1HEKA

Crystal structure of equine infectious anaemia virus matrix antigen (eiav ma)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
116
structure length
116
Chain Sequence
AMADIGSMGDPLTWSKALKKLEKVTVQGSQKLTTGNCNWALSLVDLFHDTNFVKEKDWQLRDVIPLLEDVTQTLSGQEREAFERTWWAISAVKMGLQINNVVDGKASFQLLRAKYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Equine Infectious Anemia Virus Matrix Protein.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN, CORE PROTEIN P15
total genus 30
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08723 Gag_p15 Gag protein p15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.90 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 1hekA00
1TAMA 2LYBA 4ICAA 2HMXA 1HEKA 1ECWA 2H3QA 1UPHA 4JMUA 2GOLA 2K4IA 2JMGA 2N1RA 1L6NA 2K4HA 1HIWA 2H3VA 1A6SA 2NV3A 2LYAA 1ED1A 2H3FA 2K4EA 4IC9A 2H3ZA 2H3IA
chains in the Genus database with same CATH superfamily
5JU5A 1TVAA 5AIBA 3RB0A 5AKZA 4DSEA 4UQGA 3TAPA 4HAIA 5HHHA 7ICSA 5A0LA 3NVYA 4GC7A 8ICFA 4EBEA 5J8YA 3CW2C 5AM1A 2QB0B 1S5LU 4ECXA 3GDXA 4PHAA 1SWWA 4RT2A 5DB7A 2ZTEA 5J2IA 3ZDDA 3WK8A 4QZGA 4NM2A 1C20A 1ZQZA 3L5KA 1XU4A 1F0MA 5DG7A 7ICPA 4Y2PA 2PI5A 4M0AA 1WWUA 2ASLA 4CE6A 3O0FA 2BQRA 1V85A 3N4MB 4RQMA 1UPHA 3HWTA 2NRXA 1COKA 2AQ0A 4UBBA 2B6GA 1V9PA 2L5YA 4IL6U 4KX5A 2V4RA 4J9QA 2DGZA 5J0TA 3RB3A 4C4TA 2BQ3A 3LVVA 3MR3A 3BQ1A 1X42A 3FM9A 1ECWA 4EX7A 5AK5A 5KFAA 1IV8A 1D8LA 3AQFA 1UHUA 4DO9A 3QEBZ 4NLNA 4C7ZA 1AQ6A 2MRLA 4O3NA 1S0OA 4YR2A 5IIMA 3F2CA 4QIWC 3OHBA 1ZXIA 1ZQKA 2KJ9A 4FBUA 5DQHA 2NRTA 1NNLA 5B5EU 3I28A 3T3FA 3KZIU 1L3SA 4C0ZA 4DCCA 4Q44A 3QEAZ 4E0DA 1Z19A 4DOAA 4RPZA 2UVWA 1NJWA 3TACB 4RNMA 4NLGA 5ALVA 3C2KA 2K60A 8ICPA 4ED8A 3C1ZA 1NZBA 4PZNA 2R8HA 4IRKA 5ALXA 1H38A 3V7KA 5DLFA 2WF7A 1QSLA 5CJ7A 2UVRA 2BQUA 1ZQCA 5J2CA 4ED7A 3V6JA 3AM9A 3WK6A 3TARA 2H3ZA 3ICXA 2FMQA 4B9NA 4O3SA 2F44A 3PR5B 2EZYA 5DG9A 3IG5A 4ZH4A 4BWMA 2DFLA 5EOZA 2BGWA 2A1JA 3RRGA 4ZOHC 4DQIA 4J9KA 1N61A 2LBOA 7ICGA 4IS7A 3PO4A 2V4QA 3OJSA 3HKZF 3PSFA 5KFDA 5KT4A 3PMNA 3RF9A 4ED3A 1MA7A 4IR9A 4O3PA 4YR0A 3BS7A 3HX0A 1SGGA 5KTQA 2EAMA 4Q8EA 2FJ6A 5IINA 1L7PA 3ZDEA 4BUGA 2VA8A 5J0XA 5DQIA 5HR6A 4ACOA 4J9NA 4FFDA 9ICVA 4ED6A 1QSYA 2AJQA 4K4IA 1VJ5A 4J9PA 4RPXA 4ECZA 1XNSA 1S77D 1IXRA 4F50A 1X40A 3ISBA 5E79U 1FEZA 2F8KA 2W8KA 4UB1A 3KKAA 2HHUA 2JRZA 3M8SA 2I5HA 2K4EA 4ECUA 3SR6A 4DL6A 3E58A 4EEKA 2BPCA 3S6JA 5BOLA 2PFQA 4B9TA 1FIQA 2C28A 5KFCA 3MR2A 3PW2A 5TISU 4BX9C 3F53A 4YP3A 1OUQA 5KFWA 3DDHA 5AKLA 9ICIA 1SV0C 1ZQBA 4MEXA 3SV4A 4CF3A 3UPQA 3PX0A 3MDAA 2WB1F 2ZIVA 5AKIA 2IMWP 2KHQA 2XIDA 2BPFA 2WTFA 1RQLA 2G0AA 3QNMA 4B9UA 2H3VA 2ZIUB 4DF4A 4KLGA 3GV7B 4R63A 3LYSA 1JXEA 3QU7A 5GTHU 5CEHA 5J29A 1YT3A 4YMNA 4KLQA 5KL8B 3VCBA 7ICMA 1N5WA 5AKJA 3M6KA 1XSLA 1U49A 4UB4A 2FPMA 3CP8A 5AI4A 4F92B 4J9RA 1ZQVA 3M6ZA 2HHSA 2G08A 5ALFA 3AEVA 4RQ4A 3QE9Y 2Q0ZX 1B43A 1K5OA 4DWIA 9ICEA 2FLLA 3SAHA 5ALGA 1ZJNA 1T8EA 1ZQHA 2G06A 2OWOA 4OJOA 1ZQIA 4JMUA 1QQ7A 2IOFK 4I28A 5J0QA 1ZQNA 2O6KA 4BGDA 1NKCA 1XC9A 2N1RA 4IRDA 3HPOA 3QU5A 1COOA 4LJXA 2ZIXA 1L7NA 5KFIA 4P2HA 4UARA 3IHQB 5AI9A 1K1QA 1SL2A 5J2AA 1PVRA 4QZDA 4I2FA 3JPSA 3RB4A 4KLSA 2KSOA 1ZQMA 5IIOA 4C8MA 2ZIUA 2CRXA 1WYGA 1D8YA 3IV6A 3THVA 5AM2A 1X6JA 4P0PA 5KFJA 2W11A 2PFNA 8ICRA 5L1JA 2ES6A 2K89A 4B9SA 2ASJA 4YR3A 4CDGA 2LM4A 1KRPA 2A1JB 2K4HA 1SZHA 4KLLA 4UAZA 3ZD9A 1S9FA 4C4RA 4UAYA 1JIHA 4QZAA 5EWEA 2KV2A 2W7OA 5KFPA 4OO1J 2GO7A 1L7OA 4ICAA 5IIIA 4YXMA 3NUQA 3BZKA 1JUDA 4QWDA 4OCZA 4F4ZA 4I2CA 9ICSA 1KFTA 2KJ5A 1KL9A 1RG6A 1TE2A 4O3RA 2KFNA 5ALPA 4PGYA 2HOQA 3N7PD 1T3QA 5KL1B 2IA6A 3AU2A 1BPDA 2BCQA 4EYHB 3JPRA 2CXYA 1BPEA 1SL1A 1SB3C 1S10A 1U4BA 2JGAA 2Z7JA 5HMMA 9ICHA 3SI8A 2ZIWA 4R66A 1TAQA 4F5NA 9ICXA 1MC8A 4PPXA 7ICEA 3SAFA 4RU9A 1Q3UA 4B9VA 9ICPA 2M0NA 2Y0SC 1Z4OA 1NK7A 3F2DA 2EANA 3H8JA 2XO7A 3AU6A 2MU2A 4F91B 1QQ6A 4QWBA 4M6WB 3PY8A 5J0RA 2F2AB 1NK4A 5EE9A 2OM6A 3A0HU 3TANA 1ZOLA 2XCAA 4KLEA 3H0MB 2H5XA 5DB8A 3C28A 3RFAA 4RZRA 4F4KA 4NV0A 3KBBA 8ICSA 2LYHA 4U6PA 5AKHA 2E8PA 5F3XB 2FPKA 2ZIWB 3NVWA 2R8GA 3UQ2A 4CGZA 1K1SA 2PKEA 1UA1A 4GC6A 4B6JA 2CPRA 2J6SA 4KITB 3KZXA 9ICGA 8ICXA 1Q46A 4DL7A 4UB3A 4KLIA 2KOBA 2RP5A 4LZDA 2HBMA 1SL0A 4M2YA 4XQ8A 4KTQA 1ZQPA 2UVVA 5KFVA 2MSNA 2EAOA 4RNOA 3MFHA 9ICUA 3Q8LA 3C1YA 4QWCA 1L3TA 3B0YA 3G6YA 1VLBA 7ICVA 1ZQUA 2KHVA 3QZ8A 4ECSA 3QYPA 3EPGA 2E8NA 2ZTDA 2EZXA 4P0PB 4F5PA 2ODGA 3EWAA 2DKZA 3C21A 3H4DA 1U48A 8ICAA 1KQQA 2XGPA 4GLXA 3EUB2 1ZRMA 1V97A 4GXIA 2DUYA 2AQ4A 1WCNA 3PO5A 4PL2A 5AI8A 2FLNA 5KG6A 4YCXA 2A1AA 4TUSA 8ICCA 1ZQOA 5DB6A 1SKWA 5CHGA 2W9BA 4US9A 4IQUA 3H8SA 4ECVA 2JZBA 3IG8A 3WKCA 9ICNA 5J8YC 4OJ5A 5FP0A 5CP2A 4JK1A 5EWGA 3UXNA 1S0VA 4Y2YA 2PI4A 3J81j 5HR7A 2E8OA 4GFJA 4YMOA 5KFYA 3ONNA 3BQTA 4RQ7A 2EAPA 1NI3A 4JB3A 3ZDCA 4P4PA 9ICWA 4TQRA 2VANA 5C0YA 2AGOA 4O3MA 4F4WA 3RAQA 3GV5B 3JPTA 3RH4A 2QKQA 4UW9A 3EZ5A 5KAFU 2ZXIA 2HCFA 3T5HA 2XY5A 3N97B 5BPCA 5K4LA 2YQEA 4DQRA 4MHVA 2BKEA 3JPPA 1KSPA 4FBTA 5J2FA 5IIKA 4DF8A 1T3NA 1QCKA 2Y1IA 1NJZA 1ZQYA 2F77X 5KT3A 3HP6A 5J0UA 4QZFA 3RRHA 4O0IA 1PVQA 5DB9A 3KFUF 2LYBA 3IDWA 3TADC 4IRCA 2M9NA 4IQWA 2ZJ5A 4RQ5A 1Q3VA 5J2DA 4EZ6A 2FMSA 4RQ1A 5ALHA 3MDCA 4MF8A 2WAQC 4QWEA 1RQNA 5ALYA 1N62A 1F5SA 4KLJA 2KD1A 2W9AA 2QARB 5AI0A 3C5GA 2YX8A 1SXEA 1B4FA 4AYBC 4PGXA 1L3UA 5ALTA 1ZQEA 1SIJA 1S97A 2W54A 4PGQA 4C8KA 3RJEA 1YZ7A 4O3QA 4PHPA 2ZIVB 7ICQA 2YMQA 5ALOA 4KLDA 4Q43A 1JX4A 3RJJA 2RQ5A 2YB4A 1ZD4A 2E1EA 3QUTA 9ICRA 2IHMA 3NASA 2BHNA 2W43A 2KFZA 2KKVA 4YD2A 1A77A 2AHOB 1Z1VA 4J9SA 1L8OA 2DL0A 3B0XA 2JEJA 1BPBA 2KE7A 1N63A 2EH9A 2R8JA 7ICUA 3C2MA 3M9NB 3KOOA 1HIWA 3ISCA 3Q8SB 4F5OA 1LB2B 2I1QA 2E1FA 3OTQA 5J0WA 1TAUA 5KFKA 3NS1A 5F9LA 4QW9A 5C5JA 4QZCA 2BCRA 3TFRA 2C22A 3D2SA 1M6YA 3GQCA 4EX6A 1CEZA 1N56A 4DL4A 4ECQA 2KKPA 3N28A 3KHGA 5KFXA 4F8RA 1KFDA 2EQYA 4MEYA 5ALSA 3TAQA 3WK4A 4FO6A 3H0LB 3TQ1A 5KFTA 1B22A 4EEYA 5J0PA 2K4PA 1LVHA 3RBEA 3B9JA 2IOHA 3HT3A 4DQSA 3PX6A 1X9MA 1N60A 1IM4A 3KHRA 3SQIA 1CI4A 4GIBA 1TK8A 4EZ9A 1X9SA 4PJ0U 1ZJMA 5KFZA 3DV9A 5G5GA 4F3OA 2HW3A 1Z3EB 3RH5A 4DLGA 2KZ3A 5ALNA 1KDHA 4F72A 1BNPA 1QH9A 9ICAA 2Y0SF 5DGBA 3FYHA 8ICNA 3K4GA 1L6NA 3AL0B 2ZUCA 5GTIU 4Y2TA 3QU4A 4TUPA 4Y2UA 5KG3A 4NLCA 2QB1A 4Z6DA 3R9KA 9ICCA 4U7CA 2VA2A 5HMLA 5AK4A 2C2DA 3H4BA 3C23A 3JPOA 5KFLA 2KN7A 1ZQRA 3M8RA 3HRDD 2LM1A 4NWIA 2BZFA 2KVSA 2G09A 4OJPA 3KTQA 2G07A 1Y88A 2BDUA 4O5KA 3ORYA 1SKRA 2K8BB 1N5XA 2HHXA 5J0OA 3MBYA 4ELUA 9ICOA 1WWVA 2KVCA 1XSPA 2ALZA 3NVZA 1IIPA 2GH1A 2KG5A 8ICWA 2DWQA 2FDRA 2P66A 9ICLA 1RYUA 4CF4A 5KT6A 3K75D 2RDJA 5CA7A 1FO4A 2HVIA 4M9HA 3UMCA 7ICFA 2HBKA 1XO1A 3BQ7A 2NRVA 3L4PA 4PH5A 1NK0A 3H8MA 5BOMA 1KKXA 5AKEA 2K8AA 2PMZC 1UA0A 2KIVA 2HOFA 2ZJAA 5KFOA 1UT5A 2KIWA 1L5UA 2ASDA 8ICQA 2YB1A 3D2NA 4C7YA 4KLUA 1FFVA 3K1ZA 4I2JA 1DGJA 2AGQA 3WKAA 2AGPA 1PK1A 2H3IA 5AM4A 2BCSA 1DOQA 3E0FA 2HMXA 4RQ3A 2IOFA 3FDSA 5J0SA 2JEFA 3GIKA 3WK9A 4KN7A 3MR5A 1MQ3A 3PSIA 4NM1A 4TURA 1QTMA 3PR4A 5H2FU 3WK5A 5KFBA 2FLPA 4K4GA 1J97A 2OH2A 4OD0A 4ECWA 5CB1A 4BDPA 4Y2JA 3BJYA 1TAMA 1CUKA 1WCLA 5KFGA 1XSNA 1HUZA 2KEYA 5J2JA 5EE1A 5D46A 4EELA 3UMBA 3U26A 1OXJA 3PMLA 2QB0A 2C2EA 2OCEA 4QIWF 5DDMA 5ALIA 2W3SA 2HHWA 3M9MB 2VJ4A 5AKYA 2GWSA 4LZGA 4DL5A 1KTQA 4FZMA 2KICA 3BQ2A 4DFDA 4G9BA 1JALA 4DS4A 4RQ0A 5AK6A 2A3VA 3Q8QB 1X6IA 5AI6A 4C80A 2OHFA 4F4YA 3IM1A 3QU2A 1LV5A 4ED1A 4ED2A 1XS9D 4DSJA 1GO3F 3C29A 3SAGA 3OSNA 1ZQ1C 1ZD3A 3V72A 2EDUA 2W3RA 3SYZA 7ICJA 2CN1A 4UB8U 2DKXA 3PSTA 4PHDA 4MFCA 2Y9UA 2KZMA 2XY7A 2BCUA 3H40A 1EXNA 5L1IA 4DQQA 2EZZA 4KMUA 1ZD2P 4I2BA 3RJKA 4QZ8A 1ZQQA 4PHEA 2P35A 4F2SA 4F71A 3AN1A 1V38A 2BR0A 1D9DA 1ZETA 1DXSA 2DBYA 5AICA 2UVUA 1PUZA 1TK5A 4QZHA 1VDVA 4EBCA 3MR6A 2RRDA 3SV3A 2A19A 8ICTA 8ICZA 4ELTA 3QXGA 8ICLA 3EYZA 4K4HA 5AIAA 1QLNA 2HDOA 4YXJA 2LKYA 1ZQAA 5AHXA 3PX4A 5ALQA 3MFIA 3ZDBA 4DSLA 5D4BA 3WKDA 4RQ6A 3C2LA 2XI9A 4KMOB 2G5IB 2KNJA 5ALEA 3T5JA 2OXOA 1OW5A 3RJFA 4MFAA 2BDPA 4G3IA 4ECYA 4CNQA 3WKEA 5AM5A 5KG7A 3F2BA 4JWNA 4F2RA 1RPLA 4J9LA 5KFQA 3ETRA 3PSPA 1KLNA 4UB6U 2ISOA 1RM6C 2JH1A 4M9GA 2Y9TA 2GLEA 2KMDA 3BQ0A 2W9CA 1TFRA 4C8NA 3Q8KA 1HJPA 3QU9A 4KX3A 2W04A 4YG2A 4M9JA 8ICMA 5DLGA 5AK3A 1ZD5A 4UAVA 3GIIA 4KLHA 2RHFA 1KW4A 2NV3A 3TI0A 3UXPA 3ZDAA 2E3TA 4O5EA 4YMMA 3KHHA 1NOMA 2BCVA 4ECTA 1NZPA 9ICFA 4P0QA 2E5SA 4I27A 3PW5A 3MGHA 2XC9A 1S0NA 4DFKA 5D49A 1T4GA 1MN8A 3NRZA 4UB2A 2ZTCA 3GIMA 3M9OB 1BPYA 1ED1A 2WF8A 8ICVA 4IC9A 4YD1A 2KJ8A 2OYYA 3Q8RB 7ICRA 4P4MA 1Z1BA 3IRUA 4UBCA 4ED0A 1UQVA 1X2IA 3PZPA 1T7PA 3BZCA 4FE3A 4QZ9A 5KG0A 2XVTA 4USAA 5KT2A 2WFAA 1L7MA 3KD3A 2MUTB 2HHTA 1A0PA 1Z4NA 4M6WA 5KG4A 5HHIA 3ISDA 4C4SA 1SV0A 4RQNA 1SZPA 2Y1JA 9ICBA 2ISPA 4P4OA 4AP9A 3NRWA 4RPYA 3N7SC 3SD7A 1L3VA 2KK0A 4TUQA 2F3NA 1SV4A 3H8WA 5CR0A 4TQSA 3RJIA 2ZXHA 1KBUA 4M9LA 2F76X 3TADA 1NJXA 3G6VA 2YTUA 3HKZC 1QSSA 1WUDA 3ALRA 4MF2A 4O5CA 4NLZA 1TKDA 9ICMA 3MC1A 2FE9A 3H7IA 2WF6A 2F1JA 3OHAA 3PW4A 2I6XA 5EE3A 3BDPA 2JEIA 4FZNA 5KAIU 2IBKA 5L1KA 1NK5A 4I2AA 2NRZA 3GILA 1X9XA 3PVXA 4NXZA 4HYKA 1O08A 4DEZA 5DBAA 4DL2A 1KFSA 3RAXA 1HEKA 4BWJA 1ZQSA 5KFFA 4O3OA 4IQVA 4QZIA 3QZ7A 3IN5A 4P0QB 2FPLA 1SWVA 5AI5A 4DOCA 5AM3A 5IILA 4QZEA 1SKSA 1ZRNA 2H3FA 8ICHA 5KFRA 3MGVA 4Y2VA 3EW9A 4FZLA 1ZQFA 2K8CB 5DBBA 4Y2XA 2NO5A 1BVSA 2XGQA 5KFNA 3HJEA 5KG2A 4DLEA 2GOLA 4M9NA 2PFOA 1JMSA 4QJFB 4NY8A 2W7PA 1X66A 3DEEA 3I76A 2JEGA 3ED5A 7ICHA 7ICLA 3V6KA 3T5KA 1J2NA 3QUCA 3MABA 3RBDA 2LPEA 4JV1A 1XO0A 4R8UB 2QARA 2H3QA 4JWMA 7ICIA 4FS2A 5AM0A 5KT7A 1ZQXA 8ICJA 2YMMA 1NK9A 2ZIXB 1KEJA 5ALZA 1WG8A 3OSPA 5J2GA 2W8LA 1JRPA 3N7RC 7ICNA 2HSZA 2F8LA 2HI0A 4EYIB 2J6UA 1B0XA 5DKWA 3HILA 1HUOA 4NLKA 3LWLA 7ICKA 1AROP 4RNNA 1PVPA 4NJ8A 3V6HA 5TZVA 3WK7A 1NKEA 4OJLA 8ICEA 3NVVA 5G5HA 4YVZA 2BPGA 4R64A 3HW8A 1PZNA 3SEIA 1Q8KA 5ALDA 4Q8FA 3LWMA 5J2EA 2D6FC 4F5RA 4M04A 5ALUA 1DK3A 2HHQA 4PZOA 5DDYA 5J2HA 2LI6A 3RH6A 5EWFA 4R8UA 2NYVA 4J9OA 1A76A 2VJ5A 4NL9C 2PXIA 1PK3A 3CRXA 4GXKA 4DS5A 5EE0A 4UAUA 3PW7A 4US8A 4XRHA 9ICKA 2WAQF 3FAHA 3G6XA 3AQEA 4M47A 4F93B 1X9WA 3SZ2A 9ICQA 5KG5A 8ICGA 4QNLA 3BS5B 1DK2A 4DFJA 1ZYQA 4KLOA 3NTUA 3TFSA 2LMRA 8ICUA 4O9MA 3RB6A 3AMZA 1DGSA 4MFFA 3WKBA 3GIJA 3BS5A 1S0MA 4I29A 3H0RB 3Q8MA 3JPQA 2JZBB 5KG1A 2P6UA 2JV3A 2E8MA 4Y2SA 5J2KA 3NGDA 2I9GA 3RR8A 4DL3A 1U45A 3GFKB 4DQPA 1BGXT 2NRWA 5HP4A 5T14A 3PW0A 3VC8A 5DQGA 5ALLA 4ECRA 2KZZA 8ICBA 3PNCA 4FS1A 4UASA 1YZ6A 2RDIA 2J6TA 2AXTU 5ALRA 1LKYB 5CWRA 3UXOA 1NK6A 1ZQDA 4BJQA 3F5AA 5DGAA 1BPXA 2YY6A 5F9NA 3L3FX 2JHDA 1T94A 3T5LA 2IHNA 2NO4A 3WU2U 1IG6A 4OJ6A 2FMPA 1D9FA 4YN4A 1Z00B 2LYAA 4C8OA 4X5VA 4J9MA 4I2DA 4Y2QA 3ETLA 1RDFA 3OPXA 3F5EA 4XA5A 2QLTA 3GZFA 4PL1A 1JI7A 4EBDA 4C8LA 2V9WA 5KFEA 1D8BA 3KKAC 1MSWD 1ZQGA 1TV9A 3UMGA 3V7JA 2D3DA 4B9MA 4WJ3B 9ICTA 2F1HA 3OJUA 3KHLA 2HOIA 2Q4TA 5AKXA 4RUAA 3AUOA 3CNHA 1L8LA 2W9BB 4QZBA 2VIXA 2JR5A 3V7LA 4YQWA 3M7DA 4Q45A 2YMPA 3CYMA 1F44A 5KFMA 4F4XA 1C7YA 8ICKA 5JRTA 2VA3A 2AH5A 1BPZA 4I2HA 4QW8A 4DOBA 4JV2A 1U9LA 4IQTA 3ZD8A 1ZQLA 5KFUA 2RLTA 3T79A 2KTQA 2MA1A 2B21A 2PFPA 3OGUA 2R8IA 3A0BU 5ALJA 1JXLA 2R8KA 2MAXA 1QQ5A 4ELVA 2MUTA 3D2QA 1XWLA 2ZUDA 1PK1B 2WHEA 4R65A 2XCPA 2HBJA 4YFKA 4Z6EA 2XY6A 1NK8A 4JV0A 5HNKA 4J03A 1ZQTA 4IR1A 4AYBF 2JH7A 2OEHA 7ICOA 8ICIA 4DFMA 1SXDA 5ALMA 4QWAA 4KLMA 5IIJA 4KLTA 1P7DA 1O03A 2ATLA 5JTIA 2DQNB 2LHTA 3LVWA 3RTVA 3FC4A 1N48A 2F1IA 2HHVA 3RJGA 3GV8B 1KN5A 3I1YA 2R18A 1S8OA 2W9MA 2K4IA 5KFSA 4UAWA 1NJYA 1ZQJA 3IP4B 5J0YA 1TK0A 4CF5A 7ICTA 3M1YA 2W03A 1RYRA 2W55A 2PMZF 3QX7A 4EENA 4DSIA 1JN3A 1Z00A 4Z6CA 1J2MA 2DPIA 2FI1A 4GXJA 9ICJA 1FFUA 5DG8A 4XUSA 5B66U 4RQ8A 2ZG6A 2DF4B 3RJHA 8ICYA 4RUCA 4UB5A 3SENA 2KSOB 4NLBA 2D8CA 4RT3A 1A6SA 5AKKA 2WF9A 2ZJ8A 3LDAA 1RXWA 2B0CA 3MGIA 2YN4A 4Z6FA 2ZUBA 1CRXA 5L1MA 5CRXA 4BXOA 5ALWA 1U47A 3TKAA 5J2BA 4F5QA 3C5FA 8ICOA 4KLFA 1S76D 4Y2RA 1NKBA 3ZI4A 4NL9A 5AKGA 2WB1C 1UT8A 4I2GA 1N2XA 4CRXA 1JROA 1RXVA 5KT5A 3SMVA 4RQ2A 3UQ0A 2HBLA 1UCVA 2G5HB 3E2EA 2W9CB 4I2IA 5DBCA 1LKYA 5ALKA 3RR7A 3D6JA 3UM9A 5L1LA 3LK9A 4UATA 4BXOB 4A8EA 4DSFA 1MQ2A 1DRGA 3QUQA 3EPIA 4I2EA 3JPNA 5L9XA 2DPJA 4JUZA 5KNIA 2XICA 2JXJA 4CCHA 2VKQA 4LVSA 1RYSA 5KFHA 5JUMA 4DSKA 2KP7A 3GU3A 4KN4A 2ESEA 2JMGA 1ZQWA 2AU0A 1URJA 4DFPA 1RZTA 1BNOA 2YMLA 3PV8A 4B9LA 3K1RB 2C2RA 3Q8PB 2WF5A 2HVHA 3QUBA 2P6RA
chains in the Genus database with same CATH topology
2G06A 3D2SA 2KJ9A 4FZMA 3T79A 1PVQA 2KICA 3KFUF 2LYBA 4OJOA 2MA1A 4P0PB 2H3QA 1IIPA 2JGAA 2Z7JA 4JMUA 2GH1A 1CRXA 3F2BA 5T14A 5CRXA 1Q3VA 2ZIWA 2A3VA 3VC8A 4C0ZA 2N1RA 1XNSA 2KKPA 5A0LA 1Z19A 3NRWA 3PSPA 2ZIXA 2ZIXB 3N7SC 3SAFA 2JH1A 1Q3UA 4PL2A 2M0NA 2Y0SC 3D2QA 3H0LB 2WAQC 3F2DA 2WB1C 2K4EA 2ZXHA 1KBUA 2HBKA 3N7RC 2F76X 5C0YA 2F8LA 1L6NA 4CRXA 2KD1A 2HBJA 1PVRA 1GO3F 4BJQA 3F5AA 2K8AA 2PMZC 3HKZC 3C29A 4AYBF 4KX3A 3SMVA 1WUDA 2JH7A 2W04A 3SAGA 2YX8A 3ALRA 3L3FX 1PVPA 1ZQ1C 4AYBC 2HOFA 2HBLA 2JHDA 1T94A 3IG8A 2CN1A 4OJLA 4BX9C 2KIWA 3PSTA 2F2AB 2G5HB 2ZIUA 4OJ5A 2OM6A 3F53A 1P7DA 2YB1A 3D2NA 4OJ6A 2CRXA 3SQIA 2DQNB 2RHFA 3H0MB 3K1ZA 2LHTA 2NV3A 4FZNA 4P0PA 1OUQA 2D6FC 3LVWA 2LYAA 2ZIVB 3C28A 3RFAA 5HR7A 2H3ZA 4NV0A 3ICXA 2H3IA 4ACOA 2K89A 3O0FA 4GFJA 3ONNA 2VJ5A 3OPXA 3F5EA 2R18A 3GZFA 3E0FA 4PL1A 2Y0SF 1HEKA 2HMXA 1NZBA 4U6PA 1UPHA 2WB1F 2ZIVA 4CDGA 3CRXA 2K4IA 2ZIWB 1D8BA 2YB4A 2E1EA 4P0QA 4A8EA 2K4HA 2E5SA 2KHQA 4CGZA 1SZHA 3IG5A 2XIDA 3PSIA 4KX5A 3IN5A 1DRGA 4O3MA 4P0QB 3AL0B 2G0AA 4WJ3B 3IP4B 2H3VA 2ZIUB 2KKVA 2DGZA 2WAQF 2HOIA 2CPRA 3AQEA 2Q4TA 3LYSA 2OH2A 2ZXIA 4NLCA 2KV2A 1ED1A 1YT3A 2XICA 3KZXA 2H3FA 3LVVA 4U7CA 4IC9A 2W03A 2LBOA 2W7OA 2KJ8A 2OYYA 2VKQA 2VIXA 3MGVA 5KL8B 1TAMA 2RRDA 3VCBA 1Z1BA 4FZLA 4OO1J 2PMZF 3HKZF 3M7DA 2K8CB 3PSFA 4QNLA 4ICAA 3M6KA 2KEYA 3PZPA 2KOBA 2RP5A 1ECWA 3CYMA 2HBMA 4FE3A 1F44A 2GOLA 3GU3A 3CP8A 3RF9A 1MA7A 3AQFA 3NUQA 2XVTA 2JMGA 1URJA 4NWIA 4QJFB 2G09A 4OJPA 2W7PA 2LKYA 2ZG6A 1HIWA 2DF4B 2G07A 2BDUA 2KJ5A 3DEEA 2E1FA 3M6ZA 2G08A 2MRLA 2K8BB 1A6SA 3H0RB 4QIWF 4BUGA 1A0PA 4NLBA 3F2CA 2XI9A 3SAHA 4KMOB 2G5IB 2F77X 2KNJA 2HOQA 2KVCA 2VJ4A 3N7PD 4QIWC 5HR6A 5KL1B 2OXOA 1XO0A 2KHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TAM A;  2LYB A;  4ICA A;  2HMX A;  1HEK A;  1ECW A;  2H3Q A;  1UPH A;  4JMU A;  2GOL A;  2K4I A;  2JMG A;  2N1R A;  1L6N A;  2K4H A;  1HIW A;  2H3V A;  1A6S A;  2NV3 A;  2LYA A;  1ED1 A;  2H3F A;  2K4E A;  4IC9 A;  2H3Z A;  2H3I A; 
#chains in the Genus database with same CATH topology
 5JU5 A;  1TVA A;  5AIB A;  3RB0 A;  5AKZ A;  4DSE A;  4UQG A;  3TAP A;  4HAI A;  5HHH A;  7ICS A;  5A0L A;  3NVY A;  4GC7 A;  8ICF A;  4EBE A;  5J8Y A;  3CW2 C;  5AM1 A;  2QB0 B;  1S5L U;  4ECX A;  3GDX A;  4PHA A;  1SWW A;  4RT2 A;  5DB7 A;  2ZTE A;  5J2I A;  3ZDD A;  3WK8 A;  4QZG A;  4NM2 A;  1C20 A;  1ZQZ A;  3L5K A;  1XU4 A;  1F0M A;  5DG7 A;  7ICP A;  4Y2P A;  2PI5 A;  4M0A A;  1WWU A;  2ASL A;  4CE6 A;  3O0F A;  2BQR A;  1V85 A;  3N4M B;  4RQM A;  1UPH A;  3HWT A;  2NRX A;  1COK A;  2AQ0 A;  4UBB A;  2B6G A;  1V9P A;  2L5Y A;  4IL6 U;  4KX5 A;  2V4R A;  4J9Q A;  2DGZ A;  5J0T A;  3RB3 A;  4C4T A;  2BQ3 A;  3LVV A;  3MR3 A;  3BQ1 A;  1X42 A;  3FM9 A;  1ECW A;  4EX7 A;  5AK5 A;  5KFA A;  1IV8 A;  1D8L A;  3AQF A;  1UHU A;  4DO9 A;  3QEB Z;  4NLN A;  4C7Z A;  1AQ6 A;  2MRL A;  4O3N A;  1S0O A;  4YR2 A;  5IIM A;  3F2C A;  4QIW C;  3OHB A;  1ZXI A;  1ZQK A;  2KJ9 A;  4FBU A;  5DQH A;  2NRT A;  1NNL A;  5B5E U;  3I28 A;  3T3F A;  3KZI U;  1L3S A;  4C0Z A;  4DCC A;  4Q44 A;  3QEA Z;  4E0D A;  1Z19 A;  4DOA A;  4RPZ A;  2UVW A;  1NJW A;  3TAC B;  4RNM A;  4NLG A;  5ALV A;  3C2K A;  2K60 A;  8ICP A;  4ED8 A;  3C1Z A;  1NZB A;  4PZN A;  2R8H A;  4IRK A;  5ALX A;  1H38 A;  3V7K A;  5DLF A;  2WF7 A;  1QSL A;  5CJ7 A;  2UVR A;  2BQU A;  1ZQC A;  5J2C A;  4ED7 A;  3V6J A;  3AM9 A;  3WK6 A;  3TAR A;  2H3Z A;  3ICX A;  2FMQ A;  4B9N A;  4O3S A;  2F44 A;  3PR5 B;  2EZY A;  5DG9 A;  3IG5 A;  4ZH4 A;  4BWM A;  2DFL A;  5EOZ A;  2BGW A;  2A1J A;  3RRG A;  4ZOH C;  4DQI A;  4J9K A;  1N61 A;  2LBO A;  7ICG A;  4IS7 A;  3PO4 A;  2V4Q A;  3OJS A;  3HKZ F;  3PSF A;  5KFD A;  5KT4 A;  3PMN A;  3RF9 A;  4ED3 A;  1MA7 A;  4IR9 A;  4O3P A;  4YR0 A;  3BS7 A;  3HX0 A;  1SGG A;  5KTQ A;  2EAM A;  4Q8E A;  2FJ6 A;  5IIN A;  1L7P A;  3ZDE A;  4BUG A;  2VA8 A;  5J0X A;  5DQI A;  5HR6 A;  4ACO A;  4J9N A;  4FFD A;  9ICV A;  4ED6 A;  1QSY A;  2AJQ A;  4K4I A;  1VJ5 A;  4J9P A;  4RPX A;  4ECZ A;  1XNS A;  1S77 D;  1IXR A;  4F50 A;  1X40 A;  3ISB A;  5E79 U;  1FEZ A;  2F8K A;  2W8K A;  4UB1 A;  3KKA A;  2HHU A;  2JRZ A;  3M8S A;  2I5H A;  2K4E A;  4ECU A;  3SR6 A;  4DL6 A;  3E58 A;  4EEK A;  2BPC A;  3S6J A;  5BOL A;  2PFQ A;  4B9T A;  1FIQ A;  2C28 A;  5KFC A;  3MR2 A;  3PW2 A;  5TIS U;  4BX9 C;  3F53 A;  4YP3 A;  1OUQ A;  5KFW A;  3DDH A;  5AKL A;  9ICI A;  1SV0 C;  1ZQB A;  4MEX A;  3SV4 A;  4CF3 A;  3UPQ A;  3PX0 A;  3MDA A;  2WB1 F;  2ZIV A;  5AKI A;  2IMW P;  2KHQ A;  2XID A;  2BPF A;  2WTF A;  1RQL A;  2G0A A;  3QNM A;  4B9U A;  2H3V A;  2ZIU B;  4DF4 A;  4KLG A;  3GV7 B;  4R63 A;  3LYS A;  1JXE A;  3QU7 A;  5GTH U;  5CEH A;  5J29 A;  1YT3 A;  4YMN A;  4KLQ A;  5KL8 B;  3VCB A;  7ICM A;  1N5W A;  5AKJ A;  3M6K A;  1XSL A;  1U49 A;  4UB4 A;  2FPM A;  3CP8 A;  5AI4 A;  4F92 B;  4J9R A;  1ZQV A;  3M6Z A;  2HHS A;  2G08 A;  5ALF A;  3AEV A;  4RQ4 A;  3QE9 Y;  2Q0Z X;  1B43 A;  1K5O A;  4DWI A;  9ICE A;  2FLL A;  3SAH A;  5ALG A;  1ZJN A;  1T8E A;  1ZQH A;  2G06 A;  2OWO A;  4OJO A;  1ZQI A;  4JMU A;  1QQ7 A;  2IOF K;  4I28 A;  5J0Q A;  1ZQN A;  2O6K A;  4BGD A;  1NKC A;  1XC9 A;  2N1R A;  4IRD A;  3HPO A;  3QU5 A;  1COO A;  4LJX A;  2ZIX A;  1L7N A;  5KFI A;  4P2H A;  4UAR A;  3IHQ B;  5AI9 A;  1K1Q A;  1SL2 A;  5J2A A;  1PVR A;  4QZD A;  4I2F A;  3JPS A;  3RB4 A;  4KLS A;  2KSO A;  1ZQM A;  5IIO A;  4C8M A;  2ZIU A;  2CRX A;  1WYG A;  1D8Y A;  3IV6 A;  3THV A;  5AM2 A;  1X6J A;  4P0P A;  5KFJ A;  2W11 A;  2PFN A;  8ICR A;  5L1J A;  2ES6 A;  2K89 A;  4B9S A;  2ASJ A;  4YR3 A;  4CDG A;  2LM4 A;  1KRP A;  2A1J B;  2K4H A;  1SZH A;  4KLL A;  4UAZ A;  3ZD9 A;  1S9F A;  4C4R A;  4UAY A;  1JIH A;  4QZA A;  5EWE A;  2KV2 A;  2W7O A;  5KFP A;  4OO1 J;  2GO7 A;  1L7O A;  4ICA A;  5III A;  4YXM A;  3NUQ A;  3BZK A;  1JUD A;  4QWD A;  4OCZ A;  4F4Z A;  4I2C A;  9ICS A;  1KFT A;  2KJ5 A;  1KL9 A;  1RG6 A;  1TE2 A;  4O3R A;  2KFN A;  5ALP A;  4PGY A;  2HOQ A;  3N7P D;  1T3Q A;  5KL1 B;  2IA6 A;  3AU2 A;  1BPD A;  2BCQ A;  4EYH B;  3JPR A;  2CXY A;  1BPE A;  1SL1 A;  1SB3 C;  1S10 A;  1U4B A;  2JGA A;  2Z7J A;  5HMM A;  9ICH A;  3SI8 A;  2ZIW A;  4R66 A;  1TAQ A;  4F5N A;  9ICX A;  1MC8 A;  4PPX A;  7ICE A;  3SAF A;  4RU9 A;  1Q3U A;  4B9V A;  9ICP A;  2M0N A;  2Y0S C;  1Z4O A;  1NK7 A;  3F2D A;  2EAN A;  3H8J A;  2XO7 A;  3AU6 A;  2MU2 A;  4F91 B;  1QQ6 A;  4QWB A;  4M6W B;  3PY8 A;  5J0R A;  2F2A B;  1NK4 A;  5EE9 A;  2OM6 A;  3A0H U;  3TAN A;  1ZOL A;  2XCA A;  4KLE A;  3H0M B;  2H5X A;  5DB8 A;  3C28 A;  3RFA A;  4RZR A;  4F4K A;  4NV0 A;  3KBB A;  8ICS A;  2LYH A;  4U6P A;  5AKH A;  2E8P A;  5F3X B;  2FPK A;  2ZIW B;  3NVW A;  2R8G A;  3UQ2 A;  4CGZ A;  1K1S A;  2PKE A;  1UA1 A;  4GC6 A;  4B6J A;  2CPR A;  2J6S A;  4KIT B;  3KZX A;  9ICG A;  8ICX A;  1Q46 A;  4DL7 A;  4UB3 A;  4KLI A;  2KOB A;  2RP5 A;  4LZD A;  2HBM A;  1SL0 A;  4M2Y A;  4XQ8 A;  4KTQ A;  1ZQP A;  2UVV A;  5KFV A;  2MSN A;  2EAO A;  4RNO A;  3MFH A;  9ICU A;  3Q8L A;  3C1Y A;  4QWC A;  1L3T A;  3B0Y A;  3G6Y A;  1VLB A;  7ICV A;  1ZQU A;  2KHV A;  3QZ8 A;  4ECS A;  3QYP A;  3EPG A;  2E8N A;  2ZTD A;  2EZX A;  4P0P B;  4F5P A;  2ODG A;  3EWA A;  2DKZ A;  3C21 A;  3H4D A;  1U48 A;  8ICA A;  1KQQ A;  2XGP A;  4GLX A;  3EUB 2;  1ZRM A;  1V97 A;  4GXI A;  2DUY A;  2AQ4 A;  1WCN A;  3PO5 A;  4PL2 A;  5AI8 A;  2FLN A;  5KG6 A;  4YCX A;  2A1A A;  4TUS A;  8ICC A;  1ZQO A;  5DB6 A;  1SKW A;  5CHG A;  2W9B A;  4US9 A;  4IQU A;  3H8S A;  4ECV A;  2JZB A;  3IG8 A;  3WKC A;  9ICN A;  5J8Y C;  4OJ5 A;  5FP0 A;  5CP2 A;  4JK1 A;  5EWG A;  3UXN A;  1S0V A;  4Y2Y A;  2PI4 A;  3J81 j;  5HR7 A;  2E8O A;  4GFJ A;  4YMO A;  5KFY A;  3ONN A;  3BQT A;  4RQ7 A;  2EAP A;  1NI3 A;  4JB3 A;  3ZDC A;  4P4P A;  9ICW A;  4TQR A;  2VAN A;  5C0Y A;  2AGO A;  4O3M A;  4F4W A;  3RAQ A;  3GV5 B;  3JPT A;  3RH4 A;  2QKQ A;  4UW9 A;  3EZ5 A;  5KAF U;  2ZXI A;  2HCF A;  3T5H A;  2XY5 A;  3N97 B;  5BPC A;  5K4L A;  2YQE A;  4DQR A;  4MHV A;  2BKE A;  3JPP A;  1KSP A;  4FBT A;  5J2F A;  5IIK A;  4DF8 A;  1T3N A;  1QCK A;  2Y1I A;  1NJZ A;  1ZQY A;  2F77 X;  5KT3 A;  3HP6 A;  5J0U A;  4QZF A;  3RRH A;  4O0I A;  1PVQ A;  5DB9 A;  3KFU F;  2LYB A;  3IDW A;  3TAD C;  4IRC A;  2M9N A;  4IQW A;  2ZJ5 A;  4RQ5 A;  1Q3V A;  5J2D A;  4EZ6 A;  2FMS A;  4RQ1 A;  5ALH A;  3MDC A;  4MF8 A;  2WAQ C;  4QWE A;  1RQN A;  5ALY A;  1N62 A;  1F5S A;  4KLJ A;  2KD1 A;  2W9A A;  2QAR B;  5AI0 A;  3C5G A;  2YX8 A;  1SXE A;  1B4F A;  4AYB C;  4PGX A;  1L3U A;  5ALT A;  1ZQE A;  1SIJ A;  1S97 A;  2W54 A;  4PGQ A;  4C8K A;  3RJE A;  1YZ7 A;  4O3Q A;  4PHP A;  2ZIV B;  7ICQ A;  2YMQ A;  5ALO A;  4KLD A;  4Q43 A;  1JX4 A;  3RJJ A;  2RQ5 A;  2YB4 A;  1ZD4 A;  2E1E A;  3QUT A;  9ICR A;  2IHM A;  3NAS A;  2BHN A;  2W43 A;  2KFZ A;  2KKV A;  4YD2 A;  1A77 A;  2AHO B;  1Z1V A;  4J9S A;  1L8O A;  2DL0 A;  3B0X A;  2JEJ A;  1BPB A;  2KE7 A;  1N63 A;  2EH9 A;  2R8J A;  7ICU A;  3C2M A;  3M9N B;  3KOO A;  1HIW A;  3ISC A;  3Q8S B;  4F5O A;  1LB2 B;  2I1Q A;  2E1F A;  3OTQ A;  5J0W A;  1TAU A;  5KFK A;  3NS1 A;  5F9L A;  4QW9 A;  5C5J A;  4QZC A;  2BCR A;  3TFR A;  2C22 A;  3D2S A;  1M6Y A;  3GQC A;  4EX6 A;  1CEZ A;  1N56 A;  4DL4 A;  4ECQ A;  2KKP A;  3N28 A;  3KHG A;  5KFX A;  4F8R A;  1KFD A;  2EQY A;  4MEY A;  5ALS A;  3TAQ A;  3WK4 A;  4FO6 A;  3H0L B;  3TQ1 A;  5KFT A;  1B22 A;  4EEY A;  5J0P A;  2K4P A;  1LVH A;  3RBE A;  3B9J A;  2IOH A;  3HT3 A;  4DQS A;  3PX6 A;  1X9M A;  1N60 A;  1IM4 A;  3KHR A;  3SQI A;  1CI4 A;  4GIB A;  1TK8 A;  4EZ9 A;  1X9S A;  4PJ0 U;  1ZJM A;  5KFZ A;  3DV9 A;  5G5G A;  4F3O A;  2HW3 A;  1Z3E B;  3RH5 A;  4DLG A;  2KZ3 A;  5ALN A;  1KDH A;  4F72 A;  1BNP A;  1QH9 A;  9ICA A;  2Y0S F;  5DGB A;  3FYH A;  8ICN A;  3K4G A;  1L6N A;  3AL0 B;  2ZUC A;  5GTI U;  4Y2T A;  3QU4 A;  4TUP A;  4Y2U A;  5KG3 A;  4NLC A;  2QB1 A;  4Z6D A;  3R9K A;  9ICC A;  4U7C A;  2VA2 A;  5HML A;  5AK4 A;  2C2D A;  3H4B A;  3C23 A;  3JPO A;  5KFL A;  2KN7 A;  1ZQR A;  3M8R A;  3HRD D;  2LM1 A;  4NWI A;  2BZF A;  2KVS A;  2G09 A;  4OJP A;  3KTQ A;  2G07 A;  1Y88 A;  2BDU A;  4O5K A;  3ORY A;  1SKR A;  2K8B B;  1N5X A;  2HHX A;  5J0O A;  3MBY A;  4ELU A;  9ICO A;  1WWV A;  2KVC A;  1XSP A;  2ALZ A;  3NVZ A;  1IIP A;  2GH1 A;  2KG5 A;  8ICW A;  2DWQ A;  2FDR A;  2P66 A;  9ICL A;  1RYU A;  4CF4 A;  5KT6 A;  3K75 D;  2RDJ A;  5CA7 A;  1FO4 A;  2HVI A;  4M9H A;  3UMC A;  7ICF A;  2HBK A;  1XO1 A;  3BQ7 A;  2NRV A;  3L4P A;  4PH5 A;  1NK0 A;  3H8M A;  5BOM A;  1KKX A;  5AKE A;  2K8A A;  2PMZ C;  1UA0 A;  2KIV A;  2HOF A;  2ZJA A;  5KFO A;  1UT5 A;  2KIW A;  1L5U A;  2ASD A;  8ICQ A;  2YB1 A;  3D2N A;  4C7Y A;  4KLU A;  1FFV A;  3K1Z A;  4I2J A;  1DGJ A;  2AGQ A;  3WKA A;  2AGP A;  1PK1 A;  2H3I A;  5AM4 A;  2BCS A;  1DOQ A;  3E0F A;  2HMX A;  4RQ3 A;  2IOF A;  3FDS A;  5J0S A;  2JEF A;  3GIK A;  3WK9 A;  4KN7 A;  3MR5 A;  1MQ3 A;  3PSI A;  4NM1 A;  4TUR A;  1QTM A;  3PR4 A;  5H2F U;  3WK5 A;  5KFB A;  2FLP A;  4K4G A;  1J97 A;  2OH2 A;  4OD0 A;  4ECW A;  5CB1 A;  4BDP A;  4Y2J A;  3BJY A;  1TAM A;  1CUK A;  1WCL A;  5KFG A;  1XSN A;  1HUZ A;  2KEY A;  5J2J A;  5EE1 A;  5D46 A;  4EEL A;  3UMB A;  3U26 A;  1OXJ A;  3PML A;  2QB0 A;  2C2E A;  2OCE A;  4QIW F;  5DDM A;  5ALI A;  2W3S A;  2HHW A;  3M9M B;  2VJ4 A;  5AKY A;  2GWS A;  4LZG A;  4DL5 A;  1KTQ A;  4FZM A;  2KIC A;  3BQ2 A;  4DFD A;  4G9B A;  1JAL A;  4DS4 A;  4RQ0 A;  5AK6 A;  2A3V A;  3Q8Q B;  1X6I A;  5AI6 A;  4C80 A;  2OHF A;  4F4Y A;  3IM1 A;  3QU2 A;  1LV5 A;  4ED1 A;  4ED2 A;  1XS9 D;  4DSJ A;  1GO3 F;  3C29 A;  3SAG A;  3OSN A;  1ZQ1 C;  1ZD3 A;  3V72 A;  2EDU A;  2W3R A;  3SYZ A;  7ICJ A;  2CN1 A;  4UB8 U;  2DKX A;  3PST A;  4PHD A;  4MFC A;  2Y9U A;  2KZM A;  2XY7 A;  2BCU A;  3H40 A;  1EXN A;  5L1I A;  4DQQ A;  2EZZ A;  4KMU A;  1ZD2 P;  4I2B A;  3RJK A;  4QZ8 A;  1ZQQ A;  4PHE A;  2P35 A;  4F2S A;  4F71 A;  3AN1 A;  1V38 A;  2BR0 A;  1D9D A;  1ZET A;  1DXS A;  2DBY A;  5AIC A;  2UVU A;  1PUZ A;  1TK5 A;  4QZH A;  1VDV A;  4EBC A;  3MR6 A;  2RRD A;  3SV3 A;  2A19 A;  8ICT A;  8ICZ A;  4ELT A;  3QXG A;  8ICL A;  3EYZ A;  4K4H A;  5AIA A;  1QLN A;  2HDO A;  4YXJ A;  2LKY A;  1ZQA A;  5AHX A;  3PX4 A;  5ALQ A;  3MFI A;  3ZDB A;  4DSL A;  5D4B A;  3WKD A;  4RQ6 A;  3C2L A;  2XI9 A;  4KMO B;  2G5I B;  2KNJ A;  5ALE A;  3T5J A;  2OXO A;  1OW5 A;  3RJF A;  4MFA A;  2BDP A;  4G3I A;  4ECY A;  4CNQ A;  3WKE A;  5AM5 A;  5KG7 A;  3F2B A;  4JWN A;  4F2R A;  1RPL A;  4J9L A;  5KFQ A;  3ETR A;  3PSP A;  1KLN A;  4UB6 U;  2ISO A;  1RM6 C;  2JH1 A;  4M9G A;  2Y9T A;  2GLE A;  2KMD A;  3BQ0 A;  2W9C A;  1TFR A;  4C8N A;  3Q8K A;  1HJP A;  3QU9 A;  4KX3 A;  2W04 A;  4YG2 A;  4M9J A;  8ICM A;  5DLG A;  5AK3 A;  1ZD5 A;  4UAV A;  3GII A;  4KLH A;  2RHF A;  1KW4 A;  2NV3 A;  3TI0 A;  3UXP A;  3ZDA A;  2E3T A;  4O5E A;  4YMM A;  3KHH A;  1NOM A;  2BCV A;  4ECT A;  1NZP A;  9ICF A;  4P0Q A;  2E5S A;  4I27 A;  3PW5 A;  3MGH A;  2XC9 A;  1S0N A;  4DFK A;  5D49 A;  1T4G A;  1MN8 A;  3NRZ A;  4UB2 A;  2ZTC A;  3GIM A;  3M9O B;  1BPY A;  1ED1 A;  2WF8 A;  8ICV A;  4IC9 A;  4YD1 A;  2KJ8 A;  2OYY A;  3Q8R B;  7ICR A;  4P4M A;  1Z1B A;  3IRU A;  4UBC A;  4ED0 A;  1UQV A;  1X2I A;  3PZP A;  1T7P A;  3BZC A;  4FE3 A;  4QZ9 A;  5KG0 A;  2XVT A;  4USA A;  5KT2 A;  2WFA A;  1L7M A;  3KD3 A;  2MUT B;  2HHT A;  1A0P A;  1Z4N A;  4M6W A;  5KG4 A;  5HHI A;  3ISD A;  4C4S A;  1SV0 A;  4RQN A;  1SZP A;  2Y1J A;  9ICB A;  2ISP A;  4P4O A;  4AP9 A;  3NRW A;  4RPY A;  3N7S C;  3SD7 A;  1L3V A;  2KK0 A;  4TUQ A;  2F3N A;  1SV4 A;  3H8W A;  5CR0 A;  4TQS A;  3RJI A;  2ZXH A;  1KBU A;  4M9L A;  2F76 X;  3TAD A;  1NJX A;  3G6V A;  2YTU A;  3HKZ C;  1QSS A;  1WUD A;  3ALR A;  4MF2 A;  4O5C A;  4NLZ A;  1TKD A;  9ICM A;  3MC1 A;  2FE9 A;  3H7I A;  2WF6 A;  2F1J A;  3OHA A;  3PW4 A;  2I6X A;  5EE3 A;  3BDP A;  2JEI A;  4FZN A;  5KAI U;  2IBK A;  5L1K A;  1NK5 A;  4I2A A;  2NRZ A;  3GIL A;  1X9X A;  3PVX A;  4NXZ A;  4HYK A;  1O08 A;  4DEZ A;  5DBA A;  4DL2 A;  1KFS A;  3RAX A;  1HEK A;  4BWJ A;  1ZQS A;  5KFF A;  4O3O A;  4IQV A;  4QZI A;  3QZ7 A;  3IN5 A;  4P0Q B;  2FPL A;  1SWV A;  5AI5 A;  4DOC A;  5AM3 A;  5IIL A;  4QZE A;  1SKS A;  1ZRN A;  2H3F A;  8ICH A;  5KFR A;  3MGV A;  4Y2V A;  3EW9 A;  4FZL A;  1ZQF A;  2K8C B;  5DBB A;  4Y2X A;  2NO5 A;  1BVS A;  2XGQ A;  5KFN A;  3HJE A;  5KG2 A;  4DLE A;  2GOL A;  4M9N A;  2PFO A;  1JMS A;  4QJF B;  4NY8 A;  2W7P A;  1X66 A;  3DEE A;  3I76 A;  2JEG A;  3ED5 A;  7ICH A;  7ICL A;  3V6K A;  3T5K A;  1J2N A;  3QUC A;  3MAB A;  3RBD A;  2LPE A;  4JV1 A;  1XO0 A;  4R8U B;  2QAR A;  2H3Q A;  4JWM A;  7ICI A;  4FS2 A;  5AM0 A;  5KT7 A;  1ZQX A;  8ICJ A;  2YMM A;  1NK9 A;  2ZIX B;  1KEJ A;  5ALZ A;  1WG8 A;  3OSP A;  5J2G A;  2W8L A;  1JRP A;  3N7R C;  7ICN A;  2HSZ A;  2F8L A;  2HI0 A;  4EYI B;  2J6U A;  1B0X A;  5DKW A;  3HIL A;  1HUO A;  4NLK A;  3LWL A;  7ICK A;  1ARO P;  4RNN A;  1PVP A;  4NJ8 A;  3V6H A;  5TZV A;  3WK7 A;  1NKE A;  4OJL A;  8ICE A;  3NVV A;  5G5H A;  4YVZ A;  2BPG A;  4R64 A;  3HW8 A;  1PZN A;  3SEI A;  1Q8K A;  5ALD A;  4Q8F A;  3LWM A;  5J2E A;  2D6F C;  4F5R A;  4M04 A;  5ALU A;  1DK3 A;  2HHQ A;  4PZO A;  5DDY A;  5J2H A;  2LI6 A;  3RH6 A;  5EWF A;  4R8U A;  2NYV A;  4J9O A;  1A76 A;  2VJ5 A;  4NL9 C;  2PXI A;  1PK3 A;  3CRX A;  4GXK A;  4DS5 A;  5EE0 A;  4UAU A;  3PW7 A;  4US8 A;  4XRH A;  9ICK A;  2WAQ F;  3FAH A;  3G6X A;  3AQE A;  4M47 A;  4F93 B;  1X9W A;  3SZ2 A;  9ICQ A;  5KG5 A;  8ICG A;  4QNL A;  3BS5 B;  1DK2 A;  4DFJ A;  1ZYQ A;  4KLO A;  3NTU A;  3TFS A;  2LMR A;  8ICU A;  4O9M A;  3RB6 A;  3AMZ A;  1DGS A;  4MFF A;  3WKB A;  3GIJ A;  3BS5 A;  1S0M A;  4I29 A;  3H0R B;  3Q8M A;  3JPQ A;  2JZB B;  5KG1 A;  2P6U A;  2JV3 A;  2E8M A;  4Y2S A;  5J2K A;  3NGD A;  2I9G A;  3RR8 A;  4DL3 A;  1U45 A;  3GFK B;  4DQP A;  1BGX T;  2NRW A;  5HP4 A;  5T14 A;  3PW0 A;  3VC8 A;  5DQG A;  5ALL A;  4ECR A;  2KZZ A;  8ICB A;  3PNC A;  4FS1 A;  4UAS A;  1YZ6 A;  2RDI A;  2J6T A;  2AXT U;  5ALR A;  1LKY B;  5CWR A;  3UXO A;  1NK6 A;  1ZQD A;  4BJQ A;  3F5A A;  5DGA A;  1BPX A;  2YY6 A;  5F9N A;  3L3F X;  2JHD A;  1T94 A;  3T5L A;  2IHN A;  2NO4 A;  3WU2 U;  1IG6 A;  4OJ6 A;  2FMP A;  1D9F A;  4YN4 A;  1Z00 B;  2LYA A;  4C8O A;  4X5V A;  4J9M A;  4I2D A;  4Y2Q A;  3ETL A;  1RDF A;  3OPX A;  3F5E A;  4XA5 A;  2QLT A;  3GZF A;  4PL1 A;  1JI7 A;  4EBD A;  4C8L A;  2V9W A;  5KFE A;  1D8B A;  3KKA C;  1MSW D;  1ZQG A;  1TV9 A;  3UMG A;  3V7J A;  2D3D A;  4B9M A;  4WJ3 B;  9ICT A;  2F1H A;  3OJU A;  3KHL A;  2HOI A;  2Q4T A;  5AKX A;  4RUA A;  3AUO A;  3CNH A;  1L8L A;  2W9B B;  4QZB A;  2VIX A;  2JR5 A;  3V7L A;  4YQW A;  3M7D A;  4Q45 A;  2YMP A;  3CYM A;  1F44 A;  5KFM A;  4F4X A;  1C7Y A;  8ICK A;  5JRT A;  2VA3 A;  2AH5 A;  1BPZ A;  4I2H A;  4QW8 A;  4DOB A;  4JV2 A;  1U9L A;  4IQT A;  3ZD8 A;  1ZQL A;  5KFU A;  2RLT A;  3T79 A;  2KTQ A;  2MA1 A;  2B21 A;  2PFP A;  3OGU A;  2R8I A;  3A0B U;  5ALJ A;  1JXL A;  2R8K A;  2MAX A;  1QQ5 A;  4ELV A;  2MUT A;  3D2Q A;  1XWL A;  2ZUD A;  1PK1 B;  2WHE A;  4R65 A;  2XCP A;  2HBJ A;  4YFK A;  4Z6E A;  2XY6 A;  1NK8 A;  4JV0 A;  5HNK A;  4J03 A;  1ZQT A;  4IR1 A;  4AYB F;  2JH7 A;  2OEH A;  7ICO A;  8ICI A;  4DFM A;  1SXD A;  5ALM A;  4QWA A;  4KLM A;  5IIJ A;  4KLT A;  1P7D A;  1O03 A;  2ATL A;  5JTI A;  2DQN B;  2LHT A;  3LVW A;  3RTV A;  3FC4 A;  1N48 A;  2F1I A;  2HHV A;  3RJG A;  3GV8 B;  1KN5 A;  3I1Y A;  2R18 A;  1S8O A;  2W9M A;  2K4I A;  5KFS A;  4UAW A;  1NJY A;  1ZQJ A;  3IP4 B;  5J0Y A;  1TK0 A;  4CF5 A;  7ICT A;  3M1Y A;  2W03 A;  1RYR A;  2W55 A;  2PMZ F;  3QX7 A;  4EEN A;  4DSI A;  1JN3 A;  1Z00 A;  4Z6C A;  1J2M A;  2DPI A;  2FI1 A;  4GXJ A;  9ICJ A;  1FFU A;  5DG8 A;  4XUS A;  5B66 U;  4RQ8 A;  2ZG6 A;  2DF4 B;  3RJH A;  8ICY A;  4RUC A;  4UB5 A;  3SEN A;  2KSO B;  4NLB A;  2D8C A;  4RT3 A;  1A6S A;  5AKK A;  2WF9 A;  2ZJ8 A;  3LDA A;  1RXW A;  2B0C A;  3MGI A;  2YN4 A;  4Z6F A;  2ZUB A;  1CRX A;  5L1M A;  5CRX A;  4BXO A;  5ALW A;  1U47 A;  3TKA A;  5J2B A;  4F5Q A;  3C5F A;  8ICO A;  4KLF A;  1S76 D;  4Y2R A;  1NKB A;  3ZI4 A;  4NL9 A;  5AKG A;  2WB1 C;  1UT8 A;  4I2G A;  1N2X A;  4CRX A;  1JRO A;  1RXV A;  5KT5 A;  3SMV A;  4RQ2 A;  3UQ0 A;  2HBL A;  1UCV A;  2G5H B;  3E2E A;  2W9C B;  4I2I A;  5DBC A;  1LKY A;  5ALK A;  3RR7 A;  3D6J A;  3UM9 A;  5L1L A;  3LK9 A;  4UAT A;  4BXO B;  4A8E A;  4DSF A;  1MQ2 A;  1DRG A;  3QUQ A;  3EPI A;  4I2E A;  3JPN A;  5L9X A;  2DPJ A;  4JUZ A;  5KNI A;  2XIC A;  2JXJ A;  4CCH A;  2VKQ A;  4LVS A;  1RYS A;  5KFH A;  5JUM A;  4DSK A;  2KP7 A;  3GU3 A;  4KN4 A;  2ESE A;  2JMG A;  1ZQW A;  2AU0 A;  1URJ A;  4DFP A;  1RZT A;  1BNO A;  2YML A;  3PV8 A;  4B9L A;  3K1R B;  2C2R A;  3Q8P B;  2WF5 A;  2HVH A;  3QUB A;  2P6R A; 
#chains in the Genus database with same CATH homology
 2G06 A;  3D2S A;  2KJ9 A;  4FZM A;  3T79 A;  1PVQ A;  2KIC A;  3KFU F;  2LYB A;  4OJO A;  2MA1 A;  4P0P B;  2H3Q A;  1IIP A;  2JGA A;  2Z7J A;  4JMU A;  2GH1 A;  1CRX A;  3F2B A;  5T14 A;  5CRX A;  1Q3V A;  2ZIW A;  2A3V A;  3VC8 A;  4C0Z A;  2N1R A;  1XNS A;  2KKP A;  5A0L A;  1Z19 A;  3NRW A;  3PSP A;  2ZIX A;  2ZIX B;  3N7S C;  3SAF A;  2JH1 A;  1Q3U A;  4PL2 A;  2M0N A;  2Y0S C;  3D2Q A;  3H0L B;  2WAQ C;  3F2D A;  2WB1 C;  2K4E A;  2ZXH A;  1KBU A;  2HBK A;  3N7R C;  2F76 X;  5C0Y A;  2F8L A;  1L6N A;  4CRX A;  2KD1 A;  2HBJ A;  1PVR A;  1GO3 F;  4BJQ A;  3F5A A;  2K8A A;  2PMZ C;  3HKZ C;  3C29 A;  4AYB F;  4KX3 A;  3SMV A;  1WUD A;  2JH7 A;  2W04 A;  3SAG A;  2YX8 A;  3ALR A;  3L3F X;  1PVP A;  1ZQ1 C;  4AYB C;  2HOF A;  2HBL A;  2JHD A;  1T94 A;  3IG8 A;  2CN1 A;  4OJL A;  4BX9 C;  2KIW A;  3PST A;  2F2A B;  2G5H B;  2ZIU A;  4OJ5 A;  2OM6 A;  3F53 A;  1P7D A;  2YB1 A;  3D2N A;  4OJ6 A;  2CRX A;  3SQI A;  2DQN B;  2RHF A;  3H0M B;  3K1Z A;  2LHT A;  2NV3 A;  4FZN A;  4P0P A;  1OUQ A;  2D6F C;  3LVW A;  2LYA A;  2ZIV B;  3C28 A;  3RFA A;  5HR7 A;  2H3Z A;  4NV0 A;  3ICX A;  2H3I A;  4ACO A;  2K89 A;  3O0F A;  4GFJ A;  3ONN A;  2VJ5 A;  3OPX A;  3F5E A;  2R18 A;  3GZF A;  3E0F A;  4PL1 A;  2Y0S F;  1HEK A;  2HMX A;  1NZB A;  4U6P A;  1UPH A;  2WB1 F;  2ZIV A;  4CDG A;  3CRX A;  2K4I A;  2ZIW B;  1D8B A;  2YB4 A;  2E1E A;  4P0Q A;  4A8E A;  2K4H A;  2E5S A;  2KHQ A;  4CGZ A;  1SZH A;  3IG5 A;  2XID A;  3PSI A;  4KX5 A;  3IN5 A;  1DRG A;  4O3M A;  4P0Q B;  3AL0 B;  2G0A A;  4WJ3 B;  3IP4 B;  2H3V A;  2ZIU B;  2KKV A;  2DGZ A;  2WAQ F;  2HOI A;  2CPR A;  3AQE A;  2Q4T A;  3LYS A;  2OH2 A;  2ZXI A;  4NLC A;  2KV2 A;  1ED1 A;  1YT3 A;  2XIC A;  3KZX A;  2H3F A;  3LVV A;  4U7C A;  4IC9 A;  2W03 A;  2LBO A;  2W7O A;  2KJ8 A;  2OYY A;  2VKQ A;  2VIX A;  3MGV A;  5KL8 B;  1TAM A;  2RRD A;  3VCB A;  1Z1B A;  4FZL A;  4OO1 J;  2PMZ F;  3HKZ F;  3M7D A;  2K8C B;  3PSF A;  4QNL A;  4ICA A;  3M6K A;  2KEY A;  3PZP A;  2KOB A;  2RP5 A;  1ECW A;  3CYM A;  2HBM A;  4FE3 A;  1F44 A;  2GOL A;  3GU3 A;  3CP8 A;  3RF9 A;  1MA7 A;  3AQF A;  3NUQ A;  2XVT A;  2JMG A;  1URJ A;  4NWI A;  4QJF B;  2G09 A;  4OJP A;  2W7P A;  2LKY A;  2ZG6 A;  1HIW A;  2DF4 B;  2G07 A;  2BDU A;  2KJ5 A;  3DEE A;  2E1F A;  3M6Z A;  2G08 A;  2MRL A;  2K8B B;  1A6S A;  3H0R B;  4QIW F;  4BUG A;  1A0P A;  4NLB A;  3F2C A;  2XI9 A;  3SAH A;  4KMO B;  2G5I B;  2F77 X;  2KNJ A;  2HOQ A;  2KVC A;  2VJ4 A;  3N7P D;  4QIW C;  5HR6 A;  5KL1 B;  2OXO A;  1XO0 A;  2KHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...