1HF0A

Crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
128
Chain Sequence
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords OCTAMER-BINDING TRANSCRIPTION FACTOR 1
total genus 43
structure length 128
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hf0A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1hf0A01
3TEDA 3HOUJ 3EUSA 1R9TJ 4IVZA 1IDYA 3HOZJ 2PUEA 2JCGA 4YARA 4DZJA 4JX5A 2VI6A 1JH9A 4YG7B 5IPAA 2O8KA 2CJJA 3A01A 4BBSJ 5IYDJ 5FKNA 3A01B 4G12A 2OFYA 2GBYA 2AWIA 3DCFA 5K7ZA 5EF6A 1IC8A 1JFSA 2DJNA 5IP6A 4C2MJ 4V2FA 1ETXA 5IOZA 1ORKA 2YU9J 1DWKA 3S15J 2Y30A 2HXIA 3FK7A 1ZQ3P 2WV1A 3PM1A 5DS9A 1R69A 3F6WA 4BXXJ 2XIUA 3JXBC 3GTJJ 2ELKA 1UMQA 4DYCA 4JQDA 1HF0A 1RKWA 1ZKGA 2AUWA 3S1NJ 4XK4A 3IH3A 2R0QC 1RKTA 4J1XA 2HQ5A 1JWLA 2IVQA 2VKEA 2E19A 5M5YJ 1AU7A 4I6TA 1VF9A 2LY9A 5IOYA 2XSDC 1MNMC 2L8NA 4X4DA 2L0KA 3BTIA 3ZOBA 5M3MJ 4YG1A 2Y9YA 2EZLA 1A6IA 4QSHA 2X48A 1GV2A 2XB0X 1POUA 4OB4A 4IHXA 1JKQC 2EH3A 2P81A 1JT6A 3HB9A 3QQ6A 2DA5A 2MGQA 2HYJA 1VNDA 1GVDA 2E1OA 3LNQA 2D5VA 1ZZBA 1AHDP 1YRNB 1ZZ6A 3JRHA 1RZRA 2KDZA 3BQZA 2XRLA 1SQ8A 5EG0B 2CUEA 4DZPA 3ZQLA 3S2DJ 1ZK8A 2IBDA 4FN3A 1UXCA 3BR3A 1W0TA 4A93J 3CQZJ 1X58A 3QF3A 3HBLA 4UUSA 1WPKA 5FLVA 1CQTA 4L5EA 4Z5CA 1ZR4A 3ZHIA 3HM5A 2LD5A 3S16J 2MEZA 4D7NA 3CLCA 2DA6A 4MCXA 2XJ3A 3GTOJ 3OSGA 1ITYA 4EEFG 3ZQGA 2NVTJ 4M3GA 3KJXA 4QTRA 3S1QJ 3JRGA 1D5YA 3S1MJ 5IYCJ 2BNOA 1IJWC 1POGA 1QPIA 3GN5A 4J19A 3UKGA 4A3EJ 2L49A 4MFEA 1RZRD 2XGCA 1NTCA 2JN6A 2M0CA 2LCVA 4JCXA 1MBHA 5F04A 4MFDA 3GTQJ 1T56A 4I76A 2HOSA 2LYPA 2HOTA 1UXDA 1ETVA 3PXPA 2KPJA 3MKLA 1APLC 4UUTA 1XG1A 4JCYA 5EZGA 2CSFA 4A3KJ 1U78A 2PUCA 1RZSA 1JJ8C 2AO9A 1U8BA 4M3EA 1X2LA 1QP0A 3JR9A 4X4CA 1LCDA 3GBFA 2EF8A 3NAUA 3QWGA 2PUBA 3LSRA 5IP9J 1WH6A 2PIJA 4GHJA 1R63A 5K98B 1ZVVA 1I3QJ 5IP7J 1ENHA 4S0HB 3S14J 3TP3A 1ZZ9A 1Y1VJ 4C3HJ 3ZQCA 5EGOA 3F52A 2LFBA 3QYXA 1DU0A 3G1MA 1Y1WJ 2NS7A 3C2BA 4JYKA 3LOCA 5E3NA 1L1MA 1SANA 1JJ6C 2HI3A 4UUSB 4IHYA 3F51A 1LMB3 2EWTA 4W97A 2KT0A 1LFBA 1PERL 4A3JJ 2IU7A 2HXOA 5EDNA 2IV1A 1WETA 1NEQA 5GP9A 3JRCA 1EFAA 4X4IA 2AXUA 2DMNA 3LSPA 2DA2A 2DTZA 1B8IA 3Q0VA 2Y9ZA 1PUFA 3G5GA 1OSLA 3Q0WA 2KZ8A 2KEKA 4X4HA 3PO2J 3JXCL 1BDIA 4XRSG 1LE8B 1TC3C 1LE8A 1HDDC 2R7ZJ 2DN0A 1QP7A 3GN5B 2LYJA 2EZHA 3QPLA 1QVUA 4A3LJ 3OIOA 4FTHA 2GZUA 2CROA 2VKVA 2M9HA 1O4XA 2JWTA 1ETQA 2XPWA 3HZIB 5F08A 4O8BA 2PUAA 5F0CA 3HOYJ 3OOUA 1ZAYA 3E7LA 1I50J 5GPAA 4X6AJ 1EF4A 1G2HA 3BTCA 2QF7A 5F0HA 3BQYA 5M3FJ 3OQNA 1JUPA 1IRZA 2X6OA 2XCJA 2NVYJ 2XPVA 2ECCA 2MQKA 1Y9QA 1H88C 2R1JL 1PRVA 1ETOA 2K9SA 2JA6J 4BY7J 2IVGA 2Y31A 2XI8A 3TP0A 4Z59A 5A7LA 5K7FA 1QVTA 3ZQFA 2DMQA 3TW7A 4DYQA 2GM4A 1MSFC 2WUSR 1YSEA 1MBFA 3KZ3A 1W0UA 5FKKA 2I10A 4DYRA 3OQMA 4XICA 2B63J 1UTXA 1QP4A 3I4NJ 3DNVB 1HDPA 3HKZN 2JA5J 2PUGA 1U9OA 1VPWA 2ICPA 3G1OA 1MH4A 2FQ4A 2ID6A 3RKQA 1VFCA 3BR2A 2IUOA 2DMTA 3CROL 1WH7A 3BTJA 2EQRA 3B7HA 3UFDA 2Y0SN 4PU7A 5FKMA 4A3FJ 3DEWA 1FJLA 3M3YJ 2NOGA 1HLVA 4IA8A 1MSEC 3OQOA 5FJ8J 4A3GJ 4BBRJ 1DW9A 1TWGJ 3HGGA 2H8RA 1RPEL 2PE5A 2VPRA 1H89C 2BJCA 4XRSA 2FX0A 3BG9A 1TWAJ 1JTYA 2EBYA 1B8IB 2L7FP 5E3MA 4CYCA 4B4CA 3H3VK 3GTKJ 4B1RA 3NARA 1ZS4A 1FIAA 2VUMJ 3O8HA 5EGOB 4D5FA 4FISA 3BDNA 3GTPJ 3HOXJ 3S17J 4MCTA 3Q3SA 3SJMA 1U9NA 2ZB9A 4V2GA 3BR6A 1ZZ7A 2AXVA 2HSGA 3VK0A 2GRLA 3OMTA 3SFIA 5F27A 2XB5A 1P7IA 2LTPA 2DA1A 2OR1L 4M3DA 2R5ZB 1QRYA 1LQCA 5E3LA 3ZQHA 4M6VA 1FIPA 2LYRA 3IVPA 3SCFA 4IHWA 2AW6A 5DTDA 2XGDA 2BNNA 2PMZN 1ETYA 4W1UA 3W6VA 5J3LA 2AHQA 1ZGWA 5C4XJ 4PU4C 4BKXA 3FYAA 1E3OC 2NS8A 2GLOA 2O4AA 3MVPA 2QCOA 2IVBA 2ICTA 1TWHJ 4A3BJ 1A5JA 2XPUA 3IV5A 1OJLA 1WCMJ 2DMUA 2IAIA 3JRDA 3GBGA 2ECBA 4M3BA 4RDUA 3FK6A 1MBJA 1JKRC 1XWRA 4NDWA 1DU6A 4AUXA 4IEJA 1UG2A 2L9RA 2R92J 1ZPQA 1HCRA 1Q1VA 1IGNA 2CUFA 1WI3A 1Z0XA 1RESA 2RAEA 4J1WA 4X4BA 3OP9A 1IDZA 3GTGJ 3ZHMA 3JXDL 4A69C 3O9XA 2KEJA 1OCPA 2JVLA 2L7MP 2L7ZA 4D7MA 3SCGA 1RR7A 2M34A 1BJZA 9ANTA 4FBIA 1GV5A 4MLOA 4Y52J 5C44J 3JRIA 2DA7A 1PRUA 4I6ZA 3MN2A 1H8AC 5FLMJ 2FJ1A 1JUSA 4CYCB 1JKOC 3IH2A 3O8GA 4QIWN 4Z58A 1F43A 2MW8A 2NVXJ 2WIUB 2YUSA 2R5ZA 3FYMA 2WAQN 2OPTA 3K2AA 4FCYA 1LCCA 4Y7NJ 3JRBA 1IV6A 4A3CJ 1K61A 1IUFA 2EBIA 2R63A 2W48A 1QQBA 5IYBJ 5M5WJ 4GFBA 2K9NA 2LP0A 3K7AJ 3JRFA 2CQQA 5M5XJ 3GTMJ 5FKOA 4I6UA 3SDGA 4X4GA 4IWRA 3BS3A 1B72B 2GRMA 1ZZCA 3FMYA 1PNRA 3VPRA 1WIZA 1P7JA 2O7OA 5C4JJ 4AYBN 2NVQJ 3LFPA 3A02A 2H1KA 3B6AA 3BR0A 2EZIA 3IH4A 4D5CA 3HOVJ 2LVSA 2WB1N 3BG5A 1I6HJ 3HEFA 4XRMA 1K83J 1UHSA 3A03A 5BNGA 2JA8J 2FJRA 4PU3C 1JKPC 2MSYA 1B0NA 5E3OA 3CCYA 1OCTC 3BR5A 2R5YA 1NK2P 3JRAA 2R5YB 3BG3A 3HDDA 1X2NA 1BL0A 2PPXA 3S1RJ 2JJ7A 5K7HA 3RQIA 1ZZ8A 1ETKA 2KEIA 4Y42A 3ZKCA 1JTXA 4AC0A 3CMYA 2LKXA 2CRGA 2DMPA 4DW6A 5F0FA 2LYSA 3CECA 4X4EA 4HNVA 3BR1A 5JLXA 1QPZA 3BD1A 2LR8A 2HOAA 4A3DJ 1LFUP 2CQXA 2R93J 3F0CA 2ME0A 1B72A 1WH8A 4GQMA 2TRTA 2LK2A 3SCHA 3FISA 1VI0A 4B3AA 3M4OJ 2O38A 2O49A 3LISA 1AKHA 1S7EA 4FE4A 1RPWA 1MBEA 2M8GX 5GPCA 3D1NI 2Y2ZA 2E2IJ 2JA7J 4PU8A 4MIMA 1QQAA 1JGGA 3QQAA 3H0GJ 3LSJA 1PUFB 3H5TA 1JUMA 1CJGA 2PUFA 3Q0UA 2K9QA 5J1YA 2B5AA 5HODA 3FIWA 1OFCX 5JLWA 2LYLA 2OF7A 2COBA 2N8GA 3PO3J 1RETA 3LSGA 2AXZA 2LYQA 3U3WA 3G1LA 1MBKA 3KXAA 4Z5HA 3MLFA 4I8TA 1GUUA 3FKIJ 3I4MJ 1MH3A 4BY1J 2HDDA 2ME6A 1GDTA 1SFOJ 2K40A 5EEAA 3TW6A 3JREA 4A3MJ 2M2EA 1ADRA 3BT9A 1PRAA 1IG7A 4IHVA 2JK3A 2BNMA 4JX4A 1T33A 2JMWA 3L1PA 2E2HJ 1ZUGA 4Z5DA 5FKLA 5EG0A 4M3FA 1FTTA 4I6RA 1XC5A 1ZTRA 4X1EA 3TRBA 3S8QA 1RIOA 1AKHB 4YG4A 4X4FA 4NDLA 1HOMA 1F36A 3HOWJ 4F8DA 3OSFA 2O9LA 5EZHA 4JX6A 1BW6A 3WHCA 2YS9A 3CDLA 1ZR2A 4FE7A 2IEKA 3S2HJ 1JT0A 2CU7A 3BTLA 4YBAA 4XIDA 2EZKA 2TCTA 3RZDJ 3QPSA 1XS9A 1JFTA 1BA5A 5J1UA 2DA4A 4JP0A 2LLKA 1MBGA 1ETWA 4ABZA 1BDHA 3HGYA 1BW5A 5J1RA 3G7DA 1TWFJ 2ID3A 1WH5A 1FEXA 2E2JJ 2PUDA 4MO7A 2HINA 2FD5A 1NERA 3ZQIA 4RBOA 1LLIA 1X2MA 3B6CA 1FTZA 2LYKA 2DA3A 3WHBA 1TWCJ 1WGXA 5F1JA 1GT0C 1YRNA 4LOCA 4C3IJ 2A6CA 3GTLJ 1Y7YA 2MG4A 1Z77A 1NK3P 5EYRA 2XGEA 3R1FA 2G0EA 4C3JJ 5C3EJ 4A3IJ 3RZOJ 3RZZA 2X9DA 1X57A
chains in the Genus database with same CATH superfamily
3ABMH 1R9TJ 1IDYA 3HOZJ 4G8XA 2PUEA 1MMNA 3IC7A 1UELB 1Q1HA 4E6KG 3A0HC 1L3LA 2JCGA 3BC8A 4KT5C 1RZ4A 5AIPA 5J8CA 2CJJA 3GZCA 3OYHA 2HYGD 2IPQX 2K86A 5A2QZ 5FKNA 1X1AA 3A01B 1SAUA 2PXKA 1X1DA 5LHGA 5IP6A 4V2FA 5IOZA 3SZPA 1GXPA 4QPOA 1T6SA 2HXIA 5ILUA 2XVCA 4HBLA 4RA2A 1U5TC 3HYIA 2IGNA 2XIUA 3GTJJ 3EYYA 4DYCA 4ER3A 5J8FA 2X51A 3QRFF 1HF0A 2EV6A 4MQVA 2HZDA 4Y4RA 4XK4A 2JPBA 2L5QA 1KU3A 3GZ6A 2HQ5A 5B66C 2ELJA 4XKBA 3DU5A 1HSJA 1VF9A 3FZVA 2WWYA 3X2QH 3FF5A 1MIJA 3HL2A 5KVRA 2LNBA 3KEYA 3S3NA 3BP8A 1MDMB 1PJRA 3GMEA 2X48A 2ZNZA 3VYRB 4OB4A 2BYVE 3OKZA 1JKQC 2ZO4A 2P81A 4EKGA 3HB9A 2X6WA 3QQ6A 4IX7A 2DA5A 4AIHA 1GVDA 1ZZBA 4EZIA 1FP2A 1YRNB 2F4MB 3ZCOA 3DTIA 2KIQA 1ZG1A 1YLFA 3EDPA 5EG0B 1G3WA 2CUEA 4M9ZA 3BCAA 4NC6A 1D3YA 1LEAA 4MTEA 3BY6A 1OCOH 3IL2A 5IT9Z 5K5QA 1KA8A 3HIFA 1W0TA 1ACIA 1OYYA 3CMAI 2LOOA 3K10A 2XAQA 2KISA 1PDNC 2KJCA 3H5AA 3PNTA 1WI9A 2Z9OA 1W7PA 3OL3A 3ZN0A 2Z99A 1I39A 4D7NA 3L2RA 2DA6A 2XF6A 2HFZA 2MEZA 2XJ3A 1ZREA 3GTOJ 3ECHA 1Z91A 4C2UA 1ZHFA 4GDFA 4KT6A 1D5YA 1R36A 1IJWC 5DUKA 1QPIA 4FX0A 1D8JA 2JN6A 2LCVA 1MBHA 3Q5FA 5DTMA 3GTQJ 4I76A 1X19A 2CS3A 2HOTA 2LYPA 1ETVA 3PXPA 2KPJA 3MKLA 2Y69H 3OIPA 4KITB 4UXNA 2HVQA 2H1LA 3CJRB 5E18F 4M3EA 1YFHA 2EA4A 2PUBA 1LVKA 2EF8A 3GBFA 3QWGA 3M7GA 4Q2JA 1R63A 3TBIA 1YTYA 3OYEA 2CUZA 3RCOA 3E6BA 4A5MA 4IO9F 4X0GA 4FASD 1S3JA 2MFZA 3ABTA 4UV9A 3CZ6A 3A2KA 3F52A 1LJ9A 1R5GA 1VQKI 3H36A 1J5YA 3I5UA 3OYFA 1Y1WJ 1BIBA 3ASOH 1L1MA 3IWFA 1JJ6C 4HLYA 4IHYA 2EFWA 3CUQA 2H09A 1IV8A 2EA2A 1R71A 3OYJA 3K4JA 2Z3YA 5TRDA 4FQGA 4YIRX 3T8TA 5ILVA 4ZYDA 1PERL 4KDPA 1KQ0A 3HXLA 2IV1A 2WY7Q 4U88A 4ER6A 1WETA 5KK1A 2DMNA 1ODDA 3Q0VA 2Y9ZA 1PUFA 1YS7A 3E6DA 4X4HA 1S6LA 1BDIA 4XRSG 2LMDA 4L5IA 3L7WA 4KIFA 2ZJRF 3F8BA 3HRTA 1HDDC 2R7ZJ 2DN0A 3DU6A 5LHHA 3V8LA 4DE8A 3BZKA 3GYHX 2LYJA 2UWMA 3QPLA 1QVUA 4I7HA 5HS8A 3G71I 1XSDA 2GZUA 2PXFA 5B3SH 1P4XA 2F4IA 4BS9A 1O57A 2VQGA 5D5UB 4HW0A 2HGCA 2L3DA 4EGYA 1O4XA 3DF8A 4P9UA 4OOIA 5F0CA 3OOUA 1T8IA 4KFCA 4XKCA 2P6TA 5GPAA 4X6AJ 4ZYGA 2UV1A 1O3QA 3I64A 3MFKA 1IRZA 1IN7A 5E8GA 3J81Z 3Q9SA 3BPVA 2J7WA 5LEJA 2V6CA 3SEQA 3DBRB 4BY7J 4YIFA 3W6JB 4Z59A 1X1CA 2J5PA 1MSFC 3HPGA 3OYDA 3KZ3A 1YW9A 4RGRA 1BIAA 2WAEA 5E79C 5DM6F 3K6GA 2PXQA 2Z33A 1HW2A 2B63J 2MLGA 1QO0D 2R7FA 4RGUA 1S7AA 2ZSIB 5EEHA 3SZGA 3HKZN 1XMXA 1BR2A 4OU0A 3RPUD 2V7FA 1P2FA 1JHFA 3G1OA 3ROUA 3LAPA 2IUOA 2XV4S 4A2UA 1OQYA 1FX7A 2Y0SN 4PU7A 1USTA 1KZHA 4A3FJ 3LSHA 4BAYA 2NOGA 2X6YA 1K7AA 2JQ7A 4A3GJ 1DW9A 1QZEA 3BPXA 4ZDOA 2R7QA 4J01A 2PE5A 1T98A 1B4AA 1U2ZA 2FRHA 3GZ5A 1B9NA 3R4KA 2QBYA 4XM3A 4D9JA 2QBYB 3BG9A 1TWAJ 1B8IB 1R22A 4CYCA 3H3VK 2EILH 3NARA 1FIAA 3PL8A 3SYTA 3WODF 4A0ZA 2VUMJ 4D5FA 1YQAA 2ZJPF 2EB7A 3S17J 3CCQI 4MCTA 2FNAA 2ZB9A 2VIXA 4HA8A 3LQXA 2GRLA 3OMTA 1IO2A 3SFIA 1DULA 5ED4A 3WTZA 2DA1A 5ICFA 4QPQA 2R5ZB 2CV0A 2XHKA 4K2EA 5E3LA 3ZQHA 3ASNH 3IHUA 5H20A 4XBFA 1ZGAA 2QWWA 1RR8C 4R79A 3SCFA 5DTDA 3AG4H 1R5ID 5GAHJ 3ZR8X 4IL6C 4ZH4F 2ZSHB 2K85A 2VKDA 2AHQA 4A6EA 4PU4C 2RC4A 3VWSA 2FUG2 2V3CC 2KRCA 2WA0A 3F23A 1IUYA 3FYAA 1LFPA 2NS8A 2O4AA 1AOYA 2QCOA 4NUBA 3LA3A 4A3BJ 4NBQA 1OJLA 2J5OA 1WCMJ 2Y0MA 3V8KA 2IAIA 3F6OA 2EIMH 2ECBA 3OR1C 3CJQB 2L2OA 3QP6A 3VFZA 3WU2C 1XWRA 1DU6A 4I0AA 4RM3A 1ZPQA 3DBLB 1DPUA 1Q1VA 1DGWY 2ZMEA 1HKSA 4OBMA 4J1WA 3C18A 3OP9A 4A6DA 3ZHMA 3K4NA 3JXDL 2BHZA 1WJDA 2PX9A 2XF7A 3BJAA 3VODA 4A69C 4E4HA 2JVHA 4DE9A 2OC6A 2JVLA 3O9XA 2DT7B 2IGKA 3I0TA 4D7MA 1EA3A 1TTYA 2IGOA 2M34A 2EV5A 1LDDA 4LG0B 4WXCA 4FBIA 3WTYC 4DBQA 3RPQA 4CYCB 4UV8A 3FDYA 3O8GA 4QIWN 3FWEA 4DOZA 2R7SA 4EM2A 2YUSA 3KZIC 2R5ZA 2HQAA 2WAQN 2V1NA 2AS5F 3K2AA 2Q8KA 3CO6C 3MCZA 4KN7X 4Y7NJ 1XCVA 2K4JA 2IA0A 1I6XA 2STTA 2R63A 3LSMA 5FLXK 2HVSA 3KP2A 3K7AJ 3JRFA 1USSA 3SDGA 3H0DA 3ZMDA 3ZGKA 3BS3A 2Z16A 4JQFA 2DI3A 3UWPA 5HDGA 1K6YA 2HPIA 2FSWA 3V7RA 3E0JB 2KIMA 3DLLF 3LFPA 3A02A 4CCNA 2LVSA 2WB1N 3KP7A 3HEFA 1EJ9A 3HSEA 3A03A 2FJRA 3L2CA 1DQUA 5E3OA 3CCYA 3BR5A 1E2XA 1DP7P 2R5YA 2OTJI 4KYWA 2R5YB 1YW7A 3S1RJ 1D1CA 3WTUC 5K7HA 4IOCF 2KJBA 4A0YA 2UUZA 2KEIA 5H2FC 4PGGA 3N4MA 2CRGA 1IF1A 4HNVA 3H3UA 1QPZA 2HOAA 2PXLA 2CQXA 2R93J 2DO7A 2ME0A 1B72A 4I02A 4GQMA 1J75A 4UB8C 4J00A 5TJJA 3IUOA 4OAZA 3FISA 1W7PD 1X3UA 2O49A 3UNGC 2HPMA 1OYIA 3K4KA 5CVVA 1MGTA 1RPWA 1AKHA 1U8RA 3LISA 1QQAA 4PU8A 3M1EA 4MIMA 1BC8C 4BQNA 3H5TA 1PUFB 1JUMA 3K4LA 4XRFA 4C30A 3M9LA 2HKOA 1FC3A 4GGGA 2OF7A 2X1EA 2DPDA 3CD6I 3LSGA 3PO3J 1EH6A 2LYQA 4ESBA 2JT1A 1MBKA 1ZAOA 2MA3A 3PNVA 1Z67A 4WCGA 3W6KB 1LDKB 1RNLA 4RAZA 5LLQA 4BY1J 3R09A 3MQ0A 3K1PA 2ME6A 1SFOJ 3FX3A 5K5OA 3JREA 5K5RA 4OIPF 1EKEA 3DPLC 2XAFA 3HHGA 4YIIA 1VQ8I 5FKLA 1X1PA 2EFQA 4M3FA 4ZC3A 5EG0A 4Y17A 5D4SA 2L9SA 3AL0C 4PK4A 5B5EC 3ULQB 5DUIA 4X4FA 2CFXA 4HX7A 1F36A 2R4GA 5BPIA 4EJTA 4GO1A 3C7JA 4JX6A 2B9SA 1T38A 4FE7A 2YX7A 1JT0A 4CHUA 2CU7A 3OY9A 4YBAA 5AONA 2ZMEC 3RZDJ 3DP7A 2WY8Q 4CCKA 1XS9A 2VODA 4L9VA 4DNCA 4ABZA 4L0ZB 2HFHA 1Y39A 1DUXC 1X1BA 1I1SA 5J1RA 3QOPA 2TDXA 3IAM2 1L0OC 2JZYA 5HNHA 2FD5A 1J0RA 1E3HA 3MWMA 3ZQIA 4RBOA 2DDAA 1TT0A 2CWEA 4IPAA 2M30A 4I01A 5F1JA 4LOCA 2GXBA 4U0VA 3CCVI 4C3IJ 3D5RC 3GTLJ 1Y7YA 4CZZA 2XGEA 1U5TA 5J4VA 1U5TB 4A3IJ 1XPXA 3BROA 2XRNA 2KP6A 3HOUJ 3EUSA 1XGSA 3WE3A 2VBWA 1FZPB 2VEOA 4JX5A 2FFHA 5IPAA 2O8KA 2CQNA 5F64A 1O3TA 3HTSB 4BBSJ 2DCEA 3LFUA 5J47A 3DCFA 1K78B 3N05A 1WJEA 2ADUA 3DKYA 3HRUA 2DJNA 4C2MJ 2GXAA 4UVAA 4BU2A 2OUMA 3S15J 1BN5A 3CDIA 1ZQ3P 3PM1A 2KHMA 3EUAA 3F6WA 5DSXA 1UMQA 4IRIA 2QKMB 5ICCA 4WK8F 2DYSH 2F5VA 1TP4A 1ZKGA 4CZCA 3OWQA 1RKTA 2MBFA 5DDGA 2BVLA 2RV8A 3PSFA 2E19A 1YIJI 2IVQA 4KJZA 1D8KA 2BY0A 5M5YJ 1AU7A 4ZYAA 2RQQA 3I53A 5IOYA 2L8NA 1MNMC 4X4DA 2DBBA 3A0BC 4YEJA 2L0KA 1SFKA 3BTIA 2CW7A 4YFKF 3TEPA 1S5LC 3OYGA 2XB0X 4CYDA 3BZ6A 1JT6A 4HEA2 3SFZA 3I71A 2ICWG 2Q0OA 4NHJA 2XAGA 4KA4A 1QZXA 1VQ4I 3S3MA 2JTVA 2PQ8A 4HSTA 2E5ZA 3HSFA 1UFMA 4NC7A 4DZPA 3S2DJ 1FNNA 2CSOA 4AIKA 4FN3A 1SMTA 3SEZA 1UXCA 3WE2A 2ZXHA 2QQ9A 2CGPA 2BE5F 3CQZJ 1MJBA 5H6RA 3HKZA 2Z1DA 1X58A 3RDIA 3KX2A 2ZJ2A 2DXIA 1S9HA 4Z5CA 1IW7F 3CP8A 1QU3A 3ZHIA 1Z1DA 3GO5A 4LD5A 4G6QA 1WVRA 2CYYA 2EPFA 2Y0SA 5TGTA 1QNTA 4F93B 2R7RA 1FOWA 3QF3A 4EEFG 2NVTJ 2ISYA 5FB2A 3JRGA 5IYCJ 1GHCA 2NYXA 2UXXA 3OYIA 3FXRA 3KIOA 1WJFA 1H0MA 2DOAA 1MMDA 4Z2YA 4MFDA 3GZNB 3CUQB 1IN6A 4TV7A 1SAXA 2HOSA 5D5XB 4L9JA 1ERDA 4UUTA 1XG1A 2DPUA 4JCYA 3H35A 5EZGA 4CCMA 2V1XA 3RJPA 2PUCA 2LREA 1U8BA 1QP0A 4B3XA 2GWRA 3JR9A 4C9YA 1S72I 3GVAA 1LCDA 3C1DA 2QYOA 1VQ7I 4ZYEA 4N4OB 1ZVVA 1K79A 5K98B 2K4BA 1I3QJ 5IP7J 2BBYA 5DCMB 1W7PB 3VOEA 4PFPA 3F8MA 1D0YA 4JK1X 1LKXA 3C2HA 1YI2I 3KEOA 1Y1VJ 3ZQCA 3DEEA 5EGOA 2BY1A 5L3CA 4YRVA 3QYXA 3O3KA 2O6GE 1Y8QB 2DYRH 3G1MA 4HZFA 3CCEI 3C2BA 4PJNA 3TO9A 4E7HA 1Y8RB 4E7KA 5J40A 4XLPF 1IN4A 1Y0UA 3F51A 1P4WA 2BVMA 4EJOA 1V54H 3L09A 2EWTA 4W97A 4L9TA 2VC1A 3ABKH 5IY5H 2BZTA 2E35A 3QP5A 2F5DA 2KDOA 2HDWA 4UB6C 3G4SI 4HF2A 2DJIA 4P5OA 5GP9A 3JRCA 4EK9A 1EFAA 2VQHA 2AXTC 2AXUA 3QOWA 3LSPA 2BXZA 3E5QA 2DA2A 3G5GA 3IRRA 3ZQ7A 2UXNA 1OSLA 1A36A 2KZ8A 2G9WA 3J7AY 3PO2J 3JXCL 1MJ9A 3PIOF 1LE8B 1TC3C 1LE8A 5CVIA 2QSHX 3NZLA 2EZHA 3CC2I 3AFHA 5JUWA 1ZYRF 3K1NA 2XXAA 3DPUA 4ZTFA 4MQ9F 3BCBA 2V9PA 3CJTB 1Z7UA 2M9HA 3R6SA 2GOMA 2XPWA 4RAYA 3QODA 3V4GA 3HOYJ 2NNYA 5DRTA 3GZDA 4ASNA 3H92A 2DK8A 3KYLA 3BTCA 3BQYA 3Q9VA 4IHSA 1R4MB 1D0ZA 2HQNA 2PXVA 2X6OA 4BE0A 2DU9A 1VQPI 4CA0A 1H88C 2M45A 2K9SA 1DP3A 4RS8A 4P1WA 4ZTJA 5A7LA 5K7FA 1XX5A 2DMQA 3TW7A 2WUSR 1YSEA 1MBFA 1UG0A 3MKYB 3SXYA 1TL8A 2LBFB 2I10A 3FHNA 3IAS2 4DYRA 3ZMZA 3QPHA 1IN8A 3F6VA 1QP4A 4JBAA 1HDPA 3TO7A 2PUGA 1U9OA 4RM2A 1HBXG 5A2QK 4IRGA 3RKQA 1VFCA 4NC8A 2E34A 2K9MA 2DMTA 4OWRB 3DQVC 1S29A 3B7HA 2PJRA 4QWQA 2OQGA 2IA1A 1R00A 2VBXA 2LF8A 3BJOA 4LLLA 4CICA 1LVAA 3DEWA 5BS6A 1KGSA 5BPDA 2QQBA 4BBRJ 1TWGJ 2VXZA 2VPRA 2P8TA 4RLQA 4GYIA 1K6OA 2ELHA 5BOXA 3FM3A 3K69A 4Q5SF 2A05A 2EBYA 4LIUA 5LRSA 5E3MA 4HG2A 4B4CA 3L2VA 3LFKA 3GTKJ 1OISA 3KZYA 2E1MC 5DRYA 2ZKZA 3W3CA 1KQ9A 4XSXF 3VK0A 1U9NA 1ZZ7A 3CO7C 2HSGA 2P5VA 4F3QA 2M3AA 3RQ4A 3KP4A 2OR1L 1P7IA 4M3DA 1FBUA 2LDUA 2X1CA 3DBHB 3I54A 4R1HA 4M6VA 1XGOA 1WWXA 2ZFUA 2LYRA 4YELA 1ZG5A 1BI2A 3HUGA 2AW6A 1G4DA 1ETYA 3HJEA 3AG3H 4XLEA 4GRIA 1SD7A 3CDHA 5H6QA 1FLIA 3CP2A 2OZ6A 2GOXB 1FPQA 2FMYA 3L00A 3MVPA 1TWHJ 5KHDA 1Y56A 5B1AH 1CF7B 1S7OA 2DMUA 3RIRA 3KETA 1XGMA 3FBIB 1MMAA 2JSPA 1JKRC 1X4PA 2I8DA 1UG2A 2R92J 1IGNA 4BXFA 1WI3A 1Z0XA 2E60A 2QZ8A 2RAEA 4X4BA 3GTGJ 3GCMA 1SFXA 3GUDA 2VOOA 3LSKA 2KEJA 1B9MA 2E5NA 4F92B 3L2QA 4WXDA 3KP5A 2L7ZA 1YJ9I 2XROA 1RR7A 4KIGA 2MC3A 1V55H 4BQAA 1F4KA 9ANTA 1OR7C 5C44J 3JRIA 3TMOA 3CF5F 6PAXA 1PRUA 4I6ZA 1Z6RA 1G3SA 2FJ1A 3M9AA 2Y48A 1JUSA 4U7DA 2BW3B 2WADA 3NDBB 2KRFA 2BY3A 2NVXJ 2WIUB 5HLIA 2PN6A 1AA7A 5L3GA 2FU4A 3FMQA 1LCCA 3ERMA 2HWVA 4OIRF 1SD4A 4A3CJ 2AQEA 4B8XA 3DWLE 2HNHA 4MNUA 5ILSA 4DIQA 3KZZA 5DD4A 5DTRA 3TKYA 2ZC2A 4I6UA 1KU7A 2LH9A 1G3YA 4A12A 3PQJA 2HS5A 4IWRA 5LEKA 1B72B 2VT3A 3RYPA 1ZZCA 3GZDC 3VPRA 4DGWB 2QENA 4N0BA 3CCUI 3F72A 1TNTA 3K4BA 5C4JJ 3HC7A 4AYBN 1U3EM 2E71A 4AM3A 2H1KA 2DLLA 1J9IA 3IH4A 4D5CA 3C2GA 4BACA 3M8FA 4XRMA 2BXYA 3AG1H 1D5VA 4H4KC 1J2XA 4PU3C 2PXTA 1GVJA 1JKPC 2IS4A 2R7VA 4CXFA 3W2AA 4RGXA 2UZKA 1NK2P 5DCMA 2R7OA 1FYMA 3BG3A 2L9VA 4RB0A 3TOAA 4HAMA 1BL0A 2PPXA 3HRSA 3L9FA 1VQ5I 2PBIA 2BHYA 1SD6A 1WJCA 2M0MA 2RREA 1CGPA 4XR6A 2ZJQF 3P5JA 1MNDA 3CMYA 1O7LA 2LKXA 1PVEA 5HNFA 3CECA 2LYSA 5F0FA 2PXEA 2JQEA 5DYMA 5B1BH 3ZMSA 3BD1A 1IRXA 1V3FA 2W57A 3J80K 2FOWA 1LFUP 1RUNA 1G59A 3F0CA 1WH8A 2TRTA 2A69F 4YG2F 4XMYA 2DAOA 2KIUA 1Z7LA 2O38A 3I56I 2JA7J 3D1NI 2LKPA 3TQNA 5CVRA 1JGGA 1UAAA 1HQ1A 4L0YB 3U1KA 2BW3A 3H0GJ 1DDNA 4XORA 4MCXA 4IF4A 4UHTA 2QSGX 3Q0UA 3WTSC 4XLFA 2PUFA 2H27A 2R7DA 1FWZA 4BDZA 3G1LA 3VB2A 4BJ5C 1FSHA 4OMZA 1ZRFA 2HDCA 1Z3YA 2HDDA 1HW5A 3JAMK 1ZELA 2K40A 4EJUA 3HTUA 4P96A 2ZMEB 2D1HA 4PJMA 1ADRA 2HR3A 2DFIA 4M74A 1STZA 2H8WA 1PRAA 4XLAA 1R1UA 4KMUX 2A5YB 1QZYA 1YX5A 3MZ8A 4PDKA 2E2HJ 3T0YA 4PCQA 3SHFA 3R61A 1FTTA 4I6RA 1YX3A 1ZTRA 1AKHB 3I4PA 2CW8A 4NDLA 2OAZA 1HOMA 5EZHA 2AQFA 5E17F 2HTSA 3CDLA 4NNJA 2RN7A 2IEKA 1NG6A 2L7KA 2VKHA 4RMNA 1X3ZB 2CQKA 2W85A 4LGWA 1Z6TA 2EZKA 4XIDA 1PP7U 3SDBA 2KL4A 3ZPLA 2DA4A 5J1UA 2M7AA 2LLKA 4Y3OA 4IJAA 1TWFJ 1T95A 2ID3A 4HV5A 5EJCA 3G73A 2VXDA 5KCMA 1ULYA 2HINA 5LHIA 2KMUA 5FO5A 1Y6IA 1LLIA 1FTZA 2LYKA 2MYSA 3U1DA 1YRNA 1I27A 3CCMI 1ONVA 2A6CA 2F6CA 2DQLA 1XDSA 1ZLKA 1Z77A 4ENKA 5EYRA 1NK3P 3R1FA 1HQCA 3PFIA 2VE9A 1XB4A 1HKTA 4WWCA 4HQMA 1X57A 5LBQA 3TEDA 4U7BA 3E5XA 4Y33A 4IVZA 3ECOA 5DCFA 1OCZH 4YARA 4HNTA 4II3A 1IZ1A 4ENMA 2P6SA 3IKVA 2VI6A 5D6EA 1KU9A 1MZBA 1ZLJA 3JTHA 3A01A 2OFYA 4MHGA 1BR4A 2XAJA 2AWIA 5K7ZA 1IC8A 1JFSA 1ETXA 2A6HF 3IP4B 4HF0A 5FLXZ 1DWKA 2Y30A 3T8RA 3K1MA 4Q4ZF 2VQCA 2WV1A 2I5UA 5ERIA 5JHFA 3OYLA 4BXXJ 3JXBC 4F7ZA 2JA2A 2NS0A 3FXMA 2O8XA 1BOBA 5DV5A 2GA1A 2ZBKA 3GFJA 1HC8A 1GLNA 2EV0A 3IH3A 4CH7A 4AD9A 4BJ6C 2DK5A 1SVOA 4EM0B 3KPHA 2LY9A 4HV6A 3FBNB 2D2WA 3CMEI 1WQ2A 2GIVA 4BUPA 5L3BA 3MEJA 2XAUA 5M3MJ 2XKPA 2Y9YA 4P9FA 2A6TA 2EZLA 4FX4A 1A6IA 4KN4X 4QSHA 2B0LA 3AAFA 1O3SA 1POUA 4OIQF 3IRQA 3TOBA 4AU7A 4QLCU 3V7SA 3JCUC 3WTVC 3OYKA 4ENJA 3DKXA 5GTHC 3DLAA 1VNDA 2E1OA 3E3VA 2YX4A 4ZZLA 4BEHA 2XRLA 3PFYA 2GAUA 2ESNA 4ON0A 2WAQA 3ZQLA 1WRJA 2IBDA 1D1AA 2VLAA 1RRJA 1T0FA 3DM5A 2PMHA 5L3DA 2QGUA 3P9CA 1G6NA 4A93J 3WTTC 4AIDA 2JSCA 3HBLA 5CVJA 2M4HA 2LBFA 2EJRA 1ZR4A 1HXDA 3BLYA 2NRAC 4ER5A 3S16J 3J80Z 5IT3A 2W00A 3LMMA 1ITYA 3HHHA 3ZQGA 1MJAA 1XSVA 4M3GA 4ZJZA 4QTRA 1RI7A 3S1QJ 4EGZA 4HDUA 3S1MJ 3VEPA 1POGA 3GN5A 2L49A 3UKGA 4ZZDA 2OV7A 4MFEA 1RZRD 1NTCA 1JHHA 1UHMA 1UXDA 3ERED 2RGVA 5JVGF 1APLC 1R7JA 1HW1A 1QPMA 1W5CC 3S8PA 2L02A 2QQ8A 1LUJB 1MDMA 3F22A 2FMLA 4G9YA 4OINF 2CSFA 5E1ZB 1RZSA 1JJ8C 2AO9A 2AXLA 3DEUA 4ZDLA 1X2LA 4CCJA 5GAGJ 4LB5A 2P0WA 3TFLA 4X4CA 4ER7A 1J59A 5IP9J 4R8HA 2E1CA 3ML6A 5EEGA 2HEOA 3OMYA 2M8EA 3GF2A 3TDUC 3LQQA 4EQZA 4M9SA 1YIOA 4LIVA 1I3AA 3S14J 1KYWA 3QAHA 3E6MA 3IWZA 2LFBA 1DU0A 1KYZA 3FKJA 2FNPA 5CKTA 1K4SA 2NS7A 1WZ2A 2A6EF 5E3NA 1ZGJA 3MZHA 4F55A 1HSTA 3A9YA 2VQLA 2K5CA 3RSNA 4GCVA 2D45A 1LEBA 3FXJA 2FXAA 3ME5A 2K7LA 4FETA 1VQ6I 3QYEA 3HUGB 1MKMA 2IU7A 5KAIC 5HLGA 4Q47A 4X4IA 1W36D 3J7YJ 4Z6YA 1BBYA 5L3EA 1XMAA 1B8IA 3KCCA 3F3XA 4MTDA 1REPC 1GXQA 4BDYA 3CMMA 2KEKA 1XN7A 1VQMI 5CLSA 1QP7A 3CF2A 2FQ3A 3GN5B 5LGNA 4A3LJ 1XTAA 3FXLA 5F1RA 2CROA 4UVBA 2EFPA 3F8FA 2PJRB 1HKQA 2HTJA 4ANJA 2EIKH 2W1OA 2H6BA 2GZWA 2KQRA 4NQWA 3U9GA 3L2UA 2JWTA 1ETQA 3HZIB 2PUAA 1YOVB 1ON1A 1ZAYA 2PI0A 3AKZA 1JI8A 3T1BA 1I50J 4RB2C 3W2VA 3HSRA 2QF7A 5F0HA 5M3FJ 3OQNA 1YJWI 3H5RA 2VL8A 2P5KA 1Y9QA 2MABA 1V4RA 1ETOA 4PJLA 2IVGA 2Y31A 5HDKA 2QVOA 3TP0A 2R7TA 1P92A 3RKWA 2GM4A 4DYQA 3F8CA 3C3WA 5CPRB 5FKKA 4XICA 1LB2A 1SFEA 2IVMA 2OJED 2IP2A 1KONA 3I4NJ 3DNVB 1TQPA 4XOTA 2WBMA 3V42A 3JAMZ 2RDPA 3GUUA 2JA5J 4IRHA 1A6QA 4IQJA 4LK1F 2YBDA 2FQ4A 2DFEA 3OOPA 1TW3A 1T39A 3BTJA 2EQRA 1QHGA 4MEXF 5HDNA 5FKMA 4BE1A 4UY8I 3E97A 5JR3A 3GLXA 3COAC 3ESWB 1FJLA 3M3YJ 3OQOA 1HLVA 3J7AO 1BJAA 1QQIA 1YW8A 3HGGA 1A04A 2V26A 2H8RA 1RPEL 4KNYA 2P4WA 3ZMUA 1R49A 3GLLA 2L01A 2JRTA 2FX0A 5DM7F 3H5NA 5FFXA 3CCSI 2L7FP 3D5SC 3TO6A 1TNSA 4B1RA 1FY7A 1BR1A 1SVLA 2OCEA 4BNCA 2NNNA 5EGOB 3BDNA 2V1DA 3EQLF 3ZRGA 3HOXJ 3KP3A 3Q3SA 3SJMA 3NRVA 4HRIA 2BOLA 3MEXA 3OYBA 2AXVA 4ESJA 5GAGi 2W24A 3TGNA 2XB5A 2LTPA 5AIQA 1WJ5A 3PIPF 2J7UA 1LQCA 3FXQA 2R3SA 3ZMVA 4KMFA 2XXQA 5FFZA 1FIPA 2JVGA 3WGIA 4PZJA 4CGZA 3IVPA 2XAHA 2CMPA 4BE2A 2PXBA 1UJ8A 2XGDA 1IXSB 2BNNA 1H9TA 2M4GA 2NXNB 5J3LA 2KLOA 4BKXA 4UUVA 3MD2A 3ZMTA 2IJLA 4O6JA 2X0LA 2GLOA 1IXCA 2W82A 4GXOA 4I0BA 4DQ2A 2IVBA 1A5JA 4HQEA 2XPUA 2VBYA 3IV5A 1U0JA 4HYEA 1WKMA 3ZXSA 2A5WA 2B7EA 4M3BA 4RAFA 3OIQA 1V5GA 1YJNI 2LSOA 1FSEA 4NDWA 1F1ZA 4HDVA 2FBHA 3WU0A 2K9LA 4N4NB 2CUFA 2RVCA 2E36A 1ZH5A 3HOTA 2IS2A 3OS2A 4LK0F 4BHCA 4OIOF 4IOAF 2OTLI 2L4MA 4RB3C 4D1QA 1GV5A 5HS7A 3KLNA 2H94A 3BDDA 4EATA 2A61A 4Y52J 4CDGA 2DA7A 1H8AC 5FLMJ 4L18B 4Z58A 3FMSA 2MW8A 2W7NA 2ZXJA 5DT2A 5J4YA 2PXDA 2OPTA 2ZCWA 3EUHA 4FCYA 1PUEE 3ZP5A 3JRBA 1IV6A 2RNGA 3RKXA 3H9GA 1IUFA 1A31A 2EBIA 1QQBA 4E7SA 2XDVA 2K9NA 2LP0A 2CQQA 4X4GA 4XNFA 2HQRA 2HKXA 3EYIA 5FRNA 2GRMA 1PNRA 2FBKA 2W25A 3FHZA 1WIZA 4C2TA 2LKSA 1X4OA 2LF7A 2OCCH 5ICGA 2NVQJ 2K3PA 1OR7A 2CUJA 3HOVJ 2EIJH 2CFOA 1YHQI 2QM3A 5BNGA 2RKHA 1B0NA 2RQPA 1R5HA 1OCTC 2XSJC 1HA8A 3CUOA 2DOFA 3VSKA 3JRAA 1N75A 1SVMA 2CW0F 2ACJA 3J81K 1X2NA 2BEOA 4N9IA 1XD7A 2JJ7A 3B02A 5D6FA 3RQIA 3JSOA 3VYTB 2VOPA 3REOA 3J7ZI 3ZKCA 1U2WA 1JTXA 2P7VB 4AC0A 2DMPA 4X4EA 4DW6A 1VQLI 3BG6A 5JLXA 2IS6A 4A3DJ 2FA5A 2HOEA 2M87A 4XLHA 1KU2A 4D0PA 2LK2A 2L4AA 2QEXI 3GEZA 4XONA 3M4OJ 1S7EA 4FE4A 3OWTA 2M8GX 5GPCA 1LPQA 1BM9A 1NG7A 3QU3A 1WFXA 1PP8F 1CJGA 3FXUA 4HX8A 1FT9A 2K9QA 5J1YA 3K70C 5HODA 3NROA 1OFCX 2OA4A 1OCCH 3PNYA 2MD0A 5JLWA 2LYLA 2X4HA 2COBA 2N8GA 2AXZA 1RETA 3U3WA 1R58A 3RTRA 2VJ4A 3R60A 4RGSA 3KXAA 4Z5HA 4I8TA 2PEXA 1Z9CA 3FKIJ 1GUUA 1IXRC 1LDJA 2IRFG 3K4MA 2FEZA 3VYUB 1GDTA 1U6GA 2LNMA 1TBXA 3WTXC 4I09A 5HS9A 5EEAA 2LRDA 2DDBA 2YSRA 3R0AA 4LFUA 3TW6A 4A3MJ 3LSIA 2M2EA 1IG7A 4HF1A 3A9ZA 2LLVA 2Z2SB 1T33A 2JMWA 4M73A 1FOYA 3QOEA 4Z5DA 1Y0NA 4KICA 1XC5A 2KIFA 4X1EA 3DV8A 3S8QA 1QA6A 3PJRA 2F5FA 2FOKA 4F8DA 3RPUA 3OSFA 2O9LA 2Q2EA 1BW6A 3GXOA 3ISPA 2ZXIA 3S32A 2XIGA 4IXAA 4CSWA 2W4SA 1WHUA 2X85A 5JI6A 5FGMA 2MH2A 4BL0B 2TCTA 3P7NA 1JFTA 1FBSA 5FD6A 1O3RA 1G3TA 4CCLA 1MBGA 3PQKA 1R4NB 3HGYA 1BDHA 3G7DA 3QFIA 1WH5A 4BH9A 1FEXA 1NERA 4G94A 1VQ9I 2QSFX 3B6CA 3MKZA 1KQ8A 2VJIA 4KUMA 3WHBA 1WGXA 4YFNF 4UNOA 1MMGA 3CLOA 2EINH 4LMYA 2FF4A 2ODRD 3OR2C 3EPZA 2X6XA 3KP6A 1X3WB 3A1YA 1N25A 4RAGA 2XUBA 3EUHC 2G0EA 4C3JJ 3RZOJ 2M5WA 3RZZA 2X9DA 3ABLH 4B09A 3F8NA 2XGXA 4IZZA 2XASA 4IQ4A 4A0XA 3QOXA 5E1XA 2IW5A 4DZJA 2M4KA 1T08B 1EH8A 5LRRA 4I2OA 1JH9A 4YG7B 1K4TA 1FYKA 1I1GA 4RB1A 5IYDJ 4G12A 3KL4A 2GBYA 4DJAA 5EF6A 3S93A 3HRMA 2VBZA 1JE8A 2YU9J 4PJJA 1ORKA 5FD5A 3VSLA 1DGRM 1SFUA 3FK7A 1YITI 4LB6B 2MC4A 4G7ZF 1R69A 5BQTA 5DS9A 1NHAA 2ZXWH 3M07A 2ELKA 1BI1A 1RIOH 2YPRA 4JQDA 1ZN2A 3HPHA 4LLGF 3ZQQA 1RKWA 5GTIC 5DEQA 1FMWA 3S1NJ 2AUWA 1P9QC 1FOXA 1QZZA 1Z21A 2OZUA 1OKRA 4HLXA 4S05A 2R0QC 3FXKA 4J1XA 1JWLA 5J6XA 1BI3A 2VKEA 1ON2A 1E3PA 4ITVA 2R7WA 4I6TA 3RKYA 2HU9A 4H0EA 2XSDC 1XDUA 4ETSA 1M1EB 4M72A 3LA7A 3ZOBA 4WX9A 4YG1A 4BHBA 3ONQA 2YR2A 4BQQA 2W84A 4II2A 1GV2A 3LAJA 3WG7H 1ZARA 4IHXA 2EH3A 1TLHB 3G6EI 3DTEA 2MGQA 3I58A 1DPRA 2HYJA 2XC7A 2V1UA 3LNQA 2D5VA 1RZRA 1AHDP 1ZZ6A 3JRHA 5GAEJ 2KDZA 3BQZA 1SQ8A 2QKLB 3F9KA 3NWTA 3H9JA 3A9XA 4PJ0C 1ZK8A 2KRHA 4NQWB 2V6EA 3HG9A 3BR3A 1TQMA 3F21A 3JTGA 1OYWA 1W5TA 3QWLA 4UUSA 1WPKA 1XCBA 1H9GA 4XKVA 1MD0A 4L5EA 1CQTA 5FLVA 3SR4A 4CO8A 2O61A 3HM5A 2LD5A 3CLCA 2F5EA 2JRMA 3CCRI 2FBIA 2DTRA 3TDZC 3OSGA 1JGSA 1J7KA 1QGPA 3QYBA 3KJXA 4JOMA 1E17A 2ETHA 2BNOA 4J19A 1TQIA 4A3EJ 2LC2A 2XGCA 1V5EA 3V7CA 2G7UA 2M0CA 4JCXA 5F04A 1UCRA 1T56A 2MH9A 1IAWA 5JFRA 1FOKA 2A3SA 2KKOA 5F6FA 3TELA 3CTAA 3WGHA 4BQOA 4IVNA 2O5RA 3QYFA 4A3KJ 1XSXA 1RUOA 1IN5A 1YYVA 4U87A 1U78A 3KFWX 2X1DA 4Y15A 2WB1A 3DPTA 4YFXF 4V19K 5LFAA 4DBRA 3KEQA 2DFFA 1N77A 2WTEA 4ZYHA 4E7JA 3NAUA 3LSRA 1WH6A 4AIJA 2PIJA 4GHJA 4LG3A 3N97A 3RI4A 1FP1D 2NVUB 2Q1ZB 1Z05A 3V8JA 1MMSA 2KZGA 1ENHA 3H3ZA 4S0HB 1IRGA 3GFMA 2MXDA 2PXPA 1PYVA 3TP3A 1ZZ9A 4G6DA 5E1WA 4AVPA 4C3HJ 3PE5A 3I55I 2ZFWA 3D5LA 4XLCA 4JYKA 3LOCA 5CVUA 2L9NA 1SANA 1T2KA 2E1NA 1TT5B 2HI3A 4UUSB 2DFHA 3VWBA 4KISA 2GXGA 4ESFA 4F91B 1P6RA 2IA2A 2OD5A 2CG4A 1LMB3 1SD5A 2IXSA 1TZLA 2KT0A 1LFBA 1UZCA 4EVIA 5LGTA 2HXOA 3E1SA 5EDNA 4A3JJ 5E20A 3I59B 4EV0A 1F5TA 1NEQA 1YG2A 3WU1B 2QQAA 4G7HF 4B48A 2K3FA 3LSTA 2DTZA 2CQ7A 3Q0WA 2M7BA 2BGCA 4M9XA 5HLTA 4M71A 2KFDA 2E1MB 2L54A 2V9KA 3CLQA 4LJZF 1QB2A 4F52A 3FMRA 3ELKA 4XN0A 2H6CA 3OIOA 4M6YA 4FTHA 1XMKA 1B6AA 3DFGA 2QUFA 2K27A 2VKVA 3BOQA 2C6YA 3CUQC 3EUKL 5F08A 1EH7A 3SQNA 4O8BA 3PSIA 3E7LA 3U21A 2HCNA 1W36C 4ENNA 1EF4A 2G7HA 2R7XA 1NW3A 2F2EA 1G2HA 1WJAA 2PMUA 3MKWB 1JUPA 1SMYF 4IKFA 2XCJA 2NVYJ 2XPVA 4A5NA 1B1BA 2ECCA 3W2WA 3OYMA 2KPMA 4CUGA 1PRVA 2MQKA 2R1JL 3ABUA 4NB5A 2JA6J 2XI8A 1W1WE 5HOOA 2PJPA 1QVTA 4ZDPA 3ZQFA 1BOAA 4UVCA 4XSZF 2HYFA 2ISZA 2A68F 2JUCA 1W0UA 3DKWA 3EETA 3OQMA 4GYGA 3K70D 1R1TA 1S8NA 3CC4I 1UTXA 1UHWA 5D8KB 2EFNA 4FT8A 2EFOA 3S3OA 1VPWA 2ICPA 3BJ6A 1MH4A 1R6RA 2ID6A 3CROL 3BR2A 4U0WA 1WH7A 4L9NA 5D5VB 3UFDA 1AWCA 3SX0A 3D0SA 2IGMA 2OU2A 2F4OB 3KYCB 2P7CB 3CCJI 4IA8A 1MSEC 5FJ8J 3PUBA 1ZRCA 4WVLA 2LG4A 1H89C 1R1VA 5DTQA 2O03A 4HNUA 1YS6A 4XRSA 1N78A 2BJCA 1OLTA 2CO5A 1JTYA 1WJBA 4I98B 2GA2A 5KAFC 1ZS4A 3OV8A 5KNLA 1V5FA 3O8HA 2QLZA 4FISA 2Z5UA 4B44A 3GTPJ 3RYRA 3NXHA 2Y75A 4V2GA 3BR6A 4S04A 4WF2A 4EJVA 2HVRA 4EMSA 1O7FA 3G3ZA 4E70A 5F27A 5D5WB 2P5LC 3JW4A 1QRYA 2O3FA 4BXUA 2VE8A 2L1PA 4AVZA 5BMZA 3KLOA 5HVQC 2NOJB 3GW2A 4HSRA 2CV1A 4IHWA 3SZTA 4LG0A 2PMZN 1WSUA 3QU6A 2M1BA 4W1UA 3W6VA 2O0YA 1ZGWA 5C4XJ 4E7ZA 4BHPA 2K02A 4CCOA 3MZYA 2XXPA 1E3OC 1VQNI 2ICTA 1G8XA 5CQGA 4XLNF 2VPLA 2JUGA 3DXJF 2V4JC 3VDXA 1CF7A 1IRFA 2PMZA 4O5VA 4M6XA 3I9V2 5ICEA 3GBGA 3JRDA 4B43A 1A35A 2VASA 2HZTA 2LY2A 2NAZA 4XOPA 3MMYB 4RDUA 1OMIA 3FK6A 1MBJA 3R0JA 5DD8A 4HOBA 4PGHA 4AUXA 4IEJA 4EM1A 2L9RA 1NH3A 1HCRA 5E8IA 2DQRA 1RESA 3LWFA 4HPQA 3B73A 1IDZA 2WV0A 3BWGA 2F48A 3QPTA 4PUSA 4LLNA 1OCPA 5K1YA 2L7MP 5FROA 3HZJA 1MNEA 2DW4A 5CYVA 3SCGA 3KYDB 1RC9A 1BJZA 5GADJ 2VC0A 4MLOA 1K78A 2IT0A 2LYCA 4E7LA 2ESHA 5LGUA 3MN2A 1OCRH 1JKOC 4XL9A 3IH2A 2VB6A 3GX4X 1W5SA 1VTNC 1F43A 1D0XA 3LQRA 3FYMA 5FRMA 3MAJA 4WXHA 4P55A 2VJ5A 1K61A 4LITA 3OS1A 2Q2EB 4PSXA 3T5XA 2W48A 5IYBJ 4BJTA 5M5WJ 4GFBA 1ZG3A 3H1CA 4EJWA 3GTMJ 3G2BA 5M5XJ 5FKOA 4N9HA 2FE3A 4EQQA 1SEUA 3HOSA 3FMYA 4AWXB 5GAHi 2DODA 3K0LA 1YO5C 3GFLA 1P7JA 2DOEA 2O7OA 2F5CA 2COMA 3M8EA 2DT5A 1P4AA 2V79A 3B6AA 3WGGA 3BR0A 2EZIA 1I6HJ 4ER0A 3L2WA 3BG5A 4Y13A 3K9TA 1K83J 1UHSA 3U2RA 3VYSB 2PG4A 2PFBA 4BGDA 2JA8J 3E6CC 3BZCA 2XKOA 4BYYA 1UB9A 2MSYA 3OS0A 2RNJA 2MLKA 2XF5A 1OPCA 4IHTA 5HLHA 2VN2A 1J09A 1LQ1A 4O3MA 3A4CA 3HDDA 3M1CA 3CCLI 3NQOA 5IT9K 1R23A 1ZZ8A 1ETKA 4EKIA 1QBJA 3E5UA 1ZRDA 2PLYA 1W4MA 4Y42A 3FM5A 3GFIA 4U0YA 3BR1A 4L5JA 2LR8A 2QA4I 2OQRA 4RLFA 3NEUA 3O6BB 1C0WA 2STWA 2D1VA 4MGRA 2MD5A 2VT2A 1BC7C 3ZN1A 3SCHA 4B3AA 1VI0A 3M8JA 2E7WA 3I59A 3WTWC 3PUFA 2EK5A 5CQEA 3ZPXA 1MBEA 2E2IJ 2Y2ZA 1BI0A 2JPCA 4XN3A 2BY2A 3QQAA 5TISC 3LSJA 5JVTA 3TL4X 3OYNA 3OL4A 2B5AA 1T0FC 2E7XA 3FIWA 4G7OF 4HRAA 1LNWA 1SC7A 4KIBA 2YU3A 3MLFA 5D8LB 3NWSA 2EWNA 3I4MJ 1MFQC 3DTKA 1MH3A 2GQQA 2KZVA 2BV6A 3IKTA 2ZNYA 2GIZA 3LL7A 3BT9A 4PSWA 4E7IA 1B59A 2JK3A 4XKWA 1VQOI 1D1BA 4IHVA 2BNMA 4JX4A 4FHTA 3AG2H 3G0TA 3L1PA 1ZUGA 3GWZA 4B47A 2A07F 1FMVA 1QHHD 4I99C 1FBQA 3WG9A 3TRBA 3UR3C 1E0EA 1RIOA 4XQFA 4YG4A 4PFOA 2V9VA 2WC2A 3HOWJ 3O2PE 1VZ0A 2HCSA 1TW2A 3WHCA 3CESA 2YS9A 1ZR2A 2CH0A 1JXSA 4G6TB 5D4RA 1XGNA 2WAFA 3OYCA 3S2HJ 2OBPA 3I3LA 3BTLA 4HX4A 4OMYA 1FYLA 3KE2A 3QPSA 3CC7I 1BA5A 3P9KA 3K2ZA 4JP0A 1ETWA 5JHUA 1BW5A 2LLWA 3JSPA 5LD2C 4MO7A 2E2JJ 2PUDA 5CJ9A 3H9QA 5L3FA 1X2MA 3OYAA 3K4CA 2DT6A 3LA2A 2CV2A 3AL0B 2DA3A 1GT0C 1TWCJ 2VJJA 1Z3XA 2IS1A 3FXOA 1MW7A 3S2WA 2VONA 1I5ZA 4Q48A 1YE9A 2R7UA 4OAYA 2MG4A 3CJNA 4AYBA 1EV7A 2PXUA 1F9NA 3BG7A 4MEYF 5C3EJ 2LY1A 4BEHB 3P9IA
chains in the Genus database with same CATH topology
3TEDA 3HOUJ 3EUSA 1R9TJ 4IVZA 1IDYA 3HOZJ 2PUEA 2JCGA 4YARA 4DZJA 4JX5A 2VI6A 1JH9A 4YG7B 5IPAA 2O8KA 2CJJA 3A01A 4BBSJ 5IYDJ 5FKNA 3A01B 4G12A 2OFYA 2GBYA 2AWIA 3DCFA 5K7ZA 5EF6A 1IC8A 1JFSA 2DJNA 5IP6A 4C2MJ 4V2FA 1ETXA 5IOZA 1ORKA 2YU9J 1DWKA 3S15J 2Y30A 2HXIA 3FK7A 1ZQ3P 2WV1A 3PM1A 5DS9A 1R69A 3F6WA 4BXXJ 2XIUA 3JXBC 3GTJJ 2ELKA 1UMQA 4DYCA 4JQDA 1HF0A 1RKWA 1ZKGA 2AUWA 3S1NJ 4XK4A 3IH3A 2R0QC 1RKTA 4J1XA 2HQ5A 1JWLA 2IVQA 2VKEA 2E19A 5M5YJ 1AU7A 4I6TA 1VF9A 2LY9A 5IOYA 2XSDC 1MNMC 2L8NA 4X4DA 2L0KA 3BTIA 3ZOBA 5M3MJ 4YG1A 2Y9YA 2EZLA 1A6IA 4QSHA 2X48A 1GV2A 2XB0X 1POUA 4OB4A 4IHXA 1JKQC 2EH3A 2P81A 1JT6A 3HB9A 3QQ6A 2DA5A 2MGQA 2HYJA 1VNDA 1GVDA 2E1OA 3LNQA 2D5VA 1ZZBA 1AHDP 1YRNB 1ZZ6A 3JRHA 1RZRA 2KDZA 3BQZA 2XRLA 1SQ8A 5EG0B 2CUEA 4DZPA 3ZQLA 3S2DJ 1ZK8A 2IBDA 4FN3A 1UXCA 3BR3A 1W0TA 4A93J 3CQZJ 1X58A 3QF3A 3HBLA 4UUSA 1WPKA 5FLVA 1CQTA 4L5EA 4Z5CA 1ZR4A 3ZHIA 3HM5A 2LD5A 3S16J 2MEZA 4D7NA 3CLCA 2DA6A 4MCXA 2XJ3A 3GTOJ 3OSGA 1ITYA 4EEFG 3ZQGA 2NVTJ 4M3GA 3KJXA 4QTRA 3S1QJ 3JRGA 1D5YA 3S1MJ 5IYCJ 2BNOA 1IJWC 1POGA 1QPIA 3GN5A 4J19A 3UKGA 4A3EJ 2L49A 4MFEA 1RZRD 2XGCA 1NTCA 2JN6A 2M0CA 2LCVA 4JCXA 1MBHA 5F04A 4MFDA 3GTQJ 1T56A 4I76A 2HOSA 2LYPA 2HOTA 1UXDA 1ETVA 3PXPA 2KPJA 3MKLA 1APLC 4UUTA 1XG1A 4JCYA 5EZGA 2CSFA 4A3KJ 1U78A 2PUCA 1RZSA 1JJ8C 2AO9A 1U8BA 4M3EA 1X2LA 1QP0A 3JR9A 4X4CA 1LCDA 3GBFA 2EF8A 3NAUA 3QWGA 2PUBA 3LSRA 5IP9J 1WH6A 2PIJA 4GHJA 1R63A 5K98B 1ZVVA 1I3QJ 5IP7J 1ENHA 4S0HB 3S14J 3TP3A 1ZZ9A 1Y1VJ 4C3HJ 3ZQCA 5EGOA 3F52A 2LFBA 3QYXA 1DU0A 3G1MA 1Y1WJ 2NS7A 3C2BA 4JYKA 3LOCA 5E3NA 1L1MA 1SANA 1JJ6C 2HI3A 4UUSB 4IHYA 3F51A 1LMB3 2EWTA 4W97A 2KT0A 1LFBA 1PERL 4A3JJ 2IU7A 2HXOA 5EDNA 2IV1A 1WETA 1NEQA 5GP9A 3JRCA 1EFAA 4X4IA 2AXUA 2DMNA 3LSPA 2DA2A 2DTZA 1B8IA 3Q0VA 2Y9ZA 1PUFA 3G5GA 1OSLA 3Q0WA 2KZ8A 2KEKA 4X4HA 3PO2J 3JXCL 1BDIA 4XRSG 1LE8B 1TC3C 1LE8A 1HDDC 2R7ZJ 2DN0A 1QP7A 3GN5B 2LYJA 2EZHA 3QPLA 1QVUA 4A3LJ 3OIOA 4FTHA 2GZUA 2CROA 2VKVA 2M9HA 1O4XA 2JWTA 1ETQA 2XPWA 3HZIB 5F08A 4O8BA 2PUAA 5F0CA 3HOYJ 3OOUA 1ZAYA 3E7LA 1I50J 5GPAA 4X6AJ 1EF4A 1G2HA 3BTCA 2QF7A 5F0HA 3BQYA 5M3FJ 3OQNA 1JUPA 1IRZA 2X6OA 2XCJA 2NVYJ 2XPVA 2ECCA 2MQKA 1Y9QA 1H88C 2R1JL 1PRVA 1ETOA 2K9SA 2JA6J 4BY7J 2IVGA 2Y31A 2XI8A 3TP0A 4Z59A 5A7LA 5K7FA 1QVTA 3ZQFA 2DMQA 3TW7A 4DYQA 2GM4A 1MSFC 2WUSR 1YSEA 1MBFA 3KZ3A 1W0UA 5FKKA 2I10A 4DYRA 3OQMA 4XICA 2B63J 1UTXA 1QP4A 3I4NJ 3DNVB 1HDPA 3HKZN 2JA5J 2PUGA 1U9OA 1VPWA 2ICPA 3G1OA 1MH4A 2FQ4A 2ID6A 3RKQA 1VFCA 3BR2A 2IUOA 2DMTA 3CROL 1WH7A 3BTJA 2EQRA 3B7HA 3UFDA 2Y0SN 4PU7A 5FKMA 4A3FJ 3DEWA 1FJLA 3M3YJ 2NOGA 1HLVA 4IA8A 1MSEC 3OQOA 5FJ8J 4A3GJ 4BBRJ 1DW9A 1TWGJ 3HGGA 2H8RA 1RPEL 2PE5A 2VPRA 1H89C 2BJCA 4XRSA 2FX0A 3BG9A 1TWAJ 1JTYA 2EBYA 1B8IB 2L7FP 5E3MA 4CYCA 4B4CA 3H3VK 3GTKJ 4B1RA 3NARA 1ZS4A 1FIAA 2VUMJ 3O8HA 5EGOB 4D5FA 4FISA 3BDNA 3GTPJ 3HOXJ 3S17J 4MCTA 3Q3SA 3SJMA 1U9NA 2ZB9A 4V2GA 3BR6A 1ZZ7A 2AXVA 2HSGA 3VK0A 2GRLA 3OMTA 3SFIA 5F27A 2XB5A 1P7IA 2LTPA 2DA1A 2OR1L 4M3DA 2R5ZB 1QRYA 1LQCA 5E3LA 3ZQHA 4M6VA 1FIPA 2LYRA 3IVPA 3SCFA 4IHWA 2AW6A 5DTDA 2XGDA 2BNNA 2PMZN 1ETYA 4W1UA 3W6VA 5J3LA 2AHQA 1ZGWA 5C4XJ 4PU4C 4BKXA 3FYAA 1E3OC 2NS8A 2GLOA 2O4AA 3MVPA 2QCOA 2IVBA 2ICTA 1TWHJ 4A3BJ 1A5JA 2XPUA 3IV5A 1OJLA 1WCMJ 2DMUA 2IAIA 3JRDA 3GBGA 2ECBA 4M3BA 4RDUA 3FK6A 1MBJA 1JKRC 1XWRA 4NDWA 1DU6A 4AUXA 4IEJA 1UG2A 2L9RA 2R92J 1ZPQA 1HCRA 1Q1VA 1IGNA 2CUFA 1WI3A 1Z0XA 1RESA 2RAEA 4J1WA 4X4BA 3OP9A 1IDZA 3GTGJ 3ZHMA 3JXDL 4A69C 3O9XA 2KEJA 1OCPA 2JVLA 2L7MP 2L7ZA 4D7MA 3SCGA 1RR7A 2M34A 1BJZA 9ANTA 4FBIA 1GV5A 4MLOA 4Y52J 5C44J 3JRIA 2DA7A 1PRUA 4I6ZA 3MN2A 1H8AC 5FLMJ 2FJ1A 1JUSA 4CYCB 1JKOC 3IH2A 3O8GA 4QIWN 4Z58A 1F43A 2MW8A 2NVXJ 2WIUB 2YUSA 2R5ZA 3FYMA 2WAQN 2OPTA 3K2AA 4FCYA 1LCCA 4Y7NJ 3JRBA 1IV6A 4A3CJ 1K61A 1IUFA 2EBIA 2R63A 2W48A 1QQBA 5IYBJ 5M5WJ 4GFBA 2K9NA 2LP0A 3K7AJ 3JRFA 2CQQA 5M5XJ 3GTMJ 5FKOA 4I6UA 3SDGA 4X4GA 4IWRA 3BS3A 1B72B 2GRMA 1ZZCA 3FMYA 1PNRA 3VPRA 1WIZA 1P7JA 2O7OA 5C4JJ 4AYBN 2NVQJ 3LFPA 3A02A 2H1KA 3B6AA 3BR0A 2EZIA 3IH4A 4D5CA 3HOVJ 2LVSA 2WB1N 3BG5A 1I6HJ 3HEFA 4XRMA 1K83J 1UHSA 3A03A 5BNGA 2JA8J 2FJRA 4PU3C 1JKPC 2MSYA 1B0NA 5E3OA 3CCYA 1OCTC 3BR5A 2R5YA 1NK2P 3JRAA 2R5YB 3BG3A 3HDDA 1X2NA 1BL0A 2PPXA 3S1RJ 2JJ7A 5K7HA 3RQIA 1ZZ8A 1ETKA 2KEIA 4Y42A 3ZKCA 1JTXA 4AC0A 3CMYA 2LKXA 2CRGA 2DMPA 4DW6A 5F0FA 2LYSA 3CECA 4X4EA 4HNVA 3BR1A 5JLXA 1QPZA 3BD1A 2LR8A 2HOAA 4A3DJ 1LFUP 2CQXA 2R93J 3F0CA 2ME0A 1B72A 1WH8A 4GQMA 2TRTA 2LK2A 3SCHA 3FISA 1VI0A 4B3AA 3M4OJ 2O38A 2O49A 3LISA 1AKHA 1S7EA 4FE4A 1RPWA 1MBEA 2M8GX 5GPCA 3D1NI 2Y2ZA 2E2IJ 2JA7J 4PU8A 4MIMA 1QQAA 1JGGA 3QQAA 3H0GJ 3LSJA 1PUFB 3H5TA 1JUMA 1CJGA 2PUFA 3Q0UA 2K9QA 5J1YA 2B5AA 5HODA 3FIWA 1OFCX 5JLWA 2LYLA 2OF7A 2COBA 2N8GA 3PO3J 1RETA 3LSGA 2AXZA 2LYQA 3U3WA 3G1LA 1MBKA 3KXAA 4Z5HA 3MLFA 4I8TA 1GUUA 3FKIJ 3I4MJ 1MH3A 4BY1J 2HDDA 2ME6A 1GDTA 1SFOJ 2K40A 5EEAA 3TW6A 3JREA 4A3MJ 2M2EA 1ADRA 3BT9A 1PRAA 1IG7A 4IHVA 2JK3A 2BNMA 4JX4A 1T33A 2JMWA 3L1PA 2E2HJ 1ZUGA 4Z5DA 5FKLA 5EG0A 4M3FA 1FTTA 4I6RA 1XC5A 1ZTRA 4X1EA 3TRBA 3S8QA 1RIOA 1AKHB 4YG4A 4X4FA 4NDLA 1HOMA 1F36A 3HOWJ 4F8DA 3OSFA 2O9LA 5EZHA 4JX6A 1BW6A 3WHCA 2YS9A 3CDLA 1ZR2A 4FE7A 2IEKA 3S2HJ 1JT0A 2CU7A 3BTLA 4YBAA 4XIDA 2EZKA 2TCTA 3RZDJ 3QPSA 1XS9A 1JFTA 1BA5A 5J1UA 2DA4A 4JP0A 2LLKA 1MBGA 1ETWA 4ABZA 1BDHA 3HGYA 1BW5A 5J1RA 3G7DA 1TWFJ 2ID3A 1WH5A 1FEXA 2E2JJ 2PUDA 4MO7A 2HINA 2FD5A 1NERA 3ZQIA 4RBOA 1LLIA 1X2MA 3B6CA 1FTZA 2LYKA 2DA3A 3WHBA 1TWCJ 1WGXA 5F1JA 1GT0C 1YRNA 4LOCA 4C3IJ 2A6CA 3GTLJ 1Y7YA 2MG4A 1Z77A 1NK3P 5EYRA 2XGEA 3R1FA 2G0EA 4C3JJ 5C3EJ 4A3IJ 3RZOJ 3RZZA 2X9DA 1X57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TED A;  3HOU J;  3EUS A;  1R9T J;  4IVZ A;  1IDY A;  3HOZ J;  2PUE A;  2JCG A;  4YAR A;  4DZJ A;  4JX5 A;  2VI6 A;  1JH9 A;  4YG7 B;  5IPA A;  2O8K A;  2CJJ A;  3A01 A;  4BBS J;  5IYD J;  5FKN A;  3A01 B;  4G12 A;  2OFY A;  2GBY A;  2AWI A;  3DCF A;  5K7Z A;  5EF6 A;  1IC8 A;  1JFS A;  2DJN A;  5IP6 A;  4C2M J;  4V2F A;  1ETX A;  5IOZ A;  1ORK A;  2YU9 J;  1DWK A;  3S15 J;  2Y30 A;  2HXI A;  3FK7 A;  1ZQ3 P;  2WV1 A;  3PM1 A;  5DS9 A;  1R69 A;  3F6W A;  4BXX J;  2XIU A;  3JXB C;  3GTJ J;  2ELK A;  1UMQ A;  4DYC A;  4JQD A;  1HF0 A;  1RKW A;  1ZKG A;  2AUW A;  3S1N J;  4XK4 A;  3IH3 A;  2R0Q C;  1RKT A;  4J1X A;  2HQ5 A;  1JWL A;  2IVQ A;  2VKE A;  2E19 A;  5M5Y J;  1AU7 A;  4I6T A;  1VF9 A;  2LY9 A;  5IOY A;  2XSD C;  1MNM C;  2L8N A;  4X4D A;  2L0K A;  3BTI A;  3ZOB A;  5M3M J;  4YG1 A;  2Y9Y A;  2EZL A;  1A6I A;  4QSH A;  2X48 A;  1GV2 A;  2XB0 X;  1POU A;  4OB4 A;  4IHX A;  1JKQ C;  2EH3 A;  2P81 A;  1JT6 A;  3HB9 A;  3QQ6 A;  2DA5 A;  2MGQ A;  2HYJ A;  1VND A;  1GVD A;  2E1O A;  3LNQ A;  2D5V A;  1ZZB A;  1AHD P;  1YRN B;  1ZZ6 A;  3JRH A;  1RZR A;  2KDZ A;  3BQZ A;  2XRL A;  1SQ8 A;  5EG0 B;  2CUE A;  4DZP A;  3ZQL A;  3S2D J;  1ZK8 A;  2IBD A;  4FN3 A;  1UXC A;  3BR3 A;  1W0T A;  4A93 J;  3CQZ J;  1X58 A;  3QF3 A;  3HBL A;  4UUS A;  1WPK A;  5FLV A;  1CQT A;  4L5E A;  4Z5C A;  1ZR4 A;  3ZHI A;  3HM5 A;  2LD5 A;  3S16 J;  2MEZ A;  4D7N A;  3CLC A;  2DA6 A;  4MCX A;  2XJ3 A;  3GTO J;  3OSG A;  1ITY A;  4EEF G;  3ZQG A;  2NVT J;  4M3G A;  3KJX A;  4QTR A;  3S1Q J;  3JRG A;  1D5Y A;  3S1M J;  5IYC J;  2BNO A;  1IJW C;  1POG A;  1QPI A;  3GN5 A;  4J19 A;  3UKG A;  4A3E J;  2L49 A;  4MFE A;  1RZR D;  2XGC A;  1NTC A;  2JN6 A;  2M0C A;  2LCV A;  4JCX A;  1MBH A;  5F04 A;  4MFD A;  3GTQ J;  1T56 A;  4I76 A;  2HOS A;  2LYP A;  2HOT A;  1UXD A;  1ETV A;  3PXP A;  2KPJ A;  3MKL A;  1APL C;  4UUT A;  1XG1 A;  4JCY A;  5EZG A;  2CSF A;  4A3K J;  1U78 A;  2PUC A;  1RZS A;  1JJ8 C;  2AO9 A;  1U8B A;  4M3E A;  1X2L A;  1QP0 A;  3JR9 A;  4X4C A;  1LCD A;  3GBF A;  2EF8 A;  3NAU A;  3QWG A;  2PUB A;  3LSR A;  5IP9 J;  1WH6 A;  2PIJ A;  4GHJ A;  1R63 A;  5K98 B;  1ZVV A;  1I3Q J;  5IP7 J;  1ENH A;  4S0H B;  3S14 J;  3TP3 A;  1ZZ9 A;  1Y1V J;  4C3H J;  3ZQC A;  5EGO A;  3F52 A;  2LFB A;  3QYX A;  1DU0 A;  3G1M A;  1Y1W J;  2NS7 A;  3C2B A;  4JYK A;  3LOC A;  5E3N A;  1L1M A;  1SAN A;  1JJ6 C;  2HI3 A;  4UUS B;  4IHY A;  3F51 A;  1LMB 3;  2EWT A;  4W97 A;  2KT0 A;  1LFB A;  1PER L;  4A3J J;  2IU7 A;  2HXO A;  5EDN A;  2IV1 A;  1WET A;  1NEQ A;  5GP9 A;  3JRC A;  1EFA A;  4X4I A;  2AXU A;  2DMN A;  3LSP A;  2DA2 A;  2DTZ A;  1B8I A;  3Q0V A;  2Y9Z A;  1PUF A;  3G5G A;  1OSL A;  3Q0W A;  2KZ8 A;  2KEK A;  4X4H A;  3PO2 J;  3JXC L;  1BDI A;  4XRS G;  1LE8 B;  1TC3 C;  1LE8 A;  1HDD C;  2R7Z J;  2DN0 A;  1QP7 A;  3GN5 B;  2LYJ A;  2EZH A;  3QPL A;  1QVU A;  4A3L J;  3OIO A;  4FTH A;  2GZU A;  2CRO A;  2VKV A;  2M9H A;  1O4X A;  2JWT A;  1ETQ A;  2XPW A;  3HZI B;  5F08 A;  4O8B A;  2PUA A;  5F0C A;  3HOY J;  3OOU A;  1ZAY A;  3E7L A;  1I50 J;  5GPA A;  4X6A J;  1EF4 A;  1G2H A;  3BTC A;  2QF7 A;  5F0H A;  3BQY A;  5M3F J;  3OQN A;  1JUP A;  1IRZ A;  2X6O A;  2XCJ A;  2NVY J;  2XPV A;  2ECC A;  2MQK A;  1Y9Q A;  1H88 C;  2R1J L;  1PRV A;  1ETO A;  2K9S A;  2JA6 J;  4BY7 J;  2IVG A;  2Y31 A;  2XI8 A;  3TP0 A;  4Z59 A;  5A7L A;  5K7F A;  1QVT A;  3ZQF A;  2DMQ A;  3TW7 A;  4DYQ A;  2GM4 A;  1MSF C;  2WUS R;  1YSE A;  1MBF A;  3KZ3 A;  1W0U A;  5FKK A;  2I10 A;  4DYR A;  3OQM A;  4XIC A;  2B63 J;  1UTX A;  1QP4 A;  3I4N J;  3DNV B;  1HDP A;  3HKZ N;  2JA5 J;  2PUG A;  1U9O A;  1VPW A;  2ICP A;  3G1O A;  1MH4 A;  2FQ4 A;  2ID6 A;  3RKQ A;  1VFC A;  3BR2 A;  2IUO A;  2DMT A;  3CRO L;  1WH7 A;  3BTJ A;  2EQR A;  3B7H A;  3UFD A;  2Y0S N;  4PU7 A;  5FKM A;  4A3F J;  3DEW A;  1FJL A;  3M3Y J;  2NOG A;  1HLV A;  4IA8 A;  1MSE C;  3OQO A;  5FJ8 J;  4A3G J;  4BBR J;  1DW9 A;  1TWG J;  3HGG A;  2H8R A;  1RPE L;  2PE5 A;  2VPR A;  1H89 C;  2BJC A;  4XRS A;  2FX0 A;  3BG9 A;  1TWA J;  1JTY A;  2EBY A;  1B8I B;  2L7F P;  5E3M A;  4CYC A;  4B4C A;  3H3V K;  3GTK J;  4B1R A;  3NAR A;  1ZS4 A;  1FIA A;  2VUM J;  3O8H A;  5EGO B;  4D5F A;  4FIS A;  3BDN A;  3GTP J;  3HOX J;  3S17 J;  4MCT A;  3Q3S A;  3SJM A;  1U9N A;  2ZB9 A;  4V2G A;  3BR6 A;  1ZZ7 A;  2AXV A;  2HSG A;  3VK0 A;  2GRL A;  3OMT A;  3SFI A;  5F27 A;  2XB5 A;  1P7I A;  2LTP A;  2DA1 A;  2OR1 L;  4M3D A;  2R5Z B;  1QRY A;  1LQC A;  5E3L A;  3ZQH A;  4M6V A;  1FIP A;  2LYR A;  3IVP A;  3SCF A;  4IHW A;  2AW6 A;  5DTD A;  2XGD A;  2BNN A;  2PMZ N;  1ETY A;  4W1U A;  3W6V A;  5J3L A;  2AHQ A;  1ZGW A;  5C4X J;  4PU4 C;  4BKX A;  3FYA A;  1E3O C;  2NS8 A;  2GLO A;  2O4A A;  3MVP A;  2QCO A;  2IVB A;  2ICT A;  1TWH J;  4A3B J;  1A5J A;  2XPU A;  3IV5 A;  1OJL A;  1WCM J;  2DMU A;  2IAI A;  3JRD A;  3GBG A;  2ECB A;  4M3B A;  4RDU A;  3FK6 A;  1MBJ A;  1JKR C;  1XWR A;  4NDW A;  1DU6 A;  4AUX A;  4IEJ A;  1UG2 A;  2L9R A;  2R92 J;  1ZPQ A;  1HCR A;  1Q1V A;  1IGN A;  2CUF A;  1WI3 A;  1Z0X A;  1RES A;  2RAE A;  4J1W A;  4X4B A;  3OP9 A;  1IDZ A;  3GTG J;  3ZHM A;  3JXD L;  4A69 C;  3O9X A;  2KEJ A;  1OCP A;  2JVL A;  2L7M P;  2L7Z A;  4D7M A;  3SCG A;  1RR7 A;  2M34 A;  1BJZ A;  9ANT A;  4FBI A;  1GV5 A;  4MLO A;  4Y52 J;  5C44 J;  3JRI A;  2DA7 A;  1PRU A;  4I6Z A;  3MN2 A;  1H8A C;  5FLM J;  2FJ1 A;  1JUS A;  4CYC B;  1JKO C;  3IH2 A;  3O8G A;  4QIW N;  4Z58 A;  1F43 A;  2MW8 A;  2NVX J;  2WIU B;  2YUS A;  2R5Z A;  3FYM A;  2WAQ N;  2OPT A;  3K2A A;  4FCY A;  1LCC A;  4Y7N J;  3JRB A;  1IV6 A;  4A3C J;  1K61 A;  1IUF A;  2EBI A;  2R63 A;  2W48 A;  1QQB A;  5IYB J;  5M5W J;  4GFB A;  2K9N A;  2LP0 A;  3K7A J;  3JRF A;  2CQQ A;  5M5X J;  3GTM J;  5FKO A;  4I6U A;  3SDG A;  4X4G A;  4IWR A;  3BS3 A;  1B72 B;  2GRM A;  1ZZC A;  3FMY A;  1PNR A;  3VPR A;  1WIZ A;  1P7J A;  2O7O A;  5C4J J;  4AYB N;  2NVQ J;  3LFP A;  3A02 A;  2H1K A;  3B6A A;  3BR0 A;  2EZI A;  3IH4 A;  4D5C A;  3HOV J;  2LVS A;  2WB1 N;  3BG5 A;  1I6H J;  3HEF A;  4XRM A;  1K83 J;  1UHS A;  3A03 A;  5BNG A;  2JA8 J;  2FJR A;  4PU3 C;  1JKP C;  2MSY A;  1B0N A;  5E3O A;  3CCY A;  1OCT C;  3BR5 A;  2R5Y A;  1NK2 P;  3JRA A;  2R5Y B;  3BG3 A;  3HDD A;  1X2N A;  1BL0 A;  2PPX A;  3S1R J;  2JJ7 A;  5K7H A;  3RQI A;  1ZZ8 A;  1ETK A;  2KEI A;  4Y42 A;  3ZKC A;  1JTX A;  4AC0 A;  3CMY A;  2LKX A;  2CRG A;  2DMP A;  4DW6 A;  5F0F A;  2LYS A;  3CEC A;  4X4E A;  4HNV A;  3BR1 A;  5JLX A;  1QPZ A;  3BD1 A;  2LR8 A;  2HOA A;  4A3D J;  1LFU P;  2CQX A;  2R93 J;  3F0C A;  2ME0 A;  1B72 A;  1WH8 A;  4GQM A;  2TRT A;  2LK2 A;  3SCH A;  3FIS A;  1VI0 A;  4B3A A;  3M4O J;  2O38 A;  2O49 A;  3LIS A;  1AKH A;  1S7E A;  4FE4 A;  1RPW A;  1MBE A;  2M8G X;  5GPC A;  3D1N I;  2Y2Z A;  2E2I J;  2JA7 J;  4PU8 A;  4MIM A;  1QQA A;  1JGG A;  3QQA A;  3H0G J;  3LSJ A;  1PUF B;  3H5T A;  1JUM A;  1CJG A;  2PUF A;  3Q0U A;  2K9Q A;  5J1Y A;  2B5A A;  5HOD A;  3FIW A;  1OFC X;  5JLW A;  2LYL A;  2OF7 A;  2COB A;  2N8G A;  3PO3 J;  1RET A;  3LSG A;  2AXZ A;  2LYQ A;  3U3W A;  3G1L A;  1MBK A;  3KXA A;  4Z5H A;  3MLF A;  4I8T A;  1GUU A;  3FKI J;  3I4M J;  1MH3 A;  4BY1 J;  2HDD A;  2ME6 A;  1GDT A;  1SFO J;  2K40 A;  5EEA A;  3TW6 A;  3JRE A;  4A3M J;  2M2E A;  1ADR A;  3BT9 A;  1PRA A;  1IG7 A;  4IHV A;  2JK3 A;  2BNM A;  4JX4 A;  1T33 A;  2JMW A;  3L1P A;  2E2H J;  1ZUG A;  4Z5D A;  5FKL A;  5EG0 A;  4M3F A;  1FTT A;  4I6R A;  1XC5 A;  1ZTR A;  4X1E A;  3TRB A;  3S8Q A;  1RIO A;  1AKH B;  4YG4 A;  4X4F A;  4NDL A;  1HOM A;  1F36 A;  3HOW J;  4F8D A;  3OSF A;  2O9L A;  5EZH A;  4JX6 A;  1BW6 A;  3WHC A;  2YS9 A;  3CDL A;  1ZR2 A;  4FE7 A;  2IEK A;  3S2H J;  1JT0 A;  2CU7 A;  3BTL A;  4YBA A;  4XID A;  2EZK A;  2TCT A;  3RZD J;  3QPS A;  1XS9 A;  1JFT A;  1BA5 A;  5J1U A;  2DA4 A;  4JP0 A;  2LLK A;  1MBG A;  1ETW A;  4ABZ A;  1BDH A;  3HGY A;  1BW5 A;  5J1R A;  3G7D A;  1TWF J;  2ID3 A;  1WH5 A;  1FEX A;  2E2J J;  2PUD A;  4MO7 A;  2HIN A;  2FD5 A;  1NER A;  3ZQI A;  4RBO A;  1LLI A;  1X2M A;  3B6C A;  1FTZ A;  2LYK A;  2DA3 A;  3WHB A;  1TWC J;  1WGX A;  5F1J A;  1GT0 C;  1YRN A;  4LOC A;  4C3I J;  2A6C A;  3GTL J;  1Y7Y A;  2MG4 A;  1Z77 A;  1NK3 P;  5EYR A;  2XGE A;  3R1F A;  2G0E A;  4C3J J;  5C3E J;  4A3I J;  3RZO J;  3RZZ A;  2X9D A;  1X57 A; 
#chains in the Genus database with same CATH topology
 3ABM H;  1R9T J;  1IDY A;  3HOZ J;  4G8X A;  2PUE A;  1MMN A;  3IC7 A;  1UEL B;  1Q1H A;  4E6K G;  3A0H C;  1L3L A;  2JCG A;  3BC8 A;  4KT5 C;  1RZ4 A;  5AIP A;  5J8C A;  2CJJ A;  3GZC A;  3OYH A;  2HYG D;  2IPQ X;  2K86 A;  5A2Q Z;  5FKN A;  1X1A A;  3A01 B;  1SAU A;  2PXK A;  1X1D A;  5LHG A;  5IP6 A;  4V2F A;  5IOZ A;  3SZP A;  1GXP A;  4QPO A;  1T6S A;  2HXI A;  5ILU A;  2XVC A;  4HBL A;  4RA2 A;  1U5T C;  3HYI A;  2IGN A;  2XIU A;  3GTJ J;  3EYY A;  4DYC A;  4ER3 A;  5J8F A;  2X51 A;  3QRF F;  1HF0 A;  2EV6 A;  4MQV A;  2HZD A;  4Y4R A;  4XK4 A;  2JPB A;  2L5Q A;  1KU3 A;  3GZ6 A;  2HQ5 A;  5B66 C;  2ELJ A;  4XKB A;  3DU5 A;  1HSJ A;  1VF9 A;  3FZV A;  2WWY A;  3X2Q H;  3FF5 A;  1MIJ A;  3HL2 A;  5KVR A;  2LNB A;  3KEY A;  3S3N A;  3BP8 A;  1MDM B;  1PJR A;  3GME A;  2X48 A;  2ZNZ A;  3VYR B;  4OB4 A;  2BYV E;  3OKZ A;  1JKQ C;  2ZO4 A;  2P81 A;  4EKG A;  3HB9 A;  2X6W A;  3QQ6 A;  4IX7 A;  2DA5 A;  4AIH A;  1GVD A;  1ZZB A;  4EZI A;  1FP2 A;  1YRN B;  2F4M B;  3ZCO A;  3DTI A;  2KIQ A;  1ZG1 A;  1YLF A;  3EDP A;  5EG0 B;  1G3W A;  2CUE A;  4M9Z A;  3BCA A;  4NC6 A;  1D3Y A;  1LEA A;  4MTE A;  3BY6 A;  1OCO H;  3IL2 A;  5IT9 Z;  5K5Q A;  1KA8 A;  3HIF A;  1W0T A;  1ACI A;  1OYY A;  3CMA I;  2LOO A;  3K10 A;  2XAQ A;  2KIS A;  1PDN C;  2KJC A;  3H5A A;  3PNT A;  1WI9 A;  2Z9O A;  1W7P A;  3OL3 A;  3ZN0 A;  2Z99 A;  1I39 A;  4D7N A;  3L2R A;  2DA6 A;  2XF6 A;  2HFZ A;  2MEZ A;  2XJ3 A;  1ZRE A;  3GTO J;  3ECH A;  1Z91 A;  4C2U A;  1ZHF A;  4GDF A;  4KT6 A;  1D5Y A;  1R36 A;  1IJW C;  5DUK A;  1QPI A;  4FX0 A;  1D8J A;  2JN6 A;  2LCV A;  1MBH A;  3Q5F A;  5DTM A;  3GTQ J;  4I76 A;  1X19 A;  2CS3 A;  2HOT A;  2LYP A;  1ETV A;  3PXP A;  2KPJ A;  3MKL A;  2Y69 H;  3OIP A;  4KIT B;  4UXN A;  2HVQ A;  2H1L A;  3CJR B;  5E18 F;  4M3E A;  1YFH A;  2EA4 A;  2PUB A;  1LVK A;  2EF8 A;  3GBF A;  3QWG A;  3M7G A;  4Q2J A;  1R63 A;  3TBI A;  1YTY A;  3OYE A;  2CUZ A;  3RCO A;  3E6B A;  4A5M A;  4IO9 F;  4X0G A;  4FAS D;  1S3J A;  2MFZ A;  3ABT A;  4UV9 A;  3CZ6 A;  3A2K A;  3F52 A;  1LJ9 A;  1R5G A;  1VQK I;  3H36 A;  1J5Y A;  3I5U A;  3OYF A;  1Y1W J;  1BIB A;  3ASO H;  1L1M A;  3IWF A;  1JJ6 C;  4HLY A;  4IHY A;  2EFW A;  3CUQ A;  2H09 A;  1IV8 A;  2EA2 A;  1R71 A;  3OYJ A;  3K4J A;  2Z3Y A;  5TRD A;  4FQG A;  4YIR X;  3T8T A;  5ILV A;  4ZYD A;  1PER L;  4KDP A;  1KQ0 A;  3HXL A;  2IV1 A;  2WY7 Q;  4U88 A;  4ER6 A;  1WET A;  5KK1 A;  2DMN A;  1ODD A;  3Q0V A;  2Y9Z A;  1PUF A;  1YS7 A;  3E6D A;  4X4H A;  1S6L A;  1BDI A;  4XRS G;  2LMD A;  4L5I A;  3L7W A;  4KIF A;  2ZJR F;  3F8B A;  3HRT A;  1HDD C;  2R7Z J;  2DN0 A;  3DU6 A;  5LHH A;  3V8L A;  4DE8 A;  3BZK A;  3GYH X;  2LYJ A;  2UWM A;  3QPL A;  1QVU A;  4I7H A;  5HS8 A;  3G71 I;  1XSD A;  2GZU A;  2PXF A;  5B3S H;  1P4X A;  2F4I A;  4BS9 A;  1O57 A;  2VQG A;  5D5U B;  4HW0 A;  2HGC A;  2L3D A;  4EGY A;  1O4X A;  3DF8 A;  4P9U A;  4OOI A;  5F0C A;  3OOU A;  1T8I A;  4KFC A;  4XKC A;  2P6T A;  5GPA A;  4X6A J;  4ZYG A;  2UV1 A;  1O3Q A;  3I64 A;  3MFK A;  1IRZ A;  1IN7 A;  5E8G A;  3J81 Z;  3Q9S A;  3BPV A;  2J7W A;  5LEJ A;  2V6C A;  3SEQ A;  3DBR B;  4BY7 J;  4YIF A;  3W6J B;  4Z59 A;  1X1C A;  2J5P A;  1MSF C;  3HPG A;  3OYD A;  3KZ3 A;  1YW9 A;  4RGR A;  1BIA A;  2WAE A;  5E79 C;  5DM6 F;  3K6G A;  2PXQ A;  2Z33 A;  1HW2 A;  2B63 J;  2MLG A;  1QO0 D;  2R7F A;  4RGU A;  1S7A A;  2ZSI B;  5EEH A;  3SZG A;  3HKZ N;  1XMX A;  1BR2 A;  4OU0 A;  3RPU D;  2V7F A;  1P2F A;  1JHF A;  3G1O A;  3ROU A;  3LAP A;  2IUO A;  2XV4 S;  4A2U A;  1OQY A;  1FX7 A;  2Y0S N;  4PU7 A;  1UST A;  1KZH A;  4A3F J;  3LSH A;  4BAY A;  2NOG A;  2X6Y A;  1K7A A;  2JQ7 A;  4A3G J;  1DW9 A;  1QZE A;  3BPX A;  4ZDO A;  2R7Q A;  4J01 A;  2PE5 A;  1T98 A;  1B4A A;  1U2Z A;  2FRH A;  3GZ5 A;  1B9N A;  3R4K A;  2QBY A;  4XM3 A;  4D9J A;  2QBY B;  3BG9 A;  1TWA J;  1B8I B;  1R22 A;  4CYC A;  3H3V K;  2EIL H;  3NAR A;  1FIA A;  3PL8 A;  3SYT A;  3WOD F;  4A0Z A;  2VUM J;  4D5F A;  1YQA A;  2ZJP F;  2EB7 A;  3S17 J;  3CCQ I;  4MCT A;  2FNA A;  2ZB9 A;  2VIX A;  4HA8 A;  3LQX A;  2GRL A;  3OMT A;  1IO2 A;  3SFI A;  1DUL A;  5ED4 A;  3WTZ A;  2DA1 A;  5ICF A;  4QPQ A;  2R5Z B;  2CV0 A;  2XHK A;  4K2E A;  5E3L A;  3ZQH A;  3ASN H;  3IHU A;  5H20 A;  4XBF A;  1ZGA A;  2QWW A;  1RR8 C;  4R79 A;  3SCF A;  5DTD A;  3AG4 H;  1R5I D;  5GAH J;  3ZR8 X;  4IL6 C;  4ZH4 F;  2ZSH B;  2K85 A;  2VKD A;  2AHQ A;  4A6E A;  4PU4 C;  2RC4 A;  3VWS A;  2FUG 2;  2V3C C;  2KRC A;  2WA0 A;  3F23 A;  1IUY A;  3FYA A;  1LFP A;  2NS8 A;  2O4A A;  1AOY A;  2QCO A;  4NUB A;  3LA3 A;  4A3B J;  4NBQ A;  1OJL A;  2J5O A;  1WCM J;  2Y0M A;  3V8K A;  2IAI A;  3F6O A;  2EIM H;  2ECB A;  3OR1 C;  3CJQ B;  2L2O A;  3QP6 A;  3VFZ A;  3WU2 C;  1XWR A;  1DU6 A;  4I0A A;  4RM3 A;  1ZPQ A;  3DBL B;  1DPU A;  1Q1V A;  1DGW Y;  2ZME A;  1HKS A;  4OBM A;  4J1W A;  3C18 A;  3OP9 A;  4A6D A;  3ZHM A;  3K4N A;  3JXD L;  2BHZ A;  1WJD A;  2PX9 A;  2XF7 A;  3BJA A;  3VOD A;  4A69 C;  4E4H A;  2JVH A;  4DE9 A;  2OC6 A;  2JVL A;  3O9X A;  2DT7 B;  2IGK A;  3I0T A;  4D7M A;  1EA3 A;  1TTY A;  2IGO A;  2M34 A;  2EV5 A;  1LDD A;  4LG0 B;  4WXC A;  4FBI A;  3WTY C;  4DBQ A;  3RPQ A;  4CYC B;  4UV8 A;  3FDY A;  3O8G A;  4QIW N;  3FWE A;  4DOZ A;  2R7S A;  4EM2 A;  2YUS A;  3KZI C;  2R5Z A;  2HQA A;  2WAQ N;  2V1N A;  2AS5 F;  3K2A A;  2Q8K A;  3CO6 C;  3MCZ A;  4KN7 X;  4Y7N J;  1XCV A;  2K4J A;  2IA0 A;  1I6X A;  2STT A;  2R63 A;  3LSM A;  5FLX K;  2HVS A;  3KP2 A;  3K7A J;  3JRF A;  1USS A;  3SDG A;  3H0D A;  3ZMD A;  3ZGK A;  3BS3 A;  2Z16 A;  4JQF A;  2DI3 A;  3UWP A;  5HDG A;  1K6Y A;  2HPI A;  2FSW A;  3V7R A;  3E0J B;  2KIM A;  3DLL F;  3LFP A;  3A02 A;  4CCN A;  2LVS A;  2WB1 N;  3KP7 A;  3HEF A;  1EJ9 A;  3HSE A;  3A03 A;  2FJR A;  3L2C A;  1DQU A;  5E3O A;  3CCY A;  3BR5 A;  1E2X A;  1DP7 P;  2R5Y A;  2OTJ I;  4KYW A;  2R5Y B;  1YW7 A;  3S1R J;  1D1C A;  3WTU C;  5K7H A;  4IOC F;  2KJB A;  4A0Y A;  2UUZ A;  2KEI A;  5H2F C;  4PGG A;  3N4M A;  2CRG A;  1IF1 A;  4HNV A;  3H3U A;  1QPZ A;  2HOA A;  2PXL A;  2CQX A;  2R93 J;  2DO7 A;  2ME0 A;  1B72 A;  4I02 A;  4GQM A;  1J75 A;  4UB8 C;  4J00 A;  5TJJ A;  3IUO A;  4OAZ A;  3FIS A;  1W7P D;  1X3U A;  2O49 A;  3UNG C;  2HPM A;  1OYI A;  3K4K A;  5CVV A;  1MGT A;  1RPW A;  1AKH A;  1U8R A;  3LIS A;  1QQA A;  4PU8 A;  3M1E A;  4MIM A;  1BC8 C;  4BQN A;  3H5T A;  1PUF B;  1JUM A;  3K4L A;  4XRF A;  4C30 A;  3M9L A;  2HKO A;  1FC3 A;  4GGG A;  2OF7 A;  2X1E A;  2DPD A;  3CD6 I;  3LSG A;  3PO3 J;  1EH6 A;  2LYQ A;  4ESB A;  2JT1 A;  1MBK A;  1ZAO A;  2MA3 A;  3PNV A;  1Z67 A;  4WCG A;  3W6K B;  1LDK B;  1RNL A;  4RAZ A;  5LLQ A;  4BY1 J;  3R09 A;  3MQ0 A;  3K1P A;  2ME6 A;  1SFO J;  3FX3 A;  5K5O A;  3JRE A;  5K5R A;  4OIP F;  1EKE A;  3DPL C;  2XAF A;  3HHG A;  4YII A;  1VQ8 I;  5FKL A;  1X1P A;  2EFQ A;  4M3F A;  4ZC3 A;  5EG0 A;  4Y17 A;  5D4S A;  2L9S A;  3AL0 C;  4PK4 A;  5B5E C;  3ULQ B;  5DUI A;  4X4F A;  2CFX A;  4HX7 A;  1F36 A;  2R4G A;  5BPI A;  4EJT A;  4GO1 A;  3C7J A;  4JX6 A;  2B9S A;  1T38 A;  4FE7 A;  2YX7 A;  1JT0 A;  4CHU A;  2CU7 A;  3OY9 A;  4YBA A;  5AON A;  2ZME C;  3RZD J;  3DP7 A;  2WY8 Q;  4CCK A;  1XS9 A;  2VOD A;  4L9V A;  4DNC A;  4ABZ A;  4L0Z B;  2HFH A;  1Y39 A;  1DUX C;  1X1B A;  1I1S A;  5J1R A;  3QOP A;  2TDX A;  3IAM 2;  1L0O C;  2JZY A;  5HNH A;  2FD5 A;  1J0R A;  1E3H A;  3MWM A;  3ZQI A;  4RBO A;  2DDA A;  1TT0 A;  2CWE A;  4IPA A;  2M30 A;  4I01 A;  5F1J A;  4LOC A;  2GXB A;  4U0V A;  3CCV I;  4C3I J;  3D5R C;  3GTL J;  1Y7Y A;  4CZZ A;  2XGE A;  1U5T A;  5J4V A;  1U5T B;  4A3I J;  1XPX A;  3BRO A;  2XRN A;  2KP6 A;  3HOU J;  3EUS A;  1XGS A;  3WE3 A;  2VBW A;  1FZP B;  2VEO A;  4JX5 A;  2FFH A;  5IPA A;  2O8K A;  2CQN A;  5F64 A;  1O3T A;  3HTS B;  4BBS J;  2DCE A;  3LFU A;  5J47 A;  3DCF A;  1K78 B;  3N05 A;  1WJE A;  2ADU A;  3DKY A;  3HRU A;  2DJN A;  4C2M J;  2GXA A;  4UVA A;  4BU2 A;  2OUM A;  3S15 J;  1BN5 A;  3CDI A;  1ZQ3 P;  3PM1 A;  2KHM A;  3EUA A;  3F6W A;  5DSX A;  1UMQ A;  4IRI A;  2QKM B;  5ICC A;  4WK8 F;  2DYS H;  2F5V A;  1TP4 A;  1ZKG A;  4CZC A;  3OWQ A;  1RKT A;  2MBF A;  5DDG A;  2BVL A;  2RV8 A;  3PSF A;  2E19 A;  1YIJ I;  2IVQ A;  4KJZ A;  1D8K A;  2BY0 A;  5M5Y J;  1AU7 A;  4ZYA A;  2RQQ A;  3I53 A;  5IOY A;  2L8N A;  1MNM C;  4X4D A;  2DBB A;  3A0B C;  4YEJ A;  2L0K A;  1SFK A;  3BTI A;  2CW7 A;  4YFK F;  3TEP A;  1S5L C;  3OYG A;  2XB0 X;  4CYD A;  3BZ6 A;  1JT6 A;  4HEA 2;  3SFZ A;  3I71 A;  2ICW G;  2Q0O A;  4NHJ A;  2XAG A;  4KA4 A;  1QZX A;  1VQ4 I;  3S3M A;  2JTV A;  2PQ8 A;  4HST A;  2E5Z A;  3HSF A;  1UFM A;  4NC7 A;  4DZP A;  3S2D J;  1FNN A;  2CSO A;  4AIK A;  4FN3 A;  1SMT A;  3SEZ A;  1UXC A;  3WE2 A;  2ZXH A;  2QQ9 A;  2CGP A;  2BE5 F;  3CQZ J;  1MJB A;  5H6R A;  3HKZ A;  2Z1D A;  1X58 A;  3RDI A;  3KX2 A;  2ZJ2 A;  2DXI A;  1S9H A;  4Z5C A;  1IW7 F;  3CP8 A;  1QU3 A;  3ZHI A;  1Z1D A;  3GO5 A;  4LD5 A;  4G6Q A;  1WVR A;  2CYY A;  2EPF A;  2Y0S A;  5TGT A;  1QNT A;  4F93 B;  2R7R A;  1FOW A;  3QF3 A;  4EEF G;  2NVT J;  2ISY A;  5FB2 A;  3JRG A;  5IYC J;  1GHC A;  2NYX A;  2UXX A;  3OYI A;  3FXR A;  3KIO A;  1WJF A;  1H0M A;  2DOA A;  1MMD A;  4Z2Y A;  4MFD A;  3GZN B;  3CUQ B;  1IN6 A;  4TV7 A;  1SAX A;  2HOS A;  5D5X B;  4L9J A;  1ERD A;  4UUT A;  1XG1 A;  2DPU A;  4JCY A;  3H35 A;  5EZG A;  4CCM A;  2V1X A;  3RJP A;  2PUC A;  2LRE A;  1U8B A;  1QP0 A;  4B3X A;  2GWR A;  3JR9 A;  4C9Y A;  1S72 I;  3GVA A;  1LCD A;  3C1D A;  2QYO A;  1VQ7 I;  4ZYE A;  4N4O B;  1ZVV A;  1K79 A;  5K98 B;  2K4B A;  1I3Q J;  5IP7 J;  2BBY A;  5DCM B;  1W7P B;  3VOE A;  4PFP A;  3F8M A;  1D0Y A;  4JK1 X;  1LKX A;  3C2H A;  1YI2 I;  3KEO A;  1Y1V J;  3ZQC A;  3DEE A;  5EGO A;  2BY1 A;  5L3C A;  4YRV A;  3QYX A;  3O3K A;  2O6G E;  1Y8Q B;  2DYR H;  3G1M A;  4HZF A;  3CCE I;  3C2B A;  4PJN A;  3TO9 A;  4E7H A;  1Y8R B;  4E7K A;  5J40 A;  4XLP F;  1IN4 A;  1Y0U A;  3F51 A;  1P4W A;  2BVM A;  4EJO A;  1V54 H;  3L09 A;  2EWT A;  4W97 A;  4L9T A;  2VC1 A;  3ABK H;  5IY5 H;  2BZT A;  2E35 A;  3QP5 A;  2F5D A;  2KDO A;  2HDW A;  4UB6 C;  3G4S I;  4HF2 A;  2DJI A;  4P5O A;  5GP9 A;  3JRC A;  4EK9 A;  1EFA A;  2VQH A;  2AXT C;  2AXU A;  3QOW A;  3LSP A;  2BXZ A;  3E5Q A;  2DA2 A;  3G5G A;  3IRR A;  3ZQ7 A;  2UXN A;  1OSL A;  1A36 A;  2KZ8 A;  2G9W A;  3J7A Y;  3PO2 J;  3JXC L;  1MJ9 A;  3PIO F;  1LE8 B;  1TC3 C;  1LE8 A;  5CVI A;  2QSH X;  3NZL A;  2EZH A;  3CC2 I;  3AFH A;  5JUW A;  1ZYR F;  3K1N A;  2XXA A;  3DPU A;  4ZTF A;  4MQ9 F;  3BCB A;  2V9P A;  3CJT B;  1Z7U A;  2M9H A;  3R6S A;  2GOM A;  2XPW A;  4RAY A;  3QOD A;  3V4G A;  3HOY J;  2NNY A;  5DRT A;  3GZD A;  4ASN A;  3H92 A;  2DK8 A;  3KYL A;  3BTC A;  3BQY A;  3Q9V A;  4IHS A;  1R4M B;  1D0Z A;  2HQN A;  2PXV A;  2X6O A;  4BE0 A;  2DU9 A;  1VQP I;  4CA0 A;  1H88 C;  2M45 A;  2K9S A;  1DP3 A;  4RS8 A;  4P1W A;  4ZTJ A;  5A7L A;  5K7F A;  1XX5 A;  2DMQ A;  3TW7 A;  2WUS R;  1YSE A;  1MBF A;  1UG0 A;  3MKY B;  3SXY A;  1TL8 A;  2LBF B;  2I10 A;  3FHN A;  3IAS 2;  4DYR A;  3ZMZ A;  3QPH A;  1IN8 A;  3F6V A;  1QP4 A;  4JBA A;  1HDP A;  3TO7 A;  2PUG A;  1U9O A;  4RM2 A;  1HBX G;  5A2Q K;  4IRG A;  3RKQ A;  1VFC A;  4NC8 A;  2E34 A;  2K9M A;  2DMT A;  4OWR B;  3DQV C;  1S29 A;  3B7H A;  2PJR A;  4QWQ A;  2OQG A;  2IA1 A;  1R00 A;  2VBX A;  2LF8 A;  3BJO A;  4LLL A;  4CIC A;  1LVA A;  3DEW A;  5BS6 A;  1KGS A;  5BPD A;  2QQB A;  4BBR J;  1TWG J;  2VXZ A;  2VPR A;  2P8T A;  4RLQ A;  4GYI A;  1K6O A;  2ELH A;  5BOX A;  3FM3 A;  3K69 A;  4Q5S F;  2A05 A;  2EBY A;  4LIU A;  5LRS A;  5E3M A;  4HG2 A;  4B4C A;  3L2V A;  3LFK A;  3GTK J;  1OIS A;  3KZY A;  2E1M C;  5DRY A;  2ZKZ A;  3W3C A;  1KQ9 A;  4XSX F;  3VK0 A;  1U9N A;  1ZZ7 A;  3CO7 C;  2HSG A;  2P5V A;  4F3Q A;  2M3A A;  3RQ4 A;  3KP4 A;  2OR1 L;  1P7I A;  4M3D A;  1FBU A;  2LDU A;  2X1C A;  3DBH B;  3I54 A;  4R1H A;  4M6V A;  1XGO A;  1WWX A;  2ZFU A;  2LYR A;  4YEL A;  1ZG5 A;  1BI2 A;  3HUG A;  2AW6 A;  1G4D A;  1ETY A;  3HJE A;  3AG3 H;  4XLE A;  4GRI A;  1SD7 A;  3CDH A;  5H6Q A;  1FLI A;  3CP2 A;  2OZ6 A;  2GOX B;  1FPQ A;  2FMY A;  3L00 A;  3MVP A;  1TWH J;  5KHD A;  1Y56 A;  5B1A H;  1CF7 B;  1S7O A;  2DMU A;  3RIR A;  3KET A;  1XGM A;  3FBI B;  1MMA A;  2JSP A;  1JKR C;  1X4P A;  2I8D A;  1UG2 A;  2R92 J;  1IGN A;  4BXF A;  1WI3 A;  1Z0X A;  2E60 A;  2QZ8 A;  2RAE A;  4X4B A;  3GTG J;  3GCM A;  1SFX A;  3GUD A;  2VOO A;  3LSK A;  2KEJ A;  1B9M A;  2E5N A;  4F92 B;  3L2Q A;  4WXD A;  3KP5 A;  2L7Z A;  1YJ9 I;  2XRO A;  1RR7 A;  4KIG A;  2MC3 A;  1V55 H;  4BQA A;  1F4K A;  9ANT A;  1OR7 C;  5C44 J;  3JRI A;  3TMO A;  3CF5 F;  6PAX A;  1PRU A;  4I6Z A;  1Z6R A;  1G3S A;  2FJ1 A;  3M9A A;  2Y48 A;  1JUS A;  4U7D A;  2BW3 B;  2WAD A;  3NDB B;  2KRF A;  2BY3 A;  2NVX J;  2WIU B;  5HLI A;  2PN6 A;  1AA7 A;  5L3G A;  2FU4 A;  3FMQ A;  1LCC A;  3ERM A;  2HWV A;  4OIR F;  1SD4 A;  4A3C J;  2AQE A;  4B8X A;  3DWL E;  2HNH A;  4MNU A;  5ILS A;  4DIQ A;  3KZZ A;  5DD4 A;  5DTR A;  3TKY A;  2ZC2 A;  4I6U A;  1KU7 A;  2LH9 A;  1G3Y A;  4A12 A;  3PQJ A;  2HS5 A;  4IWR A;  5LEK A;  1B72 B;  2VT3 A;  3RYP A;  1ZZC A;  3GZD C;  3VPR A;  4DGW B;  2QEN A;  4N0B A;  3CCU I;  3F72 A;  1TNT A;  3K4B A;  5C4J J;  3HC7 A;  4AYB N;  1U3E M;  2E71 A;  4AM3 A;  2H1K A;  2DLL A;  1J9I A;  3IH4 A;  4D5C A;  3C2G A;  4BAC A;  3M8F A;  4XRM A;  2BXY A;  3AG1 H;  1D5V A;  4H4K C;  1J2X A;  4PU3 C;  2PXT A;  1GVJ A;  1JKP C;  2IS4 A;  2R7V A;  4CXF A;  3W2A A;  4RGX A;  2UZK A;  1NK2 P;  5DCM A;  2R7O A;  1FYM A;  3BG3 A;  2L9V A;  4RB0 A;  3TOA A;  4HAM A;  1BL0 A;  2PPX A;  3HRS A;  3L9F A;  1VQ5 I;  2PBI A;  2BHY A;  1SD6 A;  1WJC A;  2M0M A;  2RRE A;  1CGP A;  4XR6 A;  2ZJQ F;  3P5J A;  1MND A;  3CMY A;  1O7L A;  2LKX A;  1PVE A;  5HNF A;  3CEC A;  2LYS A;  5F0F A;  2PXE A;  2JQE A;  5DYM A;  5B1B H;  3ZMS A;  3BD1 A;  1IRX A;  1V3F A;  2W57 A;  3J80 K;  2FOW A;  1LFU P;  1RUN A;  1G59 A;  3F0C A;  1WH8 A;  2TRT A;  2A69 F;  4YG2 F;  4XMY A;  2DAO A;  2KIU A;  1Z7L A;  2O38 A;  3I56 I;  2JA7 J;  3D1N I;  2LKP A;  3TQN A;  5CVR A;  1JGG A;  1UAA A;  1HQ1 A;  4L0Y B;  3U1K A;  2BW3 A;  3H0G J;  1DDN A;  4XOR A;  4MCX A;  4IF4 A;  4UHT A;  2QSG X;  3Q0U A;  3WTS C;  4XLF A;  2PUF A;  2H27 A;  2R7D A;  1FWZ A;  4BDZ A;  3G1L A;  3VB2 A;  4BJ5 C;  1FSH A;  4OMZ A;  1ZRF A;  2HDC A;  1Z3Y A;  2HDD A;  1HW5 A;  3JAM K;  1ZEL A;  2K40 A;  4EJU A;  3HTU A;  4P96 A;  2ZME B;  2D1H A;  4PJM A;  1ADR A;  2HR3 A;  2DFI A;  4M74 A;  1STZ A;  2H8W A;  1PRA A;  4XLA A;  1R1U A;  4KMU X;  2A5Y B;  1QZY A;  1YX5 A;  3MZ8 A;  4PDK A;  2E2H J;  3T0Y A;  4PCQ A;  3SHF A;  3R61 A;  1FTT A;  4I6R A;  1YX3 A;  1ZTR A;  1AKH B;  3I4P A;  2CW8 A;  4NDL A;  2OAZ A;  1HOM A;  5EZH A;  2AQF A;  5E17 F;  2HTS A;  3CDL A;  4NNJ A;  2RN7 A;  2IEK A;  1NG6 A;  2L7K A;  2VKH A;  4RMN A;  1X3Z B;  2CQK A;  2W85 A;  4LGW A;  1Z6T A;  2EZK A;  4XID A;  1PP7 U;  3SDB A;  2KL4 A;  3ZPL A;  2DA4 A;  5J1U A;  2M7A A;  2LLK A;  4Y3O A;  4IJA A;  1TWF J;  1T95 A;  2ID3 A;  4HV5 A;  5EJC A;  3G73 A;  2VXD A;  5KCM A;  1ULY A;  2HIN A;  5LHI A;  2KMU A;  5FO5 A;  1Y6I A;  1LLI A;  1FTZ A;  2LYK A;  2MYS A;  3U1D A;  1YRN A;  1I27 A;  3CCM I;  1ONV A;  2A6C A;  2F6C A;  2DQL A;  1XDS A;  1ZLK A;  1Z77 A;  4ENK A;  5EYR A;  1NK3 P;  3R1F A;  1HQC A;  3PFI A;  2VE9 A;  1XB4 A;  1HKT A;  4WWC A;  4HQM A;  1X57 A;  5LBQ A;  3TED A;  4U7B A;  3E5X A;  4Y33 A;  4IVZ A;  3ECO A;  5DCF A;  1OCZ H;  4YAR A;  4HNT A;  4II3 A;  1IZ1 A;  4ENM A;  2P6S A;  3IKV A;  2VI6 A;  5D6E A;  1KU9 A;  1MZB A;  1ZLJ A;  3JTH A;  3A01 A;  2OFY A;  4MHG A;  1BR4 A;  2XAJ A;  2AWI A;  5K7Z A;  1IC8 A;  1JFS A;  1ETX A;  2A6H F;  3IP4 B;  4HF0 A;  5FLX Z;  1DWK A;  2Y30 A;  3T8R A;  3K1M A;  4Q4Z F;  2VQC A;  2WV1 A;  2I5U A;  5ERI A;  5JHF A;  3OYL A;  4BXX J;  3JXB C;  4F7Z A;  2JA2 A;  2NS0 A;  3FXM A;  2O8X A;  1BOB A;  5DV5 A;  2GA1 A;  2ZBK A;  3GFJ A;  1HC8 A;  1GLN A;  2EV0 A;  3IH3 A;  4CH7 A;  4AD9 A;  4BJ6 C;  2DK5 A;  1SVO A;  4EM0 B;  3KPH A;  2LY9 A;  4HV6 A;  3FBN B;  2D2W A;  3CME I;  1WQ2 A;  2GIV A;  4BUP A;  5L3B A;  3MEJ A;  2XAU A;  5M3M J;  2XKP A;  2Y9Y A;  4P9F A;  2A6T A;  2EZL A;  4FX4 A;  1A6I A;  4KN4 X;  4QSH A;  2B0L A;  3AAF A;  1O3S A;  1POU A;  4OIQ F;  3IRQ A;  3TOB A;  4AU7 A;  4QLC U;  3V7S A;  3JCU C;  3WTV C;  3OYK A;  4ENJ A;  3DKX A;  5GTH C;  3DLA A;  1VND A;  2E1O A;  3E3V A;  2YX4 A;  4ZZL A;  4BEH A;  2XRL A;  3PFY A;  2GAU A;  2ESN A;  4ON0 A;  2WAQ A;  3ZQL A;  1WRJ A;  2IBD A;  1D1A A;  2VLA A;  1RRJ A;  1T0F A;  3DM5 A;  2PMH A;  5L3D A;  2QGU A;  3P9C A;  1G6N A;  4A93 J;  3WTT C;  4AID A;  2JSC A;  3HBL A;  5CVJ A;  2M4H A;  2LBF A;  2EJR A;  1ZR4 A;  1HXD A;  3BLY A;  2NRA C;  4ER5 A;  3S16 J;  3J80 Z;  5IT3 A;  2W00 A;  3LMM A;  1ITY A;  3HHH A;  3ZQG A;  1MJA A;  1XSV A;  4M3G A;  4ZJZ A;  4QTR A;  1RI7 A;  3S1Q J;  4EGZ A;  4HDU A;  3S1M J;  3VEP A;  1POG A;  3GN5 A;  2L49 A;  3UKG A;  4ZZD A;  2OV7 A;  4MFE A;  1RZR D;  1NTC A;  1JHH A;  1UHM A;  1UXD A;  3ERE D;  2RGV A;  5JVG F;  1APL C;  1R7J A;  1HW1 A;  1QPM A;  1W5C C;  3S8P A;  2L02 A;  2QQ8 A;  1LUJ B;  1MDM A;  3F22 A;  2FML A;  4G9Y A;  4OIN F;  2CSF A;  5E1Z B;  1RZS A;  1JJ8 C;  2AO9 A;  2AXL A;  3DEU A;  4ZDL A;  1X2L A;  4CCJ A;  5GAG J;  4LB5 A;  2P0W A;  3TFL A;  4X4C A;  4ER7 A;  1J59 A;  5IP9 J;  4R8H A;  2E1C A;  3ML6 A;  5EEG A;  2HEO A;  3OMY A;  2M8E A;  3GF2 A;  3TDU C;  3LQQ A;  4EQZ A;  4M9S A;  1YIO A;  4LIV A;  1I3A A;  3S14 J;  1KYW A;  3QAH A;  3E6M A;  3IWZ A;  2LFB A;  1DU0 A;  1KYZ A;  3FKJ A;  2FNP A;  5CKT A;  1K4S A;  2NS7 A;  1WZ2 A;  2A6E F;  5E3N A;  1ZGJ A;  3MZH A;  4F55 A;  1HST A;  3A9Y A;  2VQL A;  2K5C A;  3RSN A;  4GCV A;  2D45 A;  1LEB A;  3FXJ A;  2FXA A;  3ME5 A;  2K7L A;  4FET A;  1VQ6 I;  3QYE A;  3HUG B;  1MKM A;  2IU7 A;  5KAI C;  5HLG A;  4Q47 A;  4X4I A;  1W36 D;  3J7Y J;  4Z6Y A;  1BBY A;  5L3E A;  1XMA A;  1B8I A;  3KCC A;  3F3X A;  4MTD A;  1REP C;  1GXQ A;  4BDY A;  3CMM A;  2KEK A;  1XN7 A;  1VQM I;  5CLS A;  1QP7 A;  3CF2 A;  2FQ3 A;  3GN5 B;  5LGN A;  4A3L J;  1XTA A;  3FXL A;  5F1R A;  2CRO A;  4UVB A;  2EFP A;  3F8F A;  2PJR B;  1HKQ A;  2HTJ A;  4ANJ A;  2EIK H;  2W1O A;  2H6B A;  2GZW A;  2KQR A;  4NQW A;  3U9G A;  3L2U A;  2JWT A;  1ETQ A;  3HZI B;  2PUA A;  1YOV B;  1ON1 A;  1ZAY A;  2PI0 A;  3AKZ A;  1JI8 A;  3T1B A;  1I50 J;  4RB2 C;  3W2V A;  3HSR A;  2QF7 A;  5F0H A;  5M3F J;  3OQN A;  1YJW I;  3H5R A;  2VL8 A;  2P5K A;  1Y9Q A;  2MAB A;  1V4R A;  1ETO A;  4PJL A;  2IVG A;  2Y31 A;  5HDK A;  2QVO A;  3TP0 A;  2R7T A;  1P92 A;  3RKW A;  2GM4 A;  4DYQ A;  3F8C A;  3C3W A;  5CPR B;  5FKK A;  4XIC A;  1LB2 A;  1SFE A;  2IVM A;  2OJE D;  2IP2 A;  1KON A;  3I4N J;  3DNV B;  1TQP A;  4XOT A;  2WBM A;  3V42 A;  3JAM Z;  2RDP A;  3GUU A;  2JA5 J;  4IRH A;  1A6Q A;  4IQJ A;  4LK1 F;  2YBD A;  2FQ4 A;  2DFE A;  3OOP A;  1TW3 A;  1T39 A;  3BTJ A;  2EQR A;  1QHG A;  4MEX F;  5HDN A;  5FKM A;  4BE1 A;  4UY8 I;  3E97 A;  5JR3 A;  3GLX A;  3COA C;  3ESW B;  1FJL A;  3M3Y J;  3OQO A;  1HLV A;  3J7A O;  1BJA A;  1QQI A;  1YW8 A;  3HGG A;  1A04 A;  2V26 A;  2H8R A;  1RPE L;  4KNY A;  2P4W A;  3ZMU A;  1R49 A;  3GLL A;  2L01 A;  2JRT A;  2FX0 A;  5DM7 F;  3H5N A;  5FFX A;  3CCS I;  2L7F P;  3D5S C;  3TO6 A;  1TNS A;  4B1R A;  1FY7 A;  1BR1 A;  1SVL A;  2OCE A;  4BNC A;  2NNN A;  5EGO B;  3BDN A;  2V1D A;  3EQL F;  3ZRG A;  3HOX J;  3KP3 A;  3Q3S A;  3SJM A;  3NRV A;  4HRI A;  2BOL A;  3MEX A;  3OYB A;  2AXV A;  4ESJ A;  5GAG i;  2W24 A;  3TGN A;  2XB5 A;  2LTP A;  5AIQ A;  1WJ5 A;  3PIP F;  2J7U A;  1LQC A;  3FXQ A;  2R3S A;  3ZMV A;  4KMF A;  2XXQ A;  5FFZ A;  1FIP A;  2JVG A;  3WGI A;  4PZJ A;  4CGZ A;  3IVP A;  2XAH A;  2CMP A;  4BE2 A;  2PXB A;  1UJ8 A;  2XGD A;  1IXS B;  2BNN A;  1H9T A;  2M4G A;  2NXN B;  5J3L A;  2KLO A;  4BKX A;  4UUV A;  3MD2 A;  3ZMT A;  2IJL A;  4O6J A;  2X0L A;  2GLO A;  1IXC A;  2W82 A;  4GXO A;  4I0B A;  4DQ2 A;  2IVB A;  1A5J A;  4HQE A;  2XPU A;  2VBY A;  3IV5 A;  1U0J A;  4HYE A;  1WKM A;  3ZXS A;  2A5W A;  2B7E A;  4M3B A;  4RAF A;  3OIQ A;  1V5G A;  1YJN I;  2LSO A;  1FSE A;  4NDW A;  1F1Z A;  4HDV A;  2FBH A;  3WU0 A;  2K9L A;  4N4N B;  2CUF A;  2RVC A;  2E36 A;  1ZH5 A;  3HOT A;  2IS2 A;  3OS2 A;  4LK0 F;  4BHC A;  4OIO F;  4IOA F;  2OTL I;  2L4M A;  4RB3 C;  4D1Q A;  1GV5 A;  5HS7 A;  3KLN A;  2H94 A;  3BDD A;  4EAT A;  2A61 A;  4Y52 J;  4CDG A;  2DA7 A;  1H8A C;  5FLM J;  4L18 B;  4Z58 A;  3FMS A;  2MW8 A;  2W7N A;  2ZXJ A;  5DT2 A;  5J4Y A;  2PXD A;  2OPT A;  2ZCW A;  3EUH A;  4FCY A;  1PUE E;  3ZP5 A;  3JRB A;  1IV6 A;  2RNG A;  3RKX A;  3H9G A;  1IUF A;  1A31 A;  2EBI A;  1QQB A;  4E7S A;  2XDV A;  2K9N A;  2LP0 A;  2CQQ A;  4X4G A;  4XNF A;  2HQR A;  2HKX A;  3EYI A;  5FRN A;  2GRM A;  1PNR A;  2FBK A;  2W25 A;  3FHZ A;  1WIZ A;  4C2T A;  2LKS A;  1X4O A;  2LF7 A;  2OCC H;  5ICG A;  2NVQ J;  2K3P A;  1OR7 A;  2CUJ A;  3HOV J;  2EIJ H;  2CFO A;  1YHQ I;  2QM3 A;  5BNG A;  2RKH A;  1B0N A;  2RQP A;  1R5H A;  1OCT C;  2XSJ C;  1HA8 A;  3CUO A;  2DOF A;  3VSK A;  3JRA A;  1N75 A;  1SVM A;  2CW0 F;  2ACJ A;  3J81 K;  1X2N A;  2BEO A;  4N9I A;  1XD7 A;  2JJ7 A;  3B02 A;  5D6F A;  3RQI A;  3JSO A;  3VYT B;  2VOP A;  3REO A;  3J7Z I;  3ZKC A;  1U2W A;  1JTX A;  2P7V B;  4AC0 A;  2DMP A;  4X4E A;  4DW6 A;  1VQL I;  3BG6 A;  5JLX A;  2IS6 A;  4A3D J;  2FA5 A;  2HOE A;  2M87 A;  4XLH A;  1KU2 A;  4D0P A;  2LK2 A;  2L4A A;  2QEX I;  3GEZ A;  4XON A;  3M4O J;  1S7E A;  4FE4 A;  3OWT A;  2M8G X;  5GPC A;  1LPQ A;  1BM9 A;  1NG7 A;  3QU3 A;  1WFX A;  1PP8 F;  1CJG A;  3FXU A;  4HX8 A;  1FT9 A;  2K9Q A;  5J1Y A;  3K70 C;  5HOD A;  3NRO A;  1OFC X;  2OA4 A;  1OCC H;  3PNY A;  2MD0 A;  5JLW A;  2LYL A;  2X4H A;  2COB A;  2N8G A;  2AXZ A;  1RET A;  3U3W A;  1R58 A;  3RTR A;  2VJ4 A;  3R60 A;  4RGS A;  3KXA A;  4Z5H A;  4I8T A;  2PEX A;  1Z9C A;  3FKI J;  1GUU A;  1IXR C;  1LDJ A;  2IRF G;  3K4M A;  2FEZ A;  3VYU B;  1GDT A;  1U6G A;  2LNM A;  1TBX A;  3WTX C;  4I09 A;  5HS9 A;  5EEA A;  2LRD A;  2DDB A;  2YSR A;  3R0A A;  4LFU A;  3TW6 A;  4A3M J;  3LSI A;  2M2E A;  1IG7 A;  4HF1 A;  3A9Z A;  2LLV A;  2Z2S B;  1T33 A;  2JMW A;  4M73 A;  1FOY A;  3QOE A;  4Z5D A;  1Y0N A;  4KIC A;  1XC5 A;  2KIF A;  4X1E A;  3DV8 A;  3S8Q A;  1QA6 A;  3PJR A;  2F5F A;  2FOK A;  4F8D A;  3RPU A;  3OSF A;  2O9L A;  2Q2E A;  1BW6 A;  3GXO A;  3ISP A;  2ZXI A;  3S32 A;  2XIG A;  4IXA A;  4CSW A;  2W4S A;  1WHU A;  2X85 A;  5JI6 A;  5FGM A;  2MH2 A;  4BL0 B;  2TCT A;  3P7N A;  1JFT A;  1FBS A;  5FD6 A;  1O3R A;  1G3T A;  4CCL A;  1MBG A;  3PQK A;  1R4N B;  3HGY A;  1BDH A;  3G7D A;  3QFI A;  1WH5 A;  4BH9 A;  1FEX A;  1NER A;  4G94 A;  1VQ9 I;  2QSF X;  3B6C A;  3MKZ A;  1KQ8 A;  2VJI A;  4KUM A;  3WHB A;  1WGX A;  4YFN F;  4UNO A;  1MMG A;  3CLO A;  2EIN H;  4LMY A;  2FF4 A;  2ODR D;  3OR2 C;  3EPZ A;  2X6X A;  3KP6 A;  1X3W B;  3A1Y A;  1N25 A;  4RAG A;  2XUB A;  3EUH C;  2G0E A;  4C3J J;  3RZO J;  2M5W A;  3RZZ A;  2X9D A;  3ABL H;  4B09 A;  3F8N A;  2XGX A;  4IZZ A;  2XAS A;  4IQ4 A;  4A0X A;  3QOX A;  5E1X A;  2IW5 A;  4DZJ A;  2M4K A;  1T08 B;  1EH8 A;  5LRR A;  4I2O A;  1JH9 A;  4YG7 B;  1K4T A;  1FYK A;  1I1G A;  4RB1 A;  5IYD J;  4G12 A;  3KL4 A;  2GBY A;  4DJA A;  5EF6 A;  3S93 A;  3HRM A;  2VBZ A;  1JE8 A;  2YU9 J;  4PJJ A;  1ORK A;  5FD5 A;  3VSL A;  1DGR M;  1SFU A;  3FK7 A;  1YIT I;  4LB6 B;  2MC4 A;  4G7Z F;  1R69 A;  5BQT A;  5DS9 A;  1NHA A;  2ZXW H;  3M07 A;  2ELK A;  1BI1 A;  1RIO H;  2YPR A;  4JQD A;  1ZN2 A;  3HPH A;  4LLG F;  3ZQQ A;  1RKW A;  5GTI C;  5DEQ A;  1FMW A;  3S1N J;  2AUW A;  1P9Q C;  1FOX A;  1QZZ A;  1Z21 A;  2OZU A;  1OKR A;  4HLX A;  4S05 A;  2R0Q C;  3FXK A;  4J1X A;  1JWL A;  5J6X A;  1BI3 A;  2VKE A;  1ON2 A;  1E3P A;  4ITV A;  2R7W A;  4I6T A;  3RKY A;  2HU9 A;  4H0E A;  2XSD C;  1XDU A;  4ETS A;  1M1E B;  4M72 A;  3LA7 A;  3ZOB A;  4WX9 A;  4YG1 A;  4BHB A;  3ONQ A;  2YR2 A;  4BQQ A;  2W84 A;  4II2 A;  1GV2 A;  3LAJ A;  3WG7 H;  1ZAR A;  4IHX A;  2EH3 A;  1TLH B;  3G6E I;  3DTE A;  2MGQ A;  3I58 A;  1DPR A;  2HYJ A;  2XC7 A;  2V1U A;  3LNQ A;  2D5V A;  1RZR A;  1AHD P;  1ZZ6 A;  3JRH A;  5GAE J;  2KDZ A;  3BQZ A;  1SQ8 A;  2QKL B;  3F9K A;  3NWT A;  3H9J A;  3A9X A;  4PJ0 C;  1ZK8 A;  2KRH A;  4NQW B;  2V6E A;  3HG9 A;  3BR3 A;  1TQM A;  3F21 A;  3JTG A;  1OYW A;  1W5T A;  3QWL A;  4UUS A;  1WPK A;  1XCB A;  1H9G A;  4XKV A;  1MD0 A;  4L5E A;  1CQT A;  5FLV A;  3SR4 A;  4CO8 A;  2O61 A;  3HM5 A;  2LD5 A;  3CLC A;  2F5E A;  2JRM A;  3CCR I;  2FBI A;  2DTR A;  3TDZ C;  3OSG A;  1JGS A;  1J7K A;  1QGP A;  3QYB A;  3KJX A;  4JOM A;  1E17 A;  2ETH A;  2BNO A;  4J19 A;  1TQI A;  4A3E J;  2LC2 A;  2XGC A;  1V5E A;  3V7C A;  2G7U A;  2M0C A;  4JCX A;  5F04 A;  1UCR A;  1T56 A;  2MH9 A;  1IAW A;  5JFR A;  1FOK A;  2A3S A;  2KKO A;  5F6F A;  3TEL A;  3CTA A;  3WGH A;  4BQO A;  4IVN A;  2O5R A;  3QYF A;  4A3K J;  1XSX A;  1RUO A;  1IN5 A;  1YYV A;  4U87 A;  1U78 A;  3KFW X;  2X1D A;  4Y15 A;  2WB1 A;  3DPT A;  4YFX F;  4V19 K;  5LFA A;  4DBR A;  3KEQ A;  2DFF A;  1N77 A;  2WTE A;  4ZYH A;  4E7J A;  3NAU A;  3LSR A;  1WH6 A;  4AIJ A;  2PIJ A;  4GHJ A;  4LG3 A;  3N97 A;  3RI4 A;  1FP1 D;  2NVU B;  2Q1Z B;  1Z05 A;  3V8J A;  1MMS A;  2KZG A;  1ENH A;  3H3Z A;  4S0H B;  1IRG A;  3GFM A;  2MXD A;  2PXP A;  1PYV A;  3TP3 A;  1ZZ9 A;  4G6D A;  5E1W A;  4AVP A;  4C3H J;  3PE5 A;  3I55 I;  2ZFW A;  3D5L A;  4XLC A;  4JYK A;  3LOC A;  5CVU A;  2L9N A;  1SAN A;  1T2K A;  2E1N A;  1TT5 B;  2HI3 A;  4UUS B;  2DFH A;  3VWB A;  4KIS A;  2GXG A;  4ESF A;  4F91 B;  1P6R A;  2IA2 A;  2OD5 A;  2CG4 A;  1LMB 3;  1SD5 A;  2IXS A;  1TZL A;  2KT0 A;  1LFB A;  1UZC A;  4EVI A;  5LGT A;  2HXO A;  3E1S A;  5EDN A;  4A3J J;  5E20 A;  3I59 B;  4EV0 A;  1F5T A;  1NEQ A;  1YG2 A;  3WU1 B;  2QQA A;  4G7H F;  4B48 A;  2K3F A;  3LST A;  2DTZ A;  2CQ7 A;  3Q0W A;  2M7B A;  2BGC A;  4M9X A;  5HLT A;  4M71 A;  2KFD A;  2E1M B;  2L54 A;  2V9K A;  3CLQ A;  4LJZ F;  1QB2 A;  4F52 A;  3FMR A;  3ELK A;  4XN0 A;  2H6C A;  3OIO A;  4M6Y A;  4FTH A;  1XMK A;  1B6A A;  3DFG A;  2QUF A;  2K27 A;  2VKV A;  3BOQ A;  2C6Y A;  3CUQ C;  3EUK L;  5F08 A;  1EH7 A;  3SQN A;  4O8B A;  3PSI A;  3E7L A;  3U21 A;  2HCN A;  1W36 C;  4ENN A;  1EF4 A;  2G7H A;  2R7X A;  1NW3 A;  2F2E A;  1G2H A;  1WJA A;  2PMU A;  3MKW B;  1JUP A;  1SMY F;  4IKF A;  2XCJ A;  2NVY J;  2XPV A;  4A5N A;  1B1B A;  2ECC A;  3W2W A;  3OYM A;  2KPM A;  4CUG A;  1PRV A;  2MQK A;  2R1J L;  3ABU A;  4NB5 A;  2JA6 J;  2XI8 A;  1W1W E;  5HOO A;  2PJP A;  1QVT A;  4ZDP A;  3ZQF A;  1BOA A;  4UVC A;  4XSZ F;  2HYF A;  2ISZ A;  2A68 F;  2JUC A;  1W0U A;  3DKW A;  3EET A;  3OQM A;  4GYG A;  3K70 D;  1R1T A;  1S8N A;  3CC4 I;  1UTX A;  1UHW A;  5D8K B;  2EFN A;  4FT8 A;  2EFO A;  3S3O A;  1VPW A;  2ICP A;  3BJ6 A;  1MH4 A;  1R6R A;  2ID6 A;  3CRO L;  3BR2 A;  4U0W A;  1WH7 A;  4L9N A;  5D5V B;  3UFD A;  1AWC A;  3SX0 A;  3D0S A;  2IGM A;  2OU2 A;  2F4O B;  3KYC B;  2P7C B;  3CCJ I;  4IA8 A;  1MSE C;  5FJ8 J;  3PUB A;  1ZRC A;  4WVL A;  2LG4 A;  1H89 C;  1R1V A;  5DTQ A;  2O03 A;  4HNU A;  1YS6 A;  4XRS A;  1N78 A;  2BJC A;  1OLT A;  2CO5 A;  1JTY A;  1WJB A;  4I98 B;  2GA2 A;  5KAF C;  1ZS4 A;  3OV8 A;  5KNL A;  1V5F A;  3O8H A;  2QLZ A;  4FIS A;  2Z5U A;  4B44 A;  3GTP J;  3RYR A;  3NXH A;  2Y75 A;  4V2G A;  3BR6 A;  4S04 A;  4WF2 A;  4EJV A;  2HVR A;  4EMS A;  1O7F A;  3G3Z A;  4E70 A;  5F27 A;  5D5W B;  2P5L C;  3JW4 A;  1QRY A;  2O3F A;  4BXU A;  2VE8 A;  2L1P A;  4AVZ A;  5BMZ A;  3KLO A;  5HVQ C;  2NOJ B;  3GW2 A;  4HSR A;  2CV1 A;  4IHW A;  3SZT A;  4LG0 A;  2PMZ N;  1WSU A;  3QU6 A;  2M1B A;  4W1U A;  3W6V A;  2O0Y A;  1ZGW A;  5C4X J;  4E7Z A;  4BHP A;  2K02 A;  4CCO A;  3MZY A;  2XXP A;  1E3O C;  1VQN I;  2ICT A;  1G8X A;  5CQG A;  4XLN F;  2VPL A;  2JUG A;  3DXJ F;  2V4J C;  3VDX A;  1CF7 A;  1IRF A;  2PMZ A;  4O5V A;  4M6X A;  3I9V 2;  5ICE A;  3GBG A;  3JRD A;  4B43 A;  1A35 A;  2VAS A;  2HZT A;  2LY2 A;  2NAZ A;  4XOP A;  3MMY B;  4RDU A;  1OMI A;  3FK6 A;  1MBJ A;  3R0J A;  5DD8 A;  4HOB A;  4PGH A;  4AUX A;  4IEJ A;  4EM1 A;  2L9R A;  1NH3 A;  1HCR A;  5E8I A;  2DQR A;  1RES A;  3LWF A;  4HPQ A;  3B73 A;  1IDZ A;  2WV0 A;  3BWG A;  2F48 A;  3QPT A;  4PUS A;  4LLN A;  1OCP A;  5K1Y A;  2L7M P;  5FRO A;  3HZJ A;  1MNE A;  2DW4 A;  5CYV A;  3SCG A;  3KYD B;  1RC9 A;  1BJZ A;  5GAD J;  2VC0 A;  4MLO A;  1K78 A;  2IT0 A;  2LYC A;  4E7L A;  2ESH A;  5LGU A;  3MN2 A;  1OCR H;  1JKO C;  4XL9 A;  3IH2 A;  2VB6 A;  3GX4 X;  1W5S A;  1VTN C;  1F43 A;  1D0X A;  3LQR A;  3FYM A;  5FRM A;  3MAJ A;  4WXH A;  4P55 A;  2VJ5 A;  1K61 A;  4LIT A;  3OS1 A;  2Q2E B;  4PSX A;  3T5X A;  2W48 A;  5IYB J;  4BJT A;  5M5W J;  4GFB A;  1ZG3 A;  3H1C A;  4EJW A;  3GTM J;  3G2B A;  5M5X J;  5FKO A;  4N9H A;  2FE3 A;  4EQQ A;  1SEU A;  3HOS A;  3FMY A;  4AWX B;  5GAH i;  2DOD A;  3K0L A;  1YO5 C;  3GFL A;  1P7J A;  2DOE A;  2O7O A;  2F5C A;  2COM A;  3M8E A;  2DT5 A;  1P4A A;  2V79 A;  3B6A A;  3WGG A;  3BR0 A;  2EZI A;  1I6H J;  4ER0 A;  3L2W A;  3BG5 A;  4Y13 A;  3K9T A;  1K83 J;  1UHS A;  3U2R A;  3VYS B;  2PG4 A;  2PFB A;  4BGD A;  2JA8 J;  3E6C C;  3BZC A;  2XKO A;  4BYY A;  1UB9 A;  2MSY A;  3OS0 A;  2RNJ A;  2MLK A;  2XF5 A;  1OPC A;  4IHT A;  5HLH A;  2VN2 A;  1J09 A;  1LQ1 A;  4O3M A;  3A4C A;  3HDD A;  3M1C A;  3CCL I;  3NQO A;  5IT9 K;  1R23 A;  1ZZ8 A;  1ETK A;  4EKI A;  1QBJ A;  3E5U A;  1ZRD A;  2PLY A;  1W4M A;  4Y42 A;  3FM5 A;  3GFI A;  4U0Y A;  3BR1 A;  4L5J A;  2LR8 A;  2QA4 I;  2OQR A;  4RLF A;  3NEU A;  3O6B B;  1C0W A;  2STW A;  2D1V A;  4MGR A;  2MD5 A;  2VT2 A;  1BC7 C;  3ZN1 A;  3SCH A;  4B3A A;  1VI0 A;  3M8J A;  2E7W A;  3I59 A;  3WTW C;  3PUF A;  2EK5 A;  5CQE A;  3ZPX A;  1MBE A;  2E2I J;  2Y2Z A;  1BI0 A;  2JPC A;  4XN3 A;  2BY2 A;  3QQA A;  5TIS C;  3LSJ A;  5JVT A;  3TL4 X;  3OYN A;  3OL4 A;  2B5A A;  1T0F C;  2E7X A;  3FIW A;  4G7O F;  4HRA A;  1LNW A;  1SC7 A;  4KIB A;  2YU3 A;  3MLF A;  5D8L B;  3NWS A;  2EWN A;  3I4M J;  1MFQ C;  3DTK A;  1MH3 A;  2GQQ A;  2KZV A;  2BV6 A;  3IKT A;  2ZNY A;  2GIZ A;  3LL7 A;  3BT9 A;  4PSW A;  4E7I A;  1B59 A;  2JK3 A;  4XKW A;  1VQO I;  1D1B A;  4IHV A;  2BNM A;  4JX4 A;  4FHT A;  3AG2 H;  3G0T A;  3L1P A;  1ZUG A;  3GWZ A;  4B47 A;  2A07 F;  1FMV A;  1QHH D;  4I99 C;  1FBQ A;  3WG9 A;  3TRB A;  3UR3 C;  1E0E A;  1RIO A;  4XQF A;  4YG4 A;  4PFO A;  2V9V A;  2WC2 A;  3HOW J;  3O2P E;  1VZ0 A;  2HCS A;  1TW2 A;  3WHC A;  3CES A;  2YS9 A;  1ZR2 A;  2CH0 A;  1JXS A;  4G6T B;  5D4R A;  1XGN A;  2WAF A;  3OYC A;  3S2H J;  2OBP A;  3I3L A;  3BTL A;  4HX4 A;  4OMY A;  1FYL A;  3KE2 A;  3QPS A;  3CC7 I;  1BA5 A;  3P9K A;  3K2Z A;  4JP0 A;  1ETW A;  5JHU A;  1BW5 A;  2LLW A;  3JSP A;  5LD2 C;  4MO7 A;  2E2J J;  2PUD A;  5CJ9 A;  3H9Q A;  5L3F A;  1X2M A;  3OYA A;  3K4C A;  2DT6 A;  3LA2 A;  2CV2 A;  3AL0 B;  2DA3 A;  1GT0 C;  1TWC J;  2VJJ A;  1Z3X A;  2IS1 A;  3FXO A;  1MW7 A;  3S2W A;  2VON A;  1I5Z A;  4Q48 A;  1YE9 A;  2R7U A;  4OAY A;  2MG4 A;  3CJN A;  4AYB A;  1EV7 A;  2PXU A;  1F9N A;  3BG7 A;  4MEY F;  5C3E J;  2LY1 A;  4BEH B;  3P9I A; 
#chains in the Genus database with same CATH homology
 3TED A;  3HOU J;  3EUS A;  1R9T J;  4IVZ A;  1IDY A;  3HOZ J;  2PUE A;  2JCG A;  4YAR A;  4DZJ A;  4JX5 A;  2VI6 A;  1JH9 A;  4YG7 B;  5IPA A;  2O8K A;  2CJJ A;  3A01 A;  4BBS J;  5IYD J;  5FKN A;  3A01 B;  4G12 A;  2OFY A;  2GBY A;  2AWI A;  3DCF A;  5K7Z A;  5EF6 A;  1IC8 A;  1JFS A;  2DJN A;  5IP6 A;  4C2M J;  4V2F A;  1ETX A;  5IOZ A;  1ORK A;  2YU9 J;  1DWK A;  3S15 J;  2Y30 A;  2HXI A;  3FK7 A;  1ZQ3 P;  2WV1 A;  3PM1 A;  5DS9 A;  1R69 A;  3F6W A;  4BXX J;  2XIU A;  3JXB C;  3GTJ J;  2ELK A;  1UMQ A;  4DYC A;  4JQD A;  1HF0 A;  1RKW A;  1ZKG A;  2AUW A;  3S1N J;  4XK4 A;  3IH3 A;  2R0Q C;  1RKT A;  4J1X A;  2HQ5 A;  1JWL A;  2IVQ A;  2VKE A;  2E19 A;  5M5Y J;  1AU7 A;  4I6T A;  1VF9 A;  2LY9 A;  5IOY A;  2XSD C;  1MNM C;  2L8N A;  4X4D A;  2L0K A;  3BTI A;  3ZOB A;  5M3M J;  4YG1 A;  2Y9Y A;  2EZL A;  1A6I A;  4QSH A;  2X48 A;  1GV2 A;  2XB0 X;  1POU A;  4OB4 A;  4IHX A;  1JKQ C;  2EH3 A;  2P81 A;  1JT6 A;  3HB9 A;  3QQ6 A;  2DA5 A;  2MGQ A;  2HYJ A;  1VND A;  1GVD A;  2E1O A;  3LNQ A;  2D5V A;  1ZZB A;  1AHD P;  1YRN B;  1ZZ6 A;  3JRH A;  1RZR A;  2KDZ A;  3BQZ A;  2XRL A;  1SQ8 A;  5EG0 B;  2CUE A;  4DZP A;  3ZQL A;  3S2D J;  1ZK8 A;  2IBD A;  4FN3 A;  1UXC A;  3BR3 A;  1W0T A;  4A93 J;  3CQZ J;  1X58 A;  3QF3 A;  3HBL A;  4UUS A;  1WPK A;  5FLV A;  1CQT A;  4L5E A;  4Z5C A;  1ZR4 A;  3ZHI A;  3HM5 A;  2LD5 A;  3S16 J;  2MEZ A;  4D7N A;  3CLC A;  2DA6 A;  4MCX A;  2XJ3 A;  3GTO J;  3OSG A;  1ITY A;  4EEF G;  3ZQG A;  2NVT J;  4M3G A;  3KJX A;  4QTR A;  3S1Q J;  3JRG A;  1D5Y A;  3S1M J;  5IYC J;  2BNO A;  1IJW C;  1POG A;  1QPI A;  3GN5 A;  4J19 A;  3UKG A;  4A3E J;  2L49 A;  4MFE A;  1RZR D;  2XGC A;  1NTC A;  2JN6 A;  2M0C A;  2LCV A;  4JCX A;  1MBH A;  5F04 A;  4MFD A;  3GTQ J;  1T56 A;  4I76 A;  2HOS A;  2LYP A;  2HOT A;  1UXD A;  1ETV A;  3PXP A;  2KPJ A;  3MKL A;  1APL C;  4UUT A;  1XG1 A;  4JCY A;  5EZG A;  2CSF A;  4A3K J;  1U78 A;  2PUC A;  1RZS A;  1JJ8 C;  2AO9 A;  1U8B A;  4M3E A;  1X2L A;  1QP0 A;  3JR9 A;  4X4C A;  1LCD A;  3GBF A;  2EF8 A;  3NAU A;  3QWG A;  2PUB A;  3LSR A;  5IP9 J;  1WH6 A;  2PIJ A;  4GHJ A;  1R63 A;  5K98 B;  1ZVV A;  1I3Q J;  5IP7 J;  1ENH A;  4S0H B;  3S14 J;  3TP3 A;  1ZZ9 A;  1Y1V J;  4C3H J;  3ZQC A;  5EGO A;  3F52 A;  2LFB A;  3QYX A;  1DU0 A;  3G1M A;  1Y1W J;  2NS7 A;  3C2B A;  4JYK A;  3LOC A;  5E3N A;  1L1M A;  1SAN A;  1JJ6 C;  2HI3 A;  4UUS B;  4IHY A;  3F51 A;  1LMB 3;  2EWT A;  4W97 A;  2KT0 A;  1LFB A;  1PER L;  4A3J J;  2IU7 A;  2HXO A;  5EDN A;  2IV1 A;  1WET A;  1NEQ A;  5GP9 A;  3JRC A;  1EFA A;  4X4I A;  2AXU A;  2DMN A;  3LSP A;  2DA2 A;  2DTZ A;  1B8I A;  3Q0V A;  2Y9Z A;  1PUF A;  3G5G A;  1OSL A;  3Q0W A;  2KZ8 A;  2KEK A;  4X4H A;  3PO2 J;  3JXC L;  1BDI A;  4XRS G;  1LE8 B;  1TC3 C;  1LE8 A;  1HDD C;  2R7Z J;  2DN0 A;  1QP7 A;  3GN5 B;  2LYJ A;  2EZH A;  3QPL A;  1QVU A;  4A3L J;  3OIO A;  4FTH A;  2GZU A;  2CRO A;  2VKV A;  2M9H A;  1O4X A;  2JWT A;  1ETQ A;  2XPW A;  3HZI B;  5F08 A;  4O8B A;  2PUA A;  5F0C A;  3HOY J;  3OOU A;  1ZAY A;  3E7L A;  1I50 J;  5GPA A;  4X6A J;  1EF4 A;  1G2H A;  3BTC A;  2QF7 A;  5F0H A;  3BQY A;  5M3F J;  3OQN A;  1JUP A;  1IRZ A;  2X6O A;  2XCJ A;  2NVY J;  2XPV A;  2ECC A;  2MQK A;  1Y9Q A;  1H88 C;  2R1J L;  1PRV A;  1ETO A;  2K9S A;  2JA6 J;  4BY7 J;  2IVG A;  2Y31 A;  2XI8 A;  3TP0 A;  4Z59 A;  5A7L A;  5K7F A;  1QVT A;  3ZQF A;  2DMQ A;  3TW7 A;  4DYQ A;  2GM4 A;  1MSF C;  2WUS R;  1YSE A;  1MBF A;  3KZ3 A;  1W0U A;  5FKK A;  2I10 A;  4DYR A;  3OQM A;  4XIC A;  2B63 J;  1UTX A;  1QP4 A;  3I4N J;  3DNV B;  1HDP A;  3HKZ N;  2JA5 J;  2PUG A;  1U9O A;  1VPW A;  2ICP A;  3G1O A;  1MH4 A;  2FQ4 A;  2ID6 A;  3RKQ A;  1VFC A;  3BR2 A;  2IUO A;  2DMT A;  3CRO L;  1WH7 A;  3BTJ A;  2EQR A;  3B7H A;  3UFD A;  2Y0S N;  4PU7 A;  5FKM A;  4A3F J;  3DEW A;  1FJL A;  3M3Y J;  2NOG A;  1HLV A;  4IA8 A;  1MSE C;  3OQO A;  5FJ8 J;  4A3G J;  4BBR J;  1DW9 A;  1TWG J;  3HGG A;  2H8R A;  1RPE L;  2PE5 A;  2VPR A;  1H89 C;  2BJC A;  4XRS A;  2FX0 A;  3BG9 A;  1TWA J;  1JTY A;  2EBY A;  1B8I B;  2L7F P;  5E3M A;  4CYC A;  4B4C A;  3H3V K;  3GTK J;  4B1R A;  3NAR A;  1ZS4 A;  1FIA A;  2VUM J;  3O8H A;  5EGO B;  4D5F A;  4FIS A;  3BDN A;  3GTP J;  3HOX J;  3S17 J;  4MCT A;  3Q3S A;  3SJM A;  1U9N A;  2ZB9 A;  4V2G A;  3BR6 A;  1ZZ7 A;  2AXV A;  2HSG A;  3VK0 A;  2GRL A;  3OMT A;  3SFI A;  5F27 A;  2XB5 A;  1P7I A;  2LTP A;  2DA1 A;  2OR1 L;  4M3D A;  2R5Z B;  1QRY A;  1LQC A;  5E3L A;  3ZQH A;  4M6V A;  1FIP A;  2LYR A;  3IVP A;  3SCF A;  4IHW A;  2AW6 A;  5DTD A;  2XGD A;  2BNN A;  2PMZ N;  1ETY A;  4W1U A;  3W6V A;  5J3L A;  2AHQ A;  1ZGW A;  5C4X J;  4PU4 C;  4BKX A;  3FYA A;  1E3O C;  2NS8 A;  2GLO A;  2O4A A;  3MVP A;  2QCO A;  2IVB A;  2ICT A;  1TWH J;  4A3B J;  1A5J A;  2XPU A;  3IV5 A;  1OJL A;  1WCM J;  2DMU A;  2IAI A;  3JRD A;  3GBG A;  2ECB A;  4M3B A;  4RDU A;  3FK6 A;  1MBJ A;  1JKR C;  1XWR A;  4NDW A;  1DU6 A;  4AUX A;  4IEJ A;  1UG2 A;  2L9R A;  2R92 J;  1ZPQ A;  1HCR A;  1Q1V A;  1IGN A;  2CUF A;  1WI3 A;  1Z0X A;  1RES A;  2RAE A;  4J1W A;  4X4B A;  3OP9 A;  1IDZ A;  3GTG J;  3ZHM A;  3JXD L;  4A69 C;  3O9X A;  2KEJ A;  1OCP A;  2JVL A;  2L7M P;  2L7Z A;  4D7M A;  3SCG A;  1RR7 A;  2M34 A;  1BJZ A;  9ANT A;  4FBI A;  1GV5 A;  4MLO A;  4Y52 J;  5C44 J;  3JRI A;  2DA7 A;  1PRU A;  4I6Z A;  3MN2 A;  1H8A C;  5FLM J;  2FJ1 A;  1JUS A;  4CYC B;  1JKO C;  3IH2 A;  3O8G A;  4QIW N;  4Z58 A;  1F43 A;  2MW8 A;  2NVX J;  2WIU B;  2YUS A;  2R5Z A;  3FYM A;  2WAQ N;  2OPT A;  3K2A A;  4FCY A;  1LCC A;  4Y7N J;  3JRB A;  1IV6 A;  4A3C J;  1K61 A;  1IUF A;  2EBI A;  2R63 A;  2W48 A;  1QQB A;  5IYB J;  5M5W J;  4GFB A;  2K9N A;  2LP0 A;  3K7A J;  3JRF A;  2CQQ A;  5M5X J;  3GTM J;  5FKO A;  4I6U A;  3SDG A;  4X4G A;  4IWR A;  3BS3 A;  1B72 B;  2GRM A;  1ZZC A;  3FMY A;  1PNR A;  3VPR A;  1WIZ A;  1P7J A;  2O7O A;  5C4J J;  4AYB N;  2NVQ J;  3LFP A;  3A02 A;  2H1K A;  3B6A A;  3BR0 A;  2EZI A;  3IH4 A;  4D5C A;  3HOV J;  2LVS A;  2WB1 N;  3BG5 A;  1I6H J;  3HEF A;  4XRM A;  1K83 J;  1UHS A;  3A03 A;  5BNG A;  2JA8 J;  2FJR A;  4PU3 C;  1JKP C;  2MSY A;  1B0N A;  5E3O A;  3CCY A;  1OCT C;  3BR5 A;  2R5Y A;  1NK2 P;  3JRA A;  2R5Y B;  3BG3 A;  3HDD A;  1X2N A;  1BL0 A;  2PPX A;  3S1R J;  2JJ7 A;  5K7H A;  3RQI A;  1ZZ8 A;  1ETK A;  2KEI A;  4Y42 A;  3ZKC A;  1JTX A;  4AC0 A;  3CMY A;  2LKX A;  2CRG A;  2DMP A;  4DW6 A;  5F0F A;  2LYS A;  3CEC A;  4X4E A;  4HNV A;  3BR1 A;  5JLX A;  1QPZ A;  3BD1 A;  2LR8 A;  2HOA A;  4A3D J;  1LFU P;  2CQX A;  2R93 J;  3F0C A;  2ME0 A;  1B72 A;  1WH8 A;  4GQM A;  2TRT A;  2LK2 A;  3SCH A;  3FIS A;  1VI0 A;  4B3A A;  3M4O J;  2O38 A;  2O49 A;  3LIS A;  1AKH A;  1S7E A;  4FE4 A;  1RPW A;  1MBE A;  2M8G X;  5GPC A;  3D1N I;  2Y2Z A;  2E2I J;  2JA7 J;  4PU8 A;  4MIM A;  1QQA A;  1JGG A;  3QQA A;  3H0G J;  3LSJ A;  1PUF B;  3H5T A;  1JUM A;  1CJG A;  2PUF A;  3Q0U A;  2K9Q A;  5J1Y A;  2B5A A;  5HOD A;  3FIW A;  1OFC X;  5JLW A;  2LYL A;  2OF7 A;  2COB A;  2N8G A;  3PO3 J;  1RET A;  3LSG A;  2AXZ A;  2LYQ A;  3U3W A;  3G1L A;  1MBK A;  3KXA A;  4Z5H A;  3MLF A;  4I8T A;  1GUU A;  3FKI J;  3I4M J;  1MH3 A;  4BY1 J;  2HDD A;  2ME6 A;  1GDT A;  1SFO J;  2K40 A;  5EEA A;  3TW6 A;  3JRE A;  4A3M J;  2M2E A;  1ADR A;  3BT9 A;  1PRA A;  1IG7 A;  4IHV A;  2JK3 A;  2BNM A;  4JX4 A;  1T33 A;  2JMW A;  3L1P A;  2E2H J;  1ZUG A;  4Z5D A;  5FKL A;  5EG0 A;  4M3F A;  1FTT A;  4I6R A;  1XC5 A;  1ZTR A;  4X1E A;  3TRB A;  3S8Q A;  1RIO A;  1AKH B;  4YG4 A;  4X4F A;  4NDL A;  1HOM A;  1F36 A;  3HOW J;  4F8D A;  3OSF A;  2O9L A;  5EZH A;  4JX6 A;  1BW6 A;  3WHC A;  2YS9 A;  3CDL A;  1ZR2 A;  4FE7 A;  2IEK A;  3S2H J;  1JT0 A;  2CU7 A;  3BTL A;  4YBA A;  4XID A;  2EZK A;  2TCT A;  3RZD J;  3QPS A;  1XS9 A;  1JFT A;  1BA5 A;  5J1U A;  2DA4 A;  4JP0 A;  2LLK A;  1MBG A;  1ETW A;  4ABZ A;  1BDH A;  3HGY A;  1BW5 A;  5J1R A;  3G7D A;  1TWF J;  2ID3 A;  1WH5 A;  1FEX A;  2E2J J;  2PUD A;  4MO7 A;  2HIN A;  2FD5 A;  1NER A;  3ZQI A;  4RBO A;  1LLI A;  1X2M A;  3B6C A;  1FTZ A;  2LYK A;  2DA3 A;  3WHB A;  1TWC J;  1WGX A;  5F1J A;  1GT0 C;  1YRN A;  4LOC A;  4C3I J;  2A6C A;  3GTL J;  1Y7Y A;  2MG4 A;  1Z77 A;  1NK3 P;  5EYR A;  2XGE A;  3R1F A;  2G0E A;  4C3J J;  5C3E J;  4A3I J;  3RZO J;  3RZZ A;  2X9D A;  1X57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...