1HF0A

Crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
128
Chain Sequence
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords OCTAMER-BINDING TRANSCRIPTION FACTOR 1
total genus 43
structure length 128
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hf0A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1hf0A01
3HM5A 3O8GA 1PERL 1XC5A 3I4MJ 2XJ3A 1ETXA 3FISA 2KEJA 4X4FA 2CSFA 2WB1N 3JRGA 2HOTA 1BW6A 4A3LJ 2L7FP 3LOCA 2I10A 3DNVB 2NVQJ 2HXOA 2M9HA 3I4NJ 4M6VA 2DA7A 2NOGA 2ELKA 5IOYA 2NVYJ 4FN3A 3HOYJ 4QIWN 4A3CJ 1Y9QA 2ECCA 1GDTA 1MH3A 3B6CA 1ZR4A 1MBKA 5FJ8J 4J19A 1B8IB 1Y1WJ 2MEZA 1RIOA 2PUEA 2M2EA 4Z5CA 4IVZA 4J1WA 4YG4A 3HGYA 2NS8A 1JUPA 3HOXJ 1EFAA 1MBHA 4IEJA 2LYSA 2PUDA 1QVTA 1YSEA 4XRMA 4NDLA 1U8BA 2DJNA 3QQAA 3BR0A 4OB4A 1QP0A 5FKKA 1T56A 4BY1J 4UUSB 4YBAA 2X9DA 5J1UA 3GTPJ 1PRUA 2ME6A 3W6VA 4FBIA 1MBGA 2HI3A 3RQIA 1WI3A 1NEQA 4A3GJ 3BG3A 3GBGA 3MN2A 2KEKA 1IV6A 3IH4A 1ZZ9A 4X4CA 3BS3A 3Q0UA 2HYJA 4MCXA 1DU6A 3SCGA 1RKWA 2E2HJ 1D5YA 2CU7A 5EZGA 1UTXA 2EF8A 2ID6A 2Y9ZA 2YS9A 1IDYA 3QPLA 1LLIA 1JJ6C 1LCDA 4MCTA 4M3FA 2EZIA 4L5EA 3F0CA 1ETWA 3QWGA 1ETOA 1ZUGA 3Q0VA 3BTLA 3DCFA 3FKIJ 1WH5A 1UXDA 1LFBA 2A6CA 2MSYA 2MG4A 2M8GX 1BJZA 5HODA 3BR6A 3BQZA 2JA7J 4NDWA 1ORKA 3CCYA 3CROL 4JQDA 2HINA 3HBLA 2PIJA 1XS9A 1IGNA 4RBOA 3B7HA 4F8DA 3JR9A 4X4EA 1LFUP 2LYRA 4IHYA 3KZ3A 4JCXA 2BNNA 3VPRA 3S8QA 2H8RA 2KEIA 2LYPA 3FYMA 3OIOA 2PUCA 2K40A 5EG0A 1EF4A 2PPXA 1CJGA 2XIUA 3JRHA 4ABZA 2R5YB 1K61A 3M3YJ 4DZPA 2IVBA 1H89C 3BTJA 3JXCL 1APLC 4BY7J 2OF7A 1P7JA 1ZZBA 4JX4A 2HOSA 2AXVA 1S7EA 4X4DA 2PUGA 1HDDC 3CLCA 4Y52J 4YG1A 1RETA 2DA2A 4AC0A 1OCTC 3JREA 3OQOA 1JJ8C 1GV2A 2FQ4A 3ZKCA 1YRNB 1QRYA 1F43A 3H0GJ 3ZQHA 2PUAA 2H1KA 3JRIA 2DA1A 4B3AA 1ENHA 3JXDL 5EF6A 1MBJA 2YU9J 3SCHA 2LLKA 1WETA 2VKVA 1Y7YA 1NK2P 1H8AC 3RZOJ 1LE8B 2FX0A 2GLOA 5GPCA 2LP0A 3ZQIA 2ZB9A 1QPIA 4I8TA 4V2FA 5E3OA 4GFBA 3NARA 3K2AA 2AW6A 4I6TA 3LSJA 1TWGJ 2Y2ZA 3A03A 3BT9A 2WUSR 2BNOA 2DMTA 1B72A 1SANA 1PRAA 1IUFA 5EEAA 3K7AJ 3ZOBA 5BNGA 1TWAJ 4S0HB 3GTJJ 3GTKJ 3OSFA 1MSEC 2JVLA 3SCFA 1QQAA 4XRSA 2HQ5A 1K83J 2R93J 1ZZCA 3PO2J 5F04A 2GRMA 5E3MA 2DA3A 2R0QC 2VPRA 1BL0A 3LSGA 2CRGA 2ME0A 1NK3P 4X4GA 3BG9A 1POGA 1HF0A 2FD5A 2LY9A 3FK7A 2RAEA 4UUSA 1QP4A 2CUFA 4MLOA 2E19A 1VI0A 3BTCA 4Z58A 4DYQA 1ZPQA 3A01B 2IBDA 1GT0C 1LE8A 4J1XA 1ADRA 4HNVA 2XB5A 1JKQC 3OOUA 4V2GA 2B63J 1MBFA 1VPWA 2XRLA 4DYRA 2L7MP 3HGGA 5IP6A 3JRAA 3IH3A 2WV1A 2EQRA 2COBA 2O7OA 3O9XA 5IP9J 5EDNA 2EH3A 1JKPC 1UG2A 2OR1L 3ZQGA 2L9RA 5C44J 1DW9A 4X6AJ 2XPWA 5GP9A 1MSFC 1RPEL 2K9NA 3UKGA 5IYDJ 3GN5B 1ZAYA 1ZZ7A 3Q3SA 2GRLA 1A5JA 4AUXA 4MFEA 1MNMC 3L1PA 4Z5DA 3D1NI 2O8KA 3GTGJ 4A69C 1PNRA 2AO9A 1H88C 2L8NA 1AU7A 1OSLA 2L0KA 5F0HA 4W1UA 4DYCA 1ETVA 3S2DJ 3BR1A 4A93J 4LOCA 3CMYA 3DEWA 3BTIA 4X4BA 1R69A 1B0NA 2DA6A 2GM4A 2R7ZJ 4O8BA 3E7LA 3G5GA 3PO3J 2EBIA 4PU4C 2CJJA 2WIUB 4BKXA 2R5ZA 2HSGA 4GQMA 1JKOC 2K9QA 2JCGA 1ZS4A 3WHBA 2EBYA 9ANTA 1AKHA 4FISA 3F51A 2X48A 2CUEA 3BR3A 4JX5A 3F6WA 3OQMA 1Q1VA 5K7FA 1HCRA 3GTLJ 4IWRA 1B72B 3HOZJ 2FJRA 3ZHIA 4YARA 2IV1A 1FTTA 4I6UA 1RKTA 2IEKA 5F0FA 4YG7B 1O4XA 1ETQA 2KZ8A 3F52A 5IP7J 4BBSJ 3QQ6A 2BJCA 1ETYA 1X58A 5FKLA 4X1EA 1FIAA 3S1QJ 3GTOJ 4I6ZA 3JRFA 1WH7A 2VKEA 3B6AA 2Y9YA 3LFPA 1R9TJ 2R1JL 3BR5A 3S1RJ 2JWTA 4IHVA 1UXCA 3KXAA 3S14J 1JWLA 4C3IJ 2TCTA 4JX6A 1IDZA 1Z0XA 3OP9A 4D7MA 1PUFB 3IVPA 5FKOA 1QQBA 3H5TA 2O4AA 2CQQA 2AHQA 1I50J 5FKNA 5FLVA 1I3QJ 2NS7A 2EZLA 3TW7A 3KJXA 4MO7A 3OQNA 3S1MJ 2JMWA 4C3HJ 1LMB3 1WCMJ 4B4CA 4XICA 3LSRA 2KPJA 5K98B 1IC8A 4C3JJ 1FTZA 3BR2A 3H3VK 5JLXA 2LFBA 2LYQA 3FMYA 3OSGA 1DU0A 3G7DA 2PUBA 4IHWA 1NERA 3JRCA 4Y42A 5F1JA 3G1MA 2O9LA 3GBFA 3S17J 4C2MJ 1JKRC 3S16J 3EUSA 2DMNA 4PU3C 3FYAA 3ZHMA 2R92J 4A3MJ 2O49A 1MBEA 1TWHJ 2XGCA 1TC3C 2AXUA 2R5ZB 1JH9A 1B8IA 2WAQN 4A3JJ 2JA5J 2IVGA 4FE7A 1VF9A 3BQYA 4Y7NJ 5EGOB 3ZQFA 2JN6A 2L7ZA 1HOMA 2X6OA 4CYCB 1BW5A 1ZGWA 3UFDA 2EZKA 1TWCJ 1WIZA 3GN5A 2CQXA 3HKZN 3QYXA 1WPKA 2TRTA 2DA4A 5GPAA 3BG5A 4BBRJ 2LCVA 1ZVVA 2YUSA 4DW6A 3S2HJ 2JA6J 1G2HA 4MFDA 3IH2A 2XI8A 3RZZA 1PRVA 4I6RA 1R63A 1RZRD 1ZZ8A 5EG0B 2ICTA 1RZRA 5F08A 5F27A 2DMUA 2QCOA 2R5YA 3PM1A 1WH8A 2AXZA 1LCCA 2NVTJ 1JFTA 2BNMA 3RKQA 1IJWC 1X57A 5EYRA 5C4XJ 1ZK8A 2XPVA 3PXPA 1BDIA 2XSDC 4D5CA 2Y31A 5JLWA 4FTHA 2HXIA 1PUFA 2O38A 2IU7A 1QVUA 1YRNA 4IHXA 1RPWA 3R1FA 3U3WA 1JGGA 1X2MA 3S1NJ 4D7NA 3QF3A 3BDNA 2OFYA 1ZQ3P 4XK4A 2ECBA 3TW6A 2MGQA 5K7ZA 2K9SA 5M3FJ 1XWRA 2JK3A 2L49A 4G12A 2GZUA 2E2JJ 1OCPA 4M3BA 1XG1A 2G0EA 5EZHA 1RZSA 2DMQA 1FEXA 2XPUA 2LYKA 4QTRA 2PUFA 4XIDA 3G1LA 2LK2A 3HB9A 3O8HA 5J1RA 1VNDA 5IYBJ 1GVDA 4I76A 3OMTA 1OFCX 1TWFJ 1IRZA 3JRBA 4Z5HA 1ITYA 1JTXA 1HDPA 3IV5A 1ZR2A 2ID3A 3S15J 2N8GA 1P7IA 2EZHA 5IYCJ 5FKMA 3BD1A 2LTPA 2Y0SN 4X4HA 4DZJA 3ZQLA 2OPTA 3FIWA 1E3OC 2M34A 5M5WJ 5IOZA 3MKLA 3JXBC 3TRBA 4B1RA 1BA5A 2LYJA 3TP3A 3CDLA 1QPZA 5A7LA 3JRDA 1LQCA 5DTDA 1Y1VJ 1SFOJ 3CQZJ 1CQTA 2LR8A 1ZKGA 2P81A 3LSPA 4M3EA 1JUMA 4JP0A 1RESA 2EWTA 3HDDA 2LVSA 3HEFA 4PU7A 2XB0X 1VFCA 1IG7A 2DMPA 2AWIA 4CYCA 2W48A 1POUA 2XCJA 3TEDA 4M3DA 1JTYA 1SQ8A 3G1OA 2LYLA 4QSHA 4Z59A 3MVPA 4A3BJ 3A02A 5J3LA 2KDZA 4A3EJ 5EGOA 4XRSG 1NTCA 2DN0A 1A6IA 2LKXA 2DTZA 1Z77A 2MW8A 2AUWA 2Y30A 3ZQCA 1BDHA 1HLVA 1FJLA 1ZZ6A 4D5FA 3CECA 1FIPA 4IA8A 5DS9A 4MIMA 3WHCA 4UUTA 2IAIA 1UHSA 2MQKA 1RR7A 4GHJA 1I6HJ 2VUMJ 1GV5A 4EEFG 2IUOA 1W0TA 1T33A 5M3MJ 1JFSA 5M5YJ 3A01A 5IPAA 3SFIA 2D5VA 2JA8J 2IVQA 1WH6A 3SDGA 3HZIB 5FLMJ 1W0UA 4FE4A 3GTMJ 5K7HA 3VK0A 3TP0A 2HOAA 2R63A 1X2NA 2M0CA 2XGDA 4RDUA 2CROA 3NAUA 2PMZN 1ZTRA 4JCYA 4A3KJ 3C2BA 1L1MA 5E3LA 1WGXA 2QF7A 4AYBN 2E1OA 3HOUJ 1U9OA 1GUUA 4PU8A 3Q0WA 3LNQA 4A3FJ 4A3IJ 5J1YA 3SJMA 3GTQJ 3FK6A 4X4IA 1MH4A 2FJ1A 2HDDA 1JT6A 3MLFA 4W97A 4M3GA 3M4OJ 4FCYA 1JUSA 5C4JJ 2NVXJ 4A3DJ 5E3NA 1DWKA 3LISA 2DA5A 2JJ7A 3QPSA 4JYKA 1U78A 2PE5A 1AKHB 3HOWJ 3RZDJ 4BXXJ 1ETKA 1QP7A 2KT0A 1UMQA 2E2IJ 5M5XJ 2VI6A 2GBYA 2LD5A 1JT0A 3HOVJ 2B5AA 1OJLA 1X2LA 5C3EJ 1AHDP 2ICPA 2XGEA 1U9NA 5F0CA 1F36A
chains in the Genus database with same CATH superfamily
2L01A 2VT2A 4PJMA 2PXEA 3HM5A 4CYDA 4XLAA 2IGKA 2XJ3A 3VEPA 1ETXA 1FSHA 4E7LA 2J7WA 1OYYA 4S05A 5H6RA 3JRGA 3TFLA 2I10A 3DNVB 2WAQA 3I58A 1HA8A 1G3WA 1KQ0A 1T95A 2HXOA 2HYGD 2M9HA 2DA7A 4M6VA 3I4NJ 3OYMA 4IXAA 2CMPA 2K4BA 2NVYJ 3E1SA 4EGZA 1Y39A 1Y9QA 1D0ZA 4F7ZA 1KQ8A 1ZR4A 1MBKA 5FJ8J 4J19A 2W82A 1B8IB 2M2EA 2XGXA 3QPHA 4IVZA 1YE9A 4Z5CA 4PSWA 4YG4A 1D5VA 4KIBA 2NS8A 2ZKZA 1USTA 1JUPA 1EFAA 2V9PA 3MKYB 2PUDA 4XRMA 2A61A 2K27A 4BE1A 3BR0A 3ZCOA 1YLFA 4BQQA 2H94A 2P0WA 3G2BA 5CJ9A 4ENKA 1KZHA 1FT9A 4EJOA 4BY1J 4YBAA 2Q2EB 5J1UA 3Q9SA 3QOWA 1WI3A 2M4HA 1OCOH 1NEQA 2XAFA 4C2UA 2L54A 3IH4A 1S8NA 3I56I 3E5UA 3F8FA 2O0YA 1D5YA 2CU7A 2ID6A 2Y9ZA 1D1CA 2R7VA 3NRVA 1LCDA 1LEAA 1TL8A 1MMDA 1OMIA 2K5CA 3E5XA 3AG2H 5JI6A 4WVLA 1JGSA 1WRJA 1DDNA 3ABLH 3DTIA 3PQJA 3PFYA 4HW0A 2V1XA 2IT0A 4KJZA 3BR6A 4FX0A 1BC7C 1I3AA 3F3XA 1UCRA 3CCYA 4IX7A 4Y15A 2BXYA 2LY2A 3F6VA 4ZC3A 1R5GA 3ZQQA 1QHGA 2P5KA 3IWFA 3ZN1A 5J4YA 1T38A 2LYRA 4X4EA 3CUQC 1B4AA 3ERED 2UXXA 2BXZA 3VPRA 2H8RA 2KEIA 2LYPA 2V6EA 4F92B 1BI2A 2K40A 4XKVA 1R1UA 2XIUA 4N9HA 2PXFA 2QSFX 3QU3A 1H89C 2ZMEB 4BY7J 3RPUA 4C30A 3O6BB 4KFCA 2WB1A 2AXVA 5FD6A 2DXIA 1V4RA 3JREA 2VBYA 4E7KA 1YS6A 2XXQA 2M3AA 3ZQHA 2ZJRF 4A2UA 2CYYA 3K4LA 1U2WA 2CG4A 4B3AA 1ENHA 4XM3A 5JVGF 1MNDA 3QODA 3SZPA 3QOEA 3D5SC 2LLKA 2VKVA 4V19K 3RZOJ 1V55H 1WJFA 5GPCA 3IAM2 1XCBA 4BYYA 3HPHA 1VTNC 1QU3A 2DFFA 2W7NA 4LLLA 3ZMUA 2EWNA 2EFPA 3HC7A 1Z7LA 5ILVA 2B0LA 2DQRA 4NB5A 3IWZA 4OOIA 2BNOA 4KIFA 2DMTA 1SANA 2WAFA 4ZZDA 3ZOBA 3NDBB 3GTKJ 2JVLA 4HQEA 4XRSA 4DQ2A 2GA2A 3L00A 3ZMSA 5E3MA 2DA3A 3FM5A 3KLNA 3OOPA 2GWRA 1PYVA 2KKOA 3LSGA 4FHTA 2VN2A 4KT5C 3HRUA 5D4SA 2STWA 4EMSA 4BQNA 2CFOA 2CUFA 4MLOA 5E1XA 5GAHJ 3M7GA 3BTCA 4Z58A 5FLXZ 2XIGA 1ZPQA 2E1MB 1ADRA 2KJCA 5B1BH 3A9ZA 4M6YA 1MBFA 4KA4A 1Z7UA 2EFOA 3OYBA 1SD4A 3O9XA 3IH3A 2CS3A 2F4MB 3ASNH 5EDNA 4I2OA 4EK9A 1JKPC 4BHBA 4II2A 5ICCA 4X6AJ 2XPWA 5GP9A 1MSFC 2K9NA 5IYDJ 3HXLA 3CCRI 3H3ZA 2GRLA 3OYEA 3D0SA 4CZCA 4M9SA 3GMEA 2PXKA 3HSRA 4Z5DA 2R7SA 4ER7A 1LUJB 1WVRA 1HW5A 3FMRA 5E1ZB 2IA1A 3OYGA 2P7CB 2AO9A 2NNNA 1OSLA 2HCNA 1LMB3 1Z3XA 1ETVA 1BR4A 2E7WA 5D4RA 4HEA2 4A93J 2OCEA 2QQAA 3E6MA 2E34A 4WXHA 4N0BA 1W1WE 1R69A 2H27A 1B0NA 2GM4A 2X0LA 2CGPA 3L9FA 3J7YJ 4HF1A 4OIQF 4YFXF 4GXOA 4PU4C 2HSGA 2HCSA 5DV5A 1QA6A 1HSTA 5CVVA 2PJPA 4XQFA 9ANTA 4KIGA 3I59B 3IRQA 1BBYA 5E8GA 4JX5A 5DTQA 3OQMA 1IRFA 4YARA 1HKTA 4L9VA 1RKTA 5EEGA 4YRVA 4MQ9F 1ZN2A 2PMZA 3KEOA 5FKLA 1SFEA 1Y0NA 4BL0B 3CF2A 3LA2A 3OYNA 2B9SA 4PK4A 4RS8A 2HQNA 4LLGF 3JRFA 1WH7A 2VKEA 1H0MA 2Y9YA 1HSJA 1R9TJ 1XX5A 3BR5A 3A2KA 4MTDA 2DTRA 4OAZA 3KZYA 2GOXB 3J81Z 3HG9A 5BMZA 3S93A 2A6HF 1MMSA 4IVNA 2TCTA 2VQHA 4JX6A 3LA3A 4LIUA 3OYAA 3EYIA 4EKGA 4D7MA 1MJAA 5J8FA 5FKOA 2XKOA 4CGZA 1MW7A 1T08B 3KPHA 1RI7A 2AHQA 3GEZA 4IOCF 5FLVA 5L3GA 3RTRA 3L09A 1JHHA 4O5VA 4C3HJ 2KMUA 3BJ6A 3QRFF 1LNWA 5JLXA 3FMYA 2LYQA 4IF4A 3K1PA 2E60A 1K6YA 3RI4A 3G7DA 5F1JA 3RKYA 3NEUA 3GBFA 2O61A 3EUSA 2DMNA 1R6RA 2EPFA 4XLCA 2L1PA 1MBEA 3I55I 2XGCA 2AXUA 4XKBA 3CZ6A 2OAZA 2JQEA 2IVGA 1VF9A 3M8EA 1DP3A 2HFZA 2WBMA 1DPUA 4BUPA 1UG0A 3AKZA 2WWYA 3TOAA 1FYLA 3ZP5A 1BW5A 5K5RA 1WIZA 3GN5A 3HKZN 4EM0B 3BG5A 4BACA 2DT7B 2LCVA 3P5JA 1ZVVA 2ZJPF 2YUSA 2K9LA 1Z21A 2EV6A 4DW6A 1XGSA 1G2HA 3VYUB 1PRVA 3LQXA 1XCVA 1IAWA 2RQQA 3FBNB 1ZZ8A 5GAGJ 1LVKA 5F08A 4PUSA 3SEQA 2Z16A 4MGRA 4CO8A 1SAXA 5DSXA 2AXZA 1D0XA 2RC4A 3BROA 1IJWC 5DRYA 1TT5B 1IXCA 5EYRA 1ZK8A 4K2EA 3WG7H 1BDIA 4RA2A 3CCSI 2HXIA 1QZEA 1QVUA 2ZXJA 4M71A 3QP5A 4S04A 3E5QA 1JGGA 1X2MA 1E2XA 4BDZA 5LRRA 4D7NA 2A07F 3OWTA 5E8IA 3MZ8A 5KCMA 3CDIA 1ZQ3P 2IVBA 2ECBA 3JCUC 5K7ZA 1F1ZA 5M3FJ 3RKXA 2GZUA 2LC2A 3GZNB 2DBBA 1OISA 4NHJA 2O6GE 1FEXA 4J00A 4ETSA 2LK2A 3O8HA 3I4PA 3OWQA 5J1RA 2RREA 1P4AA 4QLCU 3SHFA 4RB0A 2QBYB 2MA3A 3WTXC 1FLIA 3GZDA 2HKXA 3OMTA 3ESWB 3JRBA 2ID3A 2R7OA 5IYCJ 2MH2A 2EZHA 4P55A 4ER0A 5HLIA 1X1DA 2LTPA 4X4HA 1PP7U 3DWLE 3A4CA 4M9ZA 4R8HA 1BN5A 3ZRGA 5J8CA 3MKZA 1U5TA 4NNJA 4HNTA 2YR2A 5IOZA 1L3LA 3MKLA 2UWMA 4B1RA 2LYJA 5D5WB 3TP3A 2EJRA 4HOBA 5CVIA 3SZTA 1MMAA 1P9QC 1YW8A 1LQCA 1REPC 5A7LA 4JOMA 3C7JA 4HZFA 3CQZJ 3FXLA 2KRFA 3DM5A 1EA3A 4RM2A 1BR2A 1V54H 1JUMA 2YU3A 3GFMA 1O7LA 2EWTA 2LVSA 3HEFA 3CMMA 1IG7A 3M9LA 3JTHA 4CYCA 4XLHA 5F6FA 3TEDA 5HNFA 1JTYA 2MFZA 3DFGA 3OL3A 2LYLA 4QSHA 4Z59A 4A3BJ 1FBQA 1HKQA 3KIOA 2STTA 4A3EJ 5EGOA 1P4XA 4XR6A 5ILSA 1NTCA 2DN0A 3ABKH 1HBXG 1VQ5I 2A05A 1J09A 4FT8A 3U1KA 2AUWA 2HVQA 3F8BA 2HQAA 5FGMA 1HLVA 1FJLA 1W4MA 3I0TA 5E79C 4LD5A 1ZZ6A 3CECA 4UUTA 1EKEA 4B09A 1YHQI 3DLAA 2MQKA 1U2ZA 1I6HJ 2VUMJ 3OV8A 4EEFG 2XSJC 1IN8A 2ZJ2A 3U1DA 2EA4A 1TNSA 1YG2A 5M5YJ 3KP6A 3A01A 3ECOA 3OS2A 2D5VA 2IVQA 4PFOA 3HZIB 3ZMVA 2KP6A 2ACJA 3ZQ7A 3S2WA 3CP8A 1MNEA 4QWQA 3WGHA 2ELHA 1TQIA 1H9TA 4E7HA 3QFIA 1VQMI 3BG6A 1SFKA 4XLFA 5GTIC 1YW9A 2W24A 1L1MA 1WGXA 4AYBN 4D1QA 4OIPF 2RKHA 4NC8A 1QZXA 3TELA 2QZ8A 3R61A 1DP7P 1MH4A 1G4DA 4IJAA 3WE2A 3MLFA 1G3TA 4UV9A 2HDWA 4IHTA 4N4OB 4PJLA 4PJ0C 3M4OJ 3E6DA 2VIXA 4A12A 1VQ8I 1TW3A 4YELA 1MDMA 3QPSA 3CP2A 3IKTA 5DYMA 3DXJF 3FWEA 4LB5A 3HOWJ 2BBYA 1Q1HA 3CDHA 1ETKA 1QP7A 4Z6YA 2QQ8A 1ZREA 2E2IJ 1E3PA 1KU2A 2ICPA 3HOVJ 1AHDP 2XGEA 1U9NA 3A1YA 4I7HA 5DCMB 2QUFA 2GXAA 2BHYA 3O8GA 1CGPA 1KU7A 1NG6A 3O3KA 1ODDA 2KEJA 3FISA 4X4FA 2BV6A 2EB7A 2HTJA 2HOTA 1BW6A 4CCLA 3BCBA 4HV5A 1XMXA 4KMUX 2NOGA 4BXFA 3VWSA 2ZMEA 2W4SA 3ISPA 1USSA 1KA8A 1GDTA 3B6CA 3FHNA 1Y1WJ 5IY5H 2DOEA 2ETHA 4RMNA 4AIKA 4J1WA 4O3MA 1MBHA 2J5PA 4IEJA 3K4NA 3RYRA 4I09A 1BIBA 5DCFA 2QVOA 3RDIA 3CCLI 3M1CA 2R7WA 1Z05A 1V5GA 4DIQA 1GVJA 3HRSA 1WJCA 2X9DA 1PRUA 3FKJA 3M07A 2JQ7A 4WCGA 3H3UA 4QPQA 4A5NA 3GBGA 2XASA 3MN2A 2O5RA 3FXUA 4KISA 4Y13A 3BS3A 2HYJA 2ZFWA 1RKWA 3PSIA 1W7PB 3AL0C 1UFMA 4HQMA 2YS9A 1IDYA 4U0YA 6PAXA 2UV1A 1ETWA 3TGNA 1QNTA 1ETOA 5HOOA 4PFPA 1WH5A 1LFBA 2V9VA 3ZPXA 2ISZA 4CSWA 2FNAA 2O3FA 4GGGA 5HODA 1KU3A 2PXTA 2JA7J 2HVRA 5HDGA 2HINA 5DRTA 3E3VA 2GAUA 2LKSA 1R58A 2PIJA 1A31A 1XS9A 4RBOA 2WY8Q 3K70D 1LB2A 3CUQA 4AIDA 1K78B 2QSGX 4IHYA 2VASA 2BNNA 2ADUA 3M8FA 3VYTB 2V79A 3UNGC 3FXKA 3IAS2 1J9IA 3ABMH 1LPQA 2HPMA 3FYMA 2PUCA 1W7PD 1L0OC 3JRHA 3FMQA 2R5YB 1K61A 3M3YJ 3BTJA 4F52A 1YW7A 3HYIA 4UXNA 1APLC 3JXCL 5LD2C 2OF7A 4A0XA 3SDBA 3WU1B 2CW8A 3MAJA 2O03A 4YG1A 2DA2A 2V1UA 4AC0A 2ICWG 1OCTC 2NVUB 3OQOA 1QO0D 3EQLF 5LFAA 1JJ8C 3VWBA 3OYCA 2IS2A 3KX2A 3QWLA 3H0GJ 3H9QA 1VQPI 3ZMDA 2PUAA 1UZCA 1BR1A 3BPVA 4FETA 1MBJA 3PIPF 3CMAI 2YU9J 4BE0A 4CCOA 2HYFA 3R0AA 3F8NA 1LE8B 4NC6A 4Q2JA 1OR7A 2LP0A 2E36A 4I8TA 4V2FA 3KYLA 4GFBA 5KHDA 4IRIA 2W57A 2DT6A 5DD8A 4EV0A 1MZBA 4BQAA 4XRFA 3QPTA 5J47A 4YFKF 2WUSR 2PMHA 4EJWA 4BGDA 3TO9A 1QQAA 4S0HB 3MKWB 3SCFA 4OAYA 1B6AA 2QWWA 5FB2A 4BHCA 2JZYA 2QKMB 3PO2J 1ZZCA 1P4WA 3W6JB 1ZHFA 2QA4I 1OYWA 2IRFG 1TQMA 3BPXA 2VPRA 1I1SA 2R7DA 2ME0A 1NK3P 4ER6A 3BG9A 1POGA 1HF0A 2FD5A 2VC0A 1WJDA 2K86A 2RAEA 1QP4A 1HKSA 2XF7A 5JFRA 1MMNA 1VI0A 4AM3A 3WU2C 3HUGB 3A01B 1PVEA 2IBDA 1SMYF 2LNBA 3GFLA 1ONVA 1LE8A 1HXDA 2XB5A 2JT1A 2VONA 2XRLA 4DYRA 4CZZA 2L7MP 3HGGA 5IP6A 4HRAA 2WV1A 4ZYHA 2O7OA 3KCCA 5IP9J 2EH3A 4IZZA 3GFIA 2L9RA 1DW9A 5KAFC 3UKGA 1ZAYA 3DTEA 1IZ1A 5BPDA 5LHHA 3F6OA 3TOBA 3BDDA 5L3BA 4A69C 1ERDA 2L8NA 5K5QA 5E18F 5F0HA 4DYCA 1YI2I 2IS6A 5F1RA 4CH7A 3VOEA 3S2DJ 1HW1A 3BR1A 2J5OA 3BTIA 4RAZA 2DA6A 2FF4A 2KFDA 3E7LA 2ZMEC 3BCAA 2F5EA 3FX3A 4GQMA 5LGNA 3C3WA 2OA4A 4G6TB 2EBYA 2DCEA 1FBSA 1U8RA 2FBKA 2TDXA 2FOKA 1ZAOA 3F6WA 2E71A 3LFKA 1WFXA 1B72B 2FJRA 1TNTA 3ZHIA 4KN7X 2IV1A 3P9KA 3K4MA 2QKLB 2IEKA 1Z6TA 1ETQA 1ZYRF 3MEJA 2JRMA 2MLKA 1G6NA 5GAEJ 2K02A 4L0ZB 1Z1DA 3S1QJ 2RQPA 3GTOJ 1K4SA 3LFPA 2JTVA 2MABA 3CCVI 3A9YA 4DNCA 1ZG3A 1LDJA 3WTSC 2A5YB 4AVPA 3K0LA 4U87A 3PL8A 3KXAA 3I54A 3S14J 4C3IJ 1BM9A 1IDZA 5DEQA 4MEXF 3IVPA 5TISC 5B3SH 1ZLKA 3HTUA 2VJIA 1S5LC 2XXPA 5HLHA 1FOXA 5ED4A 4UNOA 2BVLA 5FKNA 3MZHA 1I3QJ 2NS7A 4MHGA 3RQ4A 1FMWA 3TW7A 1R7JA 3OQNA 2DU9A 1TLHB 2XUBA 1WCMJ 3D5RC 1LVAA 4XICA 4BQOA 2VBXA 2Z2SB 2KPJA 1LFPA 1PP8F 4I01A 4HLXA 3RPQA 1FTZA 3OSGA 1OCRH 4IHWA 3M8JA 3ZN0A 1D1BA 4PJJA 4XLEA 5D6EA 4DGWB 2LKPA 2O9LA 4WXDA 3F8CA 4XSXF 4PU3C 1WJAA 3LQRA 3ZHMA 3EUHA 4HDUA 2R92J 3TEPA 4AYBA 2MBFA 1FP2A 5ICEA 1V5EA 4ZYEA 1TWHJ 1AOYA 4UVCA 2R5ZB 1JH9A 3LSKA 2Z99A 2WAQN 2X6XA 4Y7NJ 3ZQFA 1YTYA 4I02A 4AIHA 1HOMA 2R7UA 2X6OA 1K79A 5JHFA 3UFDA 2DLLA 3QYXA 4L0YB 1WPKA 1Y6IA 1W36C 3RIRA 3REOA 2DA4A 3ABTA 4E6KG 5A2QK 1K78A 3S2HJ 1QPMA 2A3SA 3T5XA 1XGMA 3IH2A 1HQCA 3ELKA 2XI8A 1XSDA 1A35A 5JR3A 1IXSB 5BQTA 1R63A 4PGGA 3TQNA 1RZRD 1EH7A 2DOFA 3ML6A 2ICTA 4ZYAA 1U3EM 5F27A 3DPUA 3OYJA 2NAZA 3LSTA 5LGUA 2QCOA 2R5YA 3PM1A 2NVTJ 4G94A 2K3FA 4XORA 2BNMA 3RKQA 1V3FA 3MWMA 5CVUA 2VXZA 3SFZA 5GTHC 2PBIA 5C4XJ 4XN0A 3CCQI 1VQ9I 3PSFA 2Y31A 4D5CA 3I5UA 2O38A 2XAUA 2XXAA 4P96A 2OQRA 1R5HA 4IHXA 4XN3A 3R1FA 2LOOA 1TP4A 2QSHX 2WY7Q 3QF3A 4CICA 2NYXA 4XK4A 3TW6A 1YS7A 2MGQA 4M6XA 2RDPA 1UELB 2OV7A 3GZCA 3CC4I 4M3BA 2F5FA 1XG1A 2MYSA 2OCCH 3VSLA 4EVIA 1RZSA 2DMQA 2XPUA 2LYKA 2G9WA 2PUFA 2R3SA 5ICFA 3FM3A 4ZDLA 5IYBJ 1GVDA 2BY1A 2DT5A 2WADA 1S7OA 1TWFJ 1OFCX 5LHIA 1B59A 3NWSA 1JTXA 1ZR2A 1M1EB 3K2ZA 5L3FA 4WWCA 3NWTA 4QPOA 4IQJA 2YX7A 5FKMA 1MGTA 1S3JA 3I3LA 3OR2C 2COMA 4AWXB 1A36A 1QGPA 2ISYA 3EDPA 3HKZA 1G59A 2PJRB 2M34A 5M5WJ 4KT6A 4Q48A 4JBAA 3PE5A 3TRBA 2M4KA 3JXBC 3A0BC 1BA5A 1WQ2A 2HQRA 3CDLA 1LEBA 1S6LA 1QPZA 2BE5F 4G7HF 2AXTC 2LBFA 4HRIA 1MKMA 3G71I 1CQTA 2LR8A 1ZKGA 5HLGA 2QEXI 2VE9A 1H9GA 4JP0A 2ESNA 3K69A 1T8IA 2FU4A 3LAPA 4CHUA 3HPGA 4HX4A 2JPCA 5L3DA 3CCUI 1SQ8A 3KZIC 3G1OA 2DDBA 2DODA 3HTSB 5DCMA 4Y3OA 3EUAA 3QYBA 4XRSG 4P9UA 3WTTC 5L3CA 3RPUD 2R7RA 5B1AH 1Z77A 2MW8A 1EV7A 2D2WA 4D5FA 2WAEA 5DS9A 3WHCA 5E1WA 2P7VB 1G3YA 5HDKA 3T8TA 4GHJA 3EETA 2KISA 3T8RA 2H6BA 3VDXA 1WJEA 1I6XA 1JFSA 3GZ6A 5IPAA 2FUG2 3TMOA 4ZTJA 4Q47A 3JW4A 3CF5F 1BC8C 2L2OA 4AVZA 3ZMZA 1FZPB 5TGTA 2FEZA 2HZDA 1J75A 1X3WB 3KEYA 2XGDA 4RDUA 3S32A 1PUEE 2PMZN 3C1DA 4X0GA 4ENMA 2VJ5A 3FHZA 4JCYA 3C2BA 1B9MA 2QF7A 1U9OA 5IT3A 3Q0WA 3LNQA 1R23A 1VZ0A 4A3IJ 5J1YA 3PIOF 2Z9OA 4RGSA 3WGGA 3CC7I 4R1HA 3MFKA 2P5LC 4HDVA 4A6DA 3CCEI 3V8LA 4NUBA 2QBYA 5GADJ 2F2EA 3MEXA 3V8KA 2JSCA 5AONA 2GXGA 1OCCH 1SVMA 1GXPA 4ZDPA 1U78A 5D6FA 4LITA 3U2RA 4OIRF 4CCNA 3L2VA 1Z91A 1O3QA 1UMQA 1B9NA 3OMYA 3KZZA 3EUKL 4XBFA 2GBYA 2LD5A 3MQ0A 1JT0A 1VQKI 4HSTA 1E17A 4Q5SF 3E6BA 1A04A 3KE2A 1JHFA 4U0VA 1F36A 2VBWA 5E20A 4XNFA 1O3SA 1XC5A 5AIPA 4HPQA 4DBQA 3L2WA 4EJTA 2CSFA 2WB1N 2DAOA 4A3LJ 1WJ5A 1BOAA 4IPAA 3LOCA 3C2HA 5GAHi 1PDNC 1R36A 2ESHA 1FP1D 2MC3A 2D1VA 4C2TA 2ELKA 1FC3A 3GWZA 5D8LB 2VODA 4HX8A 4FN3A 3HOYJ 4A3CJ 1Y56A 1D8KA 4UUVA 5JUWA 1X19A 1SEUA 1XTAA 2HVSA 2PUEA 3OY9A 2W1OA 2DFEA 1KYZA 4EM2A 3K4CA 1E3HA 1XMKA 2ZNYA 4HYEA 1OKRA 3HOXJ 1QVTA 3OIPA 1T6SA 1YSEA 2EFWA 4UB8C 3I59A 4NDLA 1U8BA 2DJNA 1TBXA 3QQAA 2VEOA 2PXQA 1QP0A 2Y69H 3V7SA 5DM6F 1B1BA 2LMDA 2W84A 4UUSB 4WK8F 4PGHA 5GAGi 3GTPJ 3RKWA 3AG3H 5KVRA 1MBGA 3J80Z 3RQIA 1LDKB 2PFBA 4RGXA 4ER3A 3ONQA 3BG3A 2EFQA 1STZA 1IV6A 2KEKA 3GW2A 1ZZ9A 2L4AA 2JSPA 3LA7A 4NC7A 4MCXA 1G8XA 1NG7A 3SCGA 2PXUA 1E0EA 2E2HJ 1RZ4A 3PNYA 5EZGA 1UTXA 2KIQA 2VJ4A 3QPLA 1LLIA 4MCTA 3QOPA 4M3FA 2JVHA 2XV4S 4L5EA 4OIOF 2CWEA 4CDGA 4P9FA 1Y0UA 3QWGA 1UJ8A 2NRAC 3Q0VA 2EA2A 2QYOA 3DF8A 3DEEA 3IKVA 1UXDA 3MD2A 1VQOI 2MSYA 2M8GX 2OJED 3BP8A 1K7AA 3BQZA 1Y8RB 4ESJA 1UAAA 1ORKA 1X1PA 5TJJA 4G9YA 3DQVC 3OL4A 4RLFA 1ZGJA 4A5MA 5KNLA 3H92A 4MQVA 3VFZA 1ZRFA 4F8DA 3JR9A 2V1DA 2R7QA 3HIFA 3HRTA 1LFUP 1J59A 3EYYA 2DYRH 1X1CA 3VODA 4LG3A 3H35A 4JK1X 1XSVA 4BS9A 1JI8A 3IP4B 3OYLA 3S8QA 1YO5C 5FLXK 3DU6A 1Z67A 1N77A 2DYSH 4A0YA 1YFHA 4HF0A 2K85A 5EG0A 1EF4A 4EGYA 2D45A 1F5TA 2PPXA 2CSOA 2O8XA 2E1MC 2OC6A 1ULYA 2EV0A 5CQGA 4ABZA 2HOEA 2FMYA 4UY8I 3WG9A 4ZYGA 5ERIA 2F48A 1JE8A 4HSRA 2OZ6A 2ELJA 2PXPA 2AQEA 2IVMA 2BY3A 4LK0F 3S3MA 2D1HA 4IHSA 4PCQA 1XB4A 4GYIA 5DDGA 2M30A 1S7AA 1IN7A 2VL8A 2MC4A 3JRIA 2PJRA 1HW2A 3CLQA 4LLNA 5E17F 3FBIB 5EF6A 3JXDL 4FX4A 1ZH5A 4OBMA 4LG0B 3LFUA 2X6WA 3SCHA 4XMYA 3T0YA 4ESFA 1NK2P 2GLOA 2FX0A 3ZQIA 2ZB9A 2Z1DA 2IXSA 1QPIA 3LWFA 5E3OA 2Y0MA 1ZG1A 2IA0A 1T0FA 2V9KA 2MLGA 3NARA 4RAYA 3KP7A 3LSJA 2Y2ZA 3CJQB 4A0ZA 2NXNB 4G8XA 4C9YA 2K4JA 4CCKA 4XOTA 5DM7F 1B72A 3RJPA 1PRAA 2W25A 4O6JA 5BNGA 1TWAJ 4CXFA 2F5DA 3GTJJ 3OSFA 1MSEC 2R93J 4RLQA 3HSFA 4IQ4A 2LH9A 2L5QA 3CESA 3VB2A 4X4GA 2IS4A 3IHUA 2LY9A 2YX4A 3DBRB 1DQUA 5L3EA 2KZGA 2H09A 4LJZF 4RB2C 3M1EA 4KUMA 2E19A 1MMGA 2VKHA 4CCJA 4HX7A 3KYDB 2LG4A 1JXSA 4J1XA 4HNVA 3O2PE 3OOUA 3OYKA 5JHUA 2OBPA 2B63J 1YX5A 3BLYA 3G3ZA 2FA5A 2IP2A 2M8EA 2Q0OA 2Y0SA 3K1NA 4Y17A 4AU7A 3W3CA 2COBA 1UG2A 2HGCA 2OR1L 3ZQGA 5C44J 4U88A 3DEUA 1RPEL 2PXVA 3W2WA 1ZZ7A 5K5OA 2F5CA 4L9JA 1A5JA 4AUXA 4MFEA 1MNMC 1X4OA 1PNRA 1SFXA 2FMLA 2BZTA 2L0KA 4BJTA 4W1UA 5K1YA 2EK5A 3GZDC 2ZXIA 2UXNA 4LOCA 5KAIC 4D9JA 3CMYA 2PXBA 4JCXA 4X4BA 2VXDA 3PUFA 1XGOA 4ER5A 3G5GA 1XDSA 1SVOA 2EBIA 3E97A 4FQGA 2CJJA 5J40A 2HS5A 2R5ZA 4BNCA 2WIUB 3NZLA 2JCGA 1ZS4A 3WHBA 2ZCWA 4FISA 3A9XA 3F51A 2J7UA 2V6CA 2CUEA 4HLYA 4ZH4F 5K7FA 4MNUA 1HCRA 3GTLJ 4IWRA 3HOZJ 3TDUC 4RB3C 1N75A 5DUIA 1J7KA 2Q2EA 3CJTB 2A68F 1RRJA 1YITI 2RN7A 5J4VA 4YG7B 2PX9A 1FPQA 1OPCA 5IP7J 3QQ6A 1X58A 2XAJA 3SYTA 4X1EA 1GHCA 3B73A 2X4HA 2K9MA 1VQLI 3MZYA 4I6ZA 3SZGA 1F4KA 3HOSA 5FROA 3F22A 3BG7A 4HAMA 3QOXA 1J0RA 1LJ9A 1UHWA 3V8JA 4N9IA 2HTSA 4M74A 4IHVA 3TO7A 4B43A 1Z9CA 1UXCA 4DJAA 1S29A 1JWLA 2AQFA 3OP9A 3HHGA 2VJJA 2JA2A 3WTUC 2OTLI 2CQQA 3IUOA 3LSHA 4BU2A 4XLPF 1U6GA 2DPDA 3KJXA 4EZIA 2CUZA 2KL4A 2HDCA 4B4CA 3LSRA 3CD6I 4B48A 3H36A 2M87A 1S9HA 1P92A 2LFBA 2BYVE 2X51A 1QBJA 3H3VK 1DU0A 1KU9A 1NERA 2HPIA 5CVJA 5LEJA 3JRCA 2DPUA 4Y42A 3G1MA 2JUGA 3GLXA 4IRHA 4C2MJ 4ENJA 4ZTFA 1HC8A 2XROA 1D1AA 4A3MJ 1MDMB 2O49A 3TO6A 5IT9K 3DBHB 2ZBKA 3K4KA 2BW3A 3SEZA 5D5XB 4A3JJ 1YJNI 2JA5J 4FE7A 1XPXA 3F21A 5LHGA 3KP4A 2PXLA 3EPZA 4LIVA 2L7ZA 4I0BA 2E1CA 1ZGAA 2BEOA 4E7SA 4IKFA 1TWCJ 5ICGA 5HLTA 2CQXA 2DI3A 5DUKA 3TL4X 2TRTA 2NNYA 1RUOA 3GUUA 2HZTA 1GLNA 3GUDA 4WXCA 4BAYA 4YIIA 2XAQA 1I5ZA 2R7TA 4BJ6C 2A69F 2VOPA 3RZZA 1K6OA 4I6RA 4A6EA 2M5WA 3AFHA 5CYVA 5EG0B 1RZRA 2EIJH 4KYWA 3DBLB 4M9XA 2X6YA 2DMUA 2FE3A 1WH8A 2ZXWH 3JSOA 4CA0A 1JFTA 3WE3A 3ULQB 1FYKA 4G7ZF 1P2FA 3V42A 2XSDC 5JLWA 1PUFA 2QGUA 3AAFA 3CMEI 4FTHA 2OTJI 2FBIA 2FFHA 1FOYA 2IU7A 5LBQA 5HNHA 1FBUA 3X2QH 2LRDA 2FOWA 4BE2A 1ZELA 2WV0A 2EIMH 3FXOA 4DE9A 1RC9A 2G7UA 2PQ8A 4BXUA 1T98A 1W36D 2OFYA 2L9SA 5BOXA 2L49A 2JK3A 4OINF 4G12A 3DKWA 1T39A 2BOLA 2E2JJ 2DFIA 3J7AY 1PJRA 2G0EA 3S3OA 3F8MA 2Q8KA 2NOJB 4HNUA 4QTRA 2VB6A 1G3SA 3QP6A 4TV7A 2IGMA 1ON2A 1KYWA 2ZO4A 2CW7A 3CCJI 1IUYA 3SX0A 4YIRX 1BJAA 4I76A 4YEJA 3HL2A 2CFXA 1X1BA 4F55A 4F3QA 3S15J 2ODRD 3CJNA 1KGSA 1P7IA 3FF5A 2Y0SN 4UV8A 2GZWA 5FFXA 2RNJA 3ZQLA 4B3XA 4CUGA 3K70C 4ANJA 1E3OC 3CO6C 2E5ZA 2P6SA 4B44A 2CQKA 2F4OB 3NROA 3K10A 3QAHA 3QYEA 2WC2A 3JRDA 5DTDA 2R7FA 3W2AA 1UHMA 1Y1VJ 3B02A 5AIQA 3LSPA 2P81A 2IGOA 2XDVA 3HSEA 2DK8A 4IRGA 1IN5A 2L4MA 2RVCA 3HDDA 4PDKA 4PU7A 2KRHA 4B47A 2AWIA 2MD0A 4XOPA 3GVAA 3KP3A 4P1WA 4ZZLA 2MXDA 4M3DA 3UWPA 2HR3A 2JVGA 3TKYA 4CCMA 1SD6A 3A02A 5J3LA 2KDZA 1SD7A 3J7AO 1SD5A 1LKXA 5J6XA 1TQPA 2CO5A 2DTZA 4XLNF 1XDUA 4L5IA 1YIJI 3L7WA 3ASOH 4NQWB 1FIPA 4ZDOA 1R5ID 1UHSA 2BY0A 1RR7A 2OQGA 2V4JC 2LYCA 1C0WA 3FXJA 2IUOA 2G7HA 1BI3A 3JAMZ 4LFUA 1T33A 5M3MJ 4KN4X 2GXBA 1T0FC 3GXOA 4PZJA 3I71A 2QENA 3OR1C 3SDGA 3L2QA 2DOAA 2JUCA 2EV5A 2JRTA 3GTMJ 5K7HA 3VK0A 2VQLA 3FZVA 2V26A 4M72A 3F9KA 2R63A 1X2NA 1NH3A 2X1EA 2M0CA 1IW7F 2GA1A 1N25A 2XF6A 2XAHA 2Z5UA 3NAUA 4GYGA 4I98B 4N4NB 2LF7A 2V3CC 2OZUA 1S72I 3HOUJ 3BZCA 3R60A 1GUUA 4PU8A 2M0MA 2KZVA 5DD4A 4A3FJ 2GIZA 3K4BA 3FK6A 4X4IA 4LGWA 2HFHA 4BH9A 5CKTA 2DW4A 1LDDA 4NQWA 1JT6A 2OD5A 1O7FA 1YQAA 2PG4A 4W97A 2R7XA 3H5RA 1TZLA 2M7BA 3ECHA 5HS8A 1X3ZB 5C4JJ 2KDOA 4OMYA 4A3DJ 5E3NA 1WZ2A 2L02A 3LISA 2DA5A 1X4PA 2XF5A 3HRMA 3HZJA 3Q5FA 2PE5A 5HS7A 1AKHB 3RZDJ 4BXXJ 1VQ6I 5H2FC 2KT0A 3N97A 2VPLA 5H20A 2YBDA 4EKIA 2VI6A 4ZJZA 3KL4A 2LREA 2B5AA 5C3EJ 3J7ZI 2KRCA 4OWRB 1D0YA 1PERL 3I4MJ 1OLTA 5CQEA 2MD5A 2YSRA 2L7FP 4E7JA 5TRDA 4HBLA 2NVQJ 2DK5A 4ON0A 1AWCA 3H1CA 5IOYA 2LBFB 4GDFA 4QIWN 4EM1A 2ECCA 1MH3A 2HNHA 2WA0A 2BY2A 2EFNA 2BW3B 5BS6A 2MEZA 1RIOA 4E7ZA 3NQOA 3HGYA 1J2XA 1K4TA 2X1CA 1MFQC 2VOOA 3RSNA 3WTZA 1QB2A 4Y33A 2LYSA 1FX7A 2F5VA 3DPTA 2E7XA 3KEQA 2XRNA 2CV2A 2MH9A 4OU0A 4OB4A 2P8TA 5FKKA 1QHHD 2RNGA 1T56A 4G6QA 4LG0A 4L5JA 2ZC2A 3KETA 1RIOH 1TW2A 2ME6A 3JAMK 3W6VA 4FBIA 1W5CC 2M4GA 1W5TA 2HI3A 3ZR8X 1IF1A 4A3GJ 4RGRA 1R1TA 4G7OF 1WHUA 2FSWA 1W7PA 4JQFA 4X4CA 3Q0UA 2ZSIB 1IXRC 1DU6A 3OS0A 3FXMA 3BZKA 3KFWX 2EF8A 5CVRA 2C6YA 5CPRB 1JJ6C 2EZIA 3F0CA 3V7RA 1RNLA 3COAC 3HJEA 1ZUGA 3BTLA 3DCFA 4U0WA 3FKIJ 2BHZA 3V7CA 2A6CA 3GCMA 2MG4A 4EQZA 1BJZA 5FD5A 3G0TA 1IV8A 4WF2A 4XL9A 4NDWA 3CROL 3WTYC 4JQDA 3KP5A 3HBLA 3U9GA 2M1BA 1KONA 1IGNA 3B7HA 2EINH 1BIAA 2GOMA 1DULA 3KZ3A 3VYRB 3HOTA 4KNYA 4D0PA 3DP7A 3E6CC 3W6KB 2I8DA 3PFIA 3OYFA 3OIOA 2QLZA 1SVLA 1CJGA 2B7EA 1TTYA 1AA7A 3SXYA 4AIJA 3ZGKA 4DZPA 2IS1A 2E5NA 3GO5A 3CC2I 5JVTA 1P7JA 4P5OA 4JX4A 1ZZBA 3T1BA 2XC7A 5LLQA 2HOSA 1S7EA 4Q4ZF 4X4DA 3DKYA 2PUGA 1HDDC 1Y8QB 2YPRA 3M9AA 3DKXA 4Y52J 1RETA 5HS9A 3CLCA 4Z2YA 4UHTA 1FOWA 1GV2A 2FBHA 2FQ4A 3F72A 1QRYA 1YRNB 3ZKCA 2K3PA 1F43A 3I53A 2DO7A 4BJ5C 3ROUA 3BOQA 2Y48A 1O3RA 2GIVA 2H1KA 3LSIA 3BY6A 2DA1A 3NXHA 2H1LA 5HVQC 1WJBA 4LK1F 2XVCA 4U7BA 1FMVA 1WETA 1Z6RA 4B8XA 1Y7YA 2LY1A 5DTMA 1H8AC 4Y4RA 2FQ3A 3Q9VA 5EEHA 3ZMTA 4I99C 3WTWC 3G4SI 3KP2A 3U21A 2LDUA 5LRSA 2UUZA 3K2AA 2AW6A 4E70A 2DJIA 4U7DA 4I6TA 1TWGJ 5D5VB 3A03A 3BT9A 3AL0B 2L9VA 4M73A 2EIKH 3IL2A 1IUFA 5EEAA 3K7AJ 2HQ5A 1K83J 2K7LA 1RUNA 2LLWA 1FY7A 3EUHC 5F04A 3H5NA 4BEHB 2GRMA 5DTRA 2R0QC 1BL0A 4PSXA 2CRGA 3H5AA 3G6EI 3FK7A 2IA2A 4UUSA 5B5EC 1YJWI 1KQ9A 2F6CA 5FFZA 2UZKA 4E4HA 4DYQA 1R22A 3S3NA 1GT0C 1JKQC 2CH0A 2QQBA 4V2GA 3UR3C 3L2UA 1UB9A 1VPWA 1I1GA 3JRAA 2EQRA 1ACIA 1QQIA 2IJLA 1IRGA 1FWZA 4PJNA 3K1MA 3N05A 3QYFA 3OYHA 1CF7B 3GN5B 3Q3SA 3GLLA 3DPLC 2HWVA 4GRIA 2P6TA 3L1PA 4WX9A 1FNNA 3D1NI 2O8KA 3GTGJ 4XSZF 2KIFA 1H88C 2DDAA 4ZYDA 1AU7A 2PI0A 4BEHA 3LL7A 3PNTA 4DOZA 4DBRA 4KICA 3WTVC 2KLOA 2LF8A 3J80K 3DEWA 1FSEA 2PLYA 4O8BA 2R7ZJ 2IW5A 2PMUA 2L3DA 3CTAA 3E0JB 4RAGA 3S8PA 3PO3J 1XSXA 1O57A 5FRNA 4BKXA 1ZG5A 2QQ9A 2AS5F 4ESBA 1JKOC 1MJBA 2K9QA 4IL6C 2W00A 1AKHA 4DE8A 3ABUA 2X48A 3BR3A 2CV1A 2BGCA 1Q1VA 2HKOA 3FDYA 1ZARA 2Y75A 1FTTA 4I6UA 1R00A 1CF7A 5F0FA 1O4XA 2KZ8A 3F52A 4GCVA 2IPQX 1BI1A 2LNMA 4BBSJ 2BJCA 1ETYA 4HA8A 1HQ1A 3LQQA 4L18B 2OU2A 4NBQA 3V4GA 4UVAA 1FIAA 4YG2F 3K4JA 4L9NA 3R6SA 3B6AA 4UVBA 3DTKA 4KITB 2R1JL 3S1RJ 2VQGA 2JWTA 2H8WA 5HDNA 3BJAA 4L9TA 4E7IA 1ZRDA 3VSKA 3PNVA 1Z0XA 1XD7A 5IT9Z 1PUFB 1EH8A 2VT3A 3KLOA 4IOAF 2PEXA 1QQBA 3H5TA 2O4AA 3MMYB 1I39A 2EILH 2FRHA 2KHMA 1I50J 2IGNA 1U5TB 2KJBA 2VBZA 2EZLA 3WODF 1DGWY 4MEYF 4MO7A 3L2CA 4IO9F 3S1MJ 2JMWA 2VC1A 5K98B 1U0JA 3CUQB 4C3JJ 3F23A 3BR2A 1IC8A 2AXLA 2KQRA 4AD9A 3I9V2 2JPBA 2PUBA 1N78A 2VE8A 3J81K 5LEKA 3GYHX 1D3YA 2A6TA 3WGIA 3S17J 1JKRC 4R79A 3S16J 4EATA 3FYAA 3PQKA 4F91B 2PXDA 2R4GA 3OYIA 1TC3C 1B8IA 1IO2A 3GX4X 3BQYA 5EGOB 4ENNA 5FO5A 1NHAA 2JN6A 2LLVA 3C18A 2P5VA 1DUXC 1EJ9A 1R71A 4CYCB 1BOBA 1ZGWA 2EZKA 3K9TA 4I0AA 2P4WA 2A5WA 3H0DA 4LMYA 5GPAA 4YIFA 4BBRJ 1YOVB 3N4MA 3BC8A 2JA6J 1YYVA 4MFDA 1ZLJA 1NW3A 3H9GA 1MJ9A 2HEOA 2RGVA 5H6QA 3DU5A 3GFJA 1VQNI 1WKMA 3BZ6A 4EJVA 4RAFA 3OYDA 4RM3A 3AG4H 1V5FA 2CV0A 1LCCA 1FYMA 1P6RA 4HV6A 2L9NA 1DGRM 1X57A 2M45A 2X85A 3I64A 3OS1A 5KK1A 2XPVA 3PXPA 1OYIA 2ZFUA 1ON1A 1SAUA 4GO1A 2DFHA 3LMMA 3TBIA 5B66C 1YRNA 5LGTA 1RPWA 4RGUA 2M7AA 3CJRB 1X1AA 4UB6C 1WI9A 5ILUA 2W85A 1VQ7I 1J5YA 2V7FA 3S1NJ 3U3WA 1OQYA 2X1DA 2VKDA 4EQQA 1R49A 3HUGA 1R4MB 1VQ4I 3BDNA 1OCZH 1MIJA 1FOKA 1XWRA 1MD0A 3LSMA 2K9SA 1WSUA 5CLSA 4ITVA 3WU0A 1OCPA 3IRRA 5EZHA 1LQ1A 3PUBA 3PJRA 1IN6A 2ZSHB 4XIDA 3G1LA 2FXAA 3RYPA 3HB9A 1VNDA 1QZZA 3C2GA 3R4KA 1YJ9I 2KPMA 4LB6B 1IRZA 4Z5HA 1T2KA 1ITYA 3DV8A 1HDPA 3IV5A 3ZPLA 2N8GA 3CCMI 3BD1A 5EJCA 3ZXSA 2RV8A 2LSOA 4DZJA 3RCOA 2OPTA 3FIWA 4HG2A 1IN4A 1I27A 1GXQA 3JSPA 2BVMA 3TDZC 1DPRA 2GQQA 5A2QZ 5D5UB 1EH6A 4YFNF 3GZ5A 2DQLA 4XKCA 2Q1ZB 2E35A 1QZYA 1SFOJ 3BWGA 3HHHA 3CLOA 4M3EA 1YIOA 5D8KB 1RR8C 4H4KC 3SR4A 1RESA 2WTEA 2FNPA 4KDPA 2XB0X 1VFCA 2A6EF 2DMPA 3P9CA 4BDYA 2ZXHA 3FMSA 3CO7C 2W48A 3OKZA 1POUA 2XCJA 4XONA 3K6GA 3KYCB 4J01A 1IRXA 3MVPA 1D8JA 1TT0A 1WWXA 4EJUA 1A6QA 3W2VA 3SQNA 2XKPA 1A6IA 2LKXA 2XAGA 3QU6A 2Y30A 3ZQCA 1BDHA 3FXRA 4HF2A 2QM3A 4IA8A 4MIMA 3R09A 4II3A 2IAIA 2CQNA 2CUJA 1W5SA 3CUOA 1GV5A 1U5TC 3G73A 1W0TA 1R1VA 2NS0A 4BHPA 1XN7A 3SFIA 2JA8J 2VLAA 2ZNZA 3MCZA 2KIUA 3OIQA 3JTGA 2OUMA 2E1NA 1OR7C 2V1NA 5FLMJ 1W0UA 1WH6A 4FE4A 4XKWA 4OMZA 4F93B 3TP0A 2HOAA 4ASNA 2H6CA 2CW0F 2I5UA 2KIMA 1SC7A 2CROA 3A0HC 1ZTRA 3GF2A 3P9IA 5FRMA 4A3KJ 3VYSB 5E3LA 1Z3YA 2E1OA 1SFUA 3BJOA 3L2RA 1R4NB 2L7KA 2ZJQF 2VQCA 3SJMA 3GTQJ 4MTEA 2Z3YA 2PN6A 3H9JA 2FJ1A 2HDDA 2XHKA 1X3UA 3P7NA 1SMTA 2HU9A 3ME5A 2F4IA 4M3GA 3D5LA 4RB1A 1JUSA 1XMAA 3AG1H 4FCYA 1O3TA 2NVXJ 1ZRCA 3IC7A 3LAJA 1DWKA 2JJ7A 1XGNA 4G6DA 4JYKA 5F64A 2CQ7A 2Z33A 4H0EA 1BI0A 1YX3A 5M5XJ 4KMFA 1F9NA 3R0JA 1OJLA 1X2LA 3DLLF 3ERMA 5BPIA 5DT2A 3FXQA 5F0CA 4FASD
chains in the Genus database with same CATH topology
3HM5A 3O8GA 1PERL 1XC5A 3I4MJ 2XJ3A 1ETXA 3FISA 2KEJA 4X4FA 2CSFA 2WB1N 3JRGA 2HOTA 1BW6A 4A3LJ 2L7FP 3LOCA 2I10A 3DNVB 2NVQJ 2HXOA 2M9HA 3I4NJ 4M6VA 2DA7A 2NOGA 2ELKA 5IOYA 2NVYJ 4FN3A 3HOYJ 4QIWN 4A3CJ 1Y9QA 2ECCA 1GDTA 1MH3A 3B6CA 1ZR4A 1MBKA 5FJ8J 4J19A 1B8IB 1Y1WJ 2MEZA 1RIOA 2PUEA 2M2EA 4Z5CA 4IVZA 4J1WA 4YG4A 3HGYA 2NS8A 1JUPA 3HOXJ 1EFAA 1MBHA 4IEJA 2LYSA 2PUDA 1QVTA 1YSEA 4XRMA 4NDLA 1U8BA 2DJNA 3QQAA 3BR0A 4OB4A 1QP0A 5FKKA 1T56A 4BY1J 4UUSB 4YBAA 2X9DA 5J1UA 3GTPJ 1PRUA 2ME6A 3W6VA 4FBIA 1MBGA 2HI3A 3RQIA 1WI3A 1NEQA 4A3GJ 3BG3A 3GBGA 3MN2A 2KEKA 1IV6A 3IH4A 1ZZ9A 4X4CA 3BS3A 3Q0UA 2HYJA 4MCXA 1DU6A 3SCGA 1RKWA 2E2HJ 1D5YA 2CU7A 5EZGA 1UTXA 2EF8A 2ID6A 2Y9ZA 2YS9A 1IDYA 3QPLA 1LLIA 1JJ6C 1LCDA 4MCTA 4M3FA 2EZIA 4L5EA 3F0CA 1ETWA 3QWGA 1ETOA 1ZUGA 3Q0VA 3BTLA 3DCFA 3FKIJ 1WH5A 1UXDA 1LFBA 2A6CA 2MSYA 2MG4A 2M8GX 1BJZA 5HODA 3BR6A 3BQZA 2JA7J 4NDWA 1ORKA 3CCYA 3CROL 4JQDA 2HINA 3HBLA 2PIJA 1XS9A 1IGNA 4RBOA 3B7HA 4F8DA 3JR9A 4X4EA 1LFUP 2LYRA 4IHYA 3KZ3A 4JCXA 2BNNA 3VPRA 3S8QA 2H8RA 2KEIA 2LYPA 3FYMA 3OIOA 2PUCA 2K40A 5EG0A 1EF4A 2PPXA 1CJGA 2XIUA 3JRHA 4ABZA 2R5YB 1K61A 3M3YJ 4DZPA 2IVBA 1H89C 3BTJA 3JXCL 1APLC 4BY7J 2OF7A 1P7JA 1ZZBA 4JX4A 2HOSA 2AXVA 1S7EA 4X4DA 2PUGA 1HDDC 3CLCA 4Y52J 4YG1A 1RETA 2DA2A 4AC0A 1OCTC 3JREA 3OQOA 1JJ8C 1GV2A 2FQ4A 3ZKCA 1YRNB 1QRYA 1F43A 3H0GJ 3ZQHA 2PUAA 2H1KA 3JRIA 2DA1A 4B3AA 1ENHA 3JXDL 5EF6A 1MBJA 2YU9J 3SCHA 2LLKA 1WETA 2VKVA 1Y7YA 1NK2P 1H8AC 3RZOJ 1LE8B 2FX0A 2GLOA 5GPCA 2LP0A 3ZQIA 2ZB9A 1QPIA 4I8TA 4V2FA 5E3OA 4GFBA 3NARA 3K2AA 2AW6A 4I6TA 3LSJA 1TWGJ 2Y2ZA 3A03A 3BT9A 2WUSR 2BNOA 2DMTA 1B72A 1SANA 1PRAA 1IUFA 5EEAA 3K7AJ 3ZOBA 5BNGA 1TWAJ 4S0HB 3GTJJ 3GTKJ 3OSFA 1MSEC 2JVLA 3SCFA 1QQAA 4XRSA 2HQ5A 1K83J 2R93J 1ZZCA 3PO2J 5F04A 2GRMA 5E3MA 2DA3A 2R0QC 2VPRA 1BL0A 3LSGA 2CRGA 2ME0A 1NK3P 4X4GA 3BG9A 1POGA 1HF0A 2FD5A 2LY9A 3FK7A 2RAEA 4UUSA 1QP4A 2CUFA 4MLOA 2E19A 1VI0A 3BTCA 4Z58A 4DYQA 1ZPQA 3A01B 2IBDA 1GT0C 1LE8A 4J1XA 1ADRA 4HNVA 2XB5A 1JKQC 3OOUA 4V2GA 2B63J 1MBFA 1VPWA 2XRLA 4DYRA 2L7MP 3HGGA 5IP6A 3JRAA 3IH3A 2WV1A 2EQRA 2COBA 2O7OA 3O9XA 5IP9J 5EDNA 2EH3A 1JKPC 1UG2A 2OR1L 3ZQGA 2L9RA 5C44J 1DW9A 4X6AJ 2XPWA 5GP9A 1MSFC 1RPEL 2K9NA 3UKGA 5IYDJ 3GN5B 1ZAYA 1ZZ7A 3Q3SA 2GRLA 1A5JA 4AUXA 4MFEA 1MNMC 3L1PA 4Z5DA 3D1NI 2O8KA 3GTGJ 4A69C 1PNRA 2AO9A 1H88C 2L8NA 1AU7A 1OSLA 2L0KA 5F0HA 4W1UA 4DYCA 1ETVA 3S2DJ 3BR1A 4A93J 4LOCA 3CMYA 3DEWA 3BTIA 4X4BA 1R69A 1B0NA 2DA6A 2GM4A 2R7ZJ 4O8BA 3E7LA 3G5GA 3PO3J 2EBIA 4PU4C 2CJJA 2WIUB 4BKXA 2R5ZA 2HSGA 4GQMA 1JKOC 2K9QA 2JCGA 1ZS4A 3WHBA 2EBYA 9ANTA 1AKHA 4FISA 3F51A 2X48A 2CUEA 3BR3A 4JX5A 3F6WA 3OQMA 1Q1VA 5K7FA 1HCRA 3GTLJ 4IWRA 1B72B 3HOZJ 2FJRA 3ZHIA 4YARA 2IV1A 1FTTA 4I6UA 1RKTA 2IEKA 5F0FA 4YG7B 1O4XA 1ETQA 2KZ8A 3F52A 5IP7J 4BBSJ 3QQ6A 2BJCA 1ETYA 1X58A 5FKLA 4X1EA 1FIAA 3S1QJ 3GTOJ 4I6ZA 3JRFA 1WH7A 2VKEA 3B6AA 2Y9YA 3LFPA 1R9TJ 2R1JL 3BR5A 3S1RJ 2JWTA 4IHVA 1UXCA 3KXAA 3S14J 1JWLA 4C3IJ 2TCTA 4JX6A 1IDZA 1Z0XA 3OP9A 4D7MA 1PUFB 3IVPA 5FKOA 1QQBA 3H5TA 2O4AA 2CQQA 2AHQA 1I50J 5FKNA 5FLVA 1I3QJ 2NS7A 2EZLA 3TW7A 3KJXA 4MO7A 3OQNA 3S1MJ 2JMWA 4C3HJ 1LMB3 1WCMJ 4B4CA 4XICA 3LSRA 2KPJA 5K98B 1IC8A 4C3JJ 1FTZA 3BR2A 3H3VK 5JLXA 2LFBA 2LYQA 3FMYA 3OSGA 1DU0A 3G7DA 2PUBA 4IHWA 1NERA 3JRCA 4Y42A 5F1JA 3G1MA 2O9LA 3GBFA 3S17J 4C2MJ 1JKRC 3S16J 3EUSA 2DMNA 4PU3C 3FYAA 3ZHMA 2R92J 4A3MJ 2O49A 1MBEA 1TWHJ 2XGCA 1TC3C 2AXUA 2R5ZB 1JH9A 1B8IA 2WAQN 4A3JJ 2JA5J 2IVGA 4FE7A 1VF9A 3BQYA 4Y7NJ 5EGOB 3ZQFA 2JN6A 2L7ZA 1HOMA 2X6OA 4CYCB 1BW5A 1ZGWA 3UFDA 2EZKA 1TWCJ 1WIZA 3GN5A 2CQXA 3HKZN 3QYXA 1WPKA 2TRTA 2DA4A 5GPAA 3BG5A 4BBRJ 2LCVA 1ZVVA 2YUSA 4DW6A 3S2HJ 2JA6J 1G2HA 4MFDA 3IH2A 2XI8A 3RZZA 1PRVA 4I6RA 1R63A 1RZRD 1ZZ8A 5EG0B 2ICTA 1RZRA 5F08A 5F27A 2DMUA 2QCOA 2R5YA 3PM1A 1WH8A 2AXZA 1LCCA 2NVTJ 1JFTA 2BNMA 3RKQA 1IJWC 1X57A 5EYRA 5C4XJ 1ZK8A 2XPVA 3PXPA 1BDIA 2XSDC 4D5CA 2Y31A 5JLWA 4FTHA 2HXIA 1PUFA 2O38A 2IU7A 1QVUA 1YRNA 4IHXA 1RPWA 3R1FA 3U3WA 1JGGA 1X2MA 3S1NJ 4D7NA 3QF3A 3BDNA 2OFYA 1ZQ3P 4XK4A 2ECBA 3TW6A 2MGQA 5K7ZA 2K9SA 5M3FJ 1XWRA 2JK3A 2L49A 4G12A 2GZUA 2E2JJ 1OCPA 4M3BA 1XG1A 2G0EA 5EZHA 1RZSA 2DMQA 1FEXA 2XPUA 2LYKA 4QTRA 2PUFA 4XIDA 3G1LA 2LK2A 3HB9A 3O8HA 5J1RA 1VNDA 5IYBJ 1GVDA 4I76A 3OMTA 1OFCX 1TWFJ 1IRZA 3JRBA 4Z5HA 1ITYA 1JTXA 1HDPA 3IV5A 1ZR2A 2ID3A 3S15J 2N8GA 1P7IA 2EZHA 5IYCJ 5FKMA 3BD1A 2LTPA 2Y0SN 4X4HA 4DZJA 3ZQLA 2OPTA 3FIWA 1E3OC 2M34A 5M5WJ 5IOZA 3MKLA 3JXBC 3TRBA 4B1RA 1BA5A 2LYJA 3TP3A 3CDLA 1QPZA 5A7LA 3JRDA 1LQCA 5DTDA 1Y1VJ 1SFOJ 3CQZJ 1CQTA 2LR8A 1ZKGA 2P81A 3LSPA 4M3EA 1JUMA 4JP0A 1RESA 2EWTA 3HDDA 2LVSA 3HEFA 4PU7A 2XB0X 1VFCA 1IG7A 2DMPA 2AWIA 4CYCA 2W48A 1POUA 2XCJA 3TEDA 4M3DA 1JTYA 1SQ8A 3G1OA 2LYLA 4QSHA 4Z59A 3MVPA 4A3BJ 3A02A 5J3LA 2KDZA 4A3EJ 5EGOA 4XRSG 1NTCA 2DN0A 1A6IA 2LKXA 2DTZA 1Z77A 2MW8A 2AUWA 2Y30A 3ZQCA 1BDHA 1HLVA 1FJLA 1ZZ6A 4D5FA 3CECA 1FIPA 4IA8A 5DS9A 4MIMA 3WHCA 4UUTA 2IAIA 1UHSA 2MQKA 1RR7A 4GHJA 1I6HJ 2VUMJ 1GV5A 4EEFG 2IUOA 1W0TA 1T33A 5M3MJ 1JFSA 5M5YJ 3A01A 5IPAA 3SFIA 2D5VA 2JA8J 2IVQA 1WH6A 3SDGA 3HZIB 5FLMJ 1W0UA 4FE4A 3GTMJ 5K7HA 3VK0A 3TP0A 2HOAA 2R63A 1X2NA 2M0CA 2XGDA 4RDUA 2CROA 3NAUA 2PMZN 1ZTRA 4JCYA 4A3KJ 3C2BA 1L1MA 5E3LA 1WGXA 2QF7A 4AYBN 2E1OA 3HOUJ 1U9OA 1GUUA 4PU8A 3Q0WA 3LNQA 4A3FJ 4A3IJ 5J1YA 3SJMA 3GTQJ 3FK6A 4X4IA 1MH4A 2FJ1A 2HDDA 1JT6A 3MLFA 4W97A 4M3GA 3M4OJ 4FCYA 1JUSA 5C4JJ 2NVXJ 4A3DJ 5E3NA 1DWKA 3LISA 2DA5A 2JJ7A 3QPSA 4JYKA 1U78A 2PE5A 1AKHB 3HOWJ 3RZDJ 4BXXJ 1ETKA 1QP7A 2KT0A 1UMQA 2E2IJ 5M5XJ 2VI6A 2GBYA 2LD5A 1JT0A 3HOVJ 2B5AA 1OJLA 1X2LA 5C3EJ 1AHDP 2ICPA 2XGEA 1U9NA 5F0CA 1F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HM5 A;  3O8G A;  1PER L;  1XC5 A;  3I4M J;  2XJ3 A;  1ETX A;  3FIS A;  2KEJ A;  4X4F A;  2CSF A;  2WB1 N;  3JRG A;  2HOT A;  1BW6 A;  4A3L J;  2L7F P;  3LOC A;  2I10 A;  3DNV B;  2NVQ J;  2HXO A;  2M9H A;  3I4N J;  4M6V A;  2DA7 A;  2NOG A;  2ELK A;  5IOY A;  2NVY J;  4FN3 A;  3HOY J;  4QIW N;  4A3C J;  1Y9Q A;  2ECC A;  1GDT A;  1MH3 A;  3B6C A;  1ZR4 A;  1MBK A;  5FJ8 J;  4J19 A;  1B8I B;  1Y1W J;  2MEZ A;  1RIO A;  2PUE A;  2M2E A;  4Z5C A;  4IVZ A;  4J1W A;  4YG4 A;  3HGY A;  2NS8 A;  1JUP A;  3HOX J;  1EFA A;  1MBH A;  4IEJ A;  2LYS A;  2PUD A;  1QVT A;  1YSE A;  4XRM A;  4NDL A;  1U8B A;  2DJN A;  3QQA A;  3BR0 A;  4OB4 A;  1QP0 A;  5FKK A;  1T56 A;  4BY1 J;  4UUS B;  4YBA A;  2X9D A;  5J1U A;  3GTP J;  1PRU A;  2ME6 A;  3W6V A;  4FBI A;  1MBG A;  2HI3 A;  3RQI A;  1WI3 A;  1NEQ A;  4A3G J;  3BG3 A;  3GBG A;  3MN2 A;  2KEK A;  1IV6 A;  3IH4 A;  1ZZ9 A;  4X4C A;  3BS3 A;  3Q0U A;  2HYJ A;  4MCX A;  1DU6 A;  3SCG A;  1RKW A;  2E2H J;  1D5Y A;  2CU7 A;  5EZG A;  1UTX A;  2EF8 A;  2ID6 A;  2Y9Z A;  2YS9 A;  1IDY A;  3QPL A;  1LLI A;  1JJ6 C;  1LCD A;  4MCT A;  4M3F A;  2EZI A;  4L5E A;  3F0C A;  1ETW A;  3QWG A;  1ETO A;  1ZUG A;  3Q0V A;  3BTL A;  3DCF A;  3FKI J;  1WH5 A;  1UXD A;  1LFB A;  2A6C A;  2MSY A;  2MG4 A;  2M8G X;  1BJZ A;  5HOD A;  3BR6 A;  3BQZ A;  2JA7 J;  4NDW A;  1ORK A;  3CCY A;  3CRO L;  4JQD A;  2HIN A;  3HBL A;  2PIJ A;  1XS9 A;  1IGN A;  4RBO A;  3B7H A;  4F8D A;  3JR9 A;  4X4E A;  1LFU P;  2LYR A;  4IHY A;  3KZ3 A;  4JCX A;  2BNN A;  3VPR A;  3S8Q A;  2H8R A;  2KEI A;  2LYP A;  3FYM A;  3OIO A;  2PUC A;  2K40 A;  5EG0 A;  1EF4 A;  2PPX A;  1CJG A;  2XIU A;  3JRH A;  4ABZ A;  2R5Y B;  1K61 A;  3M3Y J;  4DZP A;  2IVB A;  1H89 C;  3BTJ A;  3JXC L;  1APL C;  4BY7 J;  2OF7 A;  1P7J A;  1ZZB A;  4JX4 A;  2HOS A;  2AXV A;  1S7E A;  4X4D A;  2PUG A;  1HDD C;  3CLC A;  4Y52 J;  4YG1 A;  1RET A;  2DA2 A;  4AC0 A;  1OCT C;  3JRE A;  3OQO A;  1JJ8 C;  1GV2 A;  2FQ4 A;  3ZKC A;  1YRN B;  1QRY A;  1F43 A;  3H0G J;  3ZQH A;  2PUA A;  2H1K A;  3JRI A;  2DA1 A;  4B3A A;  1ENH A;  3JXD L;  5EF6 A;  1MBJ A;  2YU9 J;  3SCH A;  2LLK A;  1WET A;  2VKV A;  1Y7Y A;  1NK2 P;  1H8A C;  3RZO J;  1LE8 B;  2FX0 A;  2GLO A;  5GPC A;  2LP0 A;  3ZQI A;  2ZB9 A;  1QPI A;  4I8T A;  4V2F A;  5E3O A;  4GFB A;  3NAR A;  3K2A A;  2AW6 A;  4I6T A;  3LSJ A;  1TWG J;  2Y2Z A;  3A03 A;  3BT9 A;  2WUS R;  2BNO A;  2DMT A;  1B72 A;  1SAN A;  1PRA A;  1IUF A;  5EEA A;  3K7A J;  3ZOB A;  5BNG A;  1TWA J;  4S0H B;  3GTJ J;  3GTK J;  3OSF A;  1MSE C;  2JVL A;  3SCF A;  1QQA A;  4XRS A;  2HQ5 A;  1K83 J;  2R93 J;  1ZZC A;  3PO2 J;  5F04 A;  2GRM A;  5E3M A;  2DA3 A;  2R0Q C;  2VPR A;  1BL0 A;  3LSG A;  2CRG A;  2ME0 A;  1NK3 P;  4X4G A;  3BG9 A;  1POG A;  1HF0 A;  2FD5 A;  2LY9 A;  3FK7 A;  2RAE A;  4UUS A;  1QP4 A;  2CUF A;  4MLO A;  2E19 A;  1VI0 A;  3BTC A;  4Z58 A;  4DYQ A;  1ZPQ A;  3A01 B;  2IBD A;  1GT0 C;  1LE8 A;  4J1X A;  1ADR A;  4HNV A;  2XB5 A;  1JKQ C;  3OOU A;  4V2G A;  2B63 J;  1MBF A;  1VPW A;  2XRL A;  4DYR A;  2L7M P;  3HGG A;  5IP6 A;  3JRA A;  3IH3 A;  2WV1 A;  2EQR A;  2COB A;  2O7O A;  3O9X A;  5IP9 J;  5EDN A;  2EH3 A;  1JKP C;  1UG2 A;  2OR1 L;  3ZQG A;  2L9R A;  5C44 J;  1DW9 A;  4X6A J;  2XPW A;  5GP9 A;  1MSF C;  1RPE L;  2K9N A;  3UKG A;  5IYD J;  3GN5 B;  1ZAY A;  1ZZ7 A;  3Q3S A;  2GRL A;  1A5J A;  4AUX A;  4MFE A;  1MNM C;  3L1P A;  4Z5D A;  3D1N I;  2O8K A;  3GTG J;  4A69 C;  1PNR A;  2AO9 A;  1H88 C;  2L8N A;  1AU7 A;  1OSL A;  2L0K A;  5F0H A;  4W1U A;  4DYC A;  1ETV A;  3S2D J;  3BR1 A;  4A93 J;  4LOC A;  3CMY A;  3DEW A;  3BTI A;  4X4B A;  1R69 A;  1B0N A;  2DA6 A;  2GM4 A;  2R7Z J;  4O8B A;  3E7L A;  3G5G A;  3PO3 J;  2EBI A;  4PU4 C;  2CJJ A;  2WIU B;  4BKX A;  2R5Z A;  2HSG A;  4GQM A;  1JKO C;  2K9Q A;  2JCG A;  1ZS4 A;  3WHB A;  2EBY A;  9ANT A;  1AKH A;  4FIS A;  3F51 A;  2X48 A;  2CUE A;  3BR3 A;  4JX5 A;  3F6W A;  3OQM A;  1Q1V A;  5K7F A;  1HCR A;  3GTL J;  4IWR A;  1B72 B;  3HOZ J;  2FJR A;  3ZHI A;  4YAR A;  2IV1 A;  1FTT A;  4I6U A;  1RKT A;  2IEK A;  5F0F A;  4YG7 B;  1O4X A;  1ETQ A;  2KZ8 A;  3F52 A;  5IP7 J;  4BBS J;  3QQ6 A;  2BJC A;  1ETY A;  1X58 A;  5FKL A;  4X1E A;  1FIA A;  3S1Q J;  3GTO J;  4I6Z A;  3JRF A;  1WH7 A;  2VKE A;  3B6A A;  2Y9Y A;  3LFP A;  1R9T J;  2R1J L;  3BR5 A;  3S1R J;  2JWT A;  4IHV A;  1UXC A;  3KXA A;  3S14 J;  1JWL A;  4C3I J;  2TCT A;  4JX6 A;  1IDZ A;  1Z0X A;  3OP9 A;  4D7M A;  1PUF B;  3IVP A;  5FKO A;  1QQB A;  3H5T A;  2O4A A;  2CQQ A;  2AHQ A;  1I50 J;  5FKN A;  5FLV A;  1I3Q J;  2NS7 A;  2EZL A;  3TW7 A;  3KJX A;  4MO7 A;  3OQN A;  3S1M J;  2JMW A;  4C3H J;  1LMB 3;  1WCM J;  4B4C A;  4XIC A;  3LSR A;  2KPJ A;  5K98 B;  1IC8 A;  4C3J J;  1FTZ A;  3BR2 A;  3H3V K;  5JLX A;  2LFB A;  2LYQ A;  3FMY A;  3OSG A;  1DU0 A;  3G7D A;  2PUB A;  4IHW A;  1NER A;  3JRC A;  4Y42 A;  5F1J A;  3G1M A;  2O9L A;  3GBF A;  3S17 J;  4C2M J;  1JKR C;  3S16 J;  3EUS A;  2DMN A;  4PU3 C;  3FYA A;  3ZHM A;  2R92 J;  4A3M J;  2O49 A;  1MBE A;  1TWH J;  2XGC A;  1TC3 C;  2AXU A;  2R5Z B;  1JH9 A;  1B8I A;  2WAQ N;  4A3J J;  2JA5 J;  2IVG A;  4FE7 A;  1VF9 A;  3BQY A;  4Y7N J;  5EGO B;  3ZQF A;  2JN6 A;  2L7Z A;  1HOM A;  2X6O A;  4CYC B;  1BW5 A;  1ZGW A;  3UFD A;  2EZK A;  1TWC J;  1WIZ A;  3GN5 A;  2CQX A;  3HKZ N;  3QYX A;  1WPK A;  2TRT A;  2DA4 A;  5GPA A;  3BG5 A;  4BBR J;  2LCV A;  1ZVV A;  2YUS A;  4DW6 A;  3S2H J;  2JA6 J;  1G2H A;  4MFD A;  3IH2 A;  2XI8 A;  3RZZ A;  1PRV A;  4I6R A;  1R63 A;  1RZR D;  1ZZ8 A;  5EG0 B;  2ICT A;  1RZR A;  5F08 A;  5F27 A;  2DMU A;  2QCO A;  2R5Y A;  3PM1 A;  1WH8 A;  2AXZ A;  1LCC A;  2NVT J;  1JFT A;  2BNM A;  3RKQ A;  1IJW C;  1X57 A;  5EYR A;  5C4X J;  1ZK8 A;  2XPV A;  3PXP A;  1BDI A;  2XSD C;  4D5C A;  2Y31 A;  5JLW A;  4FTH A;  2HXI A;  1PUF A;  2O38 A;  2IU7 A;  1QVU A;  1YRN A;  4IHX A;  1RPW A;  3R1F A;  3U3W A;  1JGG A;  1X2M A;  3S1N J;  4D7N A;  3QF3 A;  3BDN A;  2OFY A;  1ZQ3 P;  4XK4 A;  2ECB A;  3TW6 A;  2MGQ A;  5K7Z A;  2K9S A;  5M3F J;  1XWR A;  2JK3 A;  2L49 A;  4G12 A;  2GZU A;  2E2J J;  1OCP A;  4M3B A;  1XG1 A;  2G0E A;  5EZH A;  1RZS A;  2DMQ A;  1FEX A;  2XPU A;  2LYK A;  4QTR A;  2PUF A;  4XID A;  3G1L A;  2LK2 A;  3HB9 A;  3O8H A;  5J1R A;  1VND A;  5IYB J;  1GVD A;  4I76 A;  3OMT A;  1OFC X;  1TWF J;  1IRZ A;  3JRB A;  4Z5H A;  1ITY A;  1JTX A;  1HDP A;  3IV5 A;  1ZR2 A;  2ID3 A;  3S15 J;  2N8G A;  1P7I A;  2EZH A;  5IYC J;  5FKM A;  3BD1 A;  2LTP A;  2Y0S N;  4X4H A;  4DZJ A;  3ZQL A;  2OPT A;  3FIW A;  1E3O C;  2M34 A;  5M5W J;  5IOZ A;  3MKL A;  3JXB C;  3TRB A;  4B1R A;  1BA5 A;  2LYJ A;  3TP3 A;  3CDL A;  1QPZ A;  5A7L A;  3JRD A;  1LQC A;  5DTD A;  1Y1V J;  1SFO J;  3CQZ J;  1CQT A;  2LR8 A;  1ZKG A;  2P81 A;  3LSP A;  4M3E A;  1JUM A;  4JP0 A;  1RES A;  2EWT A;  3HDD A;  2LVS A;  3HEF A;  4PU7 A;  2XB0 X;  1VFC A;  1IG7 A;  2DMP A;  2AWI A;  4CYC A;  2W48 A;  1POU A;  2XCJ A;  3TED A;  4M3D A;  1JTY A;  1SQ8 A;  3G1O A;  2LYL A;  4QSH A;  4Z59 A;  3MVP A;  4A3B J;  3A02 A;  5J3L A;  2KDZ A;  4A3E J;  5EGO A;  4XRS G;  1NTC A;  2DN0 A;  1A6I A;  2LKX A;  2DTZ A;  1Z77 A;  2MW8 A;  2AUW A;  2Y30 A;  3ZQC A;  1BDH A;  1HLV A;  1FJL A;  1ZZ6 A;  4D5F A;  3CEC A;  1FIP A;  4IA8 A;  5DS9 A;  4MIM A;  3WHC A;  4UUT A;  2IAI A;  1UHS A;  2MQK A;  1RR7 A;  4GHJ A;  1I6H J;  2VUM J;  1GV5 A;  4EEF G;  2IUO A;  1W0T A;  1T33 A;  5M3M J;  1JFS A;  5M5Y J;  3A01 A;  5IPA A;  3SFI A;  2D5V A;  2JA8 J;  2IVQ A;  1WH6 A;  3SDG A;  3HZI B;  5FLM J;  1W0U A;  4FE4 A;  3GTM J;  5K7H A;  3VK0 A;  3TP0 A;  2HOA A;  2R63 A;  1X2N A;  2M0C A;  2XGD A;  4RDU A;  2CRO A;  3NAU A;  2PMZ N;  1ZTR A;  4JCY A;  4A3K J;  3C2B A;  1L1M A;  5E3L A;  1WGX A;  2QF7 A;  4AYB N;  2E1O A;  3HOU J;  1U9O A;  1GUU A;  4PU8 A;  3Q0W A;  3LNQ A;  4A3F J;  4A3I J;  5J1Y A;  3SJM A;  3GTQ J;  3FK6 A;  4X4I A;  1MH4 A;  2FJ1 A;  2HDD A;  1JT6 A;  3MLF A;  4W97 A;  4M3G A;  3M4O J;  4FCY A;  1JUS A;  5C4J J;  2NVX J;  4A3D J;  5E3N A;  1DWK A;  3LIS A;  2DA5 A;  2JJ7 A;  3QPS A;  4JYK A;  1U78 A;  2PE5 A;  1AKH B;  3HOW J;  3RZD J;  4BXX J;  1ETK A;  1QP7 A;  2KT0 A;  1UMQ A;  2E2I J;  5M5X J;  2VI6 A;  2GBY A;  2LD5 A;  1JT0 A;  3HOV J;  2B5A A;  1OJL A;  1X2L A;  5C3E J;  1AHD P;  2ICP A;  2XGE A;  1U9N A;  5F0C A;  1F36 A; 
#chains in the Genus database with same CATH topology
 2L01 A;  2VT2 A;  4PJM A;  2PXE A;  3HM5 A;  4CYD A;  4XLA A;  2IGK A;  2XJ3 A;  3VEP A;  1ETX A;  1FSH A;  4E7L A;  2J7W A;  1OYY A;  4S05 A;  5H6R A;  3JRG A;  3TFL A;  2I10 A;  3DNV B;  2WAQ A;  3I58 A;  1HA8 A;  1G3W A;  1KQ0 A;  1T95 A;  2HXO A;  2HYG D;  2M9H A;  2DA7 A;  4M6V A;  3I4N J;  3OYM A;  4IXA A;  2CMP A;  2K4B A;  2NVY J;  3E1S A;  4EGZ A;  1Y39 A;  1Y9Q A;  1D0Z A;  4F7Z A;  1KQ8 A;  1ZR4 A;  1MBK A;  5FJ8 J;  4J19 A;  2W82 A;  1B8I B;  2M2E A;  2XGX A;  3QPH A;  4IVZ A;  1YE9 A;  4Z5C A;  4PSW A;  4YG4 A;  1D5V A;  4KIB A;  2NS8 A;  2ZKZ A;  1UST A;  1JUP A;  1EFA A;  2V9P A;  3MKY B;  2PUD A;  4XRM A;  2A61 A;  2K27 A;  4BE1 A;  3BR0 A;  3ZCO A;  1YLF A;  4BQQ A;  2H94 A;  2P0W A;  3G2B A;  5CJ9 A;  4ENK A;  1KZH A;  1FT9 A;  4EJO A;  4BY1 J;  4YBA A;  2Q2E B;  5J1U A;  3Q9S A;  3QOW A;  1WI3 A;  2M4H A;  1OCO H;  1NEQ A;  2XAF A;  4C2U A;  2L54 A;  3IH4 A;  1S8N A;  3I56 I;  3E5U A;  3F8F A;  2O0Y A;  1D5Y A;  2CU7 A;  2ID6 A;  2Y9Z A;  1D1C A;  2R7V A;  3NRV A;  1LCD A;  1LEA A;  1TL8 A;  1MMD A;  1OMI A;  2K5C A;  3E5X A;  3AG2 H;  5JI6 A;  4WVL A;  1JGS A;  1WRJ A;  1DDN A;  3ABL H;  3DTI A;  3PQJ A;  3PFY A;  4HW0 A;  2V1X A;  2IT0 A;  4KJZ A;  3BR6 A;  4FX0 A;  1BC7 C;  1I3A A;  3F3X A;  1UCR A;  3CCY A;  4IX7 A;  4Y15 A;  2BXY A;  2LY2 A;  3F6V A;  4ZC3 A;  1R5G A;  3ZQQ A;  1QHG A;  2P5K A;  3IWF A;  3ZN1 A;  5J4Y A;  1T38 A;  2LYR A;  4X4E A;  3CUQ C;  1B4A A;  3ERE D;  2UXX A;  2BXZ A;  3VPR A;  2H8R A;  2KEI A;  2LYP A;  2V6E A;  4F92 B;  1BI2 A;  2K40 A;  4XKV A;  1R1U A;  2XIU A;  4N9H A;  2PXF A;  2QSF X;  3QU3 A;  1H89 C;  2ZME B;  4BY7 J;  3RPU A;  4C30 A;  3O6B B;  4KFC A;  2WB1 A;  2AXV A;  5FD6 A;  2DXI A;  1V4R A;  3JRE A;  2VBY A;  4E7K A;  1YS6 A;  2XXQ A;  2M3A A;  3ZQH A;  2ZJR F;  4A2U A;  2CYY A;  3K4L A;  1U2W A;  2CG4 A;  4B3A A;  1ENH A;  4XM3 A;  5JVG F;  1MND A;  3QOD A;  3SZP A;  3QOE A;  3D5S C;  2LLK A;  2VKV A;  4V19 K;  3RZO J;  1V55 H;  1WJF A;  5GPC A;  3IAM 2;  1XCB A;  4BYY A;  3HPH A;  1VTN C;  1QU3 A;  2DFF A;  2W7N A;  4LLL A;  3ZMU A;  2EWN A;  2EFP A;  3HC7 A;  1Z7L A;  5ILV A;  2B0L A;  2DQR A;  4NB5 A;  3IWZ A;  4OOI A;  2BNO A;  4KIF A;  2DMT A;  1SAN A;  2WAF A;  4ZZD A;  3ZOB A;  3NDB B;  3GTK J;  2JVL A;  4HQE A;  4XRS A;  4DQ2 A;  2GA2 A;  3L00 A;  3ZMS A;  5E3M A;  2DA3 A;  3FM5 A;  3KLN A;  3OOP A;  2GWR A;  1PYV A;  2KKO A;  3LSG A;  4FHT A;  2VN2 A;  4KT5 C;  3HRU A;  5D4S A;  2STW A;  4EMS A;  4BQN A;  2CFO A;  2CUF A;  4MLO A;  5E1X A;  5GAH J;  3M7G A;  3BTC A;  4Z58 A;  5FLX Z;  2XIG A;  1ZPQ A;  2E1M B;  1ADR A;  2KJC A;  5B1B H;  3A9Z A;  4M6Y A;  1MBF A;  4KA4 A;  1Z7U A;  2EFO A;  3OYB A;  1SD4 A;  3O9X A;  3IH3 A;  2CS3 A;  2F4M B;  3ASN H;  5EDN A;  4I2O A;  4EK9 A;  1JKP C;  4BHB A;  4II2 A;  5ICC A;  4X6A J;  2XPW A;  5GP9 A;  1MSF C;  2K9N A;  5IYD J;  3HXL A;  3CCR I;  3H3Z A;  2GRL A;  3OYE A;  3D0S A;  4CZC A;  4M9S A;  3GME A;  2PXK A;  3HSR A;  4Z5D A;  2R7S A;  4ER7 A;  1LUJ B;  1WVR A;  1HW5 A;  3FMR A;  5E1Z B;  2IA1 A;  3OYG A;  2P7C B;  2AO9 A;  2NNN A;  1OSL A;  2HCN A;  1LMB 3;  1Z3X A;  1ETV A;  1BR4 A;  2E7W A;  5D4R A;  4HEA 2;  4A93 J;  2OCE A;  2QQA A;  3E6M A;  2E34 A;  4WXH A;  4N0B A;  1W1W E;  1R69 A;  2H27 A;  1B0N A;  2GM4 A;  2X0L A;  2CGP A;  3L9F A;  3J7Y J;  4HF1 A;  4OIQ F;  4YFX F;  4GXO A;  4PU4 C;  2HSG A;  2HCS A;  5DV5 A;  1QA6 A;  1HST A;  5CVV A;  2PJP A;  4XQF A;  9ANT A;  4KIG A;  3I59 B;  3IRQ A;  1BBY A;  5E8G A;  4JX5 A;  5DTQ A;  3OQM A;  1IRF A;  4YAR A;  1HKT A;  4L9V A;  1RKT A;  5EEG A;  4YRV A;  4MQ9 F;  1ZN2 A;  2PMZ A;  3KEO A;  5FKL A;  1SFE A;  1Y0N A;  4BL0 B;  3CF2 A;  3LA2 A;  3OYN A;  2B9S A;  4PK4 A;  4RS8 A;  2HQN A;  4LLG F;  3JRF A;  1WH7 A;  2VKE A;  1H0M A;  2Y9Y A;  1HSJ A;  1R9T J;  1XX5 A;  3BR5 A;  3A2K A;  4MTD A;  2DTR A;  4OAZ A;  3KZY A;  2GOX B;  3J81 Z;  3HG9 A;  5BMZ A;  3S93 A;  2A6H F;  1MMS A;  4IVN A;  2TCT A;  2VQH A;  4JX6 A;  3LA3 A;  4LIU A;  3OYA A;  3EYI A;  4EKG A;  4D7M A;  1MJA A;  5J8F A;  5FKO A;  2XKO A;  4CGZ A;  1MW7 A;  1T08 B;  3KPH A;  1RI7 A;  2AHQ A;  3GEZ A;  4IOC F;  5FLV A;  5L3G A;  3RTR A;  3L09 A;  1JHH A;  4O5V A;  4C3H J;  2KMU A;  3BJ6 A;  3QRF F;  1LNW A;  5JLX A;  3FMY A;  2LYQ A;  4IF4 A;  3K1P A;  2E60 A;  1K6Y A;  3RI4 A;  3G7D A;  5F1J A;  3RKY A;  3NEU A;  3GBF A;  2O61 A;  3EUS A;  2DMN A;  1R6R A;  2EPF A;  4XLC A;  2L1P A;  1MBE A;  3I55 I;  2XGC A;  2AXU A;  4XKB A;  3CZ6 A;  2OAZ A;  2JQE A;  2IVG A;  1VF9 A;  3M8E A;  1DP3 A;  2HFZ A;  2WBM A;  1DPU A;  4BUP A;  1UG0 A;  3AKZ A;  2WWY A;  3TOA A;  1FYL A;  3ZP5 A;  1BW5 A;  5K5R A;  1WIZ A;  3GN5 A;  3HKZ N;  4EM0 B;  3BG5 A;  4BAC A;  2DT7 B;  2LCV A;  3P5J A;  1ZVV A;  2ZJP F;  2YUS A;  2K9L A;  1Z21 A;  2EV6 A;  4DW6 A;  1XGS A;  1G2H A;  3VYU B;  1PRV A;  3LQX A;  1XCV A;  1IAW A;  2RQQ A;  3FBN B;  1ZZ8 A;  5GAG J;  1LVK A;  5F08 A;  4PUS A;  3SEQ A;  2Z16 A;  4MGR A;  4CO8 A;  1SAX A;  5DSX A;  2AXZ A;  1D0X A;  2RC4 A;  3BRO A;  1IJW C;  5DRY A;  1TT5 B;  1IXC A;  5EYR A;  1ZK8 A;  4K2E A;  3WG7 H;  1BDI A;  4RA2 A;  3CCS I;  2HXI A;  1QZE A;  1QVU A;  2ZXJ A;  4M71 A;  3QP5 A;  4S04 A;  3E5Q A;  1JGG A;  1X2M A;  1E2X A;  4BDZ A;  5LRR A;  4D7N A;  2A07 F;  3OWT A;  5E8I A;  3MZ8 A;  5KCM A;  3CDI A;  1ZQ3 P;  2IVB A;  2ECB A;  3JCU C;  5K7Z A;  1F1Z A;  5M3F J;  3RKX A;  2GZU A;  2LC2 A;  3GZN B;  2DBB A;  1OIS A;  4NHJ A;  2O6G E;  1FEX A;  4J00 A;  4ETS A;  2LK2 A;  3O8H A;  3I4P A;  3OWQ A;  5J1R A;  2RRE A;  1P4A A;  4QLC U;  3SHF A;  4RB0 A;  2QBY B;  2MA3 A;  3WTX C;  1FLI A;  3GZD A;  2HKX A;  3OMT A;  3ESW B;  3JRB A;  2ID3 A;  2R7O A;  5IYC J;  2MH2 A;  2EZH A;  4P55 A;  4ER0 A;  5HLI A;  1X1D A;  2LTP A;  4X4H A;  1PP7 U;  3DWL E;  3A4C A;  4M9Z A;  4R8H A;  1BN5 A;  3ZRG A;  5J8C A;  3MKZ A;  1U5T A;  4NNJ A;  4HNT A;  2YR2 A;  5IOZ A;  1L3L A;  3MKL A;  2UWM A;  4B1R A;  2LYJ A;  5D5W B;  3TP3 A;  2EJR A;  4HOB A;  5CVI A;  3SZT A;  1MMA A;  1P9Q C;  1YW8 A;  1LQC A;  1REP C;  5A7L A;  4JOM A;  3C7J A;  4HZF A;  3CQZ J;  3FXL A;  2KRF A;  3DM5 A;  1EA3 A;  4RM2 A;  1BR2 A;  1V54 H;  1JUM A;  2YU3 A;  3GFM A;  1O7L A;  2EWT A;  2LVS A;  3HEF A;  3CMM A;  1IG7 A;  3M9L A;  3JTH A;  4CYC A;  4XLH A;  5F6F A;  3TED A;  5HNF A;  1JTY A;  2MFZ A;  3DFG A;  3OL3 A;  2LYL A;  4QSH A;  4Z59 A;  4A3B J;  1FBQ A;  1HKQ A;  3KIO A;  2STT A;  4A3E J;  5EGO A;  1P4X A;  4XR6 A;  5ILS A;  1NTC A;  2DN0 A;  3ABK H;  1HBX G;  1VQ5 I;  2A05 A;  1J09 A;  4FT8 A;  3U1K A;  2AUW A;  2HVQ A;  3F8B A;  2HQA A;  5FGM A;  1HLV A;  1FJL A;  1W4M A;  3I0T A;  5E79 C;  4LD5 A;  1ZZ6 A;  3CEC A;  4UUT A;  1EKE A;  4B09 A;  1YHQ I;  3DLA A;  2MQK A;  1U2Z A;  1I6H J;  2VUM J;  3OV8 A;  4EEF G;  2XSJ C;  1IN8 A;  2ZJ2 A;  3U1D A;  2EA4 A;  1TNS A;  1YG2 A;  5M5Y J;  3KP6 A;  3A01 A;  3ECO A;  3OS2 A;  2D5V A;  2IVQ A;  4PFO A;  3HZI B;  3ZMV A;  2KP6 A;  2ACJ A;  3ZQ7 A;  3S2W A;  3CP8 A;  1MNE A;  4QWQ A;  3WGH A;  2ELH A;  1TQI A;  1H9T A;  4E7H A;  3QFI A;  1VQM I;  3BG6 A;  1SFK A;  4XLF A;  5GTI C;  1YW9 A;  2W24 A;  1L1M A;  1WGX A;  4AYB N;  4D1Q A;  4OIP F;  2RKH A;  4NC8 A;  1QZX A;  3TEL A;  2QZ8 A;  3R61 A;  1DP7 P;  1MH4 A;  1G4D A;  4IJA A;  3WE2 A;  3MLF A;  1G3T A;  4UV9 A;  2HDW A;  4IHT A;  4N4O B;  4PJL A;  4PJ0 C;  3M4O J;  3E6D A;  2VIX A;  4A12 A;  1VQ8 I;  1TW3 A;  4YEL A;  1MDM A;  3QPS A;  3CP2 A;  3IKT A;  5DYM A;  3DXJ F;  3FWE A;  4LB5 A;  3HOW J;  2BBY A;  1Q1H A;  3CDH A;  1ETK A;  1QP7 A;  4Z6Y A;  2QQ8 A;  1ZRE A;  2E2I J;  1E3P A;  1KU2 A;  2ICP A;  3HOV J;  1AHD P;  2XGE A;  1U9N A;  3A1Y A;  4I7H A;  5DCM B;  2QUF A;  2GXA A;  2BHY A;  3O8G A;  1CGP A;  1KU7 A;  1NG6 A;  3O3K A;  1ODD A;  2KEJ A;  3FIS A;  4X4F A;  2BV6 A;  2EB7 A;  2HTJ A;  2HOT A;  1BW6 A;  4CCL A;  3BCB A;  4HV5 A;  1XMX A;  4KMU X;  2NOG A;  4BXF A;  3VWS A;  2ZME A;  2W4S A;  3ISP A;  1USS A;  1KA8 A;  1GDT A;  3B6C A;  3FHN A;  1Y1W J;  5IY5 H;  2DOE A;  2ETH A;  4RMN A;  4AIK A;  4J1W A;  4O3M A;  1MBH A;  2J5P A;  4IEJ A;  3K4N A;  3RYR A;  4I09 A;  1BIB A;  5DCF A;  2QVO A;  3RDI A;  3CCL I;  3M1C A;  2R7W A;  1Z05 A;  1V5G A;  4DIQ A;  1GVJ A;  3HRS A;  1WJC A;  2X9D A;  1PRU A;  3FKJ A;  3M07 A;  2JQ7 A;  4WCG A;  3H3U A;  4QPQ A;  4A5N A;  3GBG A;  2XAS A;  3MN2 A;  2O5R A;  3FXU A;  4KIS A;  4Y13 A;  3BS3 A;  2HYJ A;  2ZFW A;  1RKW A;  3PSI A;  1W7P B;  3AL0 C;  1UFM A;  4HQM A;  2YS9 A;  1IDY A;  4U0Y A;  6PAX A;  2UV1 A;  1ETW A;  3TGN A;  1QNT A;  1ETO A;  5HOO A;  4PFP A;  1WH5 A;  1LFB A;  2V9V A;  3ZPX A;  2ISZ A;  4CSW A;  2FNA A;  2O3F A;  4GGG A;  5HOD A;  1KU3 A;  2PXT A;  2JA7 J;  2HVR A;  5HDG A;  2HIN A;  5DRT A;  3E3V A;  2GAU A;  2LKS A;  1R58 A;  2PIJ A;  1A31 A;  1XS9 A;  4RBO A;  2WY8 Q;  3K70 D;  1LB2 A;  3CUQ A;  4AID A;  1K78 B;  2QSG X;  4IHY A;  2VAS A;  2BNN A;  2ADU A;  3M8F A;  3VYT B;  2V79 A;  3UNG C;  3FXK A;  3IAS 2;  1J9I A;  3ABM H;  1LPQ A;  2HPM A;  3FYM A;  2PUC A;  1W7P D;  1L0O C;  3JRH A;  3FMQ A;  2R5Y B;  1K61 A;  3M3Y J;  3BTJ A;  4F52 A;  1YW7 A;  3HYI A;  4UXN A;  1APL C;  3JXC L;  5LD2 C;  2OF7 A;  4A0X A;  3SDB A;  3WU1 B;  2CW8 A;  3MAJ A;  2O03 A;  4YG1 A;  2DA2 A;  2V1U A;  4AC0 A;  2ICW G;  1OCT C;  2NVU B;  3OQO A;  1QO0 D;  3EQL F;  5LFA A;  1JJ8 C;  3VWB A;  3OYC A;  2IS2 A;  3KX2 A;  3QWL A;  3H0G J;  3H9Q A;  1VQP I;  3ZMD A;  2PUA A;  1UZC A;  1BR1 A;  3BPV A;  4FET A;  1MBJ A;  3PIP F;  3CMA I;  2YU9 J;  4BE0 A;  4CCO A;  2HYF A;  3R0A A;  3F8N A;  1LE8 B;  4NC6 A;  4Q2J A;  1OR7 A;  2LP0 A;  2E36 A;  4I8T A;  4V2F A;  3KYL A;  4GFB A;  5KHD A;  4IRI A;  2W57 A;  2DT6 A;  5DD8 A;  4EV0 A;  1MZB A;  4BQA A;  4XRF A;  3QPT A;  5J47 A;  4YFK F;  2WUS R;  2PMH A;  4EJW A;  4BGD A;  3TO9 A;  1QQA A;  4S0H B;  3MKW B;  3SCF A;  4OAY A;  1B6A A;  2QWW A;  5FB2 A;  4BHC A;  2JZY A;  2QKM B;  3PO2 J;  1ZZC A;  1P4W A;  3W6J B;  1ZHF A;  2QA4 I;  1OYW A;  2IRF G;  1TQM A;  3BPX A;  2VPR A;  1I1S A;  2R7D A;  2ME0 A;  1NK3 P;  4ER6 A;  3BG9 A;  1POG A;  1HF0 A;  2FD5 A;  2VC0 A;  1WJD A;  2K86 A;  2RAE A;  1QP4 A;  1HKS A;  2XF7 A;  5JFR A;  1MMN A;  1VI0 A;  4AM3 A;  3WU2 C;  3HUG B;  3A01 B;  1PVE A;  2IBD A;  1SMY F;  2LNB A;  3GFL A;  1ONV A;  1LE8 A;  1HXD A;  2XB5 A;  2JT1 A;  2VON A;  2XRL A;  4DYR A;  4CZZ A;  2L7M P;  3HGG A;  5IP6 A;  4HRA A;  2WV1 A;  4ZYH A;  2O7O A;  3KCC A;  5IP9 J;  2EH3 A;  4IZZ A;  3GFI A;  2L9R A;  1DW9 A;  5KAF C;  3UKG A;  1ZAY A;  3DTE A;  1IZ1 A;  5BPD A;  5LHH A;  3F6O A;  3TOB A;  3BDD A;  5L3B A;  4A69 C;  1ERD A;  2L8N A;  5K5Q A;  5E18 F;  5F0H A;  4DYC A;  1YI2 I;  2IS6 A;  5F1R A;  4CH7 A;  3VOE A;  3S2D J;  1HW1 A;  3BR1 A;  2J5O A;  3BTI A;  4RAZ A;  2DA6 A;  2FF4 A;  2KFD A;  3E7L A;  2ZME C;  3BCA A;  2F5E A;  3FX3 A;  4GQM A;  5LGN A;  3C3W A;  2OA4 A;  4G6T B;  2EBY A;  2DCE A;  1FBS A;  1U8R A;  2FBK A;  2TDX A;  2FOK A;  1ZAO A;  3F6W A;  2E71 A;  3LFK A;  1WFX A;  1B72 B;  2FJR A;  1TNT A;  3ZHI A;  4KN7 X;  2IV1 A;  3P9K A;  3K4M A;  2QKL B;  2IEK A;  1Z6T A;  1ETQ A;  1ZYR F;  3MEJ A;  2JRM A;  2MLK A;  1G6N A;  5GAE J;  2K02 A;  4L0Z B;  1Z1D A;  3S1Q J;  2RQP A;  3GTO J;  1K4S A;  3LFP A;  2JTV A;  2MAB A;  3CCV I;  3A9Y A;  4DNC A;  1ZG3 A;  1LDJ A;  3WTS C;  2A5Y B;  4AVP A;  3K0L A;  4U87 A;  3PL8 A;  3KXA A;  3I54 A;  3S14 J;  4C3I J;  1BM9 A;  1IDZ A;  5DEQ A;  4MEX F;  3IVP A;  5TIS C;  5B3S H;  1ZLK A;  3HTU A;  2VJI A;  1S5L C;  2XXP A;  5HLH A;  1FOX A;  5ED4 A;  4UNO A;  2BVL A;  5FKN A;  3MZH A;  1I3Q J;  2NS7 A;  4MHG A;  3RQ4 A;  1FMW A;  3TW7 A;  1R7J A;  3OQN A;  2DU9 A;  1TLH B;  2XUB A;  1WCM J;  3D5R C;  1LVA A;  4XIC A;  4BQO A;  2VBX A;  2Z2S B;  2KPJ A;  1LFP A;  1PP8 F;  4I01 A;  4HLX A;  3RPQ A;  1FTZ A;  3OSG A;  1OCR H;  4IHW A;  3M8J A;  3ZN0 A;  1D1B A;  4PJJ A;  4XLE A;  5D6E A;  4DGW B;  2LKP A;  2O9L A;  4WXD A;  3F8C A;  4XSX F;  4PU3 C;  1WJA A;  3LQR A;  3ZHM A;  3EUH A;  4HDU A;  2R92 J;  3TEP A;  4AYB A;  2MBF A;  1FP2 A;  5ICE A;  1V5E A;  4ZYE A;  1TWH J;  1AOY A;  4UVC A;  2R5Z B;  1JH9 A;  3LSK A;  2Z99 A;  2WAQ N;  2X6X A;  4Y7N J;  3ZQF A;  1YTY A;  4I02 A;  4AIH A;  1HOM A;  2R7U A;  2X6O A;  1K79 A;  5JHF A;  3UFD A;  2DLL A;  3QYX A;  4L0Y B;  1WPK A;  1Y6I A;  1W36 C;  3RIR A;  3REO A;  2DA4 A;  3ABT A;  4E6K G;  5A2Q K;  1K78 A;  3S2H J;  1QPM A;  2A3S A;  3T5X A;  1XGM A;  3IH2 A;  1HQC A;  3ELK A;  2XI8 A;  1XSD A;  1A35 A;  5JR3 A;  1IXS B;  5BQT A;  1R63 A;  4PGG A;  3TQN A;  1RZR D;  1EH7 A;  2DOF A;  3ML6 A;  2ICT A;  4ZYA A;  1U3E M;  5F27 A;  3DPU A;  3OYJ A;  2NAZ A;  3LST A;  5LGU A;  2QCO A;  2R5Y A;  3PM1 A;  2NVT J;  4G94 A;  2K3F A;  4XOR A;  2BNM A;  3RKQ A;  1V3F A;  3MWM A;  5CVU A;  2VXZ A;  3SFZ A;  5GTH C;  2PBI A;  5C4X J;  4XN0 A;  3CCQ I;  1VQ9 I;  3PSF A;  2Y31 A;  4D5C A;  3I5U A;  2O38 A;  2XAU A;  2XXA A;  4P96 A;  2OQR A;  1R5H A;  4IHX A;  4XN3 A;  3R1F A;  2LOO A;  1TP4 A;  2QSH X;  2WY7 Q;  3QF3 A;  4CIC A;  2NYX A;  4XK4 A;  3TW6 A;  1YS7 A;  2MGQ A;  4M6X A;  2RDP A;  1UEL B;  2OV7 A;  3GZC A;  3CC4 I;  4M3B A;  2F5F A;  1XG1 A;  2MYS A;  2OCC H;  3VSL A;  4EVI A;  1RZS A;  2DMQ A;  2XPU A;  2LYK A;  2G9W A;  2PUF A;  2R3S A;  5ICF A;  3FM3 A;  4ZDL A;  5IYB J;  1GVD A;  2BY1 A;  2DT5 A;  2WAD A;  1S7O A;  1TWF J;  1OFC X;  5LHI A;  1B59 A;  3NWS A;  1JTX A;  1ZR2 A;  1M1E B;  3K2Z A;  5L3F A;  4WWC A;  3NWT A;  4QPO A;  4IQJ A;  2YX7 A;  5FKM A;  1MGT A;  1S3J A;  3I3L A;  3OR2 C;  2COM A;  4AWX B;  1A36 A;  1QGP A;  2ISY A;  3EDP A;  3HKZ A;  1G59 A;  2PJR B;  2M34 A;  5M5W J;  4KT6 A;  4Q48 A;  4JBA A;  3PE5 A;  3TRB A;  2M4K A;  3JXB C;  3A0B C;  1BA5 A;  1WQ2 A;  2HQR A;  3CDL A;  1LEB A;  1S6L A;  1QPZ A;  2BE5 F;  4G7H F;  2AXT C;  2LBF A;  4HRI A;  1MKM A;  3G71 I;  1CQT A;  2LR8 A;  1ZKG A;  5HLG A;  2QEX I;  2VE9 A;  1H9G A;  4JP0 A;  2ESN A;  3K69 A;  1T8I A;  2FU4 A;  3LAP A;  4CHU A;  3HPG A;  4HX4 A;  2JPC A;  5L3D A;  3CCU I;  1SQ8 A;  3KZI C;  3G1O A;  2DDB A;  2DOD A;  3HTS B;  5DCM A;  4Y3O A;  3EUA A;  3QYB A;  4XRS G;  4P9U A;  3WTT C;  5L3C A;  3RPU D;  2R7R A;  5B1A H;  1Z77 A;  2MW8 A;  1EV7 A;  2D2W A;  4D5F A;  2WAE A;  5DS9 A;  3WHC A;  5E1W A;  2P7V B;  1G3Y A;  5HDK A;  3T8T A;  4GHJ A;  3EET A;  2KIS A;  3T8R A;  2H6B A;  3VDX A;  1WJE A;  1I6X A;  1JFS A;  3GZ6 A;  5IPA A;  2FUG 2;  3TMO A;  4ZTJ A;  4Q47 A;  3JW4 A;  3CF5 F;  1BC8 C;  2L2O A;  4AVZ A;  3ZMZ A;  1FZP B;  5TGT A;  2FEZ A;  2HZD A;  1J75 A;  1X3W B;  3KEY A;  2XGD A;  4RDU A;  3S32 A;  1PUE E;  2PMZ N;  3C1D A;  4X0G A;  4ENM A;  2VJ5 A;  3FHZ A;  4JCY A;  3C2B A;  1B9M A;  2QF7 A;  1U9O A;  5IT3 A;  3Q0W A;  3LNQ A;  1R23 A;  1VZ0 A;  4A3I J;  5J1Y A;  3PIO F;  2Z9O A;  4RGS A;  3WGG A;  3CC7 I;  4R1H A;  3MFK A;  2P5L C;  4HDV A;  4A6D A;  3CCE I;  3V8L A;  4NUB A;  2QBY A;  5GAD J;  2F2E A;  3MEX A;  3V8K A;  2JSC A;  5AON A;  2GXG A;  1OCC H;  1SVM A;  1GXP A;  4ZDP A;  1U78 A;  5D6F A;  4LIT A;  3U2R A;  4OIR F;  4CCN A;  3L2V A;  1Z91 A;  1O3Q A;  1UMQ A;  1B9N A;  3OMY A;  3KZZ A;  3EUK L;  4XBF A;  2GBY A;  2LD5 A;  3MQ0 A;  1JT0 A;  1VQK I;  4HST A;  1E17 A;  4Q5S F;  3E6B A;  1A04 A;  3KE2 A;  1JHF A;  4U0V A;  1F36 A;  2VBW A;  5E20 A;  4XNF A;  1O3S A;  1XC5 A;  5AIP A;  4HPQ A;  4DBQ A;  3L2W A;  4EJT A;  2CSF A;  2WB1 N;  2DAO A;  4A3L J;  1WJ5 A;  1BOA A;  4IPA A;  3LOC A;  3C2H A;  5GAH i;  1PDN C;  1R36 A;  2ESH A;  1FP1 D;  2MC3 A;  2D1V A;  4C2T A;  2ELK A;  1FC3 A;  3GWZ A;  5D8L B;  2VOD A;  4HX8 A;  4FN3 A;  3HOY J;  4A3C J;  1Y56 A;  1D8K A;  4UUV A;  5JUW A;  1X19 A;  1SEU A;  1XTA A;  2HVS A;  2PUE A;  3OY9 A;  2W1O A;  2DFE A;  1KYZ A;  4EM2 A;  3K4C A;  1E3H A;  1XMK A;  2ZNY A;  4HYE A;  1OKR A;  3HOX J;  1QVT A;  3OIP A;  1T6S A;  1YSE A;  2EFW A;  4UB8 C;  3I59 A;  4NDL A;  1U8B A;  2DJN A;  1TBX A;  3QQA A;  2VEO A;  2PXQ A;  1QP0 A;  2Y69 H;  3V7S A;  5DM6 F;  1B1B A;  2LMD A;  2W84 A;  4UUS B;  4WK8 F;  4PGH A;  5GAG i;  3GTP J;  3RKW A;  3AG3 H;  5KVR A;  1MBG A;  3J80 Z;  3RQI A;  1LDK B;  2PFB A;  4RGX A;  4ER3 A;  3ONQ A;  3BG3 A;  2EFQ A;  1STZ A;  1IV6 A;  2KEK A;  3GW2 A;  1ZZ9 A;  2L4A A;  2JSP A;  3LA7 A;  4NC7 A;  4MCX A;  1G8X A;  1NG7 A;  3SCG A;  2PXU A;  1E0E A;  2E2H J;  1RZ4 A;  3PNY A;  5EZG A;  1UTX A;  2KIQ A;  2VJ4 A;  3QPL A;  1LLI A;  4MCT A;  3QOP A;  4M3F A;  2JVH A;  2XV4 S;  4L5E A;  4OIO F;  2CWE A;  4CDG A;  4P9F A;  1Y0U A;  3QWG A;  1UJ8 A;  2NRA C;  3Q0V A;  2EA2 A;  2QYO A;  3DF8 A;  3DEE A;  3IKV A;  1UXD A;  3MD2 A;  1VQO I;  2MSY A;  2M8G X;  2OJE D;  3BP8 A;  1K7A A;  3BQZ A;  1Y8R B;  4ESJ A;  1UAA A;  1ORK A;  1X1P A;  5TJJ A;  4G9Y A;  3DQV C;  3OL4 A;  4RLF A;  1ZGJ A;  4A5M A;  5KNL A;  3H92 A;  4MQV A;  3VFZ A;  1ZRF A;  4F8D A;  3JR9 A;  2V1D A;  2R7Q A;  3HIF A;  3HRT A;  1LFU P;  1J59 A;  3EYY A;  2DYR H;  1X1C A;  3VOD A;  4LG3 A;  3H35 A;  4JK1 X;  1XSV A;  4BS9 A;  1JI8 A;  3IP4 B;  3OYL A;  3S8Q A;  1YO5 C;  5FLX K;  3DU6 A;  1Z67 A;  1N77 A;  2DYS H;  4A0Y A;  1YFH A;  4HF0 A;  2K85 A;  5EG0 A;  1EF4 A;  4EGY A;  2D45 A;  1F5T A;  2PPX A;  2CSO A;  2O8X A;  2E1M C;  2OC6 A;  1ULY A;  2EV0 A;  5CQG A;  4ABZ A;  2HOE A;  2FMY A;  4UY8 I;  3WG9 A;  4ZYG A;  5ERI A;  2F48 A;  1JE8 A;  4HSR A;  2OZ6 A;  2ELJ A;  2PXP A;  2AQE A;  2IVM A;  2BY3 A;  4LK0 F;  3S3M A;  2D1H A;  4IHS A;  4PCQ A;  1XB4 A;  4GYI A;  5DDG A;  2M30 A;  1S7A A;  1IN7 A;  2VL8 A;  2MC4 A;  3JRI A;  2PJR A;  1HW2 A;  3CLQ A;  4LLN A;  5E17 F;  3FBI B;  5EF6 A;  3JXD L;  4FX4 A;  1ZH5 A;  4OBM A;  4LG0 B;  3LFU A;  2X6W A;  3SCH A;  4XMY A;  3T0Y A;  4ESF A;  1NK2 P;  2GLO A;  2FX0 A;  3ZQI A;  2ZB9 A;  2Z1D A;  2IXS A;  1QPI A;  3LWF A;  5E3O A;  2Y0M A;  1ZG1 A;  2IA0 A;  1T0F A;  2V9K A;  2MLG A;  3NAR A;  4RAY A;  3KP7 A;  3LSJ A;  2Y2Z A;  3CJQ B;  4A0Z A;  2NXN B;  4G8X A;  4C9Y A;  2K4J A;  4CCK A;  4XOT A;  5DM7 F;  1B72 A;  3RJP A;  1PRA A;  2W25 A;  4O6J A;  5BNG A;  1TWA J;  4CXF A;  2F5D A;  3GTJ J;  3OSF A;  1MSE C;  2R93 J;  4RLQ A;  3HSF A;  4IQ4 A;  2LH9 A;  2L5Q A;  3CES A;  3VB2 A;  4X4G A;  2IS4 A;  3IHU A;  2LY9 A;  2YX4 A;  3DBR B;  1DQU A;  5L3E A;  2KZG A;  2H09 A;  4LJZ F;  4RB2 C;  3M1E A;  4KUM A;  2E19 A;  1MMG A;  2VKH A;  4CCJ A;  4HX7 A;  3KYD B;  2LG4 A;  1JXS A;  4J1X A;  4HNV A;  3O2P E;  3OOU A;  3OYK A;  5JHU A;  2OBP A;  2B63 J;  1YX5 A;  3BLY A;  3G3Z A;  2FA5 A;  2IP2 A;  2M8E A;  2Q0O A;  2Y0S A;  3K1N A;  4Y17 A;  4AU7 A;  3W3C A;  2COB A;  1UG2 A;  2HGC A;  2OR1 L;  3ZQG A;  5C44 J;  4U88 A;  3DEU A;  1RPE L;  2PXV A;  3W2W A;  1ZZ7 A;  5K5O A;  2F5C A;  4L9J A;  1A5J A;  4AUX A;  4MFE A;  1MNM C;  1X4O A;  1PNR A;  1SFX A;  2FML A;  2BZT A;  2L0K A;  4BJT A;  4W1U A;  5K1Y A;  2EK5 A;  3GZD C;  2ZXI A;  2UXN A;  4LOC A;  5KAI C;  4D9J A;  3CMY A;  2PXB A;  4JCX A;  4X4B A;  2VXD A;  3PUF A;  1XGO A;  4ER5 A;  3G5G A;  1XDS A;  1SVO A;  2EBI A;  3E97 A;  4FQG A;  2CJJ A;  5J40 A;  2HS5 A;  2R5Z A;  4BNC A;  2WIU B;  3NZL A;  2JCG A;  1ZS4 A;  3WHB A;  2ZCW A;  4FIS A;  3A9X A;  3F51 A;  2J7U A;  2V6C A;  2CUE A;  4HLY A;  4ZH4 F;  5K7F A;  4MNU A;  1HCR A;  3GTL J;  4IWR A;  3HOZ J;  3TDU C;  4RB3 C;  1N75 A;  5DUI A;  1J7K A;  2Q2E A;  3CJT B;  2A68 F;  1RRJ A;  1YIT I;  2RN7 A;  5J4V A;  4YG7 B;  2PX9 A;  1FPQ A;  1OPC A;  5IP7 J;  3QQ6 A;  1X58 A;  2XAJ A;  3SYT A;  4X1E A;  1GHC A;  3B73 A;  2X4H A;  2K9M A;  1VQL I;  3MZY A;  4I6Z A;  3SZG A;  1F4K A;  3HOS A;  5FRO A;  3F22 A;  3BG7 A;  4HAM A;  3QOX A;  1J0R A;  1LJ9 A;  1UHW A;  3V8J A;  4N9I A;  2HTS A;  4M74 A;  4IHV A;  3TO7 A;  4B43 A;  1Z9C A;  1UXC A;  4DJA A;  1S29 A;  1JWL A;  2AQF A;  3OP9 A;  3HHG A;  2VJJ A;  2JA2 A;  3WTU C;  2OTL I;  2CQQ A;  3IUO A;  3LSH A;  4BU2 A;  4XLP F;  1U6G A;  2DPD A;  3KJX A;  4EZI A;  2CUZ A;  2KL4 A;  2HDC A;  4B4C A;  3LSR A;  3CD6 I;  4B48 A;  3H36 A;  2M87 A;  1S9H A;  1P92 A;  2LFB A;  2BYV E;  2X51 A;  1QBJ A;  3H3V K;  1DU0 A;  1KU9 A;  1NER A;  2HPI A;  5CVJ A;  5LEJ A;  3JRC A;  2DPU A;  4Y42 A;  3G1M A;  2JUG A;  3GLX A;  4IRH A;  4C2M J;  4ENJ A;  4ZTF A;  1HC8 A;  2XRO A;  1D1A A;  4A3M J;  1MDM B;  2O49 A;  3TO6 A;  5IT9 K;  3DBH B;  2ZBK A;  3K4K A;  2BW3 A;  3SEZ A;  5D5X B;  4A3J J;  1YJN I;  2JA5 J;  4FE7 A;  1XPX A;  3F21 A;  5LHG A;  3KP4 A;  2PXL A;  3EPZ A;  4LIV A;  2L7Z A;  4I0B A;  2E1C A;  1ZGA A;  2BEO A;  4E7S A;  4IKF A;  1TWC J;  5ICG A;  5HLT A;  2CQX A;  2DI3 A;  5DUK A;  3TL4 X;  2TRT A;  2NNY A;  1RUO A;  3GUU A;  2HZT A;  1GLN A;  3GUD A;  4WXC A;  4BAY A;  4YII A;  2XAQ A;  1I5Z A;  2R7T A;  4BJ6 C;  2A69 F;  2VOP A;  3RZZ A;  1K6O A;  4I6R A;  4A6E A;  2M5W A;  3AFH A;  5CYV A;  5EG0 B;  1RZR A;  2EIJ H;  4KYW A;  3DBL B;  4M9X A;  2X6Y A;  2DMU A;  2FE3 A;  1WH8 A;  2ZXW H;  3JSO A;  4CA0 A;  1JFT A;  3WE3 A;  3ULQ B;  1FYK A;  4G7Z F;  1P2F A;  3V42 A;  2XSD C;  5JLW A;  1PUF A;  2QGU A;  3AAF A;  3CME I;  4FTH A;  2OTJ I;  2FBI A;  2FFH A;  1FOY A;  2IU7 A;  5LBQ A;  5HNH A;  1FBU A;  3X2Q H;  2LRD A;  2FOW A;  4BE2 A;  1ZEL A;  2WV0 A;  2EIM H;  3FXO A;  4DE9 A;  1RC9 A;  2G7U A;  2PQ8 A;  4BXU A;  1T98 A;  1W36 D;  2OFY A;  2L9S A;  5BOX A;  2L49 A;  2JK3 A;  4OIN F;  4G12 A;  3DKW A;  1T39 A;  2BOL A;  2E2J J;  2DFI A;  3J7A Y;  1PJR A;  2G0E A;  3S3O A;  3F8M A;  2Q8K A;  2NOJ B;  4HNU A;  4QTR A;  2VB6 A;  1G3S A;  3QP6 A;  4TV7 A;  2IGM A;  1ON2 A;  1KYW A;  2ZO4 A;  2CW7 A;  3CCJ I;  1IUY A;  3SX0 A;  4YIR X;  1BJA A;  4I76 A;  4YEJ A;  3HL2 A;  2CFX A;  1X1B A;  4F55 A;  4F3Q A;  3S15 J;  2ODR D;  3CJN A;  1KGS A;  1P7I A;  3FF5 A;  2Y0S N;  4UV8 A;  2GZW A;  5FFX A;  2RNJ A;  3ZQL A;  4B3X A;  4CUG A;  3K70 C;  4ANJ A;  1E3O C;  3CO6 C;  2E5Z A;  2P6S A;  4B44 A;  2CQK A;  2F4O B;  3NRO A;  3K10 A;  3QAH A;  3QYE A;  2WC2 A;  3JRD A;  5DTD A;  2R7F A;  3W2A A;  1UHM A;  1Y1V J;  3B02 A;  5AIQ A;  3LSP A;  2P81 A;  2IGO A;  2XDV A;  3HSE A;  2DK8 A;  4IRG A;  1IN5 A;  2L4M A;  2RVC A;  3HDD A;  4PDK A;  4PU7 A;  2KRH A;  4B47 A;  2AWI A;  2MD0 A;  4XOP A;  3GVA A;  3KP3 A;  4P1W A;  4ZZL A;  2MXD A;  4M3D A;  3UWP A;  2HR3 A;  2JVG A;  3TKY A;  4CCM A;  1SD6 A;  3A02 A;  5J3L A;  2KDZ A;  1SD7 A;  3J7A O;  1SD5 A;  1LKX A;  5J6X A;  1TQP A;  2CO5 A;  2DTZ A;  4XLN F;  1XDU A;  4L5I A;  1YIJ I;  3L7W A;  3ASO H;  4NQW B;  1FIP A;  4ZDO A;  1R5I D;  1UHS A;  2BY0 A;  1RR7 A;  2OQG A;  2V4J C;  2LYC A;  1C0W A;  3FXJ A;  2IUO A;  2G7H A;  1BI3 A;  3JAM Z;  4LFU A;  1T33 A;  5M3M J;  4KN4 X;  2GXB A;  1T0F C;  3GXO A;  4PZJ A;  3I71 A;  2QEN A;  3OR1 C;  3SDG A;  3L2Q A;  2DOA A;  2JUC A;  2EV5 A;  2JRT A;  3GTM J;  5K7H A;  3VK0 A;  2VQL A;  3FZV A;  2V26 A;  4M72 A;  3F9K A;  2R63 A;  1X2N A;  1NH3 A;  2X1E A;  2M0C A;  1IW7 F;  2GA1 A;  1N25 A;  2XF6 A;  2XAH A;  2Z5U A;  3NAU A;  4GYG A;  4I98 B;  4N4N B;  2LF7 A;  2V3C C;  2OZU A;  1S72 I;  3HOU J;  3BZC A;  3R60 A;  1GUU A;  4PU8 A;  2M0M A;  2KZV A;  5DD4 A;  4A3F J;  2GIZ A;  3K4B A;  3FK6 A;  4X4I A;  4LGW A;  2HFH A;  4BH9 A;  5CKT A;  2DW4 A;  1LDD A;  4NQW A;  1JT6 A;  2OD5 A;  1O7F A;  1YQA A;  2PG4 A;  4W97 A;  2R7X A;  3H5R A;  1TZL A;  2M7B A;  3ECH A;  5HS8 A;  1X3Z B;  5C4J J;  2KDO A;  4OMY A;  4A3D J;  5E3N A;  1WZ2 A;  2L02 A;  3LIS A;  2DA5 A;  1X4P A;  2XF5 A;  3HRM A;  3HZJ A;  3Q5F A;  2PE5 A;  5HS7 A;  1AKH B;  3RZD J;  4BXX J;  1VQ6 I;  5H2F C;  2KT0 A;  3N97 A;  2VPL A;  5H20 A;  2YBD A;  4EKI A;  2VI6 A;  4ZJZ A;  3KL4 A;  2LRE A;  2B5A A;  5C3E J;  3J7Z I;  2KRC A;  4OWR B;  1D0Y A;  1PER L;  3I4M J;  1OLT A;  5CQE A;  2MD5 A;  2YSR A;  2L7F P;  4E7J A;  5TRD A;  4HBL A;  2NVQ J;  2DK5 A;  4ON0 A;  1AWC A;  3H1C A;  5IOY A;  2LBF B;  4GDF A;  4QIW N;  4EM1 A;  2ECC A;  1MH3 A;  2HNH A;  2WA0 A;  2BY2 A;  2EFN A;  2BW3 B;  5BS6 A;  2MEZ A;  1RIO A;  4E7Z A;  3NQO A;  3HGY A;  1J2X A;  1K4T A;  2X1C A;  1MFQ C;  2VOO A;  3RSN A;  3WTZ A;  1QB2 A;  4Y33 A;  2LYS A;  1FX7 A;  2F5V A;  3DPT A;  2E7X A;  3KEQ A;  2XRN A;  2CV2 A;  2MH9 A;  4OU0 A;  4OB4 A;  2P8T A;  5FKK A;  1QHH D;  2RNG A;  1T56 A;  4G6Q A;  4LG0 A;  4L5J A;  2ZC2 A;  3KET A;  1RIO H;  1TW2 A;  2ME6 A;  3JAM K;  3W6V A;  4FBI A;  1W5C C;  2M4G A;  1W5T A;  2HI3 A;  3ZR8 X;  1IF1 A;  4A3G J;  4RGR A;  1R1T A;  4G7O F;  1WHU A;  2FSW A;  1W7P A;  4JQF A;  4X4C A;  3Q0U A;  2ZSI B;  1IXR C;  1DU6 A;  3OS0 A;  3FXM A;  3BZK A;  3KFW X;  2EF8 A;  5CVR A;  2C6Y A;  5CPR B;  1JJ6 C;  2EZI A;  3F0C A;  3V7R A;  1RNL A;  3COA C;  3HJE A;  1ZUG A;  3BTL A;  3DCF A;  4U0W A;  3FKI J;  2BHZ A;  3V7C A;  2A6C A;  3GCM A;  2MG4 A;  4EQZ A;  1BJZ A;  5FD5 A;  3G0T A;  1IV8 A;  4WF2 A;  4XL9 A;  4NDW A;  3CRO L;  3WTY C;  4JQD A;  3KP5 A;  3HBL A;  3U9G A;  2M1B A;  1KON A;  1IGN A;  3B7H A;  2EIN H;  1BIA A;  2GOM A;  1DUL A;  3KZ3 A;  3VYR B;  3HOT A;  4KNY A;  4D0P A;  3DP7 A;  3E6C C;  3W6K B;  2I8D A;  3PFI A;  3OYF A;  3OIO A;  2QLZ A;  1SVL A;  1CJG A;  2B7E A;  1TTY A;  1AA7 A;  3SXY A;  4AIJ A;  3ZGK A;  4DZP A;  2IS1 A;  2E5N A;  3GO5 A;  3CC2 I;  5JVT A;  1P7J A;  4P5O A;  4JX4 A;  1ZZB A;  3T1B A;  2XC7 A;  5LLQ A;  2HOS A;  1S7E A;  4Q4Z F;  4X4D A;  3DKY A;  2PUG A;  1HDD C;  1Y8Q B;  2YPR A;  3M9A A;  3DKX A;  4Y52 J;  1RET A;  5HS9 A;  3CLC A;  4Z2Y A;  4UHT A;  1FOW A;  1GV2 A;  2FBH A;  2FQ4 A;  3F72 A;  1QRY A;  1YRN B;  3ZKC A;  2K3P A;  1F43 A;  3I53 A;  2DO7 A;  4BJ5 C;  3ROU A;  3BOQ A;  2Y48 A;  1O3R A;  2GIV A;  2H1K A;  3LSI A;  3BY6 A;  2DA1 A;  3NXH A;  2H1L A;  5HVQ C;  1WJB A;  4LK1 F;  2XVC A;  4U7B A;  1FMV A;  1WET A;  1Z6R A;  4B8X A;  1Y7Y A;  2LY1 A;  5DTM A;  1H8A C;  4Y4R A;  2FQ3 A;  3Q9V A;  5EEH A;  3ZMT A;  4I99 C;  3WTW C;  3G4S I;  3KP2 A;  3U21 A;  2LDU A;  5LRS A;  2UUZ A;  3K2A A;  2AW6 A;  4E70 A;  2DJI A;  4U7D A;  4I6T A;  1TWG J;  5D5V B;  3A03 A;  3BT9 A;  3AL0 B;  2L9V A;  4M73 A;  2EIK H;  3IL2 A;  1IUF A;  5EEA A;  3K7A J;  2HQ5 A;  1K83 J;  2K7L A;  1RUN A;  2LLW A;  1FY7 A;  3EUH C;  5F04 A;  3H5N A;  4BEH B;  2GRM A;  5DTR A;  2R0Q C;  1BL0 A;  4PSX A;  2CRG A;  3H5A A;  3G6E I;  3FK7 A;  2IA2 A;  4UUS A;  5B5E C;  1YJW I;  1KQ9 A;  2F6C A;  5FFZ A;  2UZK A;  4E4H A;  4DYQ A;  1R22 A;  3S3N A;  1GT0 C;  1JKQ C;  2CH0 A;  2QQB A;  4V2G A;  3UR3 C;  3L2U A;  1UB9 A;  1VPW A;  1I1G A;  3JRA A;  2EQR A;  1ACI A;  1QQI A;  2IJL A;  1IRG A;  1FWZ A;  4PJN A;  3K1M A;  3N05 A;  3QYF A;  3OYH A;  1CF7 B;  3GN5 B;  3Q3S A;  3GLL A;  3DPL C;  2HWV A;  4GRI A;  2P6T A;  3L1P A;  4WX9 A;  1FNN A;  3D1N I;  2O8K A;  3GTG J;  4XSZ F;  2KIF A;  1H88 C;  2DDA A;  4ZYD A;  1AU7 A;  2PI0 A;  4BEH A;  3LL7 A;  3PNT A;  4DOZ A;  4DBR A;  4KIC A;  3WTV C;  2KLO A;  2LF8 A;  3J80 K;  3DEW A;  1FSE A;  2PLY A;  4O8B A;  2R7Z J;  2IW5 A;  2PMU A;  2L3D A;  3CTA A;  3E0J B;  4RAG A;  3S8P A;  3PO3 J;  1XSX A;  1O57 A;  5FRN A;  4BKX A;  1ZG5 A;  2QQ9 A;  2AS5 F;  4ESB A;  1JKO C;  1MJB A;  2K9Q A;  4IL6 C;  2W00 A;  1AKH A;  4DE8 A;  3ABU A;  2X48 A;  3BR3 A;  2CV1 A;  2BGC A;  1Q1V A;  2HKO A;  3FDY A;  1ZAR A;  2Y75 A;  1FTT A;  4I6U A;  1R00 A;  1CF7 A;  5F0F A;  1O4X A;  2KZ8 A;  3F52 A;  4GCV A;  2IPQ X;  1BI1 A;  2LNM A;  4BBS J;  2BJC A;  1ETY A;  4HA8 A;  1HQ1 A;  3LQQ A;  4L18 B;  2OU2 A;  4NBQ A;  3V4G A;  4UVA A;  1FIA A;  4YG2 F;  3K4J A;  4L9N A;  3R6S A;  3B6A A;  4UVB A;  3DTK A;  4KIT B;  2R1J L;  3S1R J;  2VQG A;  2JWT A;  2H8W A;  5HDN A;  3BJA A;  4L9T A;  4E7I A;  1ZRD A;  3VSK A;  3PNV A;  1Z0X A;  1XD7 A;  5IT9 Z;  1PUF B;  1EH8 A;  2VT3 A;  3KLO A;  4IOA F;  2PEX A;  1QQB A;  3H5T A;  2O4A A;  3MMY B;  1I39 A;  2EIL H;  2FRH A;  2KHM A;  1I50 J;  2IGN A;  1U5T B;  2KJB A;  2VBZ A;  2EZL A;  3WOD F;  1DGW Y;  4MEY F;  4MO7 A;  3L2C A;  4IO9 F;  3S1M J;  2JMW A;  2VC1 A;  5K98 B;  1U0J A;  3CUQ B;  4C3J J;  3F23 A;  3BR2 A;  1IC8 A;  2AXL A;  2KQR A;  4AD9 A;  3I9V 2;  2JPB A;  2PUB A;  1N78 A;  2VE8 A;  3J81 K;  5LEK A;  3GYH X;  1D3Y A;  2A6T A;  3WGI A;  3S17 J;  1JKR C;  4R79 A;  3S16 J;  4EAT A;  3FYA A;  3PQK A;  4F91 B;  2PXD A;  2R4G A;  3OYI A;  1TC3 C;  1B8I A;  1IO2 A;  3GX4 X;  3BQY A;  5EGO B;  4ENN A;  5FO5 A;  1NHA A;  2JN6 A;  2LLV A;  3C18 A;  2P5V A;  1DUX C;  1EJ9 A;  1R71 A;  4CYC B;  1BOB A;  1ZGW A;  2EZK A;  3K9T A;  4I0A A;  2P4W A;  2A5W A;  3H0D A;  4LMY A;  5GPA A;  4YIF A;  4BBR J;  1YOV B;  3N4M A;  3BC8 A;  2JA6 J;  1YYV A;  4MFD A;  1ZLJ A;  1NW3 A;  3H9G A;  1MJ9 A;  2HEO A;  2RGV A;  5H6Q A;  3DU5 A;  3GFJ A;  1VQN I;  1WKM A;  3BZ6 A;  4EJV A;  4RAF A;  3OYD A;  4RM3 A;  3AG4 H;  1V5F A;  2CV0 A;  1LCC A;  1FYM A;  1P6R A;  4HV6 A;  2L9N A;  1DGR M;  1X57 A;  2M45 A;  2X85 A;  3I64 A;  3OS1 A;  5KK1 A;  2XPV A;  3PXP A;  1OYI A;  2ZFU A;  1ON1 A;  1SAU A;  4GO1 A;  2DFH A;  3LMM A;  3TBI A;  5B66 C;  1YRN A;  5LGT A;  1RPW A;  4RGU A;  2M7A A;  3CJR B;  1X1A A;  4UB6 C;  1WI9 A;  5ILU A;  2W85 A;  1VQ7 I;  1J5Y A;  2V7F A;  3S1N J;  3U3W A;  1OQY A;  2X1D A;  2VKD A;  4EQQ A;  1R49 A;  3HUG A;  1R4M B;  1VQ4 I;  3BDN A;  1OCZ H;  1MIJ A;  1FOK A;  1XWR A;  1MD0 A;  3LSM A;  2K9S A;  1WSU A;  5CLS A;  4ITV A;  3WU0 A;  1OCP A;  3IRR A;  5EZH A;  1LQ1 A;  3PUB A;  3PJR A;  1IN6 A;  2ZSH B;  4XID A;  3G1L A;  2FXA A;  3RYP A;  3HB9 A;  1VND A;  1QZZ A;  3C2G A;  3R4K A;  1YJ9 I;  2KPM A;  4LB6 B;  1IRZ A;  4Z5H A;  1T2K A;  1ITY A;  3DV8 A;  1HDP A;  3IV5 A;  3ZPL A;  2N8G A;  3CCM I;  3BD1 A;  5EJC A;  3ZXS A;  2RV8 A;  2LSO A;  4DZJ A;  3RCO A;  2OPT A;  3FIW A;  4HG2 A;  1IN4 A;  1I27 A;  1GXQ A;  3JSP A;  2BVM A;  3TDZ C;  1DPR A;  2GQQ A;  5A2Q Z;  5D5U B;  1EH6 A;  4YFN F;  3GZ5 A;  2DQL A;  4XKC A;  2Q1Z B;  2E35 A;  1QZY A;  1SFO J;  3BWG A;  3HHH A;  3CLO A;  4M3E A;  1YIO A;  5D8K B;  1RR8 C;  4H4K C;  3SR4 A;  1RES A;  2WTE A;  2FNP A;  4KDP A;  2XB0 X;  1VFC A;  2A6E F;  2DMP A;  3P9C A;  4BDY A;  2ZXH A;  3FMS A;  3CO7 C;  2W48 A;  3OKZ A;  1POU A;  2XCJ A;  4XON A;  3K6G A;  3KYC B;  4J01 A;  1IRX A;  3MVP A;  1D8J A;  1TT0 A;  1WWX A;  4EJU A;  1A6Q A;  3W2V A;  3SQN A;  2XKP A;  1A6I A;  2LKX A;  2XAG A;  3QU6 A;  2Y30 A;  3ZQC A;  1BDH A;  3FXR A;  4HF2 A;  2QM3 A;  4IA8 A;  4MIM A;  3R09 A;  4II3 A;  2IAI A;  2CQN A;  2CUJ A;  1W5S A;  3CUO A;  1GV5 A;  1U5T C;  3G73 A;  1W0T A;  1R1V A;  2NS0 A;  4BHP A;  1XN7 A;  3SFI A;  2JA8 J;  2VLA A;  2ZNZ A;  3MCZ A;  2KIU A;  3OIQ A;  3JTG A;  2OUM A;  2E1N A;  1OR7 C;  2V1N A;  5FLM J;  1W0U A;  1WH6 A;  4FE4 A;  4XKW A;  4OMZ A;  4F93 B;  3TP0 A;  2HOA A;  4ASN A;  2H6C A;  2CW0 F;  2I5U A;  2KIM A;  1SC7 A;  2CRO A;  3A0H C;  1ZTR A;  3GF2 A;  3P9I A;  5FRM A;  4A3K J;  3VYS B;  5E3L A;  1Z3Y A;  2E1O A;  1SFU A;  3BJO A;  3L2R A;  1R4N B;  2L7K A;  2ZJQ F;  2VQC A;  3SJM A;  3GTQ J;  4MTE A;  2Z3Y A;  2PN6 A;  3H9J A;  2FJ1 A;  2HDD A;  2XHK A;  1X3U A;  3P7N A;  1SMT A;  2HU9 A;  3ME5 A;  2F4I A;  4M3G A;  3D5L A;  4RB1 A;  1JUS A;  1XMA A;  3AG1 H;  4FCY A;  1O3T A;  2NVX J;  1ZRC A;  3IC7 A;  3LAJ A;  1DWK A;  2JJ7 A;  1XGN A;  4G6D A;  4JYK A;  5F64 A;  2CQ7 A;  2Z33 A;  4H0E A;  1BI0 A;  1YX3 A;  5M5X J;  4KMF A;  1F9N A;  3R0J A;  1OJL A;  1X2L A;  3DLL F;  3ERM A;  5BPI A;  5DT2 A;  3FXQ A;  5F0C A;  4FAS D; 
#chains in the Genus database with same CATH homology
 3HM5 A;  3O8G A;  1PER L;  1XC5 A;  3I4M J;  2XJ3 A;  1ETX A;  3FIS A;  2KEJ A;  4X4F A;  2CSF A;  2WB1 N;  3JRG A;  2HOT A;  1BW6 A;  4A3L J;  2L7F P;  3LOC A;  2I10 A;  3DNV B;  2NVQ J;  2HXO A;  2M9H A;  3I4N J;  4M6V A;  2DA7 A;  2NOG A;  2ELK A;  5IOY A;  2NVY J;  4FN3 A;  3HOY J;  4QIW N;  4A3C J;  1Y9Q A;  2ECC A;  1GDT A;  1MH3 A;  3B6C A;  1ZR4 A;  1MBK A;  5FJ8 J;  4J19 A;  1B8I B;  1Y1W J;  2MEZ A;  1RIO A;  2PUE A;  2M2E A;  4Z5C A;  4IVZ A;  4J1W A;  4YG4 A;  3HGY A;  2NS8 A;  1JUP A;  3HOX J;  1EFA A;  1MBH A;  4IEJ A;  2LYS A;  2PUD A;  1QVT A;  1YSE A;  4XRM A;  4NDL A;  1U8B A;  2DJN A;  3QQA A;  3BR0 A;  4OB4 A;  1QP0 A;  5FKK A;  1T56 A;  4BY1 J;  4UUS B;  4YBA A;  2X9D A;  5J1U A;  3GTP J;  1PRU A;  2ME6 A;  3W6V A;  4FBI A;  1MBG A;  2HI3 A;  3RQI A;  1WI3 A;  1NEQ A;  4A3G J;  3BG3 A;  3GBG A;  3MN2 A;  2KEK A;  1IV6 A;  3IH4 A;  1ZZ9 A;  4X4C A;  3BS3 A;  3Q0U A;  2HYJ A;  4MCX A;  1DU6 A;  3SCG A;  1RKW A;  2E2H J;  1D5Y A;  2CU7 A;  5EZG A;  1UTX A;  2EF8 A;  2ID6 A;  2Y9Z A;  2YS9 A;  1IDY A;  3QPL A;  1LLI A;  1JJ6 C;  1LCD A;  4MCT A;  4M3F A;  2EZI A;  4L5E A;  3F0C A;  1ETW A;  3QWG A;  1ETO A;  1ZUG A;  3Q0V A;  3BTL A;  3DCF A;  3FKI J;  1WH5 A;  1UXD A;  1LFB A;  2A6C A;  2MSY A;  2MG4 A;  2M8G X;  1BJZ A;  5HOD A;  3BR6 A;  3BQZ A;  2JA7 J;  4NDW A;  1ORK A;  3CCY A;  3CRO L;  4JQD A;  2HIN A;  3HBL A;  2PIJ A;  1XS9 A;  1IGN A;  4RBO A;  3B7H A;  4F8D A;  3JR9 A;  4X4E A;  1LFU P;  2LYR A;  4IHY A;  3KZ3 A;  4JCX A;  2BNN A;  3VPR A;  3S8Q A;  2H8R A;  2KEI A;  2LYP A;  3FYM A;  3OIO A;  2PUC A;  2K40 A;  5EG0 A;  1EF4 A;  2PPX A;  1CJG A;  2XIU A;  3JRH A;  4ABZ A;  2R5Y B;  1K61 A;  3M3Y J;  4DZP A;  2IVB A;  1H89 C;  3BTJ A;  3JXC L;  1APL C;  4BY7 J;  2OF7 A;  1P7J A;  1ZZB A;  4JX4 A;  2HOS A;  2AXV A;  1S7E A;  4X4D A;  2PUG A;  1HDD C;  3CLC A;  4Y52 J;  4YG1 A;  1RET A;  2DA2 A;  4AC0 A;  1OCT C;  3JRE A;  3OQO A;  1JJ8 C;  1GV2 A;  2FQ4 A;  3ZKC A;  1YRN B;  1QRY A;  1F43 A;  3H0G J;  3ZQH A;  2PUA A;  2H1K A;  3JRI A;  2DA1 A;  4B3A A;  1ENH A;  3JXD L;  5EF6 A;  1MBJ A;  2YU9 J;  3SCH A;  2LLK A;  1WET A;  2VKV A;  1Y7Y A;  1NK2 P;  1H8A C;  3RZO J;  1LE8 B;  2FX0 A;  2GLO A;  5GPC A;  2LP0 A;  3ZQI A;  2ZB9 A;  1QPI A;  4I8T A;  4V2F A;  5E3O A;  4GFB A;  3NAR A;  3K2A A;  2AW6 A;  4I6T A;  3LSJ A;  1TWG J;  2Y2Z A;  3A03 A;  3BT9 A;  2WUS R;  2BNO A;  2DMT A;  1B72 A;  1SAN A;  1PRA A;  1IUF A;  5EEA A;  3K7A J;  3ZOB A;  5BNG A;  1TWA J;  4S0H B;  3GTJ J;  3GTK J;  3OSF A;  1MSE C;  2JVL A;  3SCF A;  1QQA A;  4XRS A;  2HQ5 A;  1K83 J;  2R93 J;  1ZZC A;  3PO2 J;  5F04 A;  2GRM A;  5E3M A;  2DA3 A;  2R0Q C;  2VPR A;  1BL0 A;  3LSG A;  2CRG A;  2ME0 A;  1NK3 P;  4X4G A;  3BG9 A;  1POG A;  1HF0 A;  2FD5 A;  2LY9 A;  3FK7 A;  2RAE A;  4UUS A;  1QP4 A;  2CUF A;  4MLO A;  2E19 A;  1VI0 A;  3BTC A;  4Z58 A;  4DYQ A;  1ZPQ A;  3A01 B;  2IBD A;  1GT0 C;  1LE8 A;  4J1X A;  1ADR A;  4HNV A;  2XB5 A;  1JKQ C;  3OOU A;  4V2G A;  2B63 J;  1MBF A;  1VPW A;  2XRL A;  4DYR A;  2L7M P;  3HGG A;  5IP6 A;  3JRA A;  3IH3 A;  2WV1 A;  2EQR A;  2COB A;  2O7O A;  3O9X A;  5IP9 J;  5EDN A;  2EH3 A;  1JKP C;  1UG2 A;  2OR1 L;  3ZQG A;  2L9R A;  5C44 J;  1DW9 A;  4X6A J;  2XPW A;  5GP9 A;  1MSF C;  1RPE L;  2K9N A;  3UKG A;  5IYD J;  3GN5 B;  1ZAY A;  1ZZ7 A;  3Q3S A;  2GRL A;  1A5J A;  4AUX A;  4MFE A;  1MNM C;  3L1P A;  4Z5D A;  3D1N I;  2O8K A;  3GTG J;  4A69 C;  1PNR A;  2AO9 A;  1H88 C;  2L8N A;  1AU7 A;  1OSL A;  2L0K A;  5F0H A;  4W1U A;  4DYC A;  1ETV A;  3S2D J;  3BR1 A;  4A93 J;  4LOC A;  3CMY A;  3DEW A;  3BTI A;  4X4B A;  1R69 A;  1B0N A;  2DA6 A;  2GM4 A;  2R7Z J;  4O8B A;  3E7L A;  3G5G A;  3PO3 J;  2EBI A;  4PU4 C;  2CJJ A;  2WIU B;  4BKX A;  2R5Z A;  2HSG A;  4GQM A;  1JKO C;  2K9Q A;  2JCG A;  1ZS4 A;  3WHB A;  2EBY A;  9ANT A;  1AKH A;  4FIS A;  3F51 A;  2X48 A;  2CUE A;  3BR3 A;  4JX5 A;  3F6W A;  3OQM A;  1Q1V A;  5K7F A;  1HCR A;  3GTL J;  4IWR A;  1B72 B;  3HOZ J;  2FJR A;  3ZHI A;  4YAR A;  2IV1 A;  1FTT A;  4I6U A;  1RKT A;  2IEK A;  5F0F A;  4YG7 B;  1O4X A;  1ETQ A;  2KZ8 A;  3F52 A;  5IP7 J;  4BBS J;  3QQ6 A;  2BJC A;  1ETY A;  1X58 A;  5FKL A;  4X1E A;  1FIA A;  3S1Q J;  3GTO J;  4I6Z A;  3JRF A;  1WH7 A;  2VKE A;  3B6A A;  2Y9Y A;  3LFP A;  1R9T J;  2R1J L;  3BR5 A;  3S1R J;  2JWT A;  4IHV A;  1UXC A;  3KXA A;  3S14 J;  1JWL A;  4C3I J;  2TCT A;  4JX6 A;  1IDZ A;  1Z0X A;  3OP9 A;  4D7M A;  1PUF B;  3IVP A;  5FKO A;  1QQB A;  3H5T A;  2O4A A;  2CQQ A;  2AHQ A;  1I50 J;  5FKN A;  5FLV A;  1I3Q J;  2NS7 A;  2EZL A;  3TW7 A;  3KJX A;  4MO7 A;  3OQN A;  3S1M J;  2JMW A;  4C3H J;  1LMB 3;  1WCM J;  4B4C A;  4XIC A;  3LSR A;  2KPJ A;  5K98 B;  1IC8 A;  4C3J J;  1FTZ A;  3BR2 A;  3H3V K;  5JLX A;  2LFB A;  2LYQ A;  3FMY A;  3OSG A;  1DU0 A;  3G7D A;  2PUB A;  4IHW A;  1NER A;  3JRC A;  4Y42 A;  5F1J A;  3G1M A;  2O9L A;  3GBF A;  3S17 J;  4C2M J;  1JKR C;  3S16 J;  3EUS A;  2DMN A;  4PU3 C;  3FYA A;  3ZHM A;  2R92 J;  4A3M J;  2O49 A;  1MBE A;  1TWH J;  2XGC A;  1TC3 C;  2AXU A;  2R5Z B;  1JH9 A;  1B8I A;  2WAQ N;  4A3J J;  2JA5 J;  2IVG A;  4FE7 A;  1VF9 A;  3BQY A;  4Y7N J;  5EGO B;  3ZQF A;  2JN6 A;  2L7Z A;  1HOM A;  2X6O A;  4CYC B;  1BW5 A;  1ZGW A;  3UFD A;  2EZK A;  1TWC J;  1WIZ A;  3GN5 A;  2CQX A;  3HKZ N;  3QYX A;  1WPK A;  2TRT A;  2DA4 A;  5GPA A;  3BG5 A;  4BBR J;  2LCV A;  1ZVV A;  2YUS A;  4DW6 A;  3S2H J;  2JA6 J;  1G2H A;  4MFD A;  3IH2 A;  2XI8 A;  3RZZ A;  1PRV A;  4I6R A;  1R63 A;  1RZR D;  1ZZ8 A;  5EG0 B;  2ICT A;  1RZR A;  5F08 A;  5F27 A;  2DMU A;  2QCO A;  2R5Y A;  3PM1 A;  1WH8 A;  2AXZ A;  1LCC A;  2NVT J;  1JFT A;  2BNM A;  3RKQ A;  1IJW C;  1X57 A;  5EYR A;  5C4X J;  1ZK8 A;  2XPV A;  3PXP A;  1BDI A;  2XSD C;  4D5C A;  2Y31 A;  5JLW A;  4FTH A;  2HXI A;  1PUF A;  2O38 A;  2IU7 A;  1QVU A;  1YRN A;  4IHX A;  1RPW A;  3R1F A;  3U3W A;  1JGG A;  1X2M A;  3S1N J;  4D7N A;  3QF3 A;  3BDN A;  2OFY A;  1ZQ3 P;  4XK4 A;  2ECB A;  3TW6 A;  2MGQ A;  5K7Z A;  2K9S A;  5M3F J;  1XWR A;  2JK3 A;  2L49 A;  4G12 A;  2GZU A;  2E2J J;  1OCP A;  4M3B A;  1XG1 A;  2G0E A;  5EZH A;  1RZS A;  2DMQ A;  1FEX A;  2XPU A;  2LYK A;  4QTR A;  2PUF A;  4XID A;  3G1L A;  2LK2 A;  3HB9 A;  3O8H A;  5J1R A;  1VND A;  5IYB J;  1GVD A;  4I76 A;  3OMT A;  1OFC X;  1TWF J;  1IRZ A;  3JRB A;  4Z5H A;  1ITY A;  1JTX A;  1HDP A;  3IV5 A;  1ZR2 A;  2ID3 A;  3S15 J;  2N8G A;  1P7I A;  2EZH A;  5IYC J;  5FKM A;  3BD1 A;  2LTP A;  2Y0S N;  4X4H A;  4DZJ A;  3ZQL A;  2OPT A;  3FIW A;  1E3O C;  2M34 A;  5M5W J;  5IOZ A;  3MKL A;  3JXB C;  3TRB A;  4B1R A;  1BA5 A;  2LYJ A;  3TP3 A;  3CDL A;  1QPZ A;  5A7L A;  3JRD A;  1LQC A;  5DTD A;  1Y1V J;  1SFO J;  3CQZ J;  1CQT A;  2LR8 A;  1ZKG A;  2P81 A;  3LSP A;  4M3E A;  1JUM A;  4JP0 A;  1RES A;  2EWT A;  3HDD A;  2LVS A;  3HEF A;  4PU7 A;  2XB0 X;  1VFC A;  1IG7 A;  2DMP A;  2AWI A;  4CYC A;  2W48 A;  1POU A;  2XCJ A;  3TED A;  4M3D A;  1JTY A;  1SQ8 A;  3G1O A;  2LYL A;  4QSH A;  4Z59 A;  3MVP A;  4A3B J;  3A02 A;  5J3L A;  2KDZ A;  4A3E J;  5EGO A;  4XRS G;  1NTC A;  2DN0 A;  1A6I A;  2LKX A;  2DTZ A;  1Z77 A;  2MW8 A;  2AUW A;  2Y30 A;  3ZQC A;  1BDH A;  1HLV A;  1FJL A;  1ZZ6 A;  4D5F A;  3CEC A;  1FIP A;  4IA8 A;  5DS9 A;  4MIM A;  3WHC A;  4UUT A;  2IAI A;  1UHS A;  2MQK A;  1RR7 A;  4GHJ A;  1I6H J;  2VUM J;  1GV5 A;  4EEF G;  2IUO A;  1W0T A;  1T33 A;  5M3M J;  1JFS A;  5M5Y J;  3A01 A;  5IPA A;  3SFI A;  2D5V A;  2JA8 J;  2IVQ A;  1WH6 A;  3SDG A;  3HZI B;  5FLM J;  1W0U A;  4FE4 A;  3GTM J;  5K7H A;  3VK0 A;  3TP0 A;  2HOA A;  2R63 A;  1X2N A;  2M0C A;  2XGD A;  4RDU A;  2CRO A;  3NAU A;  2PMZ N;  1ZTR A;  4JCY A;  4A3K J;  3C2B A;  1L1M A;  5E3L A;  1WGX A;  2QF7 A;  4AYB N;  2E1O A;  3HOU J;  1U9O A;  1GUU A;  4PU8 A;  3Q0W A;  3LNQ A;  4A3F J;  4A3I J;  5J1Y A;  3SJM A;  3GTQ J;  3FK6 A;  4X4I A;  1MH4 A;  2FJ1 A;  2HDD A;  1JT6 A;  3MLF A;  4W97 A;  4M3G A;  3M4O J;  4FCY A;  1JUS A;  5C4J J;  2NVX J;  4A3D J;  5E3N A;  1DWK A;  3LIS A;  2DA5 A;  2JJ7 A;  3QPS A;  4JYK A;  1U78 A;  2PE5 A;  1AKH B;  3HOW J;  3RZD J;  4BXX J;  1ETK A;  1QP7 A;  2KT0 A;  1UMQ A;  2E2I J;  5M5X J;  2VI6 A;  2GBY A;  2LD5 A;  1JT0 A;  3HOV J;  2B5A A;  1OJL A;  1X2L A;  5C3E J;  1AHD P;  2ICP A;  2XGE A;  1U9N A;  5F0C A;  1F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...