5KG6 A;  3M9M B;  1SKW A;  3HJE A;  1L5U A;  4I28 A;  5EE0 A;  4NLZ A;  2QB0 B;  4RQ6 A;  1D9F A;  3TAN A;  2VJ5 A;  9ICH A;  5KG3 A;  2G08 A;  1JXE A;  4UB2 A;  3T5K A;  5DQI A;  3SAH A;  5J0Q A;  1NK9 A;  4QIW C;  3DEE A;  7ICN A;  4KLE A;  1Q3V A;  2HBL A;  4UAV A;  5D46 A;  3QU2 A;  1A0P A;  4KX3 A;  3RJE A;  5KT5 A;  1SL1 A;  2ZIU B;  3FYH A;  5AM4 A;  2QAR A;  2OCE A;  2LI6 A;  5CR0 A;  2KZ3 A;  2JGA A;  4YG2 A;  4UB5 A;  3L4P A;  3SZ2 A;  9ICU A;  3MBY A;  2BQ3 A;  1COO A;  4P4O A;  4R8U A;  5C0Y A;  4M9G A;  4GIB A;  3C2K A;  3MDA A;  3HKZ C;  5L1K A;  2AXT U;  3AU6 A;  3H8S A;  4IRK A;  2QB0 A;  1L8L A;  5AKG A;  4K4G A;  4NL9 C;  4IC9 A;  4ED0 A;  1IV8 A;  3CW2 C;  1PK1 B;  3H0L B;  2K8A A;  2JEG A;  2E1F A;  3PSF A;  2J6S A;  3KD3 A;  3WKD A;  4RQM A;  3RR8 A;  3RJF A;  2BGW A;  4NJ8 A;  1IXR A;  3UXN A;  1S97 A;  2HI0 A;  2WHE A;  2ZIU A;  5B5E U;  1C20 A;  3NRW A;  9ICB A;  4ICA A;  4BWJ A;  5KFG A;  2KOB A;  2G09 A;  3L3F X;  2E8P A;  3WKB A;  4U7C A;  2HBM A;  3Q8L A;  1SWW A;  5AKX A;  5EOZ A;  5KFE A;  2WFA A;  4NV0 A;  4J9N A;  5ALK A;  2W7O A;  4F50 A;  1MA7 A;  1TK0 A;  3UMC A;  2CRX A;  2FLN A;  1KL9 A;  4F8R A;  7ICE A;  3D2Q A;  1JI7 A;  2UVW A;  1WYG A;  1Q8K A;  8ICQ A;  1PK1 A;  4PL2 A;  1ZJM A;  3NRZ A;  2RRD A;  3ISD A;  4QZ9 A;  2PKE A;  2K4P A;  4BWM A;  3WKA A;  4RQ8 A;  3GV8 B;  2AGQ A;  1T3Q A;  2XO7 A;  2C2E A;  2MSN A;  4P2H A;  2LPE A;  2MAX A;  8ICP A;  4X5V A;  3BQ0 A;  3H4B A;  2YMM A;  2LM1 A;  2DBY A;  2ZUB A;  4J9R A;  1DK3 A;  1COK A;  4RNM A;  4I2F A;  4P0P A;  4GFJ A;  1ZQ1 C;  4Y2S A;  1RPL A;  4RNO A;  1KFD A;  1KBU A;  3T5L A;  4B9S A;  2FLP A;  5III A;  2BZF A;  4FFD A;  1TVA A;  2R8K A;  4DOA A;  4WJ3 B;  4MEY A;  2JEJ A;  3LWL A;  5J2J A;  5KAF U;  8ICV A;  9ICI A;  2ZTD A;  2VKQ A;  3BQT A;  4KLJ A;  1O03 A;  1Z00 B;  3BZK A;  2PXI A;  2YY6 A;  3LVW A;  4UAZ A;  4FBU A;  3OSN A;  3EW9 A;  1JX4 A;  1U45 A;  1JIH A;  1L7M A;  4C0Z A;  2BPG A;  2NYV A;  3B0Y A;  3E2E A;  4B6J A;  2FDR A;  5KFR A;  3NGD A;  1WCN A;  1KN5 A;  3GZF A;  2ZUD A;  3I1Y A;  2GH1 A;  1ZET A;  1URJ A;  1N60 A;  3PR5 B;  3T5H A;  4I2G A;  9ICE A;  1ZQJ A;  1PVP A;  2YMQ A;  5KG2 A;  2DL0 A;  3H0R B;  5CHG A;  3ZDB A;  1X6I A;  5CRX A;  4B9N A;  3H40 A;  1HUO A;  5AKH A;  4Z6F A;  2KFZ A;  5KFI A;  1JAL A;  1SIJ A;  3C1Y A;  4I2D A;  5KFZ A;  3RB4 A;  3OJS A;  1Z00 A;  2WAQ C;  2P6U A;  2KZZ A;  4EZ6 A;  1L8O A;  3M7D A;  5AI0 A;  2UVR A;  4C8L A;  1L3T A;  3MR3 A;  5KFX A;  1RDF A;  2F8K A;  3MGH A;  4M47 A;  4FZM A;  4DFD A;  2XGP A;  2W54 A;  1SWV A;  3NVY A;  1UPH A;  2EH9 A;  3RJI A;  1ZQI A;  4YCX A;  5L1M A;  5KFH A;  5CWR A;  2ZIX B;  2HOQ A;  1FIQ A;  3EUB 2;  4RUC A;  4RUA A;  1DOQ A;  4XUS A;  4OJ6 A;  1SL2 A;  1MSW D;  5J0O A;  4C4R A;  3UXO A;  2KIC A;  3KHR A;  4KLI A;  3GIJ A;  3QUB A;  4O3P A;  5J0R A;  1U48 A;  3CNH A;  1YZ7 A;  2LYH A;  5TZV A;  5KG5 A;  1N63 A;  2OYY A;  5EE9 A;  1MQ3 A;  3HT3 A;  3E0F A;  4F5P A;  9ICV A;  1XO1 A;  3QEA Z;  1TAM A;  1HUZ A;  3RTV A;  4NXZ A;  2YX8 A;  3RB0 A;  1X9S A;  3QNM A;  4P4M A;  1S0O A;  5ALP A;  2NRW A;  3Q8R B;  3C2M A;  2ZIX A;  4KLS A;  3B0X A;  4DSL A;  1K5O A;  3IRU A;  1QSY A;  3WKE A;  3WK6 A;  3SAF A;  4DLE A;  4M9L A;  1SV0 A;  4JUZ A;  4I2H A;  1ZXI A;  1PUZ A;  4J9K A;  3H0M B;  1ZQD A;  4HYK A;  1NK8 A;  2KHQ A;  2FMP A;  4I2A A;  4OJL A;  4C4T A;  5J2G A;  3IHQ B;  1U9L A;  4DL3 A;  2F77 X;  9ICA A;  3V6K A;  1N56 A;  4KLG A;  4UB1 A;  4KN7 A;  2NO4 A;  4DL7 A;  4C4S A;  2BDP A;  2PFQ A;  4RPY A;  4O5E A;  4QZE A;  4YR0 A;  8ICT A;  4C80 A;  4ECU A;  2DPJ A;  3KHL A;  7ICU A;  1S9F A;  5AK3 A;  5JTI A;  4DSJ A;  3IDW A;  8ICC A;  4CCH A;  1BPD A;  4GC7 A;  1SB3 C;  4OJO A;  2GLE A;  2W3S A;  2V4Q A;  3LK9 A;  2VA8 A;  7ICI A;  5HR6 A;  2W43 A;  2DKX A;  3RH5 A;  1NI3 A;  3OHB A;  2MUT A;  1UA1 A;  9ICM A;  4IR9 A;  2KFN A;  4GC6 A;  3K1R B;  4NLB A;  4ECS A;  3H8M A;  3AM9 A;  2P6R A;  4ECX A;  2BCQ A;  9ICC A;  3QU7 A;  1EXN A;  1QQ7 A;  2ASJ A;  1XSN A;  3PSP A;  1RQN A;  1C7Y A;  3U26 A;  5EWG A;  3TKA A;  3I76 A;  3EZ5 A;  1ZQO A;  2WB1 F;  1OUQ A;  1TK8 A;  2DQN B;  2BKE A;  9ICT A;  1X42 A;  1A6S A;  5ALS A;  2HHT A;  1M6Y A;  1KEJ A;  2W04 A;  2YTU A;  5KFN A;  4NLG A;  2RDJ A;  3Q8P B;  5L1J A;  2K4I A;  5DG7 A;  4EYH B;  1NJZ A;  2Y9U A;  2C22 A;  2OEH A;  3RAX A;  5KFJ A;  4QW8 A;  2J6T A;  1LB2 B;  1ZQH A;  4YD1 A;  4B9M A;  4UBB A;  4KMO B;  3JPP A;  1Y88 A;  3OJU A;  3VCB A;  4FS2 A;  4DL2 A;  3ZDE A;  4F2S A;  2M0N A;  1TAU A;  2PMZ C;  7ICV A;  2KVC A;  2XCA A;  4QZG A;  1DGS A;  4ED1 A;  3ICX A;  2ZJ8 A;  2XVT A;  2KG5 A;  5J8Y A;  3MGI A;  7ICH A;  3LYS A;  2ZJ5 A;  3PO5 A;  4DFJ A;  1RXV A;  2ATL A;  4KLT A;  2KV2 A;  4I2E A;  3OTQ A;  5DB6 A;  5IIN A;  2HBK A;  1B4F A;  5ALF A;  2IBK A;  4LVS A;  3HKZ F;  9ICQ A;  1ZQS A;  3M9N B;  4IL6 U;  2JV3 A;  1PVQ A;  4A8E A;  3FC4 A;  5KL8 B;  3RRH A;  3B9J A;  2DUY A;  3MR5 A;  4OJ5 A;  1KKX A;  2HHS A;  3N4M B;  3PMN A;  1L3U A;  2AGP A;  5HML A;  3PR4 A;  2KNJ A;  2FMQ A;  3I28 A;  4US9 A;  1DGJ A;  3MGV A;  5J0S A;  2KJ8 A;  5AIC A;  1S0N A;  4AP9 A;  1Z1B A;  3MC1 A; 
#chains in the Genus database with same CATH homology
 3RF9 A;  2JH1 A;  3N7P D;  1Q3V A;  2HBL A;  2K4H A;  2ZIW A;  2G07 A;  2K8B B;  4JMU A;  4KX5 A;  3AQF A;  2ZIX A;  2W04 A;  2GOL A;  2RHF A;  3H0R B;  4ACO A;  1A0P A;  3C28 A;  2ZIV A;  4QNL A;  3T79 A;  4NLC A;  2DGZ A;  4KX3 A;  2KKV A;  1IIP A;  1SZH A;  2XIC A;  2Q4T A;  3SAF A;  4CRX A;  2ZIU B;  2G5I B;  5CRX A;  4BJQ A;  2K4I A;  2LYA A;  4QIW F;  2JGA A;  2KJ5 A;  2ZG6 A;  4P0Q B;  1HIW A;  4BX9 C;  3H0M B;  2DF4 B;  5KL1 B;  4AYB C;  2Y0S C;  4NWI A;  2OXO A;  2LBO A;  2JMG A;  2KJ9 A;  5C0Y A;  2KHQ A;  2WAQ C;  2ZIW B;  3SAG A;  2KIW A;  4OJL A;  2OH2 A;  1YT3 A;  2CPR A;  2XI9 A;  2HOF A;  2D6F C;  2KD1 A;  3HKZ C;  2F77 X;  2F8L A;  1DRG A;  4FZN A;  2JH7 A;  2OM6 A;  4FZL A;  3M7D A;  3F2C A;  4KMO B;  4QIW C;  3VCB A;  2HOI A;  4P0P A;  1Q3U A;  2BDU A;  2RP5 A;  2LYB A;  2ZXI A;  4GFJ A;  4IC9 A;  2E5S A;  3F2B A;  1ZQ1 C;  1T94 A;  3KFU F;  2M0N A;  2XID A;  1KBU A;  5A0L A;  4FZM A;  3PST A;  2PMZ C;  2KVC A;  1UPH A;  3ICX A;  3D2S A;  2HBJ A;  1NZB A;  3AL0 B;  5HR7 A;  3M6Z A;  1XO0 A;  2XVT A;  2ZXH A;  2E1E A;  2WB1 C;  3KZX A;  3IG5 A;  4CGZ A;  3H0L B;  3F5A A;  3VC8 A;  2K8A A;  1CRX A;  2H3I A;  3LYS A;  2VJ4 A;  2E1F A;  3ALR A;  3PSF A;  3C29 A;  4PL1 A;  4O3M A;  3F2D A;  3F53 A;  2ZIX B;  2LHT A;  2G5H B;  2KV2 A;  2HOQ A;  2K4E A;  3AQE A;  3D2N A;  3SMV A;  1HEK A;  2ZIV B;  4OJO A;  4WJ3 B;  3CP8 A;  4P0P B;  4OJ6 A;  2HMX A;  1GO3 F;  3O0F A;  2YB1 A;  3IP4 B;  3PSI A;  2LKY A;  3M6K A;  2ZIU A;  4CDG A;  1P7D A;  5HR6 A;  2G06 A;  2KIC A;  2HBK A;  2Y0S F;  4AYB F;  3NRW A;  2K89 A;  4BUG A;  4ICA A;  2JHD A;  2WAQ F;  3PZP A;  2KOB A;  4P0Q A;  2G09 A;  1XNS A;  2VKQ A;  2K8C B;  2W03 A;  2F2A B;  3HKZ F;  3L3F X;  3F5E A;  3N7R C;  4NLB A;  1F44 A;  5T14 A;  3ONN A;  2H3V A;  2F76 X;  2KEY A;  3SQI A;  4U7C A;  4U6P A;  3LVW A;  2G0A A;  1WUD A;  3CYM A;  2HBM A;  2OYY A;  3NUQ A;  3PSP A;  1ECW A;  2H3Q A;  2NV3 A;  3OPX A;  4A8E A;  2Z7J A;  1PVQ A;  4C0Z A;  1ED1 A;  2N1R A;  2YB4 A;  5KL8 B;  2PMZ F;  3E0F A;  4OJ5 A;  3GU3 A;  1Z19 A;  2VIX A;  4NV0 A;  2CN1 A;  2H3F A;  4FE3 A;  2WB1 F;  3IG8 A;  2VJ5 A;  4OO1 J;  4OJP A;  1TAM A;  2W7O A;  3IN5 A;  3GZF A;  3N7S C;  1OUQ A;  2G08 A;  1MA7 A;  2A3V A;  3CRX A;  2GH1 A;  2H3Z A;  2CRX A;  2DQN B;  1URJ A;  3LVV A;  2KNJ A;  2YX8 A;  1L6N A;  3K1Z A;  2KKP A;  2W7P A;  2MRL A;  3D2Q A;  1A6S A;  3RFA A;  2MA1 A;  3SAH A;  3MGV A;  1PVR A;  2KJ8 A;  2KHV A;  1D8B A;  4PL2 A;  4QJF B;  1PVP A;  2R18 A;  1Z1B A;  2RRD A;  3DEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...