1HF0A

Crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
128
Chain Sequence
b'LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCTAMER-BINDING TRANSCRIPTION FACTOR 1
molecule tags Transcription
source organism Homo sapiens
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
total genus 43
structure length 128
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hf0A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1hf0A01
2EZLA 2LTPA 4XICA 3SJMA 3SCHA 4JX6A 5E3NA 1OJLA 2H8RA 1B0NA 2PUBA 2ECBA 1ITYA 4S0HB 5IP6A 3A03A 1BW6A 2DA5A 4I76A 1SQ8A 1ZPQA 2WIUB 4A3FJ 3BTLA 1ETWA 2LVSA 1IG7A 1X2NA 4BKXA 4M3EA 2JA7J 4GQMA 4I6ZA 4PU4C 2K40A 5IOZA 3JXCL 1G2HA 2OFYA 2EZIA 4J1WA 2NVQJ 1MNMC 2L9RA 4D5CA 2GLOA 2JA8J 2PUFA 3BQZA 4FISA 4Y7NJ 5EZGA 2ID3A 1JT6A 4AUXA 1A6IA 3D1NI 5EGOA 1VNDA 2PUEA 1JH9A 2HI3A 4X4IA 4XRMA 2OF7A 1I6HJ 1TC3C 3Q0UA 4UUSA 2E2HJ 1U78A 1X58A 4BBSJ 2EBIA 2EF8A 2HXIA 3R1FA 4X4HA 4A3LJ 1JKQC 1RZRD 4MCXA 2DMQA 3L1PA 4GHJA 2LY9A 1ETVA 1QPIA 1NK2P 1T33A 1U8BA 2Y9ZA 2JVLA 2ECCA 1U9OA 2O49A 1HLVA 3GTJJ 4RDUA 5M3FJ 1JTYA 2ME0A 1TWFJ 1UXCA 2XSDC 4MO7A 2M34A 2Y0SN 1JWLA 2LYPA 2NOGA 1ZZ6A 4AYBN 4B3AA 2E19A 1ZR4A 2OPTA 1GT0C 5F1JA 3RZZA 3ZQFA 4IVZA 1BL0A 3KJXA 5FLVA 1IRZA 3F51A 3MLFA 4IHWA 2PMZN 1PNRA 1XC5A 1MH4A 3LSGA 5BNGA 1QP4A 1JUSA 2PUGA 2HOAA 1QRYA 2AHQA 1XS9A 2KT0A 4JX5A 3WHBA 1HDDC 2CUEA 1AKHB 2AUWA 2HOTA 2GBYA 3NARA 1GUUA 1H88C 2JCGA 1WGXA 2DA1A 1PUFA 3QF3A 2XB5A 2JK3A 1LLIA 1ZR2A 1NEQA 4X4DA 1RKTA 1QPZA 1CQTA 1B8IA 5DS9A 1VI0A 3G1LA 2FD5A 2PUCA 2IBDA 2ICPA 2CQQA 1XWRA 2VKEA 2WAQN 1SANA 5IP9J 4DZPA 3FKIJ 1B8IB 1QP7A 4I6TA 1Q1VA 1LMB3 2GZUA 2K9NA 3FYMA 4QSHA 3EUSA 3QQ6A 1R69A 1OFCX 1TWCJ 5E3LA 2LYLA 4MLOA 1MBKA 3HM5A 1ZQ3P 4FE7A 3BR2A 1POUA 4DW6A 1LFUP 3ZOBA 2GRLA 1QVTA 2DTZA 3S1RJ 1ZVVA 2O9LA 4J19A 2MGQA 3GTMJ 5M3MJ 3RKQA 2M2EA 5J1UA 3S14J 3F6WA 2FX0A 4BY1J 1PRAA 2XCJA 3BQYA 4BBRJ 3JXBC 2X6OA 2IU7A 3I4NJ 3A01A 1ETYA 3CROL 3BR3A 3CQZJ 3JXDL 2LKXA 3TW6A 5IYCJ 3GTGJ 2CJJA 4ABZA 1Y1WJ 1FEXA 1RKWA 2DMNA 5F0CA 2PUAA 5FKOA 3SCFA 4A3MJ 5IP7J 5EF6A 2R5ZA 4MFDA 5K98B 3OIOA 2DJNA 3ZQLA 3LSRA 5M5YJ 3TP3A 3S16J 4OB4A 3LOCA 2GRMA 3JRDA 1SFOJ 1WH7A 2IUOA 1UG2A 4M3GA 5EYRA 2QCOA 4XRSA 2L8NA 4CYCA 2E2IJ 4PU8A 2R7ZJ 3HOYJ 1MBHA 2HQ5A 4V2FA 3TW7A 1GDTA 4Y52J 1D5YA 3BR5A 2DA7A 2AO9A 1JKRC 1OCTC 1ZTRA 2CUFA 2LK2A 4GFBA 4A93J 3HZIB 4X1EA 4AC0A 2R5YB 1A5JA 3IV5A 3ZQCA 1IJWC 2IV1A 2B63J 2EWTA 3RZDJ 1RETA 1JJ6C 1ZZ7A 1MBFA 5E3OA 3S8QA 3OQMA 3CLCA 9ANTA 2DN0A 4Z5CA 4X4CA 2L7FP 1T56A 2CQXA 3S15J 5DTDA 2EQRA 4DYQA 1YSEA 2P81A 2L49A 4FTHA 3BG9A 2KPJA 3O8GA 3JRBA 1W0UA 2GM4A 1BDHA 1CJGA 1JFTA 2HOSA 4X4FA 5J1YA 2CROA 1JT0A 2LYJA 1PRVA 1Z0XA 2LP0A 4A3IJ 2KEIA 1YRNB 4JCXA 1JGGA 2VUMJ 3HB9A 1FIAA 1MH3A 4Z59A 2KEKA 3ZHIA 2ID6A 4IEJA 1RZRA 1O4XA 3M4OJ 1I50J 1WPKA 2HYJA 4Z5DA 2I10A 3E7LA 3OOUA 2HINA 3TEDA 2O8KA 1R63A 2A6CA 4A3DJ 4X4EA 4O8BA 1PERL 1IDZA 1ZZBA 2XI8A 2L7MP 2O7OA 1FTTA 5J3LA 2MQKA 3G5GA 2BNNA 1BJZA 2N8GA 3KXAA 1JKOC 2DA6A 4JCYA 5EDNA 1IUFA 1WCMJ 1LE8A 1H8AC 1NTCA 4M3FA 3UKGA 5C44J 1K61A 2NVXJ 4NDWA 4IHYA 3BTCA 1S7EA 4M6VA 1ZS4A 1H89C 1HDPA 4I6RA 2KZ8A 1ETXA 2PE5A 3S2HJ 5K7ZA 1YRNA 3IH2A 2YU9J 5IOYA 2Y9YA 1Y7YA 3BR1A 3IH4A 4XRSG 3SCGA 1TWHJ 2R1JL 1BA5A 3UFDA 1LCDA 1JKPC 1ZZ8A 1APLC 3LSPA 5A7LA 5EEAA 3A01B 1P7IA 2ELKA 3OSGA 3VK0A 3HOZJ 3Q0VA 1X57A 3FYAA 2YUSA 3H3VK 1E3OC 2R5ZB 4FCYA 1MBJA 3O9XA 3GN5A 1JUMA 4YBAA 1BDIA 5C4XJ 5FKLA 2CSFA 1K83J 2KDZA 4MIMA 4D5FA 2IAIA 1HCRA 3HOWJ 4QIWN 3O8HA 2LYSA 2O38A 2JJ7A 3BS3A 2YS9A 4UUSB 5K7HA 2LFBA 3MVPA 3BTJA 1ZKGA 5F0FA 3W6VA 3RZOJ 1HOMA 1UXDA 1ZZ9A 2COBA 1FIPA 2DA3A 2Y30A 1AU7A 4I6UA 2JA5J 3ZQHA 1GV2A 2BNMA 3BT9A 2JA6J 1WETA 3VPRA 3GTPJ 1WH6A 5JLWA 1U9NA 1FTZA 2RAEA 5GPCA 3HOUJ 2VI6A 1P7JA 4B1RA 4YG4A 2DMTA 3S1NJ 2BNOA 5EG0A 2IVQA 1DU6A 4FE4A 4YG7B 2AXZA 2IVGA 5F08A 3BG5A 3GN5B 4EEFG 2EZKA 1VF9A 3TP0A 5C3EJ 3IVPA 1MSEC 3GTKJ 1IDYA 2HSGA 2PIJA 3F52A 3QWGA 3GTOJ 1TWAJ 2MSYA 3C2BA 4IA8A 4XK4A 1JUPA 1ZK8A 1ORKA 1QQAA 1OSLA 3M3YJ 3TRBA 1LCCA 5C4JJ 3QQAA 2R5YA 3LFPA 4D7MA 2R92J 1RESA 5FLMJ 2XPUA 4X4GA 3Q3SA 5F04A 3KZ3A 1AKHA 1PRUA 1JJ8C 1WIZA 2FQ4A 1RR7A 4Z58A 4Z5HA 3G1MA 4D7NA 1QVUA 3FK7A 2XB0X 3JRFA 2W48A 2Y31A 3U3WA 2CU7A 2K9QA 2X48A 4W97A 3SDGA 2L7ZA 3BR6A 5E3MA 3JRAA 1ETQA 2JWTA 3S1MJ 2XPVA 2O4AA 2XGEA 2JN6A 3GBFA 5J1RA 2MEZA 3DNVB 3CCYA 3FISA 3DCFA 1X2LA 3SFIA 2R0QC 2AW6A 5F0HA 1VPWA 2IVBA 1ENHA 1MBGA 3G7DA 4IWRA 2WV1A 3HEFA 2L0KA 3S17J 1X2MA 1Z77A 4JYKA 4F8DA 3HDDA 4QTRA 1WH5A 2E2JJ 1BW5A 3JRIA 2PUDA 3NAUA 3HGGA 1FJLA 4IHVA 5FKNA 1ZAYA 3OSFA 3Q0WA 2AXUA 2B5AA 1GV5A 2K9SA 2BJCA 1DWKA 3H5TA 1UMQA 3B6CA 1PUFB 2QF7A 2DMPA 5M5WJ 2D5VA 1ZZCA 3QPLA 4PU3C 2VPRA 3PO2J 2XJ3A 3K7AJ 3HOXJ 1ZUGA 2AWIA 2G0EA 3S2DJ 3JRHA 2EH3A 3FK6A 2M8GX 4CYCB 4X4BA 1XG1A 2E1OA 2PPXA 1LQCA 3G1OA 2ME6A 5K7FA 1LE8B 1RPWA 2DA2A 3JR9A 2H1KA 4A3CJ 2KEJA 2WUSR 2LD5A 4JQDA 3OP9A 5HODA 1F43A 1EF4A 2XPWA 1Y1VJ 4W1UA 1IV6A 2LYQA 5IYDJ 2FJ1A 2Y2ZA 4M3BA 2TRTA 1NERA 1DU0A 4DZJA 1UTXA 3IH3A 2ZB9A 2NS7A 1TWGJ 4MFEA 5F27A 5GP9A 3CMYA 1IGNA 4BXXJ 1B72A 3B6AA 1ETKA 4C2MJ 1Y9QA 1UHSA 2MW8A 4M3DA 4IHXA 5EZHA 4L5EA 3CECA 5EG0B 2AXVA 3PXPA 1MSFC 3BDNA 3I4MJ 3BR0A 1B72B 4A3JJ 4PU7A 4YARA 1AHDP 3ZKCA 1NK3P 3HOVJ 4C3IJ 4I8TA 4BY7J 3GTQJ 1LFBA 3DEWA 3BG3A 4V2GA 3OMTA 3ZQIA 2VKVA 4A3GJ 3JRGA 2IEKA 4DYCA 3GTLJ 2CRGA 1WH8A 1DW9A 4YG1A 5JLXA 4MCTA 1POGA 4G12A 4JP0A 3RQIA 5EGOB 2HXOA 2LCVA 3OQOA 5FKKA 3LISA 4UUTA 2LYKA 4C3JJ 1W0TA 1ADRA 4LOCA 2FJRA 3H0GJ 5FKMA 2EBYA 3BD1A 2NVYJ 3CDLA 2XGCA 2MG4A 2WB1N 2LYRA 3JRCA 3ZHMA 2LLKA 1WI3A 3JREA 5IYBJ 3HKZN 3BTIA 3PM1A 4JX4A 3QPSA 2NS8A 3K2AA 3MN2A 1OCPA 3HBLA 5M5XJ 5FJ8J 3LNQA 1VFCA 4FBIA 2DA4A 2M9HA 1ETOA 3ZQGA 2HDDA 4A69C 3B7HA 2JMWA 4XIDA 2XIUA 1I3QJ 2DMUA 4A3KJ 3PO3J 3FIWA 1MBEA 1QQBA 2LR8A 2OR1L 3MKLA 4J1XA 1RPEL 2R63A 4Y42A 1QP0A 4C3HJ 1R9TJ 2ICTA 1ZGWA 3A02A 2XRLA 3S1QJ 1RZSA 4NDLA 1HF0A 3F0CA 3QYXA 4DYRA 2XGDA 3OQNA 3LSJA 1JTXA 1JFSA 1EFAA 1RIOA 1GVDA 2X9DA 2R93J 2NVTJ 4X6AJ 1IC8A 3FMYA 2TCTA 1L1MA 4A3EJ 5IPAA 4A3BJ 3WHCA 2EZHA 4HNVA 4RBOA 4B4CA 3HGYA 3GBGA 5GPAA 2M0CA 4FN3A 1F36A
chains in the Genus database with same CATH superfamily
2JQ7A 1BI3A 2FOWA 1OJLA 2DCEA 2H8RA 2G9WA 2D45A 3NQOA 5IP6A 2DA5A 5JI6A 3FHZA 3AG1H 2HVQA 1YG2A 3ML6A 3KYDB 3RI4A 5E17F 1P4XA 1GVJA 4GQMA 2DYRH 4GDFA 4ESJA 2AQFA 3OYGA 1VTNC 3A2KA 4ESBA 4MTDA 2XXPA 4FISA 1YJNI 1Z6TA 1J75A 4XLCA 2ID3A 2NVUB 1FOKA 3D1NI 1QZYA 2CW7A 3O3KA 3QU6A 3CC7I 1E17A 2HI3A 4YFXF 4BGDA 2DOEA 1MJAA 1P4WA 1U6GA 4BAYA 2F4IA 2EBIA 3J7AY 1HW5A 5LHHA 5TGTA 3SYTA 2CQ7A 3OL3A 2M8EA 1WQ2A 1NK2P 2DPDA 1U8BA 1SVMA 2FBHA 2O49A 3ABLH 4BEHA 4L5IA 4XLEA 3GX4X 1WSUA 2DJIA 3GTJJ 1WI9A 2GA1A 1LDDA 3OYIA 4IL6C 3K4MA 4CICA 1XCBA 1Q1HA 4ZH4F 5GADJ 3ZR8X 2BW3B 1MZBA 4I01A 3WTTC 1O3TA 1BC8C 1LVAA 2OCCH 1Z3YA 1UCRA 3ZMSA 2NOGA 4LFUA 1V5EA 1ZG3A 4AYBN 4RAYA 4B3AA 2CMPA 1GT0C 2M4GA 3CCJI 1VQ9I 3K1PA 3ZQFA 3RZZA 4DE8A 2P5VA 3CMEI 4J00A 5FLVA 2ZSIB 1KGSA 1OCCH 3AG3H 3ERED 1IF1A 3QAHA 4IHWA 2PMZN 3MLFA 5ED4A 2RNGA 3IHUA 4MQ9F 2PXLA 1JUSA 3PE5A 1VQPI 2AHQA 1XS9A 2PXUA 1GLNA 3H5AA 3WHBA 3KYLA 3GZNB 2HOTA 4KIBA 2GIVA 2CQKA 2XB5A 2OTJI 1LLIA 1ZR2A 1I6XA 1NEQA 4X4DA 1LDJA 2RVCA 2PMHA 1CQTA 3G1LA 2PUCA 3F6VA 2IBDA 2W84A 3ABUA 4BNCA 2PXKA 2VKEA 2WAQN 2HU9A 2A05A 4LGWA 3AG4H 3SR4A 1LQ1A 3RSNA 1J9IA 3QQ6A 1B4AA 1R1TA 2E34A 3T8RA 5L3FA 3PUBA 1KU7A 3NDBB 1ZQ3P 3E5QA 3OKZA 2XXAA 3BR2A 4CYDA 2DI3A 3QOEA 5J4VA 2D1VA 4IHTA 5DCMB 1LFUP 2DO7A 2DQLA 1WZ2A 2O9LA 2IT0A 5EJCA 4PJ0C 2FEZA 2FX0A 5DCFA 3BQYA 1WJEA 4IX7A 1OQYA 2X6OA 1ZRFA 2ZJPF 2LLWA 2PXQA 4IKFA 3Q9VA 3GXOA 1WJ5A 2LKXA 2LG4A 2QZ8A 3TW6A 1A35A 1JHFA 1RR8C 2A68F 2CJJA 4B8XA 2PXVA 2ZC2A 1RKWA 1B59A 2JPBA 5FKOA 3OY9A 4UUVA 4EKIA 3SCFA 1MIJA 2JRMA 1SD7A 3KZZA 3MKWB 2R5ZA 2O8XA 2IGKA 1XSDA 2Q2EB 1USTA 3G6EI 3FMSA 4XN3A 1BI1A 1UG2A 2IUOA 4G6QA 1TTYA 4XRSA 2V6EA 4IHSA 4PU8A 1M1EB 1MBHA 4L9JA 1R4MB 1GDTA 3BR5A 5FD6A 1D1BA 1UAAA 2MD0A 2AO9A 2ZSHB 5FO5A 3OYMA 4GFBA 4A93J 2OUMA 3HZIB 4UB8C 4AC0A 5KK1A 3LAJA 2DDAA 3ZQCA 1IJWC 4WWCA 2B63J 1FBUA 2FMYA 2J7WA 4O5VA 4KYWA 2E60A 1YW9A 1RETA 2XV4S 3PNYA 2XIGA 3I54A 1ZZ7A 5F6FA 1MBFA 1F9NA 2QGUA 4HPQA 2L7FP 4Z5CA 4X4CA 2OV7A 1WVRA 5DTDA 4RB2C 4DOZA 5ICGA 4UV9A 5CVUA 2PX9A 2IP2A 2QENA 3FXJA 1LJ9A 1B6AA 5DD4A 4B43A 4LG0B 3F8NA 3S3NA 1CJGA 2DXIA 1JFTA 3GW2A 2HOSA 5J1YA 4AIHA 2CV2A 5LEJA 4A6EA 5ILUA 1NHAA 1G3SA 2E1NA 2CG4A 2ZMEA 2LP0A 2OAZA 2KEIA 1VQ4I 1YOVB 2GXAA 1MH3A 5KNLA 2ID6A 4IEJA 3ULQB 2HQNA 3R60A 3TL4X 3P9IA 1T38A 2HYJA 5DTRA 4B47A 2W1OA 2A6CA 2X1DA 4A3DJ 1PJRA 2BGCA 1PERL 2JSPA 1MNDA 1IDZA 3SFZA 5J3LA 3LFKA 2MQKA 2BOLA 1BJZA 2BNNA 3G5GA 4D9JA 4EMSA 2COMA 4KITB 2V3CC 2X1EA 5EDNA 3OS1A 1WCMJ 1PP7U 4BDYA 4ER3A 1K61A 2O6GE 1X1DA 3H9QA 4IHYA 1C0WA 4CCKA 4RLFA 1WRJA 2LNBA 2M1BA 2JRTA 2V79A 5K7ZA 1LPQA 1YRNA 1OYWA 1XB4A 4FETA 4KUMA 1VQ8I 3TEPA 2KRFA 3E1SA 5IOYA 5KVRA 2R1JL 4Y15A 4L0YB 4ITVA 1IN5A 3DTIA 1R1UA 4XKVA 2DW4A 4KFCA 2KDOA 1P7IA 2ELKA 3BY6A 3JAMZ 5BS6A 5BMZA 1ACIA 1ZN2A 2YUSA 2CSOA 1D5VA 3JSOA 1FT9A 1JUMA 1SVOA 4D5FA 1SD5A 2IAIA 4XLAA 3DPUA 3BJAA 3O8HA 3ZGKA 2QEXI 1VQLI 1YI2I 2O38A 3BS3A 3E6BA 3GUDA 2YS9A 1R22A 4XOTA 4AD9A 3K2ZA 4UUSB 2LFBA 3RTRA 1T95A 4ZDOA 5F0FA 1UXDA 5E8IA 3VYRB 3L9FA 3RJPA 4N9HA 3ZQHA 4NC7A 4UHTA 3HOTA 3GTPJ 1U9NA 3KLOA 1WH6A 4DJAA 3TELA 1FTZA 2RAEA 1RNLA 3AFHA 1BR1A 2HZTA 3WU0A 4M71A 2VI6A 1P7JA 2KRHA 4AVPA 1IRFA 3S1NJ 2L4MA 5D6FA 1TL8A 4YG7B 5LGNA 4XBFA 2AXZA 2IVGA 3BG5A 3ONQA 2EZKA 1OR7C 2VT3A 1VF9A 4OOIA 1SEUA 5FFZA 2L02A 4CDGA 4H0EA 3PIOF 3NWSA 1MSEC 4CZCA 3GTKJ 1IDYA 1D0ZA 1YIOA 1G3WA 2K5CA 2X4HA 4HSTA 1ORKA 1QQAA 1OSLA 3M3YJ 4II2A 1UHMA 2K4JA 3LSHA 3HKZA 4EJTA 1ZLJA 2VE9A 4NQWA 3OS2A 1YYVA 3MZ8A 4D7MA 4C2UA 1TZLA 3FHNA 1RESA 4Z2YA 2A3SA 5FLMJ 4X4GA 4HV6A 5F04A 3KZ3A 4NBQA 1PRUA 2M4HA 1DQUA 3HL2A 1JJ8C 3IAM2 2FQ4A 1RR7A 1WIZA 2R7OA 3G1MA 1QVUA 2OD5A 3FK7A 4KMUX 2XB0X 1BM9A 4Y3OA 2F5CA 2W48A 2Y31A 4M72A 2X48A 3BG6A 2VJIA 4W97A 3PUFA 3SDGA 3BR6A 3K10A 2JWTA 3PJRA 4YFNF 1X1CA 5FLXZ 3DNVB 2MEZA 2HDWA 3BJOA 1HKQA 2V9PA 4MEYF 4O6JA 1X2LA 1BIBA 4RGSA 2IVBA 2CQNA 1A6QA 2L0KA 1X2MA 1Z77A 4JYKA 3CCRI 4A5NA 4QTRA 2R7WA 2VJ4A 4U7BA 2E2JJ 1EKEA 3E6MA 1BW5A 2JTVA 2QKLB 3CUQC 4U0YA 2PUDA 3WTZA 1X3UA 3DU6A 2W7NA 4IHVA 2IS1A 2XAUA 5FKNA 3BP8A 3ERMA 3OSFA 2AXUA 2K9SA 3WTSC 1XGNA 2DU9A 3CUQB 1DWKA 1HW1A 3B6CA 5DTMA 4EVIA 1R5HA 2QF7A 3CC4I 3EQLF 4XLNF 2D5VA 4AIDA 2VPRA 3S3MA 1JE8A 2WC2A 1A31A 3BWGA 3JW4A 1KYWA 3CO6C 2ZXIA 2EH3A 3B73A 2Z16A 4EJWA 3K4LA 1XG1A 5JR3A 5K7FA 2G7UA 1RPWA 4QPQA 2LD5A 4ZYAA 3U9GA 2ELHA 2ZXJA 3Q5FA 2VC1A 3NXHA 3HRSA 4ANJA 2FJ1A 3OMYA 2Y2ZA 3SX0A 2IGOA 2TRTA 2IRFG 1PDNC 2ZB9A 2VN2A 4PFPA 2HDCA 3RYRA 3OYCA 5F27A 5GP9A 4GXOA 3CMYA 1FMVA 1B72A 3L2VA 4XMYA 5GTIC 1UHSA 3CECA 5EZHA 3PXPA 3MKZA 5EG0B 2AXVA 3LWFA 3GYHX 4EJOA 3I4MJ 4RLQA 3BR0A 3DKXA 4YARA 2RN7A 3HUGB 2F48A 3ABMH 3R09A 1LB2A 5HNFA 1MNEA 1R4NB 3KEYA 4XLPF 3CJTB 1QB2A 1QPMA 4ER7A 1IXSB 3OMTA 3VSLA 3JRGA 2IEKA 5L3CA 2HVSA 1U3EM 3MEXA 3H92A 5L3GA 1RI7A 4G12A 3RQIA 2HXOA 3OQOA 4G7HF 1X1PA 2DDBA 4UUTA 2LYKA 4C3JJ 3CZ6A 1W0TA 4LOCA 5ILSA 2VIXA 4WXHA 3WU2C 4N4OB 4E7JA 3KP3A 2XDVA 3CDLA 3FM5A 2MXDA 1FNNA 2EINH 1V5GA 1QHHD 3G4SI 2V9VA 5IYBJ 4OIQF 2KPMA 2G7HA 4BEHB 4JX4A 4HNUA 2ZBKA 3LNQA 4FBIA 3MN2A 3W2WA 2PEXA 5HLGA 2GXBA 2GIZA 4IXAA 1G4DA 3FZVA 2HDDA 1I3QJ 3ZRGA 1XX5A 1I27A 2PG4A 2E1CA 4Y4RA 4JOMA 5GAHi 2DOFA 2X6XA 3KLNA 4J1XA 2KMUA 3UR3C 4Y42A 5E8GA 3V7RA 1ONVA 1W5TA 2KIFA 3FXUA 3R4KA 2M7BA 4L0ZB 2VJJA 4NDLA 1HF0A 1HKTA 4RAFA 3QYXA 2EIJH 3EUKL 2LBFA 2FRHA 1JTXA 1OCRH 3OYNA 1RIOA 4M73A 3CF2A 2F5VA 2Z5UA 3LA3A 1O3QA 4X6AJ 3CMMA 2TCTA 3HC7A 4C9YA 3LSKA 4HNVA 2RREA 3U21A 3VWBA 1O57A 4O3MA 1YW8A 1QHGA 5GPAA 1YLFA 5JHUA 2EZLA 2LTPA 4XICA 4ZYDA 5EEGA 4GGGA 3BOQA 2ETHA 4HAMA 2ECBA 1B0NA 2QM3A 4S0HB 1K4SA 1BW6A 3IWFA 1DGRM 4NB5A 2MH2A 4A3FJ 1R7JA 3BTLA 2Z99A 5J47A 1ULYA 4BKXA 2A6HF 2PXEA 2JA7J 1MFQC 4PU4C 4KNYA 5BPIA 2R4GA 2K40A 3LQQA 3MEJA 4S05A 1P6RA 5J6XA 2L9RA 2MFZA 2GLOA 1SAUA 4BACA 3DF8A 1JT6A 1QZEA 1P2FA 3NROA 3FBIB 1VNDA 2PUEA 2MBFA 4ZYEA 1HA8A 2OF7A 2BYVE 4XORA 1TC3C 3Q0UA 2L4AA 2E2HJ 2EF8A 1DUXC 1I5ZA 4BJ6C 1ZELA 1KQ9A 4CH7A 1QNTA 4CSWA 4F91B 3MCZA 1S7OA 4YEJA 3L1PA 4GHJA 1QZZA 3HRUA 1QPIA 2MLKA 2JVLA 2QYOA 3TO9A 1LEBA 4HQMA 2FUG2 1QBJA 2DOAA 1G6NA 4IJAA 4XKCA 2DFEA 3ASOH 1O7FA 2XSDC 3IWZA 3WG9A 1Z1DA 2K3PA 2M34A 1OKRA 2Y0SN 3H1CA 2L5QA 3C1DA 1QZXA 3H9GA 4LLLA 1ZR4A 2OPTA 2Q0OA 1T0FC 1YE9A 3N4MA 4IVZA 4ZYHA 2JUGA 4A0XA 3ZMUA 2LY2A 5BNGA 3QYFA 1FPQA 1QP4A 1RUOA 3J81Z 1ERDA 4EV0A 1RC9A 3MAJA 4JX5A 1HDDC 3A0HC 3K9TA 3OIQA 1PUEE 2V7FA 1BR4A 2EJRA 4LIUA 2GBYA 2P6TA 1GUUA 3CTAA 3K69A 1WGXA 3FF5A 4L5JA 2XGXA 1USSA 4A6DA 2JK3A 4CA0A 1H9GA 4U0WA 4BUPA 4HF1A 1E0EA 2ZCWA 3J81K 4XONA 5LLQA 2VOOA 2IGMA 1QU3A 4DZPA 2DLLA 5E1XA 1B8IB 5E1ZB 4ZTJA 1Q1VA 2GZUA 2LKSA 2K9NA 2KRCA 2DK8A 3K4CA 3JSPA 1OFCX 2LYLA 3CUQA 2BXZA 1MBKA 2IJLA 5HLHA 3W2AA 1POUA 4PZJA 1FC3A 3ZOBA 1ZVVA 2DTZA 2GAUA 4LJZF 2YX4A 4C2TA 3R61A 4J19A 3CJNA 3RYPA 2PN6A 3RKQA 3S14J 4BY1J 4ENJA 2XCJA 1W5SA 3A01A 3E5UA 1O3SA 2XAJA 4A2UA 5LD2C 3BR3A 3CQZJ 4UVBA 3WE3A 1X1AA 3ASNH 3W3CA 1D3YA 2DMNA 5F0CA 4A3MJ 4MNUA 2L01A 3EPZA 3KIOA 5IP7J 5EF6A 4MFDA 5K98B 1QQIA 4BJTA 4DE9A 4RS8A 5H20A 4PJJA 3TP3A 4OB4A 2GRMA 1SFOJ 3MD2A 2EPFA 4M3GA 5EYRA 5LFAA 2O0YA 1IXCA 2BBYA 2FXAA 4CYCA 3FX3A 2UUZA 5IT3A 2R7ZJ 5DRYA 3VB2A 3HOYJ 2HQ5A 2KISA 2HVRA 1UFMA 2CUFA 2EV0A 2L2OA 3GLLA 4H4KC 4X1EA 2W82A 2CUJA 2LMDA 2XUBA 2IV1A 3S2WA 2DFHA 2B0LA 3RZDJ 1JJ6C 4OAYA 2Q2EA 3OQMA 1MMNA 1XTAA 2CW0F 4BJ5C 5HS7A 3E97A 1W4MA 2O61A 2LOOA 2FFHA 1U5TA 3S15J 4WK8F 1ZYRF 1G8XA 2EQRA 2LBFB 4A0YA 2QWWA 2BHZA 3M8FA 1O3RA 2R7XA 2L49A 4BXUA 1IN4A 4FTHA 3O8GA 2GOXB 3A0BC 5LBQA 1OLTA 3JRBA 4P5OA 1W0UA 2MD5A 2GM4A 4GRIA 1BDHA 4UVCA 1ZRCA 2X0LA 3T5XA 4IRGA 1H9TA 1UJ8A 4YIFA 2CROA 4FX4A 3HIFA 2B7EA 2VEOA 4J01A 1X4PA 3VFZA 3CCVI 1Z0XA 3H35A 4EGYA 5GAHJ 3LAPA 4FQGA 1YRNB 5HDKA 1FIAA 1MGTA 2LKPA 4EJVA 3JTGA 1J7KA 3M4OJ 1EJ9A 5DV5A 2RC4A 3CUOA 3GUUA 4D0PA 4U0VA 2QA4I 3ZMDA 2ACJA 4RM2A 2HINA 2O8KA 1R63A 2VXZA 2ODRD 4O8BA 3DEEA 3TOBA 1ZZBA 1SFEA 1RIOH 2EWNA 1E3PA 4GO1A 2N8GA 5HS9A 1JKOC 2DA6A 4JCYA 3X2QH 1LE8A 4NDWA 1Y39A 1NTCA 1IN7A 1X1BA 3K1NA 2JPCA 2QKMB 5LGUA 3WG7H 3HSFA 5L3DA 2KZ8A 1ETXA 3BZ6A 2PE5A 3O6BB 4PGHA 2Y75A 2ZKZA 5HDNA 2VKDA 3IH2A 3EUHA 2VBYA 5IY5H 1Y7YA 3KL4A 3BR1A 1OPCA 1FOWA 3LL7A 1TQIA 2BVMA 3RDIA 1LCDA 1F4KA 1YTYA 3CJQB 5DD8A 4CGZA 4F7ZA 4UNOA 1ZH5A 3HOZJ 3J80K 2YU3A 3H5RA 2W24A 3OYFA 4U88A 3H3VK 5HS8A 3GFJA 4EKGA 2R5ZB 5LHIA 3HOSA 4FCYA 4YBAA 2R7DA 4KN7X 5FKLA 1K83J 4ZDLA 3I0TA 2R7UA 2X6YA 2MC3A 1FSHA 4EZIA 3LSMA 4CCLA 5K7HA 2OZUA 3SDBA 3RZOJ 3W6VA 2MYSA 1HOMA 3U1KA 4FHTA 1FY7A 1FIPA 1AU7A 2Y30A 1N75A 3L2UA 3J7YJ 1KQ8A 3LA7A 2X6WA 1GV2A 1ON2A 3DFGA 5CVIA 1VQKI 1W36C 2BNMA 1HC8A 1WETA 5EEHA 2MC4A 1BIAA 4U7DA 1UZCA 4B1RA 4KJZA 1A36A 2BNOA 2IVQA 1XPXA 2VPLA 1BBYA 2YBDA 3IVPA 3OYEA 4BQQA 3QWGA 2V9KA 3OIPA 3GTOJ 1OMIA 4R1HA 3MMYB 4A5MA 1ZK8A 2A5YB 1VQ5I 4P55A 3FXOA 4BQNA 2NNNA 2JSCA 1XDUA 4E6KG 5C4JJ 1K4TA 1YJWI 3AL0B 3NZLA 3LFPA 3SQNA 3T1BA 4LLGF 1J2XA 2HYFA 2XPUA 5GAGJ 2XF6A 2ZNYA 3IKVA 1YHQI 4RMNA 4Z5HA 3IKTA 2ZJRF 4P9FA 2ZJ2A 4BQAA 1MKMA 4XSZF 3G0TA 4KT6A 1VZ0A 2UWMA 1AOYA 3S1MJ 2O4AA 1SFKA 2BV6A 2XGEA 3ZQQA 4XLFA 2PJRA 4M6YA 2EFQA 4BH9A 3GBFA 3H36A 4CCJA 4ER0A 2MA3A 2XAFA 3FISA 3SFIA 5ICCA 2K9LA 4M9XA 1K6OA 5AIPA 2MLGA 1HW2A 2AW6A 1BN5A 4EK9A 3G7DA 1J59A 2L7KA 1AA7A 5LEKA 1U8RA 5FFXA 1WH5A 1Y8RB 4LK0F 2FMLA 3KFWX 1W36D 2P5KA 1GHCA 1LDKB 1BJAA 3K4KA 3RKWA 3H5TA 1UMQA 5TJJA 3DKWA 2DMPA 2VKHA 1STZA 1ZZCA 3DKYA 5HVQC 2XJ3A 4ASNA 4E7LA 1N25A 3CP8A 3FK6A 4CYCB 1KU3A 2KKOA 4EM0B 5E79C 3OV8A 3HHGA 3G1OA 2D2WA 2ME6A 4BXFA 1LE8B 1LQCA 2KL4A 3KZIC 2KEJA 2WUSR 5TISC 2VONA 1W7PB 1WJBA 3REOA 1EF4A 1VQMI 2LYQA 1R1VA 3I71A 1TNSA 4E7HA 5IYDJ 2EA2A 2HS5A 2VBXA 4Z6YA 3QRFF 4WVLA 2AXLA 1I1GA 1P4AA 3E6CC 1NERA 3B02A 5E18F 2HKXA 4E7SA 1TWGJ 4MFEA 1R58A 2XVCA 1IGNA 4C2MJ 1ON1A 2GA2A 4M3DA 3HRTA 2ZO4A 4I0AA 1G59A 5B66C 2R7RA 1ZGJA 3CCSI 1CGPA 4CHUA 2KIMA 3R0AA 4EQQA 4KISA 2FBKA 2HNHA 5DYMA 4Y13A 4A3JJ 4PU7A 2DQRA 3ZKCA 4C3IJ 2HFHA 4XM3A 3G73A 4V2GA 2NNYA 3RPQA 4CCMA 2VKVA 5BQTA 3R0JA 4HW0A 4CUGA 3GTLJ 2KFDA 3L09A 4KA4A 3F8BA 1DW9A 1POGA 4HX4A 5EGOB 2K7LA 2UXNA 5D4RA 2R7VA 2RQPA 5IT9Z 2NAZA 4L9NA 3OS0A 1T39A 4F52A 4S04A 1ADRA 1SMTA 1U5TB 2RQQA 4XKWA 5FKMA 4EM1A 4HDUA 3OOPA 1W7PD 2NVYJ 4LB6B 2WY8Q 2XGCA 2WB1N 2MG4A 1NH3A 1K78B 4XLHA 3JREA 3HKZN 1HBXG 2MABA 3F22A 1R5GA 2VXDA 2GZWA 3K2AA 5M5XJ 2R3SA 1D8KA 2DA4A 2OC6A 2M9HA 2DFIA 4Y33A 1FBQA 3TKYA 1ZGAA 3B7HA 2FF4A 3WODF 4A3KJ 4Q48A 2VT2A 1TQPA 2E1MC 2KIQA 2CFXA 3PFIA 5LRRA 3I59B 2LR8A 2A69F 3FXQA 1YO5C 2BY1A 2R63A 2EK5A 4IOCF 5K5QA 3DPTA 3PFYA 3A02A 2LREA 3KEQA 1XMKA 2HZDA 2XGDA 1JFSA 3KP7A 1IRGA 3GWZA 1Z91A 5FRNA 2R93J 1KONA 2UZKA 1IC8A 3FMYA 1X3WB 3HJEA 4A3EJ 3OYAA 2L9SA 3TO7A 5FD5A 4V19K 1NW3A 2F5EA 3PNVA 4CO8A 2VQLA 4HRAA 1FX7A 3BJ6A 3CCEI 4LLNA 3KYCB 3QODA 5DM6F 3SJMA 2F4MB 3CP2A 5E3NA 3SHFA 1Z67A 3C7JA 3EUHC 1L0OC 3E6DA 1ITYA 3A03A 4I76A 3VYUB 1ZPQA 5HOOA 2CO5A 2WIUB 5ILVA 1ETWA 1S8NA 2P4WA 1X2NA 4M3EA 4L9TA 4I6ZA 4HV5A 2YR2A 4BQOA 5IOZA 1TP4A 1G2HA 1REPC 5H6RA 4PSXA 1VQ6I 3M1EA 2EZIA 1NG7A 2FQ3A 3ROUA 5J8FA 4PJMA 4J1WA 1MNMC 3KETA 4D5CA 3GLXA 2FNAA 3BQZA 4Y7NJ 5EZGA 4QWQA 4AUXA 2HFZA 5DTQA 1A6IA 1FWZA 2VLAA 2ZXHA 2CV0A 2PJPA 1FLIA 4XRMA 1D1AA 1Y56A 4UUSA 4RB1A 2P7CB 1X58A 4BBSJ 4I02A 4X4HA 4A3LJ 2ADUA 2BXYA 2ELJA 2EFOA 2XF7A 2DMQA 2Z9OA 1FYMA 2H94A 4XOPA 2BW3A 3GCMA 4A12A 3HZJA 4G9YA 1S7AA 3L2RA 2KLOA 2KP6A 1JTYA 2CYYA 1TWFJ 2ME0A 4PUSA 1UXCA 1MD0A 2KZVA 4GYGA 2LYPA 4HRIA 3HPHA 3BZKA 4HYEA 3WTUC 3BZCA 2E19A 1KYZA 5F1JA 4LD5A 1BL0A 4I99C 3JAMK 5HLTA 1IRZA 1SD6A 2HCNA 4PSWA 4IOAF 1T98A 2LDUA 3RIRA 2O3FA 2QQ9A 1BOAA 5TRDA 2EFPA 2GOMA 1UB9A 2PUGA 1YS6A 3W2VA 2QLZA 3EETA 4AIKA 3ECHA 1Z6RA 4RB3C 2AUWA 4MTEA 3NARA 4F55A 1H88C 2DA1A 1PUFA 3WTYC 1JHHA 2QBYB 5CQGA 3BG7A 1QPZA 2GQQA 1VI0A 1SD4A 5DS9A 1WFXA 2FD5A 2J5PA 2ICPA 2QBYA 5CLSA 4QLCU 1XWRA 5IP9J 2ESNA 3FKIJ 2WAQA 3UWPA 1BI2A 3FYMA 4QSHA 1R69A 1TWCJ 2K85A 1TW2A 3HM5A 2DYSH 4FE7A 3GFMA 3WGIA 2CV1A 1D0XA 3DP7A 2P5LC 2NXNB 2GRLA 1QVTA 5A2QZ 5H2FC 5BPDA 2I8DA 2EB7A 2XKOA 3LMMA 4I7HA 3V8KA 5FB2A 2MGQA 3QPHA 5M3MJ 2Z2SB 5J1UA 1R71A 3TOAA 3ECOA 2IU7A 4HOBA 2CH0A 3W6KB 3D5SC 1ETYA 1Y0UA 5HDGA 2F6CA 2E5ZA 5CKTA 3J7AO 3FMQA 5IYCJ 2Y69H 3GTGJ 1SFXA 1Y1WJ 1FEXA 2LRDA 3OR1C 4LMYA 4ZDPA 3V8JA 2EILH 1ZRDA 3FXKA 2FOKA 2CS3A 3DTKA 3I9V2 5GAGi 2KHMA 4NNJA 3I64A 2QQBA 4ON0A 4DBQA 5M5YJ 3T0YA 2JVHA 3DEUA 3DTEA 4R8HA 5CVJA 2R7TA 2L8NA 4FX0A 4UV8A 4AVZA 2E2IJ 1UHWA 1XGMA 1KZHA 1D5YA 2STWA 3S3OA 4G6TB 1ZG1A 4MHGA 3A9ZA 1JKRC 1ZTRA 3COAC 3DBLB 2HQRA 2LSOA 3R6SA 3ZQ7A 4ZZDA 2F5FA 2FE3A 2LLVA 3GO5A 1YQAA 3V42A 5D5XB 3FM3A 3IV5A 3MKYB 1QGPA 1K78A 4HLYA 5L3EA 4OIRF 1BR2A 1WHUA 5D8KB 3IRRA 4ESFA 2B9SA 3OL4A 2NRAC 1T56A 4AM3A 2CQXA 4DYQA 4IO9F 3VDXA 2W00A 4TV7A 5DEQA 1J0RA 1YSEA 2RKHA 3BG9A 3FDYA 3V4GA 5J4YA 2M87A 5FROA 5L3BA 1IRXA 3HTSB 3ZMZA 4XN0A 4X4FA 3EUAA 2M0MA 1XGSA 1JI8A 4A0ZA 4UXNA 3F72A 1JT0A 5DUIA 3WTVC 1PRVA 5D5WB 1VQNI 3G71I 4A3IJ 1MJBA 4JCXA 2AQEA 3HB9A 3PQJA 4IRHA 1IO2A 4Z59A 3ZHIA 1FMWA 1ZLKA 4EQZA 1WPKA 3VSKA 1V55H 1XN7A 3NRVA 2I10A 3KP5A 3KZYA 3E7LA 4BHPA 2E5NA 2W4SA 2ZJQF 1XSVA 3TEDA 4B44A 2H27A 3M8JA 3LSIA 2LNMA 3QP6A 4HQEA 2L7MP 2M7AA 2XI8A 4N0BA 3K4JA 1UELB 4OAZA 2BE5F 5AIQA 2PJRB 4M3FA 5CPRB 5B1BH 5C44J 1FP2A 1MMGA 1N77A 3RKXA 1WJAA 3RPUD 3BTCA 1S7EA 1HSTA 5DUKA 2BZTA 1HDPA 1U2ZA 3S2HJ 4I98B 2O03A 3TGNA 2WA0A 2YU9J 1JGSA 3IH4A 3SCGA 4KIFA 5D8LB 5J8CA 1YX5A 1JKPC 2DPUA 2P7VB 4XSXF 2ISZA 3RPUA 3OR2C 5A7LA 4F3QA 2H6CA 3A01B 3VK0A 1HKSA 3RCOA 4FASD 3MQ0A 3ME5A 4E7KA 1KU9A 4XL9A 3CLQA 3OYKA 2EA4A 4BYYA 2ZFWA 2JVGA 2L54A 5GAEJ 5C4XJ 4XNFA 1R00A 2CSFA 2STTA 3HOWJ 2IXSA 4CCOA 4QIWN 3L2CA 2LYSA 2PXPA 2JJ7A 3GFLA 3QWLA 1K79A 3KP2A 2VBWA 3MVPA 3BTJA 1ZKGA 1ZZ9A 2KQRA 4I6UA 2PXFA 2JA5J 1B1BA 1Z21A 2IA1A 1O7LA 3BT9A 3CF5F 3VPRA 1G3TA 1G3YA 3ABTA 3EYYA 4B48A 2R7SA 5GPCA 3HOUJ 1EH7A 5CVVA 4YG4A 2DMTA 3QU3A 1DU6A 4NC8A 3F8FA 3GN5B 4EEFG 2IS6A 2YPRA 5C3EJ 1T08B 3RKYA 3GZDC 4XKBA 2F5DA 1Z7LA 4IF4A 3P5JA 2HSGA 2Z3YA 3F52A 1SFUA 4G6DA 3TDUC 3J7ZI 3BPXA 2MSYA 4IA8A 4XK4A 1T0FA 1JUPA 2M4KA 3CMAI 1S29A 1TW3A 1KU2A 1XMAA 3KE2A 1LCCA 3QQAA 4M9SA 2XAHA 2R92J 3K1MA 3Q3SA 3QYBA 4OMZA 5K1YA 2DT6A 2Z1DA 3U3WA 3K70C 3JTHA 2DT5A 5E3MA 1DPRA 2XPVA 3E3VA 1EH6A 4PJNA 3F9KA 3OWQA 2JN6A 1R6RA 5J1RA 3CCYA 2DBBA 3KX2A 3LQRA 2R0QC 3KPHA 1Y6IA 2OBPA 2A6TA 5F0HA 1E2XA 1ENHA 2O5RA 3HRMA 4BE0A 3CD6I 1WJCA 4M74A 2WV1A 1R36A 4F8DA 3DLLF 3HSEA 3OYBA 1YW7A 2HR3A 3HGGA 2BY0A 1FJLA 3TMOA 2EV6A 5ICFA 3CC2I 3L7WA 1GV5A 4RGRA 3M1CA 4G94A 1HSJA 2M3AA 3VYSB 3FBNB 4PU3C 1P92A 3WTWC 1TT0A 2AWIA 2G0EA 3MFKA 3S2DJ 2QQ8A 3F8CA 2M8GX 3MZYA 2ICWG 2PPXA 2HKOA 3DBHB 5FGMA 2RGVA 3JR9A 4A3CJ 3HHHA 3OP9A 3V7CA 5HODA 1N78A 1F43A 4W1UA 1Y1VJ 2Y0MA 1IV6A 1Y0NA 1I39A 2A5WA 3A1YA 2I5UA 4DZJA 3AAFA 2KIUA 3IH3A 1DU0A 2NS7A 4I2OA 1BOBA 1ETKA 3CDHA 3ESWB 4IHXA 4L5EA 2VQGA 3M7GA 1MSFC 3BDNA 4HX7A 4ETSA 1OCZH 4L18B 1B72B 1X4OA 2PLYA 3O2PE 1D1CA 4ER6A 1AHDP 1FYLA 1NK3P 4I8TA 1FP1D 3DU5A 2DT7B 2VODA 2QQAA 4GCVA 3DEWA 2QSGX 5ICEA 3ZQIA 2WAEA 1B9NA 1W7PA 3HSRA 4DYCA 2CRGA 4MQVA 1WH8A 4RGUA 4YG1A 3WE2A 1ZG5A 4MCTA 4JP0A 3AL0C 3NWTA 3PNTA 2Q8KA 4DBRA 2H09A 5KAIC 5LHGA 2LCVA 3GZCA 1NG6A 5FKKA 2A61A 5D5UB 2OTLI 2FNPA 2WBMA 1PVEA 2FJRA 2JQEA 3H0GJ 2EBYA 3F3XA 1T8IA 2EFWA 1U5TC 3DBRB 1HQCA 1XDSA 3JRCA 1DDNA 2P0WA 4EATA 4WXDA 2LLKA 1V54H 2IGNA 3HYIA 3MWMA 2XASA 4IPAA 3K4BA 5BOXA 3QPSA 1YFHA 1OCPA 2IA2A 4OIPF 1B9MA 3I4PA 4ZYGA 1ETOA 3GMEA 4RA2A 2JMWA 4XIDA 2ZMEB 2W25A 4M9ZA 4PGGA 3PO3J 3BROA 2RV8A 2HGCA 1X19A 2QVOA 1DP7P 3WGHA 1MBEA 1FZPB 1VQ7I 2JA2A 2OR1L 3MKLA 1RPEL 2VL8A 2FU4A 2ZMEC 4C3HJ 4YIRX 1R9TJ 1D0YA 2HCSA 4HDVA 3C3WA 5JVGF 2UXXA 1RZSA 4UB6C 3F0CA 2WV0A 2X85A 2V6CA 3BLYA 4N9IA 3OYLA 3ZP5A 1MDMA 4HF2A 1EV7A 2VOPA 3OQNA 1EFAA 4OU0A 1J09A 3H9JA 2P8TA 2VC0A 4A3BJ 3DV8A 4RBOA 5IT9K 2MH9A 1IV8A 2WB1A 3ZMTA 2PMUA 4Y17A 4K2EA 2EIMH 2M0CA 3FWEA 3BCBA 4FN3A 4P9UA 2D1HA 1F36A 4HLXA 2VJ5A 3ISPA 4XR6A 4B09A 3SCHA 4JX6A 5ERIA 3F21A 3VWSA 1YITI 2PUBA 4G7ZF 3F6OA 2EV5A 2W85A 1SQ8A 5KAFC 2BY3A 1UG0A 2LVSA 4ZJZA 1IG7A 3Q9SA 1U0JA 1YX3A 1DP3A 3JXCL 4YELA 2OFYA 2HPIA 2H1LA 1EA3A 2NVQJ 3A4CA 1T2KA 1CF7B 2H8WA 2JA8J 2EIKH 2PUFA 4F92B 3CDIA 3V7SA 5EGOA 3KCCA 1EH8A 1JH9A 3CJRB 4X4IA 3SXYA 1I6HJ 3QP5A 1U78A 1FYKA 2HXIA 3LQXA 3R1FA 1Z3XA 2K9MA 5DM7F 3N97A 2M30A 1JKQC 1RZRD 4MCXA 3TFLA 5B1AH 5DDGA 3WTXC 2LY9A 1ETVA 5DSXA 1T33A 2Y9ZA 2ECCA 1U9OA 1XD7A 1PYVA 3TQNA 1I3AA 1HLVA 2XHKA 4RGXA 3J80Z 4RDUA 5M3FJ 2Y0SA 2DAOA 2R7QA 2YX7A 4MO7A 1JWLA 5B3SH 1TBXA 2K86A 3I3LA 2WAFA 1TQMA 4PJLA 3PL8A 4XQFA 3I59A 1ZZ6A 3CCQI 2JZYA 2X51A 4ZC3A 3DLAA 1D8JA 1LVKA 3KJXA 4EJUA 1PP8F 2ZFUA 1YS7A 4BHBA 4Q5SF 3GF2A 3KP4A 3F51A 1PNRA 2LYCA 3CCMI 3BDDA 1OISA 1MH4A 1XC5A 3LSGA 3IL2A 4WX9A 2LF7A 4HSRA 1ZARA 2HOAA 1QRYA 4LB5A 2KT0A 5CQEA 1Z9CA 1K6YA 2E7WA 2CUEA 1AKHB 3DQVC 1OYIA 2JCGA 1R49A 2Q1ZB 3QF3A 2HOEA 3AKZA 1VQOI 2ESHA 1ZAOA 1S5LC 1RKTA 2PI0A 1B8IA 2VB6A 4EGZA 1ZREA 5E1WA 3KEOA 2CQQA 3DM5A 2TDXA 4KDPA 1SANA 3HPGA 4CZZA 1QP7A 4OINF 4I6TA 1KA8A 5CVRA 1RZ4A 4JQFA 3VOEA 3EUSA 2VQHA 5E3LA 1FSEA 4BS9A 4MLOA 4AIJA 4LIVA 4Q4ZF 4PDKA 3GZ6A 1K7AA 4DW6A 4NHJA 2QSHX 3S1RJ 4P96A 1DPUA 3IAS2 3GTMJ 3A9YA 2M2EA 1A04A 1TT5B 4G8XA 1FOYA 1PRAA 3VODA 3F6WA 4BBRJ 3JXBC 2OU2A 3I4NJ 1ODDA 4BE1A 2K27A 2A07F 3CROL 3JXDL 3SZGA 1TLHB 2VASA 3TDZC 3ZPXA 5HNHA 3KP6A 2PXBA 3OWTA 1SMYF 3F23A 4ABZA 1Y8QB 2HPMA 2NOJB 1E3HA 3NEUA 1WWXA 3QYEA 2PUAA 4M6XA 1IZ1A 1IN8A 2OQRA 2X1CA 4R79A 3MZHA 1RUNA 3S8PA 2HYGD 3OIOA 1T6SA 2DJNA 4C30A 3LSRA 3ZQLA 2VBZA 4KICA 2KJCA 3U2RA 1OCOH 3ABKH 3LOCA 3S16J 2WADA 3I55I 3JRDA 1WH7A 2H6BA 3W6JB 3QOWA 2L3DA 2BEOA 2QCOA 3AG2H 4ZZLA 3SZTA 4IRIA 1S9HA 3OYDA 4ZTFA 4V2FA 3JCUC 3TW7A 4Y52J 1RRJA 2DA7A 5DT2A 3BPVA 1OCTC 3ELKA 1WJFA 2LK2A 2L9NA 4YIIA 3G2BA 3QOPA 3LFUA 5KHDA 3D0SA 2LH9A 3M9AA 5KCMA 2R5YB 1A5JA 1IUYA 3H3UA 2EWTA 1V5FA 5FLXK 2V4JC 3PIPF 5E3OA 3S8QA 3CLCA 4U87A 4ENKA 2DN0A 9ANTA 4PFOA 3QFIA 4II3A 4CCNA 1HXDA 1MDMB 2J5OA 2P81A 2LC2A 2E1MB 2IW5A 2KPJA 4HF0A 2RNJA 4ER5A 4OWRB 3S93A 1SVLA 3FXRA 4BL0B 1S3JA 2E71A 2V1XA 4WF2A 5JHFA 2XROA 2KZGA 5CYVA 3M9LA 2IPQX 3C2HA 1I1SA 1V4RA 4DQ2A 2K4BA 3GFIA 2JT1A 2F2EA 2LYJA 4LITA 3BC8A 3CLOA 1QO0D 2JUCA 3HG9A 2L1PA 1F1ZA 1X3ZB 2FBIA 1JGGA 2VUMJ 5AONA 2KEKA 1ZHFA 4NQWB 4KN4X 1RZRA 3OYJA 1O4XA 1I50J 3PSFA 4G7OF 4Z5DA 1V3FA 4XRFA 1MMDA 4GYIA 2WTEA 3OOUA 1HQ1A 4ENMA 4X4EA 1S72I 2QUFA 2HWVA 4L9VA 1FTTA 2O7OA 1J5YA 2GXGA 3P9KA 3I56I 1SAXA 4YRVA 3C18A 4LG0A 5JFRA 1BC7C 3WGGA 3K6GA 3KXAA 1IUFA 1H8AC 3UKGA 4WXCA 2NVXJ 3PQKA 4B3XA 4OBMA 4M6VA 4RM3A 1ZS4A 1H89C 1FOXA 4I09A 4I6RA 1OR7A 2E36A 4F93B 3GZDA 2K02A 2XAQA 3ZN1A 2Y9YA 3L00A 2K3FA 4XRSG 1AWCA 1TWHJ 1BA5A 3UFDA 1XMXA 4UY8I 4Q2JA 1ZZ8A 3EYIA 1APLC 5JUWA 3LSPA 1XSXA 1IAWA 5EEAA 2R7FA 3OSGA 2PBIA 3Q0VA 3QOXA 5J40A 1X57A 3EDPA 2LY1A 3FYAA 5GTHC 1E3OC 3O9XA 1MBJA 2XAGA 3GN5A 1BDIA 1LMB3 2XXQA 3SEQA 4RAZA 2KDZA 4MIMA 1HCRA 4PCQA 4CXFA 2CGPA 2CFOA 1LEAA 2Z33A 1Z05A 2IS2A 3HTUA 1GXPA 1BI0A 2COBA 2M45A 4HBLA 2DA3A 1XCVA 2HEOA 2BY2A 2UV1A 2C6YA 4I0BA 3HUGA 5DRTA 2DFFA 2QSFX 2OZ6A 2JA6J 4DNCA 2EFNA 4HNTA 5JLWA 2CUZA 1DGWY 3DWLE 3TBIA 5EG0A 5JVTA 4FE4A 3M07A 2FSWA 5F08A 2GWRA 3C2GA 3I58A 3IP4B 3M8EA 3TP0A 3I53A 1YIJI 3UNGC 1SC7A 6PAXA 2WWYA 5A2QK 4LK1F 4UVAA 1P9QC 2PIJA 1TWAJ 3E0JB 4HEA2 3C2BA 2XC7A 2PXDA 3LSTA 2DTRA 2FA5A 3TRBA 4YG2F 5LRSA 4DIQA 1GXQA 2R5YA 2WY7Q 3CCUI 1H0MA 2CWEA 1IN6A 1AKHA 3LA2A 3H0DA 5HLIA 1WJDA 4Z58A 4D7NA 2M5WA 3JRFA 4HX8A 4P1WA 1LKXA 2LF8A 4ENNA 2CU7A 2K9QA 2L7ZA 3JRAA 3BCAA 1ETQA 2DK5A 2L9VA 4OMYA 4HA8A 1R5ID 3FXLA 2PFBA 5FRMA 4IVNA 3DCFA 5E20A 3CO7C 2HQAA 2AS5F 1VPWA 4KMFA 3K0LA 4AWXB 4JBAA 1MBGA 1QA6A 4OIOF 4IWRA 3HEFA 3FXMA 3S17J 2XSJC 4EM2A 3HDDA 3T8TA 3JRIA 3ZMVA 1MMSA 4IZZA 3NAUA 2PXTA 1ZAYA 2ZNZA 1MW7A 1R23A 3PSIA 3TO6A 3Q0WA 4MGRA 4HZFA 2B5AA 2BJCA 5F1RA 1PUFB 4NUBA 5M5WJ 4N4NB 4PK4A 3QPLA 3ZN0A 3K4NA 1MJ9A 3F8MA 3G3ZA 2NYXA 3K7AJ 2V26A 5DCMA 3HOXJ 3PO2J 2OCEA 1ZUGA 3JRHA 3N05A 3ZCOA 4X4BA 2E1OA 1TNTA 3S32A 4BU2A 4X0GA 2DA2A 2H1KA 1Z7UA 4JQDA 4D1QA 4BE2A 4JK1X 2OJED 4KIGA 4RAGA 2XPWA 1WKMA 3QPTA 4M3BA 2NS0A 2HTSA 1UTXA 2YSRA 5B5EC 1F5TA 1IW7F 4BXXJ 2A6EF 3B6AA 1Y9QA 1MMAA 2MW8A 1W1WE 2E7XA 3SEZA 1YJ9I 4HG2A 2XKPA 2CW8A 2IVMA 3HOVJ 3K70D 4BY7J 3GTQJ 1LFBA 5D6EA 2DODA 4AYBA 3BG3A 1CF7A 2IS4A 3DPLC 3CCLI 3IRQA 4A3GJ 4AU7A 3WU1B 3L2WA 1LUJB 5K5RA 3E5XA 2BHYA 2PMZA 5JLXA 3SZPA 3VYTB 2F4OB 4BHCA 4KT5C 3RQ4A 4FT8A 3P7NA 4QPOA 3LISA 1U2WA 3H5NA 5LGTA 4LG3A 3GVAA 4RB0A 1W5CC 4IQJA 3BD1A 4DGWB 3D5RC 1FBSA 3IC7A 2LYRA 1XGOA 1IXRC 3ZHMA 2BVLA 1WI3A 2OA4A 5D5VB 3ZXSA 3U1DA 3BTIA 3PM1A 2ISYA 2NS8A 5FJ8J 3HBLA 2ZXWH 1VFCA 2V1UA 2V1NA 3V8LA 1S6LA 3ZQGA 4A69C 4IQ4A 4E4HA 2XIUA 2DMUA 3HXLA 2J7UA 2P6SA 3FIWA 4E7IA 3GZ5A 3OYHA 1LNWA 4Q47A 4MEXF 3L2QA 2AXTC 4NC6A 3I5UA 3A9XA 1QQBA 5F64A 4E7ZA 1KQ0A 3FMRA 1OYYA 1QP0A 2HTJA 2XF5A 2ICTA 3CESA 4BDZA 1ZGWA 2XRLA 3S1QJ 2OQGA 4WCGA 3DXJF 4DYRA 3P9CA 1JXSA 3LSJA 4E70A 5D4SA 2KJBA 3FKJA 2W57A 1L3LA 1GVDA 2XRNA 2Y48A 2VE8A 2X9DA 2NVTJ 5CJ9A 3IUOA 1L1MA 1LFPA 3VEPA 5IPAA 2V1DA 3D5LA 5H6QA 3WHCA 2EZHA 1DULA 2RDPA 4B4CA 3GEZA 2E35A 3HGYA 2IA0A 2PQ8A 3GBGA 3ZPLA 3H3ZA 4YFKF 5K5OA 2VQCA
chains in the Genus database with same CATH topology
2EZLA 2LTPA 4XICA 3SJMA 3SCHA 4JX6A 5E3NA 1OJLA 2H8RA 1B0NA 2PUBA 2ECBA 1ITYA 4S0HB 5IP6A 3A03A 1BW6A 2DA5A 4I76A 1SQ8A 1ZPQA 2WIUB 4A3FJ 3BTLA 1ETWA 2LVSA 1IG7A 1X2NA 4BKXA 4M3EA 2JA7J 4GQMA 4I6ZA 4PU4C 2K40A 5IOZA 3JXCL 1G2HA 2OFYA 2EZIA 4J1WA 2NVQJ 1MNMC 2L9RA 4D5CA 2GLOA 2JA8J 2PUFA 3BQZA 4FISA 4Y7NJ 5EZGA 2ID3A 1JT6A 4AUXA 1A6IA 3D1NI 5EGOA 1VNDA 2PUEA 1JH9A 2HI3A 4X4IA 4XRMA 2OF7A 1I6HJ 1TC3C 3Q0UA 4UUSA 2E2HJ 1U78A 1X58A 4BBSJ 2EBIA 2EF8A 2HXIA 3R1FA 4X4HA 4A3LJ 1JKQC 1RZRD 4MCXA 2DMQA 3L1PA 4GHJA 2LY9A 1ETVA 1QPIA 1NK2P 1T33A 1U8BA 2Y9ZA 2JVLA 2ECCA 1U9OA 2O49A 1HLVA 3GTJJ 4RDUA 5M3FJ 1JTYA 2ME0A 1TWFJ 1UXCA 2XSDC 4MO7A 2M34A 2Y0SN 1JWLA 2LYPA 2NOGA 1ZZ6A 4AYBN 4B3AA 2E19A 1ZR4A 2OPTA 1GT0C 5F1JA 3RZZA 3ZQFA 4IVZA 1BL0A 3KJXA 5FLVA 1IRZA 3F51A 3MLFA 4IHWA 2PMZN 1PNRA 1XC5A 1MH4A 3LSGA 5BNGA 1QP4A 1JUSA 2PUGA 2HOAA 1QRYA 2AHQA 1XS9A 2KT0A 4JX5A 3WHBA 1HDDC 2CUEA 1AKHB 2AUWA 2HOTA 2GBYA 3NARA 1GUUA 1H88C 2JCGA 1WGXA 2DA1A 1PUFA 3QF3A 2XB5A 2JK3A 1LLIA 1ZR2A 1NEQA 4X4DA 1RKTA 1QPZA 1CQTA 1B8IA 5DS9A 1VI0A 3G1LA 2FD5A 2PUCA 2IBDA 2ICPA 2CQQA 1XWRA 2VKEA 2WAQN 1SANA 5IP9J 4DZPA 3FKIJ 1B8IB 1QP7A 4I6TA 1Q1VA 1LMB3 2GZUA 2K9NA 3FYMA 4QSHA 3EUSA 3QQ6A 1R69A 1OFCX 1TWCJ 5E3LA 2LYLA 4MLOA 1MBKA 3HM5A 1ZQ3P 4FE7A 3BR2A 1POUA 4DW6A 1LFUP 3ZOBA 2GRLA 1QVTA 2DTZA 3S1RJ 1ZVVA 2O9LA 4J19A 2MGQA 3GTMJ 5M3MJ 3RKQA 2M2EA 5J1UA 3S14J 3F6WA 2FX0A 4BY1J 1PRAA 2XCJA 3BQYA 4BBRJ 3JXBC 2X6OA 2IU7A 3I4NJ 3A01A 1ETYA 3CROL 3BR3A 3CQZJ 3JXDL 2LKXA 3TW6A 5IYCJ 3GTGJ 2CJJA 4ABZA 1Y1WJ 1FEXA 1RKWA 2DMNA 5F0CA 2PUAA 5FKOA 3SCFA 4A3MJ 5IP7J 5EF6A 2R5ZA 4MFDA 5K98B 3OIOA 2DJNA 3ZQLA 3LSRA 5M5YJ 3TP3A 3S16J 4OB4A 3LOCA 2GRMA 3JRDA 1SFOJ 1WH7A 2IUOA 1UG2A 4M3GA 5EYRA 2QCOA 4XRSA 2L8NA 4CYCA 2E2IJ 4PU8A 2R7ZJ 3HOYJ 1MBHA 2HQ5A 4V2FA 3TW7A 1GDTA 4Y52J 1D5YA 3BR5A 2DA7A 2AO9A 1JKRC 1OCTC 1ZTRA 2CUFA 2LK2A 4GFBA 4A93J 3HZIB 4X1EA 4AC0A 2R5YB 1A5JA 3IV5A 3ZQCA 1IJWC 2IV1A 2B63J 2EWTA 3RZDJ 1RETA 1JJ6C 1ZZ7A 1MBFA 5E3OA 3S8QA 3OQMA 3CLCA 9ANTA 2DN0A 4Z5CA 4X4CA 2L7FP 1T56A 2CQXA 3S15J 5DTDA 2EQRA 4DYQA 1YSEA 2P81A 2L49A 4FTHA 3BG9A 2KPJA 3O8GA 3JRBA 1W0UA 2GM4A 1BDHA 1CJGA 1JFTA 2HOSA 4X4FA 5J1YA 2CROA 1JT0A 2LYJA 1PRVA 1Z0XA 2LP0A 4A3IJ 2KEIA 1YRNB 4JCXA 1JGGA 2VUMJ 3HB9A 1FIAA 1MH3A 4Z59A 2KEKA 3ZHIA 2ID6A 4IEJA 1RZRA 1O4XA 3M4OJ 1I50J 1WPKA 2HYJA 4Z5DA 2I10A 3E7LA 3OOUA 2HINA 3TEDA 2O8KA 1R63A 2A6CA 4A3DJ 4X4EA 4O8BA 1PERL 1IDZA 1ZZBA 2XI8A 2L7MP 2O7OA 1FTTA 5J3LA 2MQKA 3G5GA 2BNNA 1BJZA 2N8GA 3KXAA 1JKOC 2DA6A 4JCYA 5EDNA 1IUFA 1WCMJ 1LE8A 1H8AC 1NTCA 4M3FA 3UKGA 5C44J 1K61A 2NVXJ 4NDWA 4IHYA 3BTCA 1S7EA 4M6VA 1ZS4A 1H89C 1HDPA 4I6RA 2KZ8A 1ETXA 2PE5A 3S2HJ 5K7ZA 1YRNA 3IH2A 2YU9J 5IOYA 2Y9YA 1Y7YA 3BR1A 3IH4A 4XRSG 3SCGA 1TWHJ 2R1JL 1BA5A 3UFDA 1LCDA 1JKPC 1ZZ8A 1APLC 3LSPA 5A7LA 5EEAA 3A01B 1P7IA 2ELKA 3OSGA 3VK0A 3HOZJ 3Q0VA 1X57A 3FYAA 2YUSA 3H3VK 1E3OC 2R5ZB 4FCYA 1MBJA 3O9XA 3GN5A 1JUMA 4YBAA 1BDIA 5C4XJ 5FKLA 2CSFA 1K83J 2KDZA 4MIMA 4D5FA 2IAIA 1HCRA 3HOWJ 4QIWN 3O8HA 2LYSA 2O38A 2JJ7A 3BS3A 2YS9A 4UUSB 5K7HA 2LFBA 3MVPA 3BTJA 1ZKGA 5F0FA 3W6VA 3RZOJ 1HOMA 1UXDA 1ZZ9A 2COBA 1FIPA 2DA3A 2Y30A 1AU7A 4I6UA 2JA5J 3ZQHA 1GV2A 2BNMA 3BT9A 2JA6J 1WETA 3VPRA 3GTPJ 1WH6A 5JLWA 1U9NA 1FTZA 2RAEA 5GPCA 3HOUJ 2VI6A 1P7JA 4B1RA 4YG4A 2DMTA 3S1NJ 2BNOA 5EG0A 2IVQA 1DU6A 4FE4A 4YG7B 2AXZA 2IVGA 5F08A 3BG5A 3GN5B 4EEFG 2EZKA 1VF9A 3TP0A 5C3EJ 3IVPA 1MSEC 3GTKJ 1IDYA 2HSGA 2PIJA 3F52A 3QWGA 3GTOJ 1TWAJ 2MSYA 3C2BA 4IA8A 4XK4A 1JUPA 1ZK8A 1ORKA 1QQAA 1OSLA 3M3YJ 3TRBA 1LCCA 5C4JJ 3QQAA 2R5YA 3LFPA 4D7MA 2R92J 1RESA 5FLMJ 2XPUA 4X4GA 3Q3SA 5F04A 3KZ3A 1AKHA 1PRUA 1JJ8C 1WIZA 2FQ4A 1RR7A 4Z58A 4Z5HA 3G1MA 4D7NA 1QVUA 3FK7A 2XB0X 3JRFA 2W48A 2Y31A 3U3WA 2CU7A 2K9QA 2X48A 4W97A 3SDGA 2L7ZA 3BR6A 5E3MA 3JRAA 1ETQA 2JWTA 3S1MJ 2XPVA 2O4AA 2XGEA 2JN6A 3GBFA 5J1RA 2MEZA 3DNVB 3CCYA 3FISA 3DCFA 1X2LA 3SFIA 2R0QC 2AW6A 5F0HA 1VPWA 2IVBA 1ENHA 1MBGA 3G7DA 4IWRA 2WV1A 3HEFA 2L0KA 3S17J 1X2MA 1Z77A 4JYKA 4F8DA 3HDDA 4QTRA 1WH5A 2E2JJ 1BW5A 3JRIA 2PUDA 3NAUA 3HGGA 1FJLA 4IHVA 5FKNA 1ZAYA 3OSFA 3Q0WA 2AXUA 2B5AA 1GV5A 2K9SA 2BJCA 1DWKA 3H5TA 1UMQA 3B6CA 1PUFB 2QF7A 2DMPA 5M5WJ 2D5VA 1ZZCA 3QPLA 4PU3C 2VPRA 3PO2J 2XJ3A 3K7AJ 3HOXJ 1ZUGA 2AWIA 2G0EA 3S2DJ 3JRHA 2EH3A 3FK6A 2M8GX 4CYCB 4X4BA 1XG1A 2E1OA 2PPXA 1LQCA 3G1OA 2ME6A 5K7FA 1LE8B 1RPWA 2DA2A 3JR9A 2H1KA 4A3CJ 2KEJA 2WUSR 2LD5A 4JQDA 3OP9A 5HODA 1F43A 1EF4A 2XPWA 1Y1VJ 4W1UA 1IV6A 2LYQA 5IYDJ 2FJ1A 2Y2ZA 4M3BA 2TRTA 1NERA 1DU0A 4DZJA 1UTXA 3IH3A 2ZB9A 2NS7A 1TWGJ 4MFEA 5F27A 5GP9A 3CMYA 1IGNA 4BXXJ 1B72A 3B6AA 1ETKA 4C2MJ 1Y9QA 1UHSA 2MW8A 4M3DA 4IHXA 5EZHA 4L5EA 3CECA 5EG0B 2AXVA 3PXPA 1MSFC 3BDNA 3I4MJ 3BR0A 1B72B 4A3JJ 4PU7A 4YARA 1AHDP 3ZKCA 1NK3P 3HOVJ 4C3IJ 4I8TA 4BY7J 3GTQJ 1LFBA 3DEWA 3BG3A 4V2GA 3OMTA 3ZQIA 2VKVA 4A3GJ 3JRGA 2IEKA 4DYCA 3GTLJ 2CRGA 1WH8A 1DW9A 4YG1A 5JLXA 4MCTA 1POGA 4G12A 4JP0A 3RQIA 5EGOB 2HXOA 2LCVA 3OQOA 5FKKA 3LISA 4UUTA 2LYKA 4C3JJ 1W0TA 1ADRA 4LOCA 2FJRA 3H0GJ 5FKMA 2EBYA 3BD1A 2NVYJ 3CDLA 2XGCA 2MG4A 2WB1N 2LYRA 3JRCA 3ZHMA 2LLKA 1WI3A 3JREA 5IYBJ 3HKZN 3BTIA 3PM1A 4JX4A 3QPSA 2NS8A 3K2AA 3MN2A 1OCPA 3HBLA 5M5XJ 5FJ8J 3LNQA 1VFCA 4FBIA 2DA4A 2M9HA 1ETOA 3ZQGA 2HDDA 4A69C 3B7HA 2JMWA 4XIDA 2XIUA 1I3QJ 2DMUA 4A3KJ 3PO3J 3FIWA 1MBEA 1QQBA 2LR8A 2OR1L 3MKLA 4J1XA 1RPEL 2R63A 4Y42A 1QP0A 4C3HJ 1R9TJ 2ICTA 1ZGWA 3A02A 2XRLA 3S1QJ 1RZSA 4NDLA 1HF0A 3F0CA 3QYXA 4DYRA 2XGDA 3OQNA 3LSJA 1JTXA 1JFSA 1EFAA 1RIOA 1GVDA 2X9DA 2R93J 2NVTJ 4X6AJ 1IC8A 3FMYA 2TCTA 1L1MA 4A3EJ 5IPAA 4A3BJ 3WHCA 2EZHA 4HNVA 4RBOA 4B4CA 3HGYA 3GBGA 5GPAA 2M0CA 4FN3A 1F36A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EZL A;  2LTP A;  4XIC A;  3SJM A;  3SCH A;  4JX6 A;  5E3N A;  1OJL A;  2H8R A;  1B0N A;  2PUB A;  2ECB A;  1ITY A;  4S0H B;  5IP6 A;  3A03 A;  1BW6 A;  2DA5 A;  4I76 A;  1SQ8 A;  1ZPQ A;  2WIU B;  4A3F J;  3BTL A;  1ETW A;  2LVS A;  1IG7 A;  1X2N A;  4BKX A;  4M3E A;  2JA7 J;  4GQM A;  4I6Z A;  4PU4 C;  2K40 A;  5IOZ A;  3JXC L;  1G2H A;  2OFY A;  2EZI A;  4J1W A;  2NVQ J;  1MNM C;  2L9R A;  4D5C A;  2GLO A;  2JA8 J;  2PUF A;  3BQZ A;  4FIS A;  4Y7N J;  5EZG A;  2ID3 A;  1JT6 A;  4AUX A;  1A6I A;  3D1N I;  5EGO A;  1VND A;  2PUE A;  1JH9 A;  2HI3 A;  4X4I A;  4XRM A;  2OF7 A;  1I6H J;  1TC3 C;  3Q0U A;  4UUS A;  2E2H J;  1U78 A;  1X58 A;  4BBS J;  2EBI A;  2EF8 A;  2HXI A;  3R1F A;  4X4H A;  4A3L J;  1JKQ C;  1RZR D;  4MCX A;  2DMQ A;  3L1P A;  4GHJ A;  2LY9 A;  1ETV A;  1QPI A;  1NK2 P;  1T33 A;  1U8B A;  2Y9Z A;  2JVL A;  2ECC A;  1U9O A;  2O49 A;  1HLV A;  3GTJ J;  4RDU A;  5M3F J;  1JTY A;  2ME0 A;  1TWF J;  1UXC A;  2XSD C;  4MO7 A;  2M34 A;  2Y0S N;  1JWL A;  2LYP A;  2NOG A;  1ZZ6 A;  4AYB N;  4B3A A;  2E19 A;  1ZR4 A;  2OPT A;  1GT0 C;  5F1J A;  3RZZ A;  3ZQF A;  4IVZ A;  1BL0 A;  3KJX A;  5FLV A;  1IRZ A;  3F51 A;  3MLF A;  4IHW A;  2PMZ N;  1PNR A;  1XC5 A;  1MH4 A;  3LSG A;  5BNG A;  1QP4 A;  1JUS A;  2PUG A;  2HOA A;  1QRY A;  2AHQ A;  1XS9 A;  2KT0 A;  4JX5 A;  3WHB A;  1HDD C;  2CUE A;  1AKH B;  2AUW A;  2HOT A;  2GBY A;  3NAR A;  1GUU A;  1H88 C;  2JCG A;  1WGX A;  2DA1 A;  1PUF A;  3QF3 A;  2XB5 A;  2JK3 A;  1LLI A;  1ZR2 A;  1NEQ A;  4X4D A;  1RKT A;  1QPZ A;  1CQT A;  1B8I A;  5DS9 A;  1VI0 A;  3G1L A;  2FD5 A;  2PUC A;  2IBD A;  2ICP A;  2CQQ A;  1XWR A;  2VKE A;  2WAQ N;  1SAN A;  5IP9 J;  4DZP A;  3FKI J;  1B8I B;  1QP7 A;  4I6T A;  1Q1V A;  1LMB 3;  2GZU A;  2K9N A;  3FYM A;  4QSH A;  3EUS A;  3QQ6 A;  1R69 A;  1OFC X;  1TWC J;  5E3L A;  2LYL A;  4MLO A;  1MBK A;  3HM5 A;  1ZQ3 P;  4FE7 A;  3BR2 A;  1POU A;  4DW6 A;  1LFU P;  3ZOB A;  2GRL A;  1QVT A;  2DTZ A;  3S1R J;  1ZVV A;  2O9L A;  4J19 A;  2MGQ A;  3GTM J;  5M3M J;  3RKQ A;  2M2E A;  5J1U A;  3S14 J;  3F6W A;  2FX0 A;  4BY1 J;  1PRA A;  2XCJ A;  3BQY A;  4BBR J;  3JXB C;  2X6O A;  2IU7 A;  3I4N J;  3A01 A;  1ETY A;  3CRO L;  3BR3 A;  3CQZ J;  3JXD L;  2LKX A;  3TW6 A;  5IYC J;  3GTG J;  2CJJ A;  4ABZ A;  1Y1W J;  1FEX A;  1RKW A;  2DMN A;  5F0C A;  2PUA A;  5FKO A;  3SCF A;  4A3M J;  5IP7 J;  5EF6 A;  2R5Z A;  4MFD A;  5K98 B;  3OIO A;  2DJN A;  3ZQL A;  3LSR A;  5M5Y J;  3TP3 A;  3S16 J;  4OB4 A;  3LOC A;  2GRM A;  3JRD A;  1SFO J;  1WH7 A;  2IUO A;  1UG2 A;  4M3G A;  5EYR A;  2QCO A;  4XRS A;  2L8N A;  4CYC A;  2E2I J;  4PU8 A;  2R7Z J;  3HOY J;  1MBH A;  2HQ5 A;  4V2F A;  3TW7 A;  1GDT A;  4Y52 J;  1D5Y A;  3BR5 A;  2DA7 A;  2AO9 A;  1JKR C;  1OCT C;  1ZTR A;  2CUF A;  2LK2 A;  4GFB A;  4A93 J;  3HZI B;  4X1E A;  4AC0 A;  2R5Y B;  1A5J A;  3IV5 A;  3ZQC A;  1IJW C;  2IV1 A;  2B63 J;  2EWT A;  3RZD J;  1RET A;  1JJ6 C;  1ZZ7 A;  1MBF A;  5E3O A;  3S8Q A;  3OQM A;  3CLC A;  9ANT A;  2DN0 A;  4Z5C A;  4X4C A;  2L7F P;  1T56 A;  2CQX A;  3S15 J;  5DTD A;  2EQR A;  4DYQ A;  1YSE A;  2P81 A;  2L49 A;  4FTH A;  3BG9 A;  2KPJ A;  3O8G A;  3JRB A;  1W0U A;  2GM4 A;  1BDH A;  1CJG A;  1JFT A;  2HOS A;  4X4F A;  5J1Y A;  2CRO A;  1JT0 A;  2LYJ A;  1PRV A;  1Z0X A;  2LP0 A;  4A3I J;  2KEI A;  1YRN B;  4JCX A;  1JGG A;  2VUM J;  3HB9 A;  1FIA A;  1MH3 A;  4Z59 A;  2KEK A;  3ZHI A;  2ID6 A;  4IEJ A;  1RZR A;  1O4X A;  3M4O J;  1I50 J;  1WPK A;  2HYJ A;  4Z5D A;  2I10 A;  3E7L A;  3OOU A;  2HIN A;  3TED A;  2O8K A;  1R63 A;  2A6C A;  4A3D J;  4X4E A;  4O8B A;  1PER L;  1IDZ A;  1ZZB A;  2XI8 A;  2L7M P;  2O7O A;  1FTT A;  5J3L A;  2MQK A;  3G5G A;  2BNN A;  1BJZ A;  2N8G A;  3KXA A;  1JKO C;  2DA6 A;  4JCY A;  5EDN A;  1IUF A;  1WCM J;  1LE8 A;  1H8A C;  1NTC A;  4M3F A;  3UKG A;  5C44 J;  1K61 A;  2NVX J;  4NDW A;  4IHY A;  3BTC A;  1S7E A;  4M6V A;  1ZS4 A;  1H89 C;  1HDP A;  4I6R A;  2KZ8 A;  1ETX A;  2PE5 A;  3S2H J;  5K7Z A;  1YRN A;  3IH2 A;  2YU9 J;  5IOY A;  2Y9Y A;  1Y7Y A;  3BR1 A;  3IH4 A;  4XRS G;  3SCG A;  1TWH J;  2R1J L;  1BA5 A;  3UFD A;  1LCD A;  1JKP C;  1ZZ8 A;  1APL C;  3LSP A;  5A7L A;  5EEA A;  3A01 B;  1P7I A;  2ELK A;  3OSG A;  3VK0 A;  3HOZ J;  3Q0V A;  1X57 A;  3FYA A;  2YUS A;  3H3V K;  1E3O C;  2R5Z B;  4FCY A;  1MBJ A;  3O9X A;  3GN5 A;  1JUM A;  4YBA A;  1BDI A;  5C4X J;  5FKL A;  2CSF A;  1K83 J;  2KDZ A;  4MIM A;  4D5F A;  2IAI A;  1HCR A;  3HOW J;  4QIW N;  3O8H A;  2LYS A;  2O38 A;  2JJ7 A;  3BS3 A;  2YS9 A;  4UUS B;  5K7H A;  2LFB A;  3MVP A;  3BTJ A;  1ZKG A;  5F0F A;  3W6V A;  3RZO J;  1HOM A;  1UXD A;  1ZZ9 A;  2COB A;  1FIP A;  2DA3 A;  2Y30 A;  1AU7 A;  4I6U A;  2JA5 J;  3ZQH A;  1GV2 A;  2BNM A;  3BT9 A;  2JA6 J;  1WET A;  3VPR A;  3GTP J;  1WH6 A;  5JLW A;  1U9N A;  1FTZ A;  2RAE A;  5GPC A;  3HOU J;  2VI6 A;  1P7J A;  4B1R A;  4YG4 A;  2DMT A;  3S1N J;  2BNO A;  5EG0 A;  2IVQ A;  1DU6 A;  4FE4 A;  4YG7 B;  2AXZ A;  2IVG A;  5F08 A;  3BG5 A;  3GN5 B;  4EEF G;  2EZK A;  1VF9 A;  3TP0 A;  5C3E J;  3IVP A;  1MSE C;  3GTK J;  1IDY A;  2HSG A;  2PIJ A;  3F52 A;  3QWG A;  3GTO J;  1TWA J;  2MSY A;  3C2B A;  4IA8 A;  4XK4 A;  1JUP A;  1ZK8 A;  1ORK A;  1QQA A;  1OSL A;  3M3Y J;  3TRB A;  1LCC A;  5C4J J;  3QQA A;  2R5Y A;  3LFP A;  4D7M A;  2R92 J;  1RES A;  5FLM J;  2XPU A;  4X4G A;  3Q3S A;  5F04 A;  3KZ3 A;  1AKH A;  1PRU A;  1JJ8 C;  1WIZ A;  2FQ4 A;  1RR7 A;  4Z58 A;  4Z5H A;  3G1M A;  4D7N A;  1QVU A;  3FK7 A;  2XB0 X;  3JRF A;  2W48 A;  2Y31 A;  3U3W A;  2CU7 A;  2K9Q A;  2X48 A;  4W97 A;  3SDG A;  2L7Z A;  3BR6 A;  5E3M A;  3JRA A;  1ETQ A;  2JWT A;  3S1M J;  2XPV A;  2O4A A;  2XGE A;  2JN6 A;  3GBF A;  5J1R A;  2MEZ A;  3DNV B;  3CCY A;  3FIS A;  3DCF A;  1X2L A;  3SFI A;  2R0Q C;  2AW6 A;  5F0H A;  1VPW A;  2IVB A;  1ENH A;  1MBG A;  3G7D A;  4IWR A;  2WV1 A;  3HEF A;  2L0K A;  3S17 J;  1X2M A;  1Z77 A;  4JYK A;  4F8D A;  3HDD A;  4QTR A;  1WH5 A;  2E2J J;  1BW5 A;  3JRI A;  2PUD A;  3NAU A;  3HGG A;  1FJL A;  4IHV A;  5FKN A;  1ZAY A;  3OSF A;  3Q0W A;  2AXU A;  2B5A A;  1GV5 A;  2K9S A;  2BJC A;  1DWK A;  3H5T A;  1UMQ A;  3B6C A;  1PUF B;  2QF7 A;  2DMP A;  5M5W J;  2D5V A;  1ZZC A;  3QPL A;  4PU3 C;  2VPR A;  3PO2 J;  2XJ3 A;  3K7A J;  3HOX J;  1ZUG A;  2AWI A;  2G0E A;  3S2D J;  3JRH A;  2EH3 A;  3FK6 A;  2M8G X;  4CYC B;  4X4B A;  1XG1 A;  2E1O A;  2PPX A;  1LQC A;  3G1O A;  2ME6 A;  5K7F A;  1LE8 B;  1RPW A;  2DA2 A;  3JR9 A;  2H1K A;  4A3C J;  2KEJ A;  2WUS R;  2LD5 A;  4JQD A;  3OP9 A;  5HOD A;  1F43 A;  1EF4 A;  2XPW A;  1Y1V J;  4W1U A;  1IV6 A;  2LYQ A;  5IYD J;  2FJ1 A;  2Y2Z A;  4M3B A;  2TRT A;  1NER A;  1DU0 A;  4DZJ A;  1UTX A;  3IH3 A;  2ZB9 A;  2NS7 A;  1TWG J;  4MFE A;  5F27 A;  5GP9 A;  3CMY A;  1IGN A;  4BXX J;  1B72 A;  3B6A A;  1ETK A;  4C2M J;  1Y9Q A;  1UHS A;  2MW8 A;  4M3D A;  4IHX A;  5EZH A;  4L5E A;  3CEC A;  5EG0 B;  2AXV A;  3PXP A;  1MSF C;  3BDN A;  3I4M J;  3BR0 A;  1B72 B;  4A3J J;  4PU7 A;  4YAR A;  1AHD P;  3ZKC A;  1NK3 P;  3HOV J;  4C3I J;  4I8T A;  4BY7 J;  3GTQ J;  1LFB A;  3DEW A;  3BG3 A;  4V2G A;  3OMT A;  3ZQI A;  2VKV A;  4A3G J;  3JRG A;  2IEK A;  4DYC A;  3GTL J;  2CRG A;  1WH8 A;  1DW9 A;  4YG1 A;  5JLX A;  4MCT A;  1POG A;  4G12 A;  4JP0 A;  3RQI A;  5EGO B;  2HXO A;  2LCV A;  3OQO A;  5FKK A;  3LIS A;  4UUT A;  2LYK A;  4C3J J;  1W0T A;  1ADR A;  4LOC A;  2FJR A;  3H0G J;  5FKM A;  2EBY A;  3BD1 A;  2NVY J;  3CDL A;  2XGC A;  2MG4 A;  2WB1 N;  2LYR A;  3JRC A;  3ZHM A;  2LLK A;  1WI3 A;  3JRE A;  5IYB J;  3HKZ N;  3BTI A;  3PM1 A;  4JX4 A;  3QPS A;  2NS8 A;  3K2A A;  3MN2 A;  1OCP A;  3HBL A;  5M5X J;  5FJ8 J;  3LNQ A;  1VFC A;  4FBI A;  2DA4 A;  2M9H A;  1ETO A;  3ZQG A;  2HDD A;  4A69 C;  3B7H A;  2JMW A;  4XID A;  2XIU A;  1I3Q J;  2DMU A;  4A3K J;  3PO3 J;  3FIW A;  1MBE A;  1QQB A;  2LR8 A;  2OR1 L;  3MKL A;  4J1X A;  1RPE L;  2R63 A;  4Y42 A;  1QP0 A;  4C3H J;  1R9T J;  2ICT A;  1ZGW A;  3A02 A;  2XRL A;  3S1Q J;  1RZS A;  4NDL A;  1HF0 A;  3F0C A;  3QYX A;  4DYR A;  2XGD A;  3OQN A;  3LSJ A;  1JTX A;  1JFS A;  1EFA A;  1RIO A;  1GVD A;  2X9D A;  2R93 J;  2NVT J;  4X6A J;  1IC8 A;  3FMY A;  2TCT A;  1L1M A;  4A3E J;  5IPA A;  4A3B J;  3WHC A;  2EZH A;  4HNV A;  4RBO A;  4B4C A;  3HGY A;  3GBG A;  5GPA A;  2M0C A;  4FN3 A;  1F36 A; 
#chains in the Genus database with same CATH topology
 2JQ7 A;  1BI3 A;  2FOW A;  1OJL A;  2DCE A;  2H8R A;  2G9W A;  2D45 A;  3NQO A;  5IP6 A;  2DA5 A;  5JI6 A;  3FHZ A;  3AG1 H;  2HVQ A;  1YG2 A;  3ML6 A;  3KYD B;  3RI4 A;  5E17 F;  1P4X A;  1GVJ A;  4GQM A;  2DYR H;  4GDF A;  4ESJ A;  2AQF A;  3OYG A;  1VTN C;  3A2K A;  4ESB A;  4MTD A;  2XXP A;  4FIS A;  1YJN I;  1Z6T A;  1J75 A;  4XLC A;  2ID3 A;  2NVU B;  1FOK A;  3D1N I;  1QZY A;  2CW7 A;  3O3K A;  3QU6 A;  3CC7 I;  1E17 A;  2HI3 A;  4YFX F;  4BGD A;  2DOE A;  1MJA A;  1P4W A;  1U6G A;  4BAY A;  2F4I A;  2EBI A;  3J7A Y;  1HW5 A;  5LHH A;  5TGT A;  3SYT A;  2CQ7 A;  3OL3 A;  2M8E A;  1WQ2 A;  1NK2 P;  2DPD A;  1U8B A;  1SVM A;  2FBH A;  2O49 A;  3ABL H;  4BEH A;  4L5I A;  4XLE A;  3GX4 X;  1WSU A;  2DJI A;  3GTJ J;  1WI9 A;  2GA1 A;  1LDD A;  3OYI A;  4IL6 C;  3K4M A;  4CIC A;  1XCB A;  1Q1H A;  4ZH4 F;  5GAD J;  3ZR8 X;  2BW3 B;  1MZB A;  4I01 A;  3WTT C;  1O3T A;  1BC8 C;  1LVA A;  2OCC H;  1Z3Y A;  1UCR A;  3ZMS A;  2NOG A;  4LFU A;  1V5E A;  1ZG3 A;  4AYB N;  4RAY A;  4B3A A;  2CMP A;  1GT0 C;  2M4G A;  3CCJ I;  1VQ9 I;  3K1P A;  3ZQF A;  3RZZ A;  4DE8 A;  2P5V A;  3CME I;  4J00 A;  5FLV A;  2ZSI B;  1KGS A;  1OCC H;  3AG3 H;  3ERE D;  1IF1 A;  3QAH A;  4IHW A;  2PMZ N;  3MLF A;  5ED4 A;  2RNG A;  3IHU A;  4MQ9 F;  2PXL A;  1JUS A;  3PE5 A;  1VQP I;  2AHQ A;  1XS9 A;  2PXU A;  1GLN A;  3H5A A;  3WHB A;  3KYL A;  3GZN B;  2HOT A;  4KIB A;  2GIV A;  2CQK A;  2XB5 A;  2OTJ I;  1LLI A;  1ZR2 A;  1I6X A;  1NEQ A;  4X4D A;  1LDJ A;  2RVC A;  2PMH A;  1CQT A;  3G1L A;  2PUC A;  3F6V A;  2IBD A;  2W84 A;  3ABU A;  4BNC A;  2PXK A;  2VKE A;  2WAQ N;  2HU9 A;  2A05 A;  4LGW A;  3AG4 H;  3SR4 A;  1LQ1 A;  3RSN A;  1J9I A;  3QQ6 A;  1B4A A;  1R1T A;  2E34 A;  3T8R A;  5L3F A;  3PUB A;  1KU7 A;  3NDB B;  1ZQ3 P;  3E5Q A;  3OKZ A;  2XXA A;  3BR2 A;  4CYD A;  2DI3 A;  3QOE A;  5J4V A;  2D1V A;  4IHT A;  5DCM B;  1LFU P;  2DO7 A;  2DQL A;  1WZ2 A;  2O9L A;  2IT0 A;  5EJC A;  4PJ0 C;  2FEZ A;  2FX0 A;  5DCF A;  3BQY A;  1WJE A;  4IX7 A;  1OQY A;  2X6O A;  1ZRF A;  2ZJP F;  2LLW A;  2PXQ A;  4IKF A;  3Q9V A;  3GXO A;  1WJ5 A;  2LKX A;  2LG4 A;  2QZ8 A;  3TW6 A;  1A35 A;  1JHF A;  1RR8 C;  2A68 F;  2CJJ A;  4B8X A;  2PXV A;  2ZC2 A;  1RKW A;  1B59 A;  2JPB A;  5FKO A;  3OY9 A;  4UUV A;  4EKI A;  3SCF A;  1MIJ A;  2JRM A;  1SD7 A;  3KZZ A;  3MKW B;  2R5Z A;  2O8X A;  2IGK A;  1XSD A;  2Q2E B;  1UST A;  3G6E I;  3FMS A;  4XN3 A;  1BI1 A;  1UG2 A;  2IUO A;  4G6Q A;  1TTY A;  4XRS A;  2V6E A;  4IHS A;  4PU8 A;  1M1E B;  1MBH A;  4L9J A;  1R4M B;  1GDT A;  3BR5 A;  5FD6 A;  1D1B A;  1UAA A;  2MD0 A;  2AO9 A;  2ZSH B;  5FO5 A;  3OYM A;  4GFB A;  4A93 J;  2OUM A;  3HZI B;  4UB8 C;  4AC0 A;  5KK1 A;  3LAJ A;  2DDA A;  3ZQC A;  1IJW C;  4WWC A;  2B63 J;  1FBU A;  2FMY A;  2J7W A;  4O5V A;  4KYW A;  2E60 A;  1YW9 A;  1RET A;  2XV4 S;  3PNY A;  2XIG A;  3I54 A;  1ZZ7 A;  5F6F A;  1MBF A;  1F9N A;  2QGU A;  4HPQ A;  2L7F P;  4Z5C A;  4X4C A;  2OV7 A;  1WVR A;  5DTD A;  4RB2 C;  4DOZ A;  5ICG A;  4UV9 A;  5CVU A;  2PX9 A;  2IP2 A;  2QEN A;  3FXJ A;  1LJ9 A;  1B6A A;  5DD4 A;  4B43 A;  4LG0 B;  3F8N A;  3S3N A;  1CJG A;  2DXI A;  1JFT A;  3GW2 A;  2HOS A;  5J1Y A;  4AIH A;  2CV2 A;  5LEJ A;  4A6E A;  5ILU A;  1NHA A;  1G3S A;  2E1N A;  2CG4 A;  2ZME A;  2LP0 A;  2OAZ A;  2KEI A;  1VQ4 I;  1YOV B;  2GXA A;  1MH3 A;  5KNL A;  2ID6 A;  4IEJ A;  3ULQ B;  2HQN A;  3R60 A;  3TL4 X;  3P9I A;  1T38 A;  2HYJ A;  5DTR A;  4B47 A;  2W1O A;  2A6C A;  2X1D A;  4A3D J;  1PJR A;  2BGC A;  1PER L;  2JSP A;  1MND A;  1IDZ A;  3SFZ A;  5J3L A;  3LFK A;  2MQK A;  2BOL A;  1BJZ A;  2BNN A;  3G5G A;  4D9J A;  4EMS A;  2COM A;  4KIT B;  2V3C C;  2X1E A;  5EDN A;  3OS1 A;  1WCM J;  1PP7 U;  4BDY A;  4ER3 A;  1K61 A;  2O6G E;  1X1D A;  3H9Q A;  4IHY A;  1C0W A;  4CCK A;  4RLF A;  1WRJ A;  2LNB A;  2M1B A;  2JRT A;  2V79 A;  5K7Z A;  1LPQ A;  1YRN A;  1OYW A;  1XB4 A;  4FET A;  4KUM A;  1VQ8 I;  3TEP A;  2KRF A;  3E1S A;  5IOY A;  5KVR A;  2R1J L;  4Y15 A;  4L0Y B;  4ITV A;  1IN5 A;  3DTI A;  1R1U A;  4XKV A;  2DW4 A;  4KFC A;  2KDO A;  1P7I A;  2ELK A;  3BY6 A;  3JAM Z;  5BS6 A;  5BMZ A;  1ACI A;  1ZN2 A;  2YUS A;  2CSO A;  1D5V A;  3JSO A;  1FT9 A;  1JUM A;  1SVO A;  4D5F A;  1SD5 A;  2IAI A;  4XLA A;  3DPU A;  3BJA A;  3O8H A;  3ZGK A;  2QEX I;  1VQL I;  1YI2 I;  2O38 A;  3BS3 A;  3E6B A;  3GUD A;  2YS9 A;  1R22 A;  4XOT A;  4AD9 A;  3K2Z A;  4UUS B;  2LFB A;  3RTR A;  1T95 A;  4ZDO A;  5F0F A;  1UXD A;  5E8I A;  3VYR B;  3L9F A;  3RJP A;  4N9H A;  3ZQH A;  4NC7 A;  4UHT A;  3HOT A;  3GTP J;  1U9N A;  3KLO A;  1WH6 A;  4DJA A;  3TEL A;  1FTZ A;  2RAE A;  1RNL A;  3AFH A;  1BR1 A;  2HZT A;  3WU0 A;  4M71 A;  2VI6 A;  1P7J A;  2KRH A;  4AVP A;  1IRF A;  3S1N J;  2L4M A;  5D6F A;  1TL8 A;  4YG7 B;  5LGN A;  4XBF A;  2AXZ A;  2IVG A;  3BG5 A;  3ONQ A;  2EZK A;  1OR7 C;  2VT3 A;  1VF9 A;  4OOI A;  1SEU A;  5FFZ A;  2L02 A;  4CDG A;  4H0E A;  3PIO F;  3NWS A;  1MSE C;  4CZC A;  3GTK J;  1IDY A;  1D0Z A;  1YIO A;  1G3W A;  2K5C A;  2X4H A;  4HST A;  1ORK A;  1QQA A;  1OSL A;  3M3Y J;  4II2 A;  1UHM A;  2K4J A;  3LSH A;  3HKZ A;  4EJT A;  1ZLJ A;  2VE9 A;  4NQW A;  3OS2 A;  1YYV A;  3MZ8 A;  4D7M A;  4C2U A;  1TZL A;  3FHN A;  1RES A;  4Z2Y A;  2A3S A;  5FLM J;  4X4G A;  4HV6 A;  5F04 A;  3KZ3 A;  4NBQ A;  1PRU A;  2M4H A;  1DQU A;  3HL2 A;  1JJ8 C;  3IAM 2;  2FQ4 A;  1RR7 A;  1WIZ A;  2R7O A;  3G1M A;  1QVU A;  2OD5 A;  3FK7 A;  4KMU X;  2XB0 X;  1BM9 A;  4Y3O A;  2F5C A;  2W48 A;  2Y31 A;  4M72 A;  2X48 A;  3BG6 A;  2VJI A;  4W97 A;  3PUF A;  3SDG A;  3BR6 A;  3K10 A;  2JWT A;  3PJR A;  4YFN F;  1X1C A;  5FLX Z;  3DNV B;  2MEZ A;  2HDW A;  3BJO A;  1HKQ A;  2V9P A;  4MEY F;  4O6J A;  1X2L A;  1BIB A;  4RGS A;  2IVB A;  2CQN A;  1A6Q A;  2L0K A;  1X2M A;  1Z77 A;  4JYK A;  3CCR I;  4A5N A;  4QTR A;  2R7W A;  2VJ4 A;  4U7B A;  2E2J J;  1EKE A;  3E6M A;  1BW5 A;  2JTV A;  2QKL B;  3CUQ C;  4U0Y A;  2PUD A;  3WTZ A;  1X3U A;  3DU6 A;  2W7N A;  4IHV A;  2IS1 A;  2XAU A;  5FKN A;  3BP8 A;  3ERM A;  3OSF A;  2AXU A;  2K9S A;  3WTS C;  1XGN A;  2DU9 A;  3CUQ B;  1DWK A;  1HW1 A;  3B6C A;  5DTM A;  4EVI A;  1R5H A;  2QF7 A;  3CC4 I;  3EQL F;  4XLN F;  2D5V A;  4AID A;  2VPR A;  3S3M A;  1JE8 A;  2WC2 A;  1A31 A;  3BWG A;  3JW4 A;  1KYW A;  3CO6 C;  2ZXI A;  2EH3 A;  3B73 A;  2Z16 A;  4EJW A;  3K4L A;  1XG1 A;  5JR3 A;  5K7F A;  2G7U A;  1RPW A;  4QPQ A;  2LD5 A;  4ZYA A;  3U9G A;  2ELH A;  2ZXJ A;  3Q5F A;  2VC1 A;  3NXH A;  3HRS A;  4ANJ A;  2FJ1 A;  3OMY A;  2Y2Z A;  3SX0 A;  2IGO A;  2TRT A;  2IRF G;  1PDN C;  2ZB9 A;  2VN2 A;  4PFP A;  2HDC A;  3RYR A;  3OYC A;  5F27 A;  5GP9 A;  4GXO A;  3CMY A;  1FMV A;  1B72 A;  3L2V A;  4XMY A;  5GTI C;  1UHS A;  3CEC A;  5EZH A;  3PXP A;  3MKZ A;  5EG0 B;  2AXV A;  3LWF A;  3GYH X;  4EJO A;  3I4M J;  4RLQ A;  3BR0 A;  3DKX A;  4YAR A;  2RN7 A;  3HUG B;  2F48 A;  3ABM H;  3R09 A;  1LB2 A;  5HNF A;  1MNE A;  1R4N B;  3KEY A;  4XLP F;  3CJT B;  1QB2 A;  1QPM A;  4ER7 A;  1IXS B;  3OMT A;  3VSL A;  3JRG A;  2IEK A;  5L3C A;  2HVS A;  1U3E M;  3MEX A;  3H92 A;  5L3G A;  1RI7 A;  4G12 A;  3RQI A;  2HXO A;  3OQO A;  4G7H F;  1X1P A;  2DDB A;  4UUT A;  2LYK A;  4C3J J;  3CZ6 A;  1W0T A;  4LOC A;  5ILS A;  2VIX A;  4WXH A;  3WU2 C;  4N4O B;  4E7J A;  3KP3 A;  2XDV A;  3CDL A;  3FM5 A;  2MXD A;  1FNN A;  2EIN H;  1V5G A;  1QHH D;  3G4S I;  2V9V A;  5IYB J;  4OIQ F;  2KPM A;  2G7H A;  4BEH B;  4JX4 A;  4HNU A;  2ZBK A;  3LNQ A;  4FBI A;  3MN2 A;  3W2W A;  2PEX A;  5HLG A;  2GXB A;  2GIZ A;  4IXA A;  1G4D A;  3FZV A;  2HDD A;  1I3Q J;  3ZRG A;  1XX5 A;  1I27 A;  2PG4 A;  2E1C A;  4Y4R A;  4JOM A;  5GAH i;  2DOF A;  2X6X A;  3KLN A;  4J1X A;  2KMU A;  3UR3 C;  4Y42 A;  5E8G A;  3V7R A;  1ONV A;  1W5T A;  2KIF A;  3FXU A;  3R4K A;  2M7B A;  4L0Z B;  2VJJ A;  4NDL A;  1HF0 A;  1HKT A;  4RAF A;  3QYX A;  2EIJ H;  3EUK L;  2LBF A;  2FRH A;  1JTX A;  1OCR H;  3OYN A;  1RIO A;  4M73 A;  3CF2 A;  2F5V A;  2Z5U A;  3LA3 A;  1O3Q A;  4X6A J;  3CMM A;  2TCT A;  3HC7 A;  4C9Y A;  3LSK A;  4HNV A;  2RRE A;  3U21 A;  3VWB A;  1O57 A;  4O3M A;  1YW8 A;  1QHG A;  5GPA A;  1YLF A;  5JHU A;  2EZL A;  2LTP A;  4XIC A;  4ZYD A;  5EEG A;  4GGG A;  3BOQ A;  2ETH A;  4HAM A;  2ECB A;  1B0N A;  2QM3 A;  4S0H B;  1K4S A;  1BW6 A;  3IWF A;  1DGR M;  4NB5 A;  2MH2 A;  4A3F J;  1R7J A;  3BTL A;  2Z99 A;  5J47 A;  1ULY A;  4BKX A;  2A6H F;  2PXE A;  2JA7 J;  1MFQ C;  4PU4 C;  4KNY A;  5BPI A;  2R4G A;  2K40 A;  3LQQ A;  3MEJ A;  4S05 A;  1P6R A;  5J6X A;  2L9R A;  2MFZ A;  2GLO A;  1SAU A;  4BAC A;  3DF8 A;  1JT6 A;  1QZE A;  1P2F A;  3NRO A;  3FBI B;  1VND A;  2PUE A;  2MBF A;  4ZYE A;  1HA8 A;  2OF7 A;  2BYV E;  4XOR A;  1TC3 C;  3Q0U A;  2L4A A;  2E2H J;  2EF8 A;  1DUX C;  1I5Z A;  4BJ6 C;  1ZEL A;  1KQ9 A;  4CH7 A;  1QNT A;  4CSW A;  4F91 B;  3MCZ A;  1S7O A;  4YEJ A;  3L1P A;  4GHJ A;  1QZZ A;  3HRU A;  1QPI A;  2MLK A;  2JVL A;  2QYO A;  3TO9 A;  1LEB A;  4HQM A;  2FUG 2;  1QBJ A;  2DOA A;  1G6N A;  4IJA A;  4XKC A;  2DFE A;  3ASO H;  1O7F A;  2XSD C;  3IWZ A;  3WG9 A;  1Z1D A;  2K3P A;  2M34 A;  1OKR A;  2Y0S N;  3H1C A;  2L5Q A;  3C1D A;  1QZX A;  3H9G A;  4LLL A;  1ZR4 A;  2OPT A;  2Q0O A;  1T0F C;  1YE9 A;  3N4M A;  4IVZ A;  4ZYH A;  2JUG A;  4A0X A;  3ZMU A;  2LY2 A;  5BNG A;  3QYF A;  1FPQ A;  1QP4 A;  1RUO A;  3J81 Z;  1ERD A;  4EV0 A;  1RC9 A;  3MAJ A;  4JX5 A;  1HDD C;  3A0H C;  3K9T A;  3OIQ A;  1PUE E;  2V7F A;  1BR4 A;  2EJR A;  4LIU A;  2GBY A;  2P6T A;  1GUU A;  3CTA A;  3K69 A;  1WGX A;  3FF5 A;  4L5J A;  2XGX A;  1USS A;  4A6D A;  2JK3 A;  4CA0 A;  1H9G A;  4U0W A;  4BUP A;  4HF1 A;  1E0E A;  2ZCW A;  3J81 K;  4XON A;  5LLQ A;  2VOO A;  2IGM A;  1QU3 A;  4DZP A;  2DLL A;  5E1X A;  1B8I B;  5E1Z B;  4ZTJ A;  1Q1V A;  2GZU A;  2LKS A;  2K9N A;  2KRC A;  2DK8 A;  3K4C A;  3JSP A;  1OFC X;  2LYL A;  3CUQ A;  2BXZ A;  1MBK A;  2IJL A;  5HLH A;  3W2A A;  1POU A;  4PZJ A;  1FC3 A;  3ZOB A;  1ZVV A;  2DTZ A;  2GAU A;  4LJZ F;  2YX4 A;  4C2T A;  3R61 A;  4J19 A;  3CJN A;  3RYP A;  2PN6 A;  3RKQ A;  3S14 J;  4BY1 J;  4ENJ A;  2XCJ A;  1W5S A;  3A01 A;  3E5U A;  1O3S A;  2XAJ A;  4A2U A;  5LD2 C;  3BR3 A;  3CQZ J;  4UVB A;  3WE3 A;  1X1A A;  3ASN H;  3W3C A;  1D3Y A;  2DMN A;  5F0C A;  4A3M J;  4MNU A;  2L01 A;  3EPZ A;  3KIO A;  5IP7 J;  5EF6 A;  4MFD A;  5K98 B;  1QQI A;  4BJT A;  4DE9 A;  4RS8 A;  5H20 A;  4PJJ A;  3TP3 A;  4OB4 A;  2GRM A;  1SFO J;  3MD2 A;  2EPF A;  4M3G A;  5EYR A;  5LFA A;  2O0Y A;  1IXC A;  2BBY A;  2FXA A;  4CYC A;  3FX3 A;  2UUZ A;  5IT3 A;  2R7Z J;  5DRY A;  3VB2 A;  3HOY J;  2HQ5 A;  2KIS A;  2HVR A;  1UFM A;  2CUF A;  2EV0 A;  2L2O A;  3GLL A;  4H4K C;  4X1E A;  2W82 A;  2CUJ A;  2LMD A;  2XUB A;  2IV1 A;  3S2W A;  2DFH A;  2B0L A;  3RZD J;  1JJ6 C;  4OAY A;  2Q2E A;  3OQM A;  1MMN A;  1XTA A;  2CW0 F;  4BJ5 C;  5HS7 A;  3E97 A;  1W4M A;  2O61 A;  2LOO A;  2FFH A;  1U5T A;  3S15 J;  4WK8 F;  1ZYR F;  1G8X A;  2EQR A;  2LBF B;  4A0Y A;  2QWW A;  2BHZ A;  3M8F A;  1O3R A;  2R7X A;  2L49 A;  4BXU A;  1IN4 A;  4FTH A;  3O8G A;  2GOX B;  3A0B C;  5LBQ A;  1OLT A;  3JRB A;  4P5O A;  1W0U A;  2MD5 A;  2GM4 A;  4GRI A;  1BDH A;  4UVC A;  1ZRC A;  2X0L A;  3T5X A;  4IRG A;  1H9T A;  1UJ8 A;  4YIF A;  2CRO A;  4FX4 A;  3HIF A;  2B7E A;  2VEO A;  4J01 A;  1X4P A;  3VFZ A;  3CCV I;  1Z0X A;  3H35 A;  4EGY A;  5GAH J;  3LAP A;  4FQG A;  1YRN B;  5HDK A;  1FIA A;  1MGT A;  2LKP A;  4EJV A;  3JTG A;  1J7K A;  3M4O J;  1EJ9 A;  5DV5 A;  2RC4 A;  3CUO A;  3GUU A;  4D0P A;  4U0V A;  2QA4 I;  3ZMD A;  2ACJ A;  4RM2 A;  2HIN A;  2O8K A;  1R63 A;  2VXZ A;  2ODR D;  4O8B A;  3DEE A;  3TOB A;  1ZZB A;  1SFE A;  1RIO H;  2EWN A;  1E3P A;  4GO1 A;  2N8G A;  5HS9 A;  1JKO C;  2DA6 A;  4JCY A;  3X2Q H;  1LE8 A;  4NDW A;  1Y39 A;  1NTC A;  1IN7 A;  1X1B A;  3K1N A;  2JPC A;  2QKM B;  5LGU A;  3WG7 H;  3HSF A;  5L3D A;  2KZ8 A;  1ETX A;  3BZ6 A;  2PE5 A;  3O6B B;  4PGH A;  2Y75 A;  2ZKZ A;  5HDN A;  2VKD A;  3IH2 A;  3EUH A;  2VBY A;  5IY5 H;  1Y7Y A;  3KL4 A;  3BR1 A;  1OPC A;  1FOW A;  3LL7 A;  1TQI A;  2BVM A;  3RDI A;  1LCD A;  1F4K A;  1YTY A;  3CJQ B;  5DD8 A;  4CGZ A;  4F7Z A;  4UNO A;  1ZH5 A;  3HOZ J;  3J80 K;  2YU3 A;  3H5R A;  2W24 A;  3OYF A;  4U88 A;  3H3V K;  5HS8 A;  3GFJ A;  4EKG A;  2R5Z B;  5LHI A;  3HOS A;  4FCY A;  4YBA A;  2R7D A;  4KN7 X;  5FKL A;  1K83 J;  4ZDL A;  3I0T A;  2R7U A;  2X6Y A;  2MC3 A;  1FSH A;  4EZI A;  3LSM A;  4CCL A;  5K7H A;  2OZU A;  3SDB A;  3RZO J;  3W6V A;  2MYS A;  1HOM A;  3U1K A;  4FHT A;  1FY7 A;  1FIP A;  1AU7 A;  2Y30 A;  1N75 A;  3L2U A;  3J7Y J;  1KQ8 A;  3LA7 A;  2X6W A;  1GV2 A;  1ON2 A;  3DFG A;  5CVI A;  1VQK I;  1W36 C;  2BNM A;  1HC8 A;  1WET A;  5EEH A;  2MC4 A;  1BIA A;  4U7D A;  1UZC A;  4B1R A;  4KJZ A;  1A36 A;  2BNO A;  2IVQ A;  1XPX A;  2VPL A;  1BBY A;  2YBD A;  3IVP A;  3OYE A;  4BQQ A;  3QWG A;  2V9K A;  3OIP A;  3GTO J;  1OMI A;  4R1H A;  3MMY B;  4A5M A;  1ZK8 A;  2A5Y B;  1VQ5 I;  4P55 A;  3FXO A;  4BQN A;  2NNN A;  2JSC A;  1XDU A;  4E6K G;  5C4J J;  1K4T A;  1YJW I;  3AL0 B;  3NZL A;  3LFP A;  3SQN A;  3T1B A;  4LLG F;  1J2X A;  2HYF A;  2XPU A;  5GAG J;  2XF6 A;  2ZNY A;  3IKV A;  1YHQ I;  4RMN A;  4Z5H A;  3IKT A;  2ZJR F;  4P9F A;  2ZJ2 A;  4BQA A;  1MKM A;  4XSZ F;  3G0T A;  4KT6 A;  1VZ0 A;  2UWM A;  1AOY A;  3S1M J;  2O4A A;  1SFK A;  2BV6 A;  2XGE A;  3ZQQ A;  4XLF A;  2PJR A;  4M6Y A;  2EFQ A;  4BH9 A;  3GBF A;  3H36 A;  4CCJ A;  4ER0 A;  2MA3 A;  2XAF A;  3FIS A;  3SFI A;  5ICC A;  2K9L A;  4M9X A;  1K6O A;  5AIP A;  2MLG A;  1HW2 A;  2AW6 A;  1BN5 A;  4EK9 A;  3G7D A;  1J59 A;  2L7K A;  1AA7 A;  5LEK A;  1U8R A;  5FFX A;  1WH5 A;  1Y8R B;  4LK0 F;  2FML A;  3KFW X;  1W36 D;  2P5K A;  1GHC A;  1LDK B;  1BJA A;  3K4K A;  3RKW A;  3H5T A;  1UMQ A;  5TJJ A;  3DKW A;  2DMP A;  2VKH A;  1STZ A;  1ZZC A;  3DKY A;  5HVQ C;  2XJ3 A;  4ASN A;  4E7L A;  1N25 A;  3CP8 A;  3FK6 A;  4CYC B;  1KU3 A;  2KKO A;  4EM0 B;  5E79 C;  3OV8 A;  3HHG A;  3G1O A;  2D2W A;  2ME6 A;  4BXF A;  1LE8 B;  1LQC A;  2KL4 A;  3KZI C;  2KEJ A;  2WUS R;  5TIS C;  2VON A;  1W7P B;  1WJB A;  3REO A;  1EF4 A;  1VQM I;  2LYQ A;  1R1V A;  3I71 A;  1TNS A;  4E7H A;  5IYD J;  2EA2 A;  2HS5 A;  2VBX A;  4Z6Y A;  3QRF F;  4WVL A;  2AXL A;  1I1G A;  1P4A A;  3E6C C;  1NER A;  3B02 A;  5E18 F;  2HKX A;  4E7S A;  1TWG J;  4MFE A;  1R58 A;  2XVC A;  1IGN A;  4C2M J;  1ON1 A;  2GA2 A;  4M3D A;  3HRT A;  2ZO4 A;  4I0A A;  1G59 A;  5B66 C;  2R7R A;  1ZGJ A;  3CCS I;  1CGP A;  4CHU A;  2KIM A;  3R0A A;  4EQQ A;  4KIS A;  2FBK A;  2HNH A;  5DYM A;  4Y13 A;  4A3J J;  4PU7 A;  2DQR A;  3ZKC A;  4C3I J;  2HFH A;  4XM3 A;  3G73 A;  4V2G A;  2NNY A;  3RPQ A;  4CCM A;  2VKV A;  5BQT A;  3R0J A;  4HW0 A;  4CUG A;  3GTL J;  2KFD A;  3L09 A;  4KA4 A;  3F8B A;  1DW9 A;  1POG A;  4HX4 A;  5EGO B;  2K7L A;  2UXN A;  5D4R A;  2R7V A;  2RQP A;  5IT9 Z;  2NAZ A;  4L9N A;  3OS0 A;  1T39 A;  4F52 A;  4S04 A;  1ADR A;  1SMT A;  1U5T B;  2RQQ A;  4XKW A;  5FKM A;  4EM1 A;  4HDU A;  3OOP A;  1W7P D;  2NVY J;  4LB6 B;  2WY8 Q;  2XGC A;  2WB1 N;  2MG4 A;  1NH3 A;  1K78 B;  4XLH A;  3JRE A;  3HKZ N;  1HBX G;  2MAB A;  3F22 A;  1R5G A;  2VXD A;  2GZW A;  3K2A A;  5M5X J;  2R3S A;  1D8K A;  2DA4 A;  2OC6 A;  2M9H A;  2DFI A;  4Y33 A;  1FBQ A;  3TKY A;  1ZGA A;  3B7H A;  2FF4 A;  3WOD F;  4A3K J;  4Q48 A;  2VT2 A;  1TQP A;  2E1M C;  2KIQ A;  2CFX A;  3PFI A;  5LRR A;  3I59 B;  2LR8 A;  2A69 F;  3FXQ A;  1YO5 C;  2BY1 A;  2R63 A;  2EK5 A;  4IOC F;  5K5Q A;  3DPT A;  3PFY A;  3A02 A;  2LRE A;  3KEQ A;  1XMK A;  2HZD A;  2XGD A;  1JFS A;  3KP7 A;  1IRG A;  3GWZ A;  1Z91 A;  5FRN A;  2R93 J;  1KON A;  2UZK A;  1IC8 A;  3FMY A;  1X3W B;  3HJE A;  4A3E J;  3OYA A;  2L9S A;  3TO7 A;  5FD5 A;  4V19 K;  1NW3 A;  2F5E A;  3PNV A;  4CO8 A;  2VQL A;  4HRA A;  1FX7 A;  3BJ6 A;  3CCE I;  4LLN A;  3KYC B;  3QOD A;  5DM6 F;  3SJM A;  2F4M B;  3CP2 A;  5E3N A;  3SHF A;  1Z67 A;  3C7J A;  3EUH C;  1L0O C;  3E6D A;  1ITY A;  3A03 A;  4I76 A;  3VYU B;  1ZPQ A;  5HOO A;  2CO5 A;  2WIU B;  5ILV A;  1ETW A;  1S8N A;  2P4W A;  1X2N A;  4M3E A;  4L9T A;  4I6Z A;  4HV5 A;  2YR2 A;  4BQO A;  5IOZ A;  1TP4 A;  1G2H A;  1REP C;  5H6R A;  4PSX A;  1VQ6 I;  3M1E A;  2EZI A;  1NG7 A;  2FQ3 A;  3ROU A;  5J8F A;  4PJM A;  4J1W A;  1MNM C;  3KET A;  4D5C A;  3GLX A;  2FNA A;  3BQZ A;  4Y7N J;  5EZG A;  4QWQ A;  4AUX A;  2HFZ A;  5DTQ A;  1A6I A;  1FWZ A;  2VLA A;  2ZXH A;  2CV0 A;  2PJP A;  1FLI A;  4XRM A;  1D1A A;  1Y56 A;  4UUS A;  4RB1 A;  2P7C B;  1X58 A;  4BBS J;  4I02 A;  4X4H A;  4A3L J;  2ADU A;  2BXY A;  2ELJ A;  2EFO A;  2XF7 A;  2DMQ A;  2Z9O A;  1FYM A;  2H94 A;  4XOP A;  2BW3 A;  3GCM A;  4A12 A;  3HZJ A;  4G9Y A;  1S7A A;  3L2R A;  2KLO A;  2KP6 A;  1JTY A;  2CYY A;  1TWF J;  2ME0 A;  4PUS A;  1UXC A;  1MD0 A;  2KZV A;  4GYG A;  2LYP A;  4HRI A;  3HPH A;  3BZK A;  4HYE A;  3WTU C;  3BZC A;  2E19 A;  1KYZ A;  5F1J A;  4LD5 A;  1BL0 A;  4I99 C;  3JAM K;  5HLT A;  1IRZ A;  1SD6 A;  2HCN A;  4PSW A;  4IOA F;  1T98 A;  2LDU A;  3RIR A;  2O3F A;  2QQ9 A;  1BOA A;  5TRD A;  2EFP A;  2GOM A;  1UB9 A;  2PUG A;  1YS6 A;  3W2V A;  2QLZ A;  3EET A;  4AIK A;  3ECH A;  1Z6R A;  4RB3 C;  2AUW A;  4MTE A;  3NAR A;  4F55 A;  1H88 C;  2DA1 A;  1PUF A;  3WTY C;  1JHH A;  2QBY B;  5CQG A;  3BG7 A;  1QPZ A;  2GQQ A;  1VI0 A;  1SD4 A;  5DS9 A;  1WFX A;  2FD5 A;  2J5P A;  2ICP A;  2QBY A;  5CLS A;  4QLC U;  1XWR A;  5IP9 J;  2ESN A;  3FKI J;  2WAQ A;  3UWP A;  1BI2 A;  3FYM A;  4QSH A;  1R69 A;  1TWC J;  2K85 A;  1TW2 A;  3HM5 A;  2DYS H;  4FE7 A;  3GFM A;  3WGI A;  2CV1 A;  1D0X A;  3DP7 A;  2P5L C;  2NXN B;  2GRL A;  1QVT A;  5A2Q Z;  5H2F C;  5BPD A;  2I8D A;  2EB7 A;  2XKO A;  3LMM A;  4I7H A;  3V8K A;  5FB2 A;  2MGQ A;  3QPH A;  5M3M J;  2Z2S B;  5J1U A;  1R71 A;  3TOA A;  3ECO A;  2IU7 A;  4HOB A;  2CH0 A;  3W6K B;  3D5S C;  1ETY A;  1Y0U A;  5HDG A;  2F6C A;  2E5Z A;  5CKT A;  3J7A O;  3FMQ A;  5IYC J;  2Y69 H;  3GTG J;  1SFX A;  1Y1W J;  1FEX A;  2LRD A;  3OR1 C;  4LMY A;  4ZDP A;  3V8J A;  2EIL H;  1ZRD A;  3FXK A;  2FOK A;  2CS3 A;  3DTK A;  3I9V 2;  5GAG i;  2KHM A;  4NNJ A;  3I64 A;  2QQB A;  4ON0 A;  4DBQ A;  5M5Y J;  3T0Y A;  2JVH A;  3DEU A;  3DTE A;  4R8H A;  5CVJ A;  2R7T A;  2L8N A;  4FX0 A;  4UV8 A;  4AVZ A;  2E2I J;  1UHW A;  1XGM A;  1KZH A;  1D5Y A;  2STW A;  3S3O A;  4G6T B;  1ZG1 A;  4MHG A;  3A9Z A;  1JKR C;  1ZTR A;  3COA C;  3DBL B;  2HQR A;  2LSO A;  3R6S A;  3ZQ7 A;  4ZZD A;  2F5F A;  2FE3 A;  2LLV A;  3GO5 A;  1YQA A;  3V42 A;  5D5X B;  3FM3 A;  3IV5 A;  3MKY B;  1QGP A;  1K78 A;  4HLY A;  5L3E A;  4OIR F;  1BR2 A;  1WHU A;  5D8K B;  3IRR A;  4ESF A;  2B9S A;  3OL4 A;  2NRA C;  1T56 A;  4AM3 A;  2CQX A;  4DYQ A;  4IO9 F;  3VDX A;  2W00 A;  4TV7 A;  5DEQ A;  1J0R A;  1YSE A;  2RKH A;  3BG9 A;  3FDY A;  3V4G A;  5J4Y A;  2M87 A;  5FRO A;  5L3B A;  1IRX A;  3HTS B;  3ZMZ A;  4XN0 A;  4X4F A;  3EUA A;  2M0M A;  1XGS A;  1JI8 A;  4A0Z A;  4UXN A;  3F72 A;  1JT0 A;  5DUI A;  3WTV C;  1PRV A;  5D5W B;  1VQN I;  3G71 I;  4A3I J;  1MJB A;  4JCX A;  2AQE A;  3HB9 A;  3PQJ A;  4IRH A;  1IO2 A;  4Z59 A;  3ZHI A;  1FMW A;  1ZLK A;  4EQZ A;  1WPK A;  3VSK A;  1V55 H;  1XN7 A;  3NRV A;  2I10 A;  3KP5 A;  3KZY A;  3E7L A;  4BHP A;  2E5N A;  2W4S A;  2ZJQ F;  1XSV A;  3TED A;  4B44 A;  2H27 A;  3M8J A;  3LSI A;  2LNM A;  3QP6 A;  4HQE A;  2L7M P;  2M7A A;  2XI8 A;  4N0B A;  3K4J A;  1UEL B;  4OAZ A;  2BE5 F;  5AIQ A;  2PJR B;  4M3F A;  5CPR B;  5B1B H;  5C44 J;  1FP2 A;  1MMG A;  1N77 A;  3RKX A;  1WJA A;  3RPU D;  3BTC A;  1S7E A;  1HST A;  5DUK A;  2BZT A;  1HDP A;  1U2Z A;  3S2H J;  4I98 B;  2O03 A;  3TGN A;  2WA0 A;  2YU9 J;  1JGS A;  3IH4 A;  3SCG A;  4KIF A;  5D8L B;  5J8C A;  1YX5 A;  1JKP C;  2DPU A;  2P7V B;  4XSX F;  2ISZ A;  3RPU A;  3OR2 C;  5A7L A;  4F3Q A;  2H6C A;  3A01 B;  3VK0 A;  1HKS A;  3RCO A;  4FAS D;  3MQ0 A;  3ME5 A;  4E7K A;  1KU9 A;  4XL9 A;  3CLQ A;  3OYK A;  2EA4 A;  4BYY A;  2ZFW A;  2JVG A;  2L54 A;  5GAE J;  5C4X J;  4XNF A;  1R00 A;  2CSF A;  2STT A;  3HOW J;  2IXS A;  4CCO A;  4QIW N;  3L2C A;  2LYS A;  2PXP A;  2JJ7 A;  3GFL A;  3QWL A;  1K79 A;  3KP2 A;  2VBW A;  3MVP A;  3BTJ A;  1ZKG A;  1ZZ9 A;  2KQR A;  4I6U A;  2PXF A;  2JA5 J;  1B1B A;  1Z21 A;  2IA1 A;  1O7L A;  3BT9 A;  3CF5 F;  3VPR A;  1G3T A;  1G3Y A;  3ABT A;  3EYY A;  4B48 A;  2R7S A;  5GPC A;  3HOU J;  1EH7 A;  5CVV A;  4YG4 A;  2DMT A;  3QU3 A;  1DU6 A;  4NC8 A;  3F8F A;  3GN5 B;  4EEF G;  2IS6 A;  2YPR A;  5C3E J;  1T08 B;  3RKY A;  3GZD C;  4XKB A;  2F5D A;  1Z7L A;  4IF4 A;  3P5J A;  2HSG A;  2Z3Y A;  3F52 A;  1SFU A;  4G6D A;  3TDU C;  3J7Z I;  3BPX A;  2MSY A;  4IA8 A;  4XK4 A;  1T0F A;  1JUP A;  2M4K A;  3CMA I;  1S29 A;  1TW3 A;  1KU2 A;  1XMA A;  3KE2 A;  1LCC A;  3QQA A;  4M9S A;  2XAH A;  2R92 J;  3K1M A;  3Q3S A;  3QYB A;  4OMZ A;  5K1Y A;  2DT6 A;  2Z1D A;  3U3W A;  3K70 C;  3JTH A;  2DT5 A;  5E3M A;  1DPR A;  2XPV A;  3E3V A;  1EH6 A;  4PJN A;  3F9K A;  3OWQ A;  2JN6 A;  1R6R A;  5J1R A;  3CCY A;  2DBB A;  3KX2 A;  3LQR A;  2R0Q C;  3KPH A;  1Y6I A;  2OBP A;  2A6T A;  5F0H A;  1E2X A;  1ENH A;  2O5R A;  3HRM A;  4BE0 A;  3CD6 I;  1WJC A;  4M74 A;  2WV1 A;  1R36 A;  4F8D A;  3DLL F;  3HSE A;  3OYB A;  1YW7 A;  2HR3 A;  3HGG A;  2BY0 A;  1FJL A;  3TMO A;  2EV6 A;  5ICF A;  3CC2 I;  3L7W A;  1GV5 A;  4RGR A;  3M1C A;  4G94 A;  1HSJ A;  2M3A A;  3VYS B;  3FBN B;  4PU3 C;  1P92 A;  3WTW C;  1TT0 A;  2AWI A;  2G0E A;  3MFK A;  3S2D J;  2QQ8 A;  3F8C A;  2M8G X;  3MZY A;  2ICW G;  2PPX A;  2HKO A;  3DBH B;  5FGM A;  2RGV A;  3JR9 A;  4A3C J;  3HHH A;  3OP9 A;  3V7C A;  5HOD A;  1N78 A;  1F43 A;  4W1U A;  1Y1V J;  2Y0M A;  1IV6 A;  1Y0N A;  1I39 A;  2A5W A;  3A1Y A;  2I5U A;  4DZJ A;  3AAF A;  2KIU A;  3IH3 A;  1DU0 A;  2NS7 A;  4I2O A;  1BOB A;  1ETK A;  3CDH A;  3ESW B;  4IHX A;  4L5E A;  2VQG A;  3M7G A;  1MSF C;  3BDN A;  4HX7 A;  4ETS A;  1OCZ H;  4L18 B;  1B72 B;  1X4O A;  2PLY A;  3O2P E;  1D1C A;  4ER6 A;  1AHD P;  1FYL A;  1NK3 P;  4I8T A;  1FP1 D;  3DU5 A;  2DT7 B;  2VOD A;  2QQA A;  4GCV A;  3DEW A;  2QSG X;  5ICE A;  3ZQI A;  2WAE A;  1B9N A;  1W7P A;  3HSR A;  4DYC A;  2CRG A;  4MQV A;  1WH8 A;  4RGU A;  4YG1 A;  3WE2 A;  1ZG5 A;  4MCT A;  4JP0 A;  3AL0 C;  3NWT A;  3PNT A;  2Q8K A;  4DBR A;  2H09 A;  5KAI C;  5LHG A;  2LCV A;  3GZC A;  1NG6 A;  5FKK A;  2A61 A;  5D5U B;  2OTL I;  2FNP A;  2WBM A;  1PVE A;  2FJR A;  2JQE A;  3H0G J;  2EBY A;  3F3X A;  1T8I A;  2EFW A;  1U5T C;  3DBR B;  1HQC A;  1XDS A;  3JRC A;  1DDN A;  2P0W A;  4EAT A;  4WXD A;  2LLK A;  1V54 H;  2IGN A;  3HYI A;  3MWM A;  2XAS A;  4IPA A;  3K4B A;  5BOX A;  3QPS A;  1YFH A;  1OCP A;  2IA2 A;  4OIP F;  1B9M A;  3I4P A;  4ZYG A;  1ETO A;  3GME A;  4RA2 A;  2JMW A;  4XID A;  2ZME B;  2W25 A;  4M9Z A;  4PGG A;  3PO3 J;  3BRO A;  2RV8 A;  2HGC A;  1X19 A;  2QVO A;  1DP7 P;  3WGH A;  1MBE A;  1FZP B;  1VQ7 I;  2JA2 A;  2OR1 L;  3MKL A;  1RPE L;  2VL8 A;  2FU4 A;  2ZME C;  4C3H J;  4YIR X;  1R9T J;  1D0Y A;  2HCS A;  4HDV A;  3C3W A;  5JVG F;  2UXX A;  1RZS A;  4UB6 C;  3F0C A;  2WV0 A;  2X85 A;  2V6C A;  3BLY A;  4N9I A;  3OYL A;  3ZP5 A;  1MDM A;  4HF2 A;  1EV7 A;  2VOP A;  3OQN A;  1EFA A;  4OU0 A;  1J09 A;  3H9J A;  2P8T A;  2VC0 A;  4A3B J;  3DV8 A;  4RBO A;  5IT9 K;  2MH9 A;  1IV8 A;  2WB1 A;  3ZMT A;  2PMU A;  4Y17 A;  4K2E A;  2EIM H;  2M0C A;  3FWE A;  3BCB A;  4FN3 A;  4P9U A;  2D1H A;  1F36 A;  4HLX A;  2VJ5 A;  3ISP A;  4XR6 A;  4B09 A;  3SCH A;  4JX6 A;  5ERI A;  3F21 A;  3VWS A;  1YIT I;  2PUB A;  4G7Z F;  3F6O A;  2EV5 A;  2W85 A;  1SQ8 A;  5KAF C;  2BY3 A;  1UG0 A;  2LVS A;  4ZJZ A;  1IG7 A;  3Q9S A;  1U0J A;  1YX3 A;  1DP3 A;  3JXC L;  4YEL A;  2OFY A;  2HPI A;  2H1L A;  1EA3 A;  2NVQ J;  3A4C A;  1T2K A;  1CF7 B;  2H8W A;  2JA8 J;  2EIK H;  2PUF A;  4F92 B;  3CDI A;  3V7S A;  5EGO A;  3KCC A;  1EH8 A;  1JH9 A;  3CJR B;  4X4I A;  3SXY A;  1I6H J;  3QP5 A;  1U78 A;  1FYK A;  2HXI A;  3LQX A;  3R1F A;  1Z3X A;  2K9M A;  5DM7 F;  3N97 A;  2M30 A;  1JKQ C;  1RZR D;  4MCX A;  3TFL A;  5B1A H;  5DDG A;  3WTX C;  2LY9 A;  1ETV A;  5DSX A;  1T33 A;  2Y9Z A;  2ECC A;  1U9O A;  1XD7 A;  1PYV A;  3TQN A;  1I3A A;  1HLV A;  2XHK A;  4RGX A;  3J80 Z;  4RDU A;  5M3F J;  2Y0S A;  2DAO A;  2R7Q A;  2YX7 A;  4MO7 A;  1JWL A;  5B3S H;  1TBX A;  2K86 A;  3I3L A;  2WAF A;  1TQM A;  4PJL A;  3PL8 A;  4XQF A;  3I59 A;  1ZZ6 A;  3CCQ I;  2JZY A;  2X51 A;  4ZC3 A;  3DLA A;  1D8J A;  1LVK A;  3KJX A;  4EJU A;  1PP8 F;  2ZFU A;  1YS7 A;  4BHB A;  4Q5S F;  3GF2 A;  3KP4 A;  3F51 A;  1PNR A;  2LYC A;  3CCM I;  3BDD A;  1OIS A;  1MH4 A;  1XC5 A;  3LSG A;  3IL2 A;  4WX9 A;  2LF7 A;  4HSR A;  1ZAR A;  2HOA A;  1QRY A;  4LB5 A;  2KT0 A;  5CQE A;  1Z9C A;  1K6Y A;  2E7W A;  2CUE A;  1AKH B;  3DQV C;  1OYI A;  2JCG A;  1R49 A;  2Q1Z B;  3QF3 A;  2HOE A;  3AKZ A;  1VQO I;  2ESH A;  1ZAO A;  1S5L C;  1RKT A;  2PI0 A;  1B8I A;  2VB6 A;  4EGZ A;  1ZRE A;  5E1W A;  3KEO A;  2CQQ A;  3DM5 A;  2TDX A;  4KDP A;  1SAN A;  3HPG A;  4CZZ A;  1QP7 A;  4OIN F;  4I6T A;  1KA8 A;  5CVR A;  1RZ4 A;  4JQF A;  3VOE A;  3EUS A;  2VQH A;  5E3L A;  1FSE A;  4BS9 A;  4MLO A;  4AIJ A;  4LIV A;  4Q4Z F;  4PDK A;  3GZ6 A;  1K7A A;  4DW6 A;  4NHJ A;  2QSH X;  3S1R J;  4P96 A;  1DPU A;  3IAS 2;  3GTM J;  3A9Y A;  2M2E A;  1A04 A;  1TT5 B;  4G8X A;  1FOY A;  1PRA A;  3VOD A;  3F6W A;  4BBR J;  3JXB C;  2OU2 A;  3I4N J;  1ODD A;  4BE1 A;  2K27 A;  2A07 F;  3CRO L;  3JXD L;  3SZG A;  1TLH B;  2VAS A;  3TDZ C;  3ZPX A;  5HNH A;  3KP6 A;  2PXB A;  3OWT A;  1SMY F;  3F23 A;  4ABZ A;  1Y8Q B;  2HPM A;  2NOJ B;  1E3H A;  3NEU A;  1WWX A;  3QYE A;  2PUA A;  4M6X A;  1IZ1 A;  1IN8 A;  2OQR A;  2X1C A;  4R79 A;  3MZH A;  1RUN A;  3S8P A;  2HYG D;  3OIO A;  1T6S A;  2DJN A;  4C30 A;  3LSR A;  3ZQL A;  2VBZ A;  4KIC A;  2KJC A;  3U2R A;  1OCO H;  3ABK H;  3LOC A;  3S16 J;  2WAD A;  3I55 I;  3JRD A;  1WH7 A;  2H6B A;  3W6J B;  3QOW A;  2L3D A;  2BEO A;  2QCO A;  3AG2 H;  4ZZL A;  3SZT A;  4IRI A;  1S9H A;  3OYD A;  4ZTF A;  4V2F A;  3JCU C;  3TW7 A;  4Y52 J;  1RRJ A;  2DA7 A;  5DT2 A;  3BPV A;  1OCT C;  3ELK A;  1WJF A;  2LK2 A;  2L9N A;  4YII A;  3G2B A;  3QOP A;  3LFU A;  5KHD A;  3D0S A;  2LH9 A;  3M9A A;  5KCM A;  2R5Y B;  1A5J A;  1IUY A;  3H3U A;  2EWT A;  1V5F A;  5FLX K;  2V4J C;  3PIP F;  5E3O A;  3S8Q A;  3CLC A;  4U87 A;  4ENK A;  2DN0 A;  9ANT A;  4PFO A;  3QFI A;  4II3 A;  4CCN A;  1HXD A;  1MDM B;  2J5O A;  2P81 A;  2LC2 A;  2E1M B;  2IW5 A;  2KPJ A;  4HF0 A;  2RNJ A;  4ER5 A;  4OWR B;  3S93 A;  1SVL A;  3FXR A;  4BL0 B;  1S3J A;  2E71 A;  2V1X A;  4WF2 A;  5JHF A;  2XRO A;  2KZG A;  5CYV A;  3M9L A;  2IPQ X;  3C2H A;  1I1S A;  1V4R A;  4DQ2 A;  2K4B A;  3GFI A;  2JT1 A;  2F2E A;  2LYJ A;  4LIT A;  3BC8 A;  3CLO A;  1QO0 D;  2JUC A;  3HG9 A;  2L1P A;  1F1Z A;  1X3Z B;  2FBI A;  1JGG A;  2VUM J;  5AON A;  2KEK A;  1ZHF A;  4NQW B;  4KN4 X;  1RZR A;  3OYJ A;  1O4X A;  1I50 J;  3PSF A;  4G7O F;  4Z5D A;  1V3F A;  4XRF A;  1MMD A;  4GYI A;  2WTE A;  3OOU A;  1HQ1 A;  4ENM A;  4X4E A;  1S72 I;  2QUF A;  2HWV A;  4L9V A;  1FTT A;  2O7O A;  1J5Y A;  2GXG A;  3P9K A;  3I56 I;  1SAX A;  4YRV A;  3C18 A;  4LG0 A;  5JFR A;  1BC7 C;  3WGG A;  3K6G A;  3KXA A;  1IUF A;  1H8A C;  3UKG A;  4WXC A;  2NVX J;  3PQK A;  4B3X A;  4OBM A;  4M6V A;  4RM3 A;  1ZS4 A;  1H89 C;  1FOX A;  4I09 A;  4I6R A;  1OR7 A;  2E36 A;  4F93 B;  3GZD A;  2K02 A;  2XAQ A;  3ZN1 A;  2Y9Y A;  3L00 A;  2K3F A;  4XRS G;  1AWC A;  1TWH J;  1BA5 A;  3UFD A;  1XMX A;  4UY8 I;  4Q2J A;  1ZZ8 A;  3EYI A;  1APL C;  5JUW A;  3LSP A;  1XSX A;  1IAW A;  5EEA A;  2R7F A;  3OSG A;  2PBI A;  3Q0V A;  3QOX A;  5J40 A;  1X57 A;  3EDP A;  2LY1 A;  3FYA A;  5GTH C;  1E3O C;  3O9X A;  1MBJ A;  2XAG A;  3GN5 A;  1BDI A;  1LMB 3;  2XXQ A;  3SEQ A;  4RAZ A;  2KDZ A;  4MIM A;  1HCR A;  4PCQ A;  4CXF A;  2CGP A;  2CFO A;  1LEA A;  2Z33 A;  1Z05 A;  2IS2 A;  3HTU A;  1GXP A;  1BI0 A;  2COB A;  2M45 A;  4HBL A;  2DA3 A;  1XCV A;  2HEO A;  2BY2 A;  2UV1 A;  2C6Y A;  4I0B A;  3HUG A;  5DRT A;  2DFF A;  2QSF X;  2OZ6 A;  2JA6 J;  4DNC A;  2EFN A;  4HNT A;  5JLW A;  2CUZ A;  1DGW Y;  3DWL E;  3TBI A;  5EG0 A;  5JVT A;  4FE4 A;  3M07 A;  2FSW A;  5F08 A;  2GWR A;  3C2G A;  3I58 A;  3IP4 B;  3M8E A;  3TP0 A;  3I53 A;  1YIJ I;  3UNG C;  1SC7 A;  6PAX A;  2WWY A;  5A2Q K;  4LK1 F;  4UVA A;  1P9Q C;  2PIJ A;  1TWA J;  3E0J B;  4HEA 2;  3C2B A;  2XC7 A;  2PXD A;  3LST A;  2DTR A;  2FA5 A;  3TRB A;  4YG2 F;  5LRS A;  4DIQ A;  1GXQ A;  2R5Y A;  2WY7 Q;  3CCU I;  1H0M A;  2CWE A;  1IN6 A;  1AKH A;  3LA2 A;  3H0D A;  5HLI A;  1WJD A;  4Z58 A;  4D7N A;  2M5W A;  3JRF A;  4HX8 A;  4P1W A;  1LKX A;  2LF8 A;  4ENN A;  2CU7 A;  2K9Q A;  2L7Z A;  3JRA A;  3BCA A;  1ETQ A;  2DK5 A;  2L9V A;  4OMY A;  4HA8 A;  1R5I D;  3FXL A;  2PFB A;  5FRM A;  4IVN A;  3DCF A;  5E20 A;  3CO7 C;  2HQA A;  2AS5 F;  1VPW A;  4KMF A;  3K0L A;  4AWX B;  4JBA A;  1MBG A;  1QA6 A;  4OIO F;  4IWR A;  3HEF A;  3FXM A;  3S17 J;  2XSJ C;  4EM2 A;  3HDD A;  3T8T A;  3JRI A;  3ZMV A;  1MMS A;  4IZZ A;  3NAU A;  2PXT A;  1ZAY A;  2ZNZ A;  1MW7 A;  1R23 A;  3PSI A;  3TO6 A;  3Q0W A;  4MGR A;  4HZF A;  2B5A A;  2BJC A;  5F1R A;  1PUF B;  4NUB A;  5M5W J;  4N4N B;  4PK4 A;  3QPL A;  3ZN0 A;  3K4N A;  1MJ9 A;  3F8M A;  3G3Z A;  2NYX A;  3K7A J;  2V26 A;  5DCM A;  3HOX J;  3PO2 J;  2OCE A;  1ZUG A;  3JRH A;  3N05 A;  3ZCO A;  4X4B A;  2E1O A;  1TNT A;  3S32 A;  4BU2 A;  4X0G A;  2DA2 A;  2H1K A;  1Z7U A;  4JQD A;  4D1Q A;  4BE2 A;  4JK1 X;  2OJE D;  4KIG A;  4RAG A;  2XPW A;  1WKM A;  3QPT A;  4M3B A;  2NS0 A;  2HTS A;  1UTX A;  2YSR A;  5B5E C;  1F5T A;  1IW7 F;  4BXX J;  2A6E F;  3B6A A;  1Y9Q A;  1MMA A;  2MW8 A;  1W1W E;  2E7X A;  3SEZ A;  1YJ9 I;  4HG2 A;  2XKP A;  2CW8 A;  2IVM A;  3HOV J;  3K70 D;  4BY7 J;  3GTQ J;  1LFB A;  5D6E A;  2DOD A;  4AYB A;  3BG3 A;  1CF7 A;  2IS4 A;  3DPL C;  3CCL I;  3IRQ A;  4A3G J;  4AU7 A;  3WU1 B;  3L2W A;  1LUJ B;  5K5R A;  3E5X A;  2BHY A;  2PMZ A;  5JLX A;  3SZP A;  3VYT B;  2F4O B;  4BHC A;  4KT5 C;  3RQ4 A;  4FT8 A;  3P7N A;  4QPO A;  3LIS A;  1U2W A;  3H5N A;  5LGT A;  4LG3 A;  3GVA A;  4RB0 A;  1W5C C;  4IQJ A;  3BD1 A;  4DGW B;  3D5R C;  1FBS A;  3IC7 A;  2LYR A;  1XGO A;  1IXR C;  3ZHM A;  2BVL A;  1WI3 A;  2OA4 A;  5D5V B;  3ZXS A;  3U1D A;  3BTI A;  3PM1 A;  2ISY A;  2NS8 A;  5FJ8 J;  3HBL A;  2ZXW H;  1VFC A;  2V1U A;  2V1N A;  3V8L A;  1S6L A;  3ZQG A;  4A69 C;  4IQ4 A;  4E4H A;  2XIU A;  2DMU A;  3HXL A;  2J7U A;  2P6S A;  3FIW A;  4E7I A;  3GZ5 A;  3OYH A;  1LNW A;  4Q47 A;  4MEX F;  3L2Q A;  2AXT C;  4NC6 A;  3I5U A;  3A9X A;  1QQB A;  5F64 A;  4E7Z A;  1KQ0 A;  3FMR A;  1OYY A;  1QP0 A;  2HTJ A;  2XF5 A;  2ICT A;  3CES A;  4BDZ A;  1ZGW A;  2XRL A;  3S1Q J;  2OQG A;  4WCG A;  3DXJ F;  4DYR A;  3P9C A;  1JXS A;  3LSJ A;  4E70 A;  5D4S A;  2KJB A;  3FKJ A;  2W57 A;  1L3L A;  1GVD A;  2XRN A;  2Y48 A;  2VE8 A;  2X9D A;  2NVT J;  5CJ9 A;  3IUO A;  1L1M A;  1LFP A;  3VEP A;  5IPA A;  2V1D A;  3D5L A;  5H6Q A;  3WHC A;  2EZH A;  1DUL A;  2RDP A;  4B4C A;  3GEZ A;  2E35 A;  3HGY A;  2IA0 A;  2PQ8 A;  3GBG A;  3ZPL A;  3H3Z A;  4YFK F;  5K5O A;  2VQC A; 
#chains in the Genus database with same CATH homology
 2EZL A;  2LTP A;  4XIC A;  3SJM A;  3SCH A;  4JX6 A;  5E3N A;  1OJL A;  2H8R A;  1B0N A;  2PUB A;  2ECB A;  1ITY A;  4S0H B;  5IP6 A;  3A03 A;  1BW6 A;  2DA5 A;  4I76 A;  1SQ8 A;  1ZPQ A;  2WIU B;  4A3F J;  3BTL A;  1ETW A;  2LVS A;  1IG7 A;  1X2N A;  4BKX A;  4M3E A;  2JA7 J;  4GQM A;  4I6Z A;  4PU4 C;  2K40 A;  5IOZ A;  3JXC L;  1G2H A;  2OFY A;  2EZI A;  4J1W A;  2NVQ J;  1MNM C;  2L9R A;  4D5C A;  2GLO A;  2JA8 J;  2PUF A;  3BQZ A;  4FIS A;  4Y7N J;  5EZG A;  2ID3 A;  1JT6 A;  4AUX A;  1A6I A;  3D1N I;  5EGO A;  1VND A;  2PUE A;  1JH9 A;  2HI3 A;  4X4I A;  4XRM A;  2OF7 A;  1I6H J;  1TC3 C;  3Q0U A;  4UUS A;  2E2H J;  1U78 A;  1X58 A;  4BBS J;  2EBI A;  2EF8 A;  2HXI A;  3R1F A;  4X4H A;  4A3L J;  1JKQ C;  1RZR D;  4MCX A;  2DMQ A;  3L1P A;  4GHJ A;  2LY9 A;  1ETV A;  1QPI A;  1NK2 P;  1T33 A;  1U8B A;  2Y9Z A;  2JVL A;  2ECC A;  1U9O A;  2O49 A;  1HLV A;  3GTJ J;  4RDU A;  5M3F J;  1JTY A;  2ME0 A;  1TWF J;  1UXC A;  2XSD C;  4MO7 A;  2M34 A;  2Y0S N;  1JWL A;  2LYP A;  2NOG A;  1ZZ6 A;  4AYB N;  4B3A A;  2E19 A;  1ZR4 A;  2OPT A;  1GT0 C;  5F1J A;  3RZZ A;  3ZQF A;  4IVZ A;  1BL0 A;  3KJX A;  5FLV A;  1IRZ A;  3F51 A;  3MLF A;  4IHW A;  2PMZ N;  1PNR A;  1XC5 A;  1MH4 A;  3LSG A;  5BNG A;  1QP4 A;  1JUS A;  2PUG A;  2HOA A;  1QRY A;  2AHQ A;  1XS9 A;  2KT0 A;  4JX5 A;  3WHB A;  1HDD C;  2CUE A;  1AKH B;  2AUW A;  2HOT A;  2GBY A;  3NAR A;  1GUU A;  1H88 C;  2JCG A;  1WGX A;  2DA1 A;  1PUF A;  3QF3 A;  2XB5 A;  2JK3 A;  1LLI A;  1ZR2 A;  1NEQ A;  4X4D A;  1RKT A;  1QPZ A;  1CQT A;  1B8I A;  5DS9 A;  1VI0 A;  3G1L A;  2FD5 A;  2PUC A;  2IBD A;  2ICP A;  2CQQ A;  1XWR A;  2VKE A;  2WAQ N;  1SAN A;  5IP9 J;  4DZP A;  3FKI J;  1B8I B;  1QP7 A;  4I6T A;  1Q1V A;  1LMB 3;  2GZU A;  2K9N A;  3FYM A;  4QSH A;  3EUS A;  3QQ6 A;  1R69 A;  1OFC X;  1TWC J;  5E3L A;  2LYL A;  4MLO A;  1MBK A;  3HM5 A;  1ZQ3 P;  4FE7 A;  3BR2 A;  1POU A;  4DW6 A;  1LFU P;  3ZOB A;  2GRL A;  1QVT A;  2DTZ A;  3S1R J;  1ZVV A;  2O9L A;  4J19 A;  2MGQ A;  3GTM J;  5M3M J;  3RKQ A;  2M2E A;  5J1U A;  3S14 J;  3F6W A;  2FX0 A;  4BY1 J;  1PRA A;  2XCJ A;  3BQY A;  4BBR J;  3JXB C;  2X6O A;  2IU7 A;  3I4N J;  3A01 A;  1ETY A;  3CRO L;  3BR3 A;  3CQZ J;  3JXD L;  2LKX A;  3TW6 A;  5IYC J;  3GTG J;  2CJJ A;  4ABZ A;  1Y1W J;  1FEX A;  1RKW A;  2DMN A;  5F0C A;  2PUA A;  5FKO A;  3SCF A;  4A3M J;  5IP7 J;  5EF6 A;  2R5Z A;  4MFD A;  5K98 B;  3OIO A;  2DJN A;  3ZQL A;  3LSR A;  5M5Y J;  3TP3 A;  3S16 J;  4OB4 A;  3LOC A;  2GRM A;  3JRD A;  1SFO J;  1WH7 A;  2IUO A;  1UG2 A;  4M3G A;  5EYR A;  2QCO A;  4XRS A;  2L8N A;  4CYC A;  2E2I J;  4PU8 A;  2R7Z J;  3HOY J;  1MBH A;  2HQ5 A;  4V2F A;  3TW7 A;  1GDT A;  4Y52 J;  1D5Y A;  3BR5 A;  2DA7 A;  2AO9 A;  1JKR C;  1OCT C;  1ZTR A;  2CUF A;  2LK2 A;  4GFB A;  4A93 J;  3HZI B;  4X1E A;  4AC0 A;  2R5Y B;  1A5J A;  3IV5 A;  3ZQC A;  1IJW C;  2IV1 A;  2B63 J;  2EWT A;  3RZD J;  1RET A;  1JJ6 C;  1ZZ7 A;  1MBF A;  5E3O A;  3S8Q A;  3OQM A;  3CLC A;  9ANT A;  2DN0 A;  4Z5C A;  4X4C A;  2L7F P;  1T56 A;  2CQX A;  3S15 J;  5DTD A;  2EQR A;  4DYQ A;  1YSE A;  2P81 A;  2L49 A;  4FTH A;  3BG9 A;  2KPJ A;  3O8G A;  3JRB A;  1W0U A;  2GM4 A;  1BDH A;  1CJG A;  1JFT A;  2HOS A;  4X4F A;  5J1Y A;  2CRO A;  1JT0 A;  2LYJ A;  1PRV A;  1Z0X A;  2LP0 A;  4A3I J;  2KEI A;  1YRN B;  4JCX A;  1JGG A;  2VUM J;  3HB9 A;  1FIA A;  1MH3 A;  4Z59 A;  2KEK A;  3ZHI A;  2ID6 A;  4IEJ A;  1RZR A;  1O4X A;  3M4O J;  1I50 J;  1WPK A;  2HYJ A;  4Z5D A;  2I10 A;  3E7L A;  3OOU A;  2HIN A;  3TED A;  2O8K A;  1R63 A;  2A6C A;  4A3D J;  4X4E A;  4O8B A;  1PER L;  1IDZ A;  1ZZB A;  2XI8 A;  2L7M P;  2O7O A;  1FTT A;  5J3L A;  2MQK A;  3G5G A;  2BNN A;  1BJZ A;  2N8G A;  3KXA A;  1JKO C;  2DA6 A;  4JCY A;  5EDN A;  1IUF A;  1WCM J;  1LE8 A;  1H8A C;  1NTC A;  4M3F A;  3UKG A;  5C44 J;  1K61 A;  2NVX J;  4NDW A;  4IHY A;  3BTC A;  1S7E A;  4M6V A;  1ZS4 A;  1H89 C;  1HDP A;  4I6R A;  2KZ8 A;  1ETX A;  2PE5 A;  3S2H J;  5K7Z A;  1YRN A;  3IH2 A;  2YU9 J;  5IOY A;  2Y9Y A;  1Y7Y A;  3BR1 A;  3IH4 A;  4XRS G;  3SCG A;  1TWH J;  2R1J L;  1BA5 A;  3UFD A;  1LCD A;  1JKP C;  1ZZ8 A;  1APL C;  3LSP A;  5A7L A;  5EEA A;  3A01 B;  1P7I A;  2ELK A;  3OSG A;  3VK0 A;  3HOZ J;  3Q0V A;  1X57 A;  3FYA A;  2YUS A;  3H3V K;  1E3O C;  2R5Z B;  4FCY A;  1MBJ A;  3O9X A;  3GN5 A;  1JUM A;  4YBA A;  1BDI A;  5C4X J;  5FKL A;  2CSF A;  1K83 J;  2KDZ A;  4MIM A;  4D5F A;  2IAI A;  1HCR A;  3HOW J;  4QIW N;  3O8H A;  2LYS A;  2O38 A;  2JJ7 A;  3BS3 A;  2YS9 A;  4UUS B;  5K7H A;  2LFB A;  3MVP A;  3BTJ A;  1ZKG A;  5F0F A;  3W6V A;  3RZO J;  1HOM A;  1UXD A;  1ZZ9 A;  2COB A;  1FIP A;  2DA3 A;  2Y30 A;  1AU7 A;  4I6U A;  2JA5 J;  3ZQH A;  1GV2 A;  2BNM A;  3BT9 A;  2JA6 J;  1WET A;  3VPR A;  3GTP J;  1WH6 A;  5JLW A;  1U9N A;  1FTZ A;  2RAE A;  5GPC A;  3HOU J;  2VI6 A;  1P7J A;  4B1R A;  4YG4 A;  2DMT A;  3S1N J;  2BNO A;  5EG0 A;  2IVQ A;  1DU6 A;  4FE4 A;  4YG7 B;  2AXZ A;  2IVG A;  5F08 A;  3BG5 A;  3GN5 B;  4EEF G;  2EZK A;  1VF9 A;  3TP0 A;  5C3E J;  3IVP A;  1MSE C;  3GTK J;  1IDY A;  2HSG A;  2PIJ A;  3F52 A;  3QWG A;  3GTO J;  1TWA J;  2MSY A;  3C2B A;  4IA8 A;  4XK4 A;  1JUP A;  1ZK8 A;  1ORK A;  1QQA A;  1OSL A;  3M3Y J;  3TRB A;  1LCC A;  5C4J J;  3QQA A;  2R5Y A;  3LFP A;  4D7M A;  2R92 J;  1RES A;  5FLM J;  2XPU A;  4X4G A;  3Q3S A;  5F04 A;  3KZ3 A;  1AKH A;  1PRU A;  1JJ8 C;  1WIZ A;  2FQ4 A;  1RR7 A;  4Z58 A;  4Z5H A;  3G1M A;  4D7N A;  1QVU A;  3FK7 A;  2XB0 X;  3JRF A;  2W48 A;  2Y31 A;  3U3W A;  2CU7 A;  2K9Q A;  2X48 A;  4W97 A;  3SDG A;  2L7Z A;  3BR6 A;  5E3M A;  3JRA A;  1ETQ A;  2JWT A;  3S1M J;  2XPV A;  2O4A A;  2XGE A;  2JN6 A;  3GBF A;  5J1R A;  2MEZ A;  3DNV B;  3CCY A;  3FIS A;  3DCF A;  1X2L A;  3SFI A;  2R0Q C;  2AW6 A;  5F0H A;  1VPW A;  2IVB A;  1ENH A;  1MBG A;  3G7D A;  4IWR A;  2WV1 A;  3HEF A;  2L0K A;  3S17 J;  1X2M A;  1Z77 A;  4JYK A;  4F8D A;  3HDD A;  4QTR A;  1WH5 A;  2E2J J;  1BW5 A;  3JRI A;  2PUD A;  3NAU A;  3HGG A;  1FJL A;  4IHV A;  5FKN A;  1ZAY A;  3OSF A;  3Q0W A;  2AXU A;  2B5A A;  1GV5 A;  2K9S A;  2BJC A;  1DWK A;  3H5T A;  1UMQ A;  3B6C A;  1PUF B;  2QF7 A;  2DMP A;  5M5W J;  2D5V A;  1ZZC A;  3QPL A;  4PU3 C;  2VPR A;  3PO2 J;  2XJ3 A;  3K7A J;  3HOX J;  1ZUG A;  2AWI A;  2G0E A;  3S2D J;  3JRH A;  2EH3 A;  3FK6 A;  2M8G X;  4CYC B;  4X4B A;  1XG1 A;  2E1O A;  2PPX A;  1LQC A;  3G1O A;  2ME6 A;  5K7F A;  1LE8 B;  1RPW A;  2DA2 A;  3JR9 A;  2H1K A;  4A3C J;  2KEJ A;  2WUS R;  2LD5 A;  4JQD A;  3OP9 A;  5HOD A;  1F43 A;  1EF4 A;  2XPW A;  1Y1V J;  4W1U A;  1IV6 A;  2LYQ A;  5IYD J;  2FJ1 A;  2Y2Z A;  4M3B A;  2TRT A;  1NER A;  1DU0 A;  4DZJ A;  1UTX A;  3IH3 A;  2ZB9 A;  2NS7 A;  1TWG J;  4MFE A;  5F27 A;  5GP9 A;  3CMY A;  1IGN A;  4BXX J;  1B72 A;  3B6A A;  1ETK A;  4C2M J;  1Y9Q A;  1UHS A;  2MW8 A;  4M3D A;  4IHX A;  5EZH A;  4L5E A;  3CEC A;  5EG0 B;  2AXV A;  3PXP A;  1MSF C;  3BDN A;  3I4M J;  3BR0 A;  1B72 B;  4A3J J;  4PU7 A;  4YAR A;  1AHD P;  3ZKC A;  1NK3 P;  3HOV J;  4C3I J;  4I8T A;  4BY7 J;  3GTQ J;  1LFB A;  3DEW A;  3BG3 A;  4V2G A;  3OMT A;  3ZQI A;  2VKV A;  4A3G J;  3JRG A;  2IEK A;  4DYC A;  3GTL J;  2CRG A;  1WH8 A;  1DW9 A;  4YG1 A;  5JLX A;  4MCT A;  1POG A;  4G12 A;  4JP0 A;  3RQI A;  5EGO B;  2HXO A;  2LCV A;  3OQO A;  5FKK A;  3LIS A;  4UUT A;  2LYK A;  4C3J J;  1W0T A;  1ADR A;  4LOC A;  2FJR A;  3H0G J;  5FKM A;  2EBY A;  3BD1 A;  2NVY J;  3CDL A;  2XGC A;  2MG4 A;  2WB1 N;  2LYR A;  3JRC A;  3ZHM A;  2LLK A;  1WI3 A;  3JRE A;  5IYB J;  3HKZ N;  3BTI A;  3PM1 A;  4JX4 A;  3QPS A;  2NS8 A;  3K2A A;  3MN2 A;  1OCP A;  3HBL A;  5M5X J;  5FJ8 J;  3LNQ A;  1VFC A;  4FBI A;  2DA4 A;  2M9H A;  1ETO A;  3ZQG A;  2HDD A;  4A69 C;  3B7H A;  2JMW A;  4XID A;  2XIU A;  1I3Q J;  2DMU A;  4A3K J;  3PO3 J;  3FIW A;  1MBE A;  1QQB A;  2LR8 A;  2OR1 L;  3MKL A;  4J1X A;  1RPE L;  2R63 A;  4Y42 A;  1QP0 A;  4C3H J;  1R9T J;  2ICT A;  1ZGW A;  3A02 A;  2XRL A;  3S1Q J;  1RZS A;  4NDL A;  1HF0 A;  3F0C A;  3QYX A;  4DYR A;  2XGD A;  3OQN A;  3LSJ A;  1JTX A;  1JFS A;  1EFA A;  1RIO A;  1GVD A;  2X9D A;  2R93 J;  2NVT J;  4X6A J;  1IC8 A;  3FMY A;  2TCT A;  1L1M A;  4A3E J;  5IPA A;  4A3B J;  3WHC A;  2EZH A;  4HNV A;  4RBO A;  4B4C A;  3HGY A;  3GBG A;  5GPA A;  2M0C A;  4FN3 A;  1F36 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...