1HF0A

Crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
128
Chain Sequence
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords OCTAMER-BINDING TRANSCRIPTION FACTOR 1
total genus 43
structure length 128
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hf0A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1hf0A01
3RZZA 2HOTA 1ZQ3P 1O4XA 2WUSR 5F0FA 1U78A 3RQIA 3MLFA 4X4DA 1ETXA 2WB1N 1K61A 1ORKA 4X4HA 2DJNA 3I4NJ 1ADRA 2OR1L 1WPKA 4IEJA 1QPIA 1ZVVA 1ITYA 5E3NA 1IC8A 1XC5A 3HGGA 2IEKA 1F36A 4LOCA 3HOZJ 4I76A 1DU0A 1IUFA 3OSFA 3B6AA 2CQXA 4XRMA 2LKXA 1MNMC 2PUAA 3S15J 1ETWA 3HGYA 1TWAJ 1NK3P 3Q3SA 4IHYA 1RESA 3RZOJ 2LYQA 2E1OA 4HNVA 3S2DJ 5DS9A 2MSYA 4A3FJ 4MIMA 3Q0WA 1YRNA 4A3MJ 2VPRA 3G1MA 3JRGA 3BDNA 1MSEC 1PRVA 1U9NA 1JTXA 2LFBA 3BG9A 1GVDA 3MKLA 4W1UA 1JKPC 1B72A 5FKOA 3S2HJ 3GTGJ 4Z5CA 1DWKA 5C4XJ 3S14J 1R9TJ 3HOUJ 3HBLA 2GBYA 3BTIA 1B72B 2CJJA 2M34A 1PUFB 1LE8B 4I6UA 4PU3C 1P7JA 5EEAA 2NVXJ 1MBEA 2JCGA 4D7MA 1OJLA 2ME0A 2X9DA 1PERL 2X6OA 4AUXA 2R5ZA 2MGQA 1TC3C 1GT0C 2NVQJ 2KEJA 4A3LJ 1QPZA 1ETYA 5EG0A 2EZIA 3SDGA 4FBIA 3QF3A 1Y1VJ 3BD1A 3HOYJ 1POUA 1L1MA 2R0QC 2M9HA 1NERA 3B7HA 3FK6A 1UHSA 2WIUB 5GPAA 3BTCA 5F1JA 1APLC 4O8BA 4MFDA 2IAIA 4I8TA 1E3OC 4JP0A 2Y0SN 4A3GJ 1QQBA 2JA5J 2LK2A 4QIWN 2EWTA 4I6TA 4ABZA 2LY9A 4G12A 3BR1A 5GP9A 2ZB9A 2BNNA 5M3MJ 5C3EJ 1VF9A 1LMB3 1JT6A 1MH4A 3BG3A 1IGNA 5K98B 1HDDC 3GTJJ 1UG2A 1X2NA 3IH3A 1NEQA 2B63J 2L49A 2M0CA 1HF0A 4AC0A 3C2BA 1ZZ7A 1JTYA 2R7ZJ 3L1PA 2HOAA 1VFCA 1FIPA 4DZPA 2VKVA 1QP7A 2TCTA 3E7LA 2R92J 4I6ZA 2XJ3A 3MN2A 2CU7A 3DNVB 2OF7A 1NK2P 4D5FA 1Q1VA 4C3HJ 1JFSA 3BR5A 1JKOC 2EBIA 5FLMJ 3GTMJ 3SJMA 4XRSG 3F6WA 2LCVA 1QRYA 1PNRA 4JCXA 3DEWA 2ECBA 3JRBA 3TEDA 4GHJA 2Y30A 3JREA 2R1JL 2MG4A 2AUWA 4YG4A 2DMPA 2IBDA 3JRHA 1ZZ6A 1WI3A 2JJ7A 3U3WA 3LSPA 2HI3A 4A3EJ 5FKNA 2MW8A 3OQNA 2IU7A 1AKHA 1Y9QA 3WHCA 2XGDA 1QP4A 4B4CA 2LD5A 4JX5A 1FEXA 5EDNA 2EQRA 3SCHA 5K7ZA 2L7ZA 2QCOA 3JRAA 1ZAYA 2K9QA 5E3MA 4YBAA 2N8GA 1ETVA 1FTZA 2FJRA 1BW6A 1TWGJ 1VI0A 5IPAA 4D7NA 3ZHIA 2LP0A 3ZOBA 5JLXA 2ICPA 3GN5A 4CYCB 1HDPA 1Z77A 3TRBA 2E2IJ 1B0NA 1BA5A 3NAUA 2ICTA 1RKWA 2AXZA 2R5YB 3CDLA 5BNGA 2RAEA 3HOVJ 1W0UA 4UUSA 2HSGA 1ZK8A 2NOGA 1POGA 1XWRA 2XIUA 4EEFG 2XB5A 3BR2A 2LYJA 2FX0A 4X4EA 3JXBC 4JX6A 5EGOA 2MEZA 4DZJA 1RZRA 4M6VA 4IHXA 2Y9YA 2XCJA 1VPWA 2DA3A 1CJGA 3BS3A 1XS9A 2HINA 3HKZN 1ZUGA 1ZZBA 3IH4A 2AHQA 2MQKA 2PE5A 2Y2ZA 1WH7A 2XSDC 2DTZA 2PUEA 2DA1A 2YUSA 2JA8J 4XIDA 2KPJA 3ZQIA 2EZLA 1HCRA 2DA2A 2I10A 4B1RA 1WH8A 3HEFA 2COBA 4BKXA 2GM4A 1JT0A 3VK0A 3TW6A 2JA7J 3ZKCA 5DTDA 1BJZA 4BY7J 2AWIA 3A01B 3BTJA 3BTLA 4Z59A 3HOWJ 2NS7A 2O4AA 3FKIJ 1I50J 2CUFA 5EYRA 5C44J 2O49A 2LYSA 2JN6A 3Q0VA 2R5ZB 5F0HA 4YG1A 1D5YA 5IP6A 4PU7A 3O8GA 2E2HJ 1H8AC 4YARA 3F0CA 3W6VA 3FISA 4L5EA 2HQ5A 4Y7NJ 5HODA 5J1UA 1W0TA 4GFBA 2LYRA 3HM5A 3UKGA 3GTKJ 3BR3A 2B5AA 4B3AA 1JH9A 3SFIA 1JKRC 1LCDA 3BG5A 4IWRA 2O7OA 1R63A 1WIZA 2KT0A 3G1LA 3OQOA 1IG7A 2LTPA 3ZQHA 4RBOA 4BY1J 3BQZA 4A3IJ 2O9LA 3G1OA 5E3LA 5EF6A 4XRSA 4RDUA 2IVQA 2LYLA 5K7HA 3M3YJ 4CYCA 1ZR2A 3HDDA 3JXDL 4GQMA 3IV5A 1HLVA 2XGEA 3S16J 1JKQC 2ID6A 1UTXA 2PIJA 4X1EA 1QP0A 4QTRA 3GBGA 1F43A 1QVTA 3TP3A 3G7DA 4BBRJ 4J1WA 1IJWC 1ZZ9A 4DW6A 3GTQJ 4FISA 4MCTA 1BW5A 4M3GA 2G0EA 3BT9A 3JRCA 3PO3J 2EBYA 2LYPA 2KEIA 1GDTA 5IYDJ 1LFBA 3QWGA 5K7FA 5FKLA 2IVGA 1ZZ8A 3DCFA 2LLKA 4A3JJ 4W97A 3JRFA 3OIOA 4DYQA 4V2FA 5C4JJ 4A3BJ 1AU7A 1CQTA 3JRIA 4BBSJ 3ZQCA 2PUGA 3LSGA 2ME6A 3S8QA 1Y1WJ 2IUOA 3ZHMA 2DA5A 4Z5DA 2DN0A 5FKMA 5IYCJ 2Y31A 4Y42A 4JQDA 1RIOA 1LLIA 1TWHJ 4A93J 2W48A 4C3JJ 2VUMJ 1T33A 2GZUA 1LFUP 3GBFA 3LNQA 3FK7A 5M5XJ 2VI6A 1B8IA 4NDLA 5M5WJ 2ELKA 2CQQA 4QSHA 2KZ8A 4OB4A 5M5YJ 1RR7A 2D5VA 3ZQLA 2JA6J 3FMYA 2FJ1A 1UXCA 1PRAA 3LISA 4X4GA 1QVUA 1X57A 2DMUA 4J1XA 1FIAA 1RZRD 4PU8A 4S0HB 4D5CA 4F8DA 1ETKA 1PUFA 1LE8A 2R63A 4IA8A 3UFDA 3TP0A 2IV1A 2O38A 2XRLA 1MBGA 3S1MJ 1G2HA 2EZHA 3CQZJ 1OCPA 1BL0A 1LQCA 2NVTJ 4FE7A 3FYAA 1WGXA 3JR9A 2AW6A 3JRDA 1JGGA 2DA7A 4JX4A 3S1QJ 3KJXA 1UMQA 1TWCJ 1X2MA 4FCYA 2AO9A 1HOMA 2GRMA 1Y7YA 2BJCA 3K2AA 2ECCA 2M8GX 3A03A 5F0CA 1ZR4A 5FJ8J 2NS8A 4FE4A 1EFAA 2JWTA 4M3BA 5EZGA 2GLOA 4XK4A 2K9NA 2FQ4A 3S17J 1ZKGA 1SQ8A 3F51A 1ETQA 1RKTA 3PO2J 2KDZA 2CROA 2H8RA 2X48A 2L8NA 1BDHA 1MBHA 2CUEA 1WETA 2O8KA 1JFTA 2XPWA 3BQYA 3D1NI 5F04A 2XPUA 4M3EA 5EG0B 3H3VK 1OCTC 4YG7B 1X58A 1X2LA 2DMTA 2M2EA 3OQMA 1JUMA 2JK3A 5FLVA 1JUPA 2VKEA 1H88C 5IP9J 2LYKA 1EF4A 2QF7A 3QQAA 2K40A 3NARA 1B8IB 1MBKA 2L7FP 3GTPJ 5J1RA 1PRUA 2AXVA 2XI8A 2EF8A 3HZIB 4UUTA 4FTHA 4Y52J 4X4CA 1TWFJ 3RZDJ 4IHVA 2JVLA 1IRZA 3QYXA 3HOXJ 1I6HJ 2LR8A 2XPVA 1VNDA 4PU4C 4BXXJ 3GN5B 9ANTA 2PPXA 4A3CJ 3A02A 4JYKA 1OSLA 1GV2A 1ZTRA 2R5YA 1DU6A 2NVYJ 3GTOJ 2PUDA 2DA6A 5F27A 2OFYA 4X6AJ 3QPSA 1NTCA 2DMQA 1JUSA 3A01A 2PUBA 1JJ6C 3KZ3A 2CSFA 1Z0XA 2HYJA 1ZZCA 3OP9A 1A6IA 3QPLA 4A3KJ 2BNOA 5IYBJ 4Z58A 3G5GA 2EZKA 1SFOJ 4I6RA 4JCYA 3F52A 4MO7A 2H1KA 1MBJA 3H0GJ 2R93J 3H5TA 1AKHB 2PUFA 1XG1A 1FTTA 1U9OA 3ZQGA 2L7MP 3ZQFA 3R1FA 3VPRA 3PM1A 2FD5A 5EGOB 3SCGA 5F08A 1JJ8C 4Z5HA 1QQAA 1ETOA 4X4FA 2CRGA 4M3FA 5IP7J 1MBFA 5GPCA 3OSGA 2DMNA 4UUSB 2XGCA 1IV6A 2L9RA 1T56A 3CCYA 1AHDP 3IVPA 1RPEL 5FKKA 4A3DJ 4XICA 3JXCL 3IH2A 5EZHA 1A5JA 3BR0A 3SCFA 3LOCA 3LSJA 2JMWA 2KEKA 3BR6A 3CLCA 2OPTA 2XB0X 3K7AJ 2GRLA 1BDIA 2YU9J 3LSRA 2WAQN 1K83J 2E19A 4V2GA 2YS9A 1OFCX 1I3QJ 3TW7A 1FJLA 4MCXA 3FYMA 3LFPA 3OMTA 2P81A 1SANA 1ENHA 2AXUA 2BNMA 4MLOA 2HXOA 2ID3A 5IOYA 3RKQA 3S1NJ 3M4OJ 3Q0UA 5M3FJ 2E2JJ 1P7IA 3OOUA 2L0KA 5J1YA 3S1RJ 1RPWA 3MVPA 4M3DA 1YSEA 1YRNB 2PMZN 1DW9A 2A6CA 2PUCA 3KXAA 4NDWA 4DYRA 3GTLJ 3CMYA 2LVSA 2Y9ZA 2HXIA 2HDDA 1MSFC 3QQ6A 2K9SA 1WH5A 1GV5A 1LCCA 3HB9A 4A69C 4IHWA 4X4BA 4MFEA 5A7LA 1S7EA 1ZPQA 3O9XA 1WCMJ 4J19A 4DYCA 2EH3A 2TRTA 5IOZA 3WHBA 1UXDA 2DA4A 3FIWA 3CECA 1JWLA 5J3LA 3B6CA 3I4MJ 5JLWA 3PXPA 1IDZA 1WH6A 4FN3A 1IDYA 1MH3A 1H89C 3CROL 3O8HA 1ZGWA 4X4IA 1ZS4A 4AYBN 2HOSA 2IVBA 1RZSA 5E3OA 2WV1A 4IVZA 4C3IJ 4C2MJ 1U8BA 1R69A 3EUSA 1RETA 1GUUA
chains in the Genus database with same CATH superfamily
1XMKA 1X3WB 3L2CA 4PJMA 4KN4X 2LG4A 2H1LA 2E7XA 3WTZA 4MNUA 4BXFA 1MMAA 2F5EA 2VIXA 4EKGA 1QPMA 2WB1N 1K61A 3RQ4A 1ORKA 2CG4A 4X4HA 2DJNA 3IL2A 1LFPA 2FMLA 2WWYA 1IC8A 3SDBA 4L18B 3HOZJ 5LGUA 3H9QA 2CQXA 1I3AA 1S9HA 1YW9A 4F3QA 4F55A 5K5QA 5L3DA 2KIQA 3H5NA 2ZSIB 4QLCU 1RESA 2XXPA 3F8NA 1VQ6I 2LYQA 2GQQA 2TDXA 1JHHA 2KKOA 4A3FJ 2ZNYA 2BVMA 4KN7X 3Q0WA 4Z2YA 3G1MA 3JRGA 2PBIA 1ZG1A 1PRVA 1FC3A 1U9NA 1WI9A 2LFBA 1JKPC 5LFAA 3ABKH 4V19K 1PUFB 4H0EA 4I6UA 3ZMVA 4IL6C 2Z16A 4DBRA 5EEAA 5HDKA 1PP7U 1SVMA 2F48A 4OAYA 1OJLA 4ZYDA 5LRRA 2MXDA 4EKIA 3E5XA 3HG9A 4AUXA 2R5ZA 1GT0C 1QPZA 2EZIA 2M1BA 4HX8A 3QF3A 5HS7A 4AM3A 3FK6A 4LB6B 1UHSA 5L3EA 2ZNZA 2BXZA 3PNTA 4OIRF 4O8BA 4MFDA 2IAIA 4CUGA 2L1PA 4P96A 5AONA 2DQRA 1MIJA 2XVCA 1WZ2A 2Y0SN 1K79A 3FMRA 1X1DA 3F72A 4EMSA 2EWTA 2LRDA 5E1WA 2XAUA 3S32A 3BY6A 3DKWA 5M3MJ 1ACIA 5KAIC 3TO6A 1JT6A 3TMOA 3GTJJ 2A6EF 3TOBA 2L49A 2B63J 4QPOA 4EQQA 1HF0A 4AC0A 3WTTC 2L7KA 4ZC3A 2CYYA 4DQ2A 1SEUA 2E5NA 1QP7A 2TCTA 2J5OA 1MNDA 3I3LA 2XJ3A 3LQXA 2F4MB 4S05A 2JVHA 2KIUA 2EV5A 3WU1B 2MBFA 3SJMA 2JRTA 3F6WA 4JCXA 2GAUA 3DEWA 3JREA 2ZCWA 4WWCA 2DMPA 2PEXA 1ZZ6A 1QB2A 1SFXA 1XSDA 4CZCA 1YS6A 2Q2EB 2HI3A 4A3EJ 2BVLA 1AKHA 3WU2C 1K7AA 3OL4A 2GIVA 3S3NA 4IVNA 2JA2A 3WGIA 2LD5A 2QSGX 2V1UA 4U0WA 1Y56A 5K7ZA 2A68F 1IXRC 4PSWA 3JRAA 3B02A 2FEZA 3CESA 2FA5A 3EUHA 4WCGA 3NDBB 3GN5A 5E8IA 1HDPA 3U21A 4IX7A 2HQRA 4XLEA 1B0NA 2V4JC 1BA5A 5DM6F 3ZPXA 2ACJA 1E0EA 1YTYA 2JUCA 2V1XA 3C2GA 1VQ8I 2JQ7A 4O6JA 4C2UA 2RAEA 3VSKA 2ESNA 4RAYA 4PFPA 3DP7A 1W0UA 2HSGA 4HX7A 5D4RA 2XB5A 3BR2A 2HZDA 4JX6A 2XV4S 1SD6A 2V1NA 1B9MA 4KMFA 1MMSA 4P5OA 2RGVA 2Y9YA 2IGOA 3QRFF 3BS3A 1XS9A 3RDIA 4LK1F 2QLZA 1WH7A 2HZTA 1G3YA 1MDMB 4N9HA 1MMNA 4GYGA 4HLXA 3J7AO 5LGTA 2P0WA 2I10A 5DCMA 4G7HF 1E3HA 5JUWA 2DLLA 5HLHA 1FP1D 2W84A 2XAHA 2W85A 2CGPA 3BTJA 2QSFX 1FMWA 2O4AA 3FKIJ 2CUFA 2HVRA 5EYRA 5C44J 1T8IA 2JN6A 5F0HA 1IO2A 4EJOA 1XCVA 2DQLA 5IY5H 3UNGC 1H8AC 2E2HJ 3FISA 3E6CC 3E6MA 5J1UA 4OBMA 3SYTA 3DLAA 4HV6A 1WVRA 2CW7A 3MZHA 3SFIA 1JKRC 4TV7A 1LCDA 2P5LC 4NUBA 2Y69H 5D5WB 2OCEA 2MA3A 1F9NA 5CQGA 2XKPA 2KT0A 1R63A 1WIZA 3BZ6A 2JTVA 3RIRA 4A3IJ 2LYLA 4XRSA 4WXDA 2QKMB 5KHDA 3FXQA 1T0FA 3M8JA 4DIQA 3N97A 3QOEA 4X1EA 2FBKA 3GWZA 3H9GA 3I59B 1QVTA 1RNLA 2DO7A 2G0EA 3CUQB 2DK8A 4IOAF 1T08B 1GDTA 3SR4A 4KFCA 1F1ZA 1OQYA 1S7AA 2LLKA 2NS0A 4W97A 3JRFA 3OIOA 4DYQA 1SC7A 1L3LA 1HBXG 3BROA 1IN7A 3ROUA 4DOZA 3ISPA 1WFXA 5K1YA 3RYPA 4G8XA 4BBSJ 3GLLA 1HW1A 2OZ6A 1KA8A 2ADUA 4Z5DA 2DN0A 3OYCA 1C0WA 3EYYA 3AKZA 1RIOA 1XGOA 1LLIA 1U5TC 2HYGD 4L9TA 5DTMA 1I27A 3GBFA 5J47A 1MNEA 1B8IA 3OY9A 3K4MA 4NDLA 3JTGA 2A3SA 2X51A 2EA4A 1W5SA 4NC8A 4OB4A 1RR7A 2D5VA 3ZQLA 1UXCA 5CQEA 1SD4A 3E0JB 2DMUA 4JOMA 2V9VA 4PU8A 1I1GA 4F8DA 1ETKA 3K69A 1LE8A 3UFDA 3IWZA 1AOYA 1LUJB 4QWQA 2KDOA 1W7PA 3ZXSA 1OCPA 2IVMA 4MEYF 1LQCA 1SFEA 1D3YA 4XLNF 3GLXA 1JGGA 2E5ZA 1X4PA 2DA7A 1MW7A 3P9CA 2CV0A 2QSHX 4WK8F 3IKTA 1UMQA 4RB0A 1TWCJ 3M7GA 4JK1X 1T2KA 2D1VA 4FCYA 1HOMA 3GZDC 3L7WA 3OWTA 4YFKF 1ZHFA 4R1HA 2VEOA 5E18F 3HTUA 2QBYB 1EFAA 2JWTA 5EZGA 2LKSA 4B48A 4IQ4A 1OLTA 2GLOA 2FQ4A 2EIJH 3KL4A 1ZKGA 1SQ8A 1RKTA 2VASA 1QHGA 3JSPA 2OAZA 3W6JB 2CV1A 3PO2J 2CROA 3M1EA 4P55A 3KX2A 4RLFA 1BDHA 1WETA 4L9VA 1PJRA 4RA2A 1W36D 1LEBA 2AXLA 3D1NI 1H9TA 2OA4A 2KZGA 4A5MA 3A9ZA 3HPGA 4M3EA 1OCTC 1X58A 3D5SC 2GOXB 3AG3H 1JUMA 2IW5A 4NBQA 2DFHA 1JUPA 3OYAA 2R7RA 3KLNA 1RIOH 1FOKA 1DPRA 4BJTA 1G3WA 3HC7A 4ENNA 2QUFA 2LYKA 1EF4A 2KPMA 1IXSB 4FX0A 2XXAA 1Y8QB 3GTPJ 5J1RA 5D8KB 4EATA 4EV0A 4EJTA 2BY0A 3S8PA 4FTHA 2MC4A 4Y52J 4L9NA 4UUVA 2ELHA 4F52A 3RZDJ 2JVLA 2WY7Q 2RQPA 4I01A 3QYXA 1SD5A 3WG7H 3TBIA 2LR8A 5FFXA 2X6YA 3ZMSA 4PU4C 4IRIA 1XB4A 2IP2A 2M5WA 3GN5B 4NQWB 1XD7A 4KUMA 3VYSB 4A3CJ 2HTSA 3VYTB 5J8CA 1ZTRA 1XN7A 3G2BA 1E3PA 1FLIA 1WJFA 3H5AA 3GTOJ 2DA6A 2DMQA 1JUSA 1YHQI 4Q2JA 3R0AA 2HYJA 5JI6A 4D0PA 1GHCA 4A3KJ 1HXDA 3G5GA 4EGZA 2F4OB 1WHUA 5ILVA 4OMZA 3F52A 2KRFA 3CJRB 5CVIA 2H1KA 1MBJA 5GAEJ 3H0GJ 3H5TA 4UVAA 2X85A 3BG7A 1FP2A 1WJEA 1ZG3A 2XROA 2Z9OA 3U1KA 2H6CA 1NHAA 3PM1A 5L3GA 5DM7F 2BXYA 1JJ8C 3T5XA 4IF4A 4X4FA 4M9XA 5IP7J 1MBFA 3BG6A 4UUSB 1YX5A 3MMYB 2L9RA 1T56A 2PMHA 1RPEL 1I1SA 5L3FA 2A5WA 3E97A 3HRTA 4FT8A 3LSJA 3SCFA 4OINF 5B3SH 5DRTA 2LLVA 3M8EA 1UB9A 2KEKA 3QP5A 3BR6A 4LLNA 3K7AJ 2YU9J 2L3DA 1DQUA 1I3QJ 1FJLA 1ZYRF 2XUBA 5IT3A 4L0YB 3ASNH 4BEHA 2AXUA 2BNMA 2HXOA 4JBAA 2XAFA 3Q0UA 3H3ZA 5AIPA 3OOUA 2L0KA 3S1RJ 3U9GA 1RPWA 3D5LA 2A07F 1YSEA 3O3KA 2QQ9A 3D5RC 2HFZA 3KXAA 4HNTA 4NDWA 4ANJA 3CMYA 3OR2C 3BJ6A 1EH6A 2HXIA 2HDDA 2Q0OA 4DGWB 2WAEA 1WH5A 4HYEA 1GV5A 1LCCA 4A69C 5A7LA 1S7EA 2IA1A 1GLNA 4XBFA 1ZREA 2MH9A 5J6XA 2TRTA 2EFPA 5IOZA 1VQKI 3WHBA 2DA4A 4PGHA 1JWLA 4BE2A 2VJIA 5JLWA 3CCJI 1ZS4A 5HOOA 1HQ1A 3OYMA 4LD5A 4P9FA 4HRIA 4HQEA 5TISC 1MMGA 2XC7A 4E7KA 1FYMA 2DDBA 4Y3OA 3EUSA 1KQ8A 2WV0A 2FUG2 1Z6RA 1DGRM 3NWSA 4Y33A 3LQRA 4M71A 2JPCA 5B1AH 3KPHA 4RGXA 1K78B 2M4GA 4BXUA 1XGNA 4XSZF 1VQPI 1OCOH 4BE1A 1YE9A 4IEJA 1VQLI 3VB2A 3VSLA 4LOCA 4E7IA 2PQ8A 4I76A 2V9PA 1IUFA 4CGZA 4HDVA 3B6AA 4KNYA 2EFOA 1U0JA 2Z3YA 2HVSA 4XRMA 2LKXA 2LF7A 3DKYA 3C18A 3ME5A 2BY1A 2Q1ZB 2ZSHB 3WE2A 1TWAJ 2V9KA 1SFUA 4E70A 1WJAA 1R7JA 5DS9A 3ZMUA 2MSYA 1MDMA 2Z33A 3MQ0A 3GFIA 1WKMA 1Y6IA 2ODRD 1L0OC 4XKVA 2M8EA 2VT3A 3K70C 1HW5A 3MKLA 3QU3A 1Z67A 1DWKA 3HBLA 2GBYA 3BTIA 1B72B 4Q5SF 1R22A 3CCMI 1Z3YA 3GW2A 2OQGA 4AVZA 4RMNA 4D1QA 4O3MA 3CD6I 4D7MA 3WG9A 2ME0A 2X6XA 4XMYA 5GAGi 2P5VA 3CZ6A 3OS2A 2M3AA 3MKWB 2MGQA 3FXMA 2OV7A 2NVQJ 2KEJA 3OV8A 1MZBA 4UV8A 4KIGA 4BGDA 1FYLA 5DDGA 2R7WA 4FBIA 1OKRA 1L1MA 2CO5A 2M9HA 3KFWX 4UXNA 3BJOA 1APLC 1RC9A 3MCZA 1ON1A 5FGMA 2P7CB 3ZQ7A 2R7OA 2LK2A 2PXBA 4MHGA 4QIWN 4I6TA 2QQ8A 2NVUB 3BR1A 3K4CA 2ZB9A 3L2UA 5C3EJ 3K4BA 4L5IA 2FNPA 3TDUC 1J0RA 1T38A 1HKQA 1MH4A 3NWTA 5K98B 3V42A 3DM5A 1KU3A 1YIJI 1UG2A 1X2NA 3CJQB 3FXUA 4A0YA 4EJUA 5FRNA 5DRYA 3C2BA 1ZZ7A 2K5CA 2R7ZJ 2HOAA 3LFKA 2UWMA 2R92J 4AIHA 4I6ZA 3HSEA 5DYMA 1QQIA 5LHIA 1BI1A 1BOBA 3J7AY 5HVQC 1FNNA 2BHYA 2GXAA 4C3HJ 3BR5A 2HOEA 3JW4A 2DK5A 2O9LA 1U6GA 1GXPA 5IT9Z 3JRBA 3TEDA 4GHJA 1UJ8A 3P5JA 3RPUD 3FZVA 4CH7A 1SVOA 4RM2A 1WI3A 3MD2A 1T6SA 4QPQA 4C2TA 4B09A 3MZ8A 1U5TB 3HSRA 1ZRCA 1D0XA 2PXEA 1R1VA 2JT1A 3BC8A 3VOEA 4B4CA 2GOMA 4ER7A 3ABUA 5EDNA 4ER3A 2CMPA 2QCOA 1O3RA 1FBQA 3WODF 1FSHA 1XCBA 3R4KA 4IXAA 5FD5A 3SQNA 2VLAA 1O3QA 1BW6A 4RB2C 1VI0A 1I6XA 2K4JA 3ZHIA 1B6AA 1TNTA 4CCOA 3ZOBA 5J40A 2ICPA 1Z77A 3TRBA 1YYVA 2E2IJ 4ZTJA 5ILSA 2ICTA 2V1DA 4E7SA 1G6NA 2AXZA 2K4BA 3CDLA 2KJBA 2ZC2A 1DP7P 4IJAA 1POGA 3I55I 1FZPB 2QGUA 3FHNA 3LSMA 5TJJA 1KZHA 1WJBA 2FX0A 3NQOA 4PUSA 5TGTA 4X4EA 5EGOA 2MEZA 3V8KA 3BZCA 2CQ7A 4DZJA 1RZRA 4YIFA 1R6RA 2LSOA 2XCJA 3MEJA 1CJGA 2HU9A 1YITI 4HG2A 5FFZA 2PN6A 2KISA 4HSTA 1DP3A 1KU9A 2XSDC 3S93A 3M9LA 2PUEA 1Y39A 2YUSA 1FOXA 3ECHA 4KITB 1K6YA 1IW7F 4XIDA 1SAXA 2JA8J 2PXUA 5EEHA 2EZLA 3KP5A 3VYUB 4I2OA 1IRFA 2DA2A 2DTRA 4B1RA 2DFFA 4ON0A 1A04A 4XLHA 2COBA 1LVAA 3RYRA 4BACA 1WJ5A 3VK0A 5EJCA 3KP7A 1LDKB 3CCUI 1X3ZB 4BY7J 2AWIA 1CF7A 3A01B 1X1BA 3W2WA 1VQOI 1TNSA 3HOWJ 1BM9A 2XSJC 4UB6C 2DXIA 2IS6A 2LYCA 5IP6A 2XF7A 3LA7A 3F0CA 2P6TA 1U2WA 1P2FA 1LPQA 5LBQA 2HQ5A 4BE0A 3FWEA 3I9V2 2LLWA 4B3AA 1R5HA 3PL8A 2R7XA 1R4NB 3IHUA 4EJWA 3CF5F 4N9IA 5J4VA 5J4YA 4YFNF 2BGCA 3OYBA 1X1AA 2FXAA 3CLOA 4G6TB 5B1BH 4ZDPA 1IG7A 3OQOA 1MFQC 3HTSB 4ZDOA 4RGSA 3COAC 3G1OA 3IAS2 5E3LA 1MGTA 5EF6A 2EIKH 3KZIC 5K7HA 4CHUA 4CYCA 3L2VA 4PJJA 3GZNB 5LGNA 4GQMA 2PJPA 3S16J 1JKQC 1QP0A 2XKOA 3GBGA 1F43A 1JI8A 2EV0A 4DE9A 4BBRJ 4J1WA 1IJWC 3A9YA 3L2WA 4DW6A 2M30A 4MCTA 1BW5A 5KVRA 2X6WA 2YBDA 1BC8C 2NXNB 2EBYA 2KEIA 3PSFA 4UVBA 4PJNA 3JCUC 2IVGA 1ZZ8A 2DODA 3DCFA 4A3JJ 1XX5A 2F2EA 3GFJA 3I56I 2K9MA 2VC1A 2MLGA 1CQTA 5E8GA 1S72I 3IAM2 2RC4A 1R23A 2ME6A 2RREA 4MGRA 3S8QA 1LVKA 4RAFA 2IUOA 3EQLF 1KQ9A 4A2UA 1D1CA 1ZGJA 2R7FA 1BI0A 3K1PA 1V5FA 4HAMA 6PAXA 3ZR8X 5EEGA 4MEXF 5M5XJ 2DT7B 2ELKA 2CQQA 1YS7A 3I54A 4NQWA 4QSHA 1YI2I 2B9SA 2IS4A 5GTHC 3FMYA 4RB1A 2BOLA 1S3JA 2IA2A 5BPIA 2NOJB 5DD4A 1FIAA 4A5NA 2RVCA 4S0HB 3KZYA 1PUFA 5LD2C 3V7CA 1ZELA 3G3ZA 2R63A 4IA8A 2O38A 2ISZA 1O57A 2WB1A 2BW3B 4LFUA 2ZJQF 1TTYA 5HNHA 2PI0A 3S1MJ 3CQZJ 3DTEA 5ICEA 3PUFA 4FE7A 3WE3A 3I0TA 3RTRA 3JR9A 2AW6A 1P6RA 3QAHA 2KIMA 3MZYA 4Y15A 3LAJA 4JX4A 2A6TA 2CWEA 1X2MA 2VT2A 1USSA 2BBYA 3RCOA 1SVLA 2GRMA 3IUOA 3I71A 5DCFA 2VXZA 4HLYA 2C6YA 2M8GX 3A03A 4M9SA 3OYDA 5FJ8J 2BY3A 3FDYA 4HX4A 4LB5A 4M3BA 4WF2A 2BYVE 1PYVA 1S6LA 2HKOA 3F51A 2ICWG 2KDZA 2L8NA 1ERDA 2PXPA 1MBHA 2KZVA 2P4WA 5H6QA 3BQYA 2E60A 5F04A 2WADA 2XPUA 1TL8A 5EG0B 3SEZA 3H3VK 3PE5A 3N4MA 3TO7A 2K27A 3DU5A 5IP9J 2VL8A 5J8FA 4GDFA 4HF1A 3E5QA 2EFNA 2GZWA 3W2VA 1J7KA 4HZFA 2UXXA 1PRUA 2L7FP 2XI8A 4AU7A 2OQRA 3IWFA 2W57A 1YJ9I 2GA2A 2O3FA 4E6KG 4IHVA 1YW8A 3HOXJ 3KZZA 1G59A 4BXXJ 2DW4A 4ZTFA 1W1WE 3FXLA 9ANTA 3CMMA 5DT2A 3MEXA 4JYKA 2ZBKA 2AS5F 3OYGA 1OSLA 2ZFWA 2WAQA 3E1SA 3LQQA 2IGMA 2W25A 2PUDA 1XTAA 3ABMH 3B73A 2HQAA 3FF5A 3QPSA 4X6AJ 1NTCA 3NXHA 1Z0XA 2VPLA 1A6IA 3KYCB 2KRHA 3TELA 2HGCA 3O2PE 4EM2A 1VQNI 4E7ZA 1SFOJ 4JCYA 4LG0A 2GXBA 2RNJA 4HOBA 1TQPA 2XXQA 4DE8A 3SFZA 2MFZA 1D1AA 2ZMEB 3P9KA 2QQBA 1XG1A 1R1UA 2FNAA 2LDUA 1FYKA 1FTTA 3ZQGA 1ZH5A 2L7MP 1BOAA 2O5RA 3R1FA 3LAPA 2DOFA 2FD5A 3HYIA 5F08A 1QQAA 2PXQA 1ETOA 1OYYA 4BYYA 2CRGA 4Z6YA 2KIFA 1D8JA 3A0BC 1R5GA 3I5UA 5GPCA 3OYFA 5KK1A 1IV6A 2XGCA 1AHDP 2EA2A 4U7BA 4CA0A 5FKKA 3IKVA 1LDJA 4XICA 1HQCA 3VODA 3V4GA 2IA0A 3WGGA 4FASD 1PP8F 3SX0A 5EZHA 1RZ4A 3SHFA 1OPCA 3LOCA 2XAJA 4ITVA 1ZLJA 4MTDA 1WSUA 4RM3A 3OYHA 4AD9A 3DU6A 4GRIA 2OPTA 3F8BA 2VXDA 3C2HA 3UR3C 3L2RA 1I5ZA 1TW3A 4ZYGA 1GVJA 2EILH 1V3FA 2YS9A 1KGSA 4XQFA 1OFCX 5LLQA 4EM0B 3TW7A 1F4KA 1VZ0A 5GAGJ 3FYMA 3OMTA 2P81A 3PUBA 1ENHA 1FBUA 2G7UA 4MLOA 4KIBA 5IOYA 2CW8A 3A0HC 4B3XA 2UZKA 3CP8A 3RKQA 2EIMH 3M4OJ 2CSOA 5M3FJ 2KMUA 3AG1H 3CCVI 4HEA2 2FSWA 1KONA 4PCQA 2R7UA 2PMZN 5K5OA 3F6OA 4KT6A 5JVTA 2VQHA 2V7FA 1J09A 3GX4X 4G6DA 4X0GA 4WXCA 1ZG5A 4NHJA 4XR6A 2OJED 3UWPA 3MFKA 4M73A 4XLCA 1UHWA 4PFOA 3OWQA 3AG4H 3JTHA 3O9XA 3WTSC 5JHFA 3CCEI 2EB7A 4DYCA 4ENKA 4PDKA 4YIIA 2ZXWH 2EH3A 5ILUA 2PXDA 5DTRA 1LQ1A 4YG2F 5HNFA 3CCRI 3I59A 2OCCH 2FU4A 3DPUA 4EZIA 1WH6A 4FN3A 1MH3A 3LWFA 4B47A 1H89C 3O8HA 3CC2I 4X4IA 2E1MB 1Z7UA 4Y4RA 5KAFC 2NAZA 2VBZA 1RZSA 2IVBA 2Z1DA 4IVZA 5HS8A 3KYLA 2QQAA 1Z3XA 2QKLB 2W00A 1U8BA 4M72A 3TL4X 5FO5A 1ULYA 1IAWA 4KT5C 4XM3A 2HPMA 1FT9A 3L00A 5HDGA 1K78A 1BR2A 2VE9A 1QZYA 1V5GA 5F6FA 2HOTA 2J7WA 2Z2SB 1XGMA 2CW0F 4MTEA 3A4CA 5FLXZ 1BR1A 1R5ID 5F0FA 1U78A 3J7YJ 1YIOA 1KU7A 1MJ9A 4KICA 2J5PA 1ETXA 2HYFA 3SZPA 2Y75A 4IO9F 3DXJF 1XSXA 1YLFA 1ADRA 1Y0NA 2OR1L 1WPKA 4XKCA 2VB6A 1QPIA 5FRMA 1EV7A 2WBMA 3KEOA 4ZJZA 2HFHA 4F92B 1XC5A 5E3NA 1ITYA 2IEKA 4G6QA 1F36A 2H8WA 2MH2A 3OSFA 2Z99A 5H2FC 3OS1A 4HF0A 1IN8A 1A6QA 2R7SA 4LMYA 4BAYA 3RI4A 2LF8A 3HGYA 4I09A 4BH9A 4BL0B 1T95A 2X0LA 1YOVB 5ERIA 1SMTA 3RZOJ 2HR3A 2PJRA 2QENA 4U0VA 2VODA 1D8KA 1O7FA 2VPRA 3K4NA 4RB3C 5BMZA 1S8NA 4JQFA 1MSEC 4W1UA 1JTXA 1B72A 1ZAYA 3S2HJ 5FKOA 3LL7A 4IHTA 5C4XJ 2ISYA 2RDPA 3S14J 3HOUJ 2CJJA 2M34A 2VQCA 1P7JA 2OUMA 2DI3A 1MBEA 2JCGA 1ZVVA 2X9DA 1PERL 3PQKA 4HPQA 1TC3C 5B5EC 4A3LJ 5EG0A 1FWZA 1W7PD 3SDGA 5ED4A 1Y1VJ 3BD1A 2PXTA 5L3CA 1POUA 2R0QC 1FSEA 2WY8Q 3B7HA 1A31A 1W5TA 2WIUB 2B7EA 5GPAA 3BTCA 1HA8A 3WU0A 3CCSI 2V79A 1N75A 4YELA 4A3GJ 1QQBA 2JA5J 3G73A 1W4MA 4IHSA 2LREA 1YQAA 2P8TA 2LY9A 4G12A 5GP9A 3FBIB 3F22A 3QYFA 3MKZA 4M74A 2L54A 3KP6A 3IH3A 5HLTA 1NEQA 2VOOA 4E4HA 3VFZA 3K2ZA 3CF2A 1JTYA 2M87A 3R60A 1UZCA 3L1PA 2O03A 3F8MA 1FIPA 3KEYA 4MQVA 4DZPA 2VKVA 2LBFB 1VFCA 3PNVA 3E7LA 4ER6A 4KMUX 3CO7C 4UVCA 3MN2A 3DNVB 2OF7A 4FETA 1NK2P 1Q1VA 2CUJA 3T8RA 1OR7C 2DPDA 1JFSA 1JKOC 1XDSA 2LCVA 1QRYA 3E6DA 4CDGA 1W36C 2ECBA 3HIFA 2Y30A 1RI7A 3WTUC 2MG4A 4IKFA 2AUWA 2IBDA 3GF2A 4IOCF 2XASA 3JRHA 4OU0A 2JJ7A 3U3WA 3OQNA 2ZMEA 3DWLE 1Y9QA 1QZZA 2ZJRF 2W82A 2YU3A 1QP4A 1ONVA 3SCHA 2DAOA 1YO5C 3DPLC 1G3TA 4XRFA 2K9QA 1MJBA 2Q8KA 1EH8A 2GWRA 2RNGA 3OKZA 5IPAA 2D1HA 3ZMZA 4D7NA 2LP0A 3RKXA 5JLXA 3R09A 1Y0UA 2VN2A 4LJZF 4CYCB 3CUOA 4XKWA 2A5YB 4OIPF 3P7NA 4BJ5C 3NAUA 2BW3A 2H09A 1RKWA 3VWSA 4CCLA 2X1DA 2HKXA 1EKEA 3RPQA 4UUSA 3IRRA 1ZK8A 2PMUA 1XWRA 2XIUA 2E7WA 2KFDA 4XLPF 4EEFG 2LYJA 5GTIC 4LLGF 2IJLA 3JXBC 2MD5A 4A6DA 1U8RA 5FB2A 3DV8A 1Z1DA 3HRUA 3ZP5A 4IHXA 2DT5A 1J9IA 2DBBA 1P9QC 2G9WA 1DGWY 3W3CA 1XGSA 3GMEA 1U2ZA 1ZUGA 1ZZBA 3I53A 2YX4A 4WX9A 1IV8A 4G9YA 1TQIA 3HOSA 3BP8A 2DTZA 2DA1A 1J5YA 2OZUA 5CJ9A 3IP4B 4DNCA 1HCRA 2LNBA 2CH0A 1WH8A 2P6SA 4BKXA 4R8HA 1UCRA 5DV5A 2JSPA 4EM1A 5DUIA 2DCEA 3TW6A 4AIDA 1G8XA 3ZKCA 5D8LB 4PK4A 1O7LA 1YX3A 4Q4ZF 1HSTA 5E1ZB 3BTLA 4F93B 4BDYA 1M1EB 1V55H 2NS7A 4Z59A 1I50J 3OOPA 2B0LA 2BV6A 4N0BA 4KYWA 3QFIA 3Q0VA 4AIKA 5LEKA 1KU2A 3GYHX 4R79A 4YG1A 1D5YA 4PU7A 1QHHD 3CP2A 3F6VA 5JHUA 2STTA 2EWNA 1D0YA 2IPQX 3RKWA 2OTLI 1JE8A 4L5EA 3LSIA 4Y7NJ 4GFBA 1ZARA 3HM5A 2LNMA 1I39A 2ZJ2A 3G0TA 1VQ7I 2MLKA 2B5AA 4BQAA 3LA3A 4CCJA 2XF5A 3I64A 3G1LA 2XDVA 2ELJA 4BY1J 4RBOA 3BQZA 1D0ZA 3AG2H 2FE3A 2XAGA 3DQVC 2OTJI 3C3WA 1ZR2A 2L2OA 1AWCA 2XGXA 3AFHA 2ID6A 3TGNA 2ZJPF 1RUOA 2PIJA 1LKXA 2YSRA 4QTRA 1A36A 4F7ZA 3TP3A 3JAMZ 3G7DA 1O3SA 1ZZ9A 2K02A 3GTQJ 4P9UA 1MKMA 4M3GA 3JRCA 2P5KA 1LFBA 3KETA 5CVRA 5K7FA 2IT0A 3QWGA 4GGGA 1J2XA 4GCVA 3PFIA 1X19A 1YJNI 4V2FA 2JVGA 3GZCA 3LFUA 2DOEA 1AU7A 3V8JA 4PZJA 3JRIA 4U88A 3ZQCA 1X1CA 2PUGA 4BHPA 1OYIA 4BHBA 3ZHMA 2HDWA 2OU2A 3PIPF 5IYCJ 2Y31A 2QA4I 2EJRA 2QEXI 3DBRB 1SMYF 1TWHJ 3OYEA 4A93J 2VUMJ 4XOPA 1MD0A 4BU2A 1N78A 5ICFA 4U0YA 1R1TA 3LNQA 1E2XA 2L4AA 2VI6A 2EK5A 2WAFA 3KCCA 3Q9VA 3BZKA 5M5WJ 2KZ8A 3ZMDA 2OBPA 4P1WA 2CUZA 2ZMEC 2JA6J 1QGPA 1PRAA 4XLFA 3L09A 4BUPA 2CFXA 3CCLI 2V3CC 1KQ0A 5L3BA 1RZRD 3DF8A 3FBNB 3WGHA 4D5CA 4L0ZB 3EETA 2A6HF 4EK9A 1TLHB 1NW3A 2QYOA 2L4MA 4EJVA 3E5UA 4UHTA 3WTYC 3CDHA 4H4KC 1BL0A 1G2HA 1B4AA 3OR1C 3ZQQA 3KYDB 4YFXF 5D5UB 3A2KA 1WGXA 2DYRH 4BQNA 3KIOA 1QBJA 3DTKA 4I8TA 3S2WA 3U2RA 4LG0B 3DBHB 2R4GA 3EDPA 2O0YA 2Y0SA 3S1QJ 3KJXA 3K70D 5GAHJ 4ZYAA 5F0CA 1ZR4A 4KDPA 2NS8A 3CJTB 2E1CA 4I7HA 4XK4A 2ZO4A 3DTIA 1IRXA 1ETQA 4PJLA 3ONQA 1H0MA 5CPRB 1K6OA 2X48A 2H8RA 4E7LA 1MMDA 3V7SA 2JSCA 1UAAA 3AL0B 1JFTA 2UXNA 2XPWA 1VQ5I 1HKTA 3VDXA 5JVGF 3GCMA 3H0DA 3F3XA 3Q5FA 2KQRA 1J59A 1AA7A 2FOKA 3OQMA 5FROA 1ZLKA 3HHHA 3QQAA 2K40A 4UV9A 5KCMA 3QPHA 1YG2A 1B8IB 2P7VB 3QODA 2K3FA 2YPRA 4K2EA 1IRGA 3OYIA 1RRJA 5HS9A 1O3TA 4UB8C 4PSXA 4X4CA 1TWFJ 4II2A 3CC7I 1IRZA 4C30A 1V54H 1GXQA 1VNDA 1U5TA 2D2WA 2F6CA 2OC6A 2RN7A 2PPXA 2VJ4A 1UELB 1R49A 3X2QH 3BPVA 2L9NA 1GV2A 2DFIA 3W6KB 1BI3A 1TQMA 1OR7A 3CDIA 2NVYJ 2H27A 5F27A 1VQMI 2OFYA 2BHZA 3LSHA 3M1CA 4PGGA 3A01A 5H6RA 1JJ6C 3KZ3A 4B43A 1ZZCA 2COMA 1H9GA 3QPLA 2BNOA 3EPZA 2KP6A 3FM5A 1XSVA 5IYBJ 4XNFA 3NEUA 3MKYB 2PJRB 4BDZA 1DPUA 3GUUA 4Z58A 4II3A 4CO8A 4N4NB 3TDZC 1TT5B 1LB2A 2EV6A 4CCMA 2IGNA 4L9JA 4XORA 2E35A 4MO7A 2X1EA 4AYBA 2VBXA 1OCRH 2K85A 3KLOA 3LMMA 3H3UA 3CCQI 1N77A 2M7BA 2R93J 1STZA 2ESHA 1XMAA 3DLLF 4NC6A 2F5CA 4IQJA 3ZQFA 3VPRA 5EGOB 1JHFA 3H92A 5E1XA 5LHGA 3SCGA 4Z5HA 3ABTA 5JR3A 3DFGA 1RR8C 4G7ZF 3IRQA 5A2QK 3OSGA 2R3SA 3CCYA 4DJAA 3TQNA 4CYDA 2RV8A 3FHZA 1YJWI 4A3DJ 1Z91A 2ZXHA 3JXCL 3IH2A 1S5LC 2JPBA 2QWWA 5BPDA 1A5JA 2VONA 3FM3A 3DKXA 1TW2A 1YW7A 2A61A 1REPC 5D6FA 2E34A 2GRLA 2VE8A 1XDUA 4MCXA 2V26A 3P9IA 4LITA 3LFPA 1SANA 3I4PA 3J80Z 3S1NJ 2WC2A 3OYJA 5J1YA 5DCMB 3HOTA 2X4HA 3MVPA 4M3DA 2PXFA 2UV1A 2DOAA 1NG7A 1R58A 4IRGA 2A6CA 2FBIA 4DYRA 3GTLJ 5D5VB 1FY7A 2LVSA 3GZ5A 5GAHi 2DJIA 3ELKA 3JAMK 2W7NA 1F5TA 2WA0A 3QQ6A 2RKHA 2K9LA 5BOXA 5BS6A 2EPFA 4IHWA 5CVVA 1B59A 4F91B 2IGKA 2OD5A 2LKPA 4BJ6C 5HDNA 2GA1A 5ICCA 2QVOA 5LHHA 5DTQA 2MABA 1X3UA 3ZN1A 4DBQA 2UUZA 3R6SA 1S29A 1ZN2A 3NRVA 4RGUA 2KRCA 4I0AA 1W5CC 5J3LA 3I4MJ 1IDZA 3PXPA 3CROL 3CO6C 2HOSA 3MWMA 2CV2A 3FMSA 4HF2A 3QOXA 2FMYA 3IC7A 2G7HA 4C2MJ 1WJDA 2M4KA 5BQTA 4XN3A 4IRHA 3AAFA 2XHKA 3ABLH 3HL2A 2XIGA 1GUUA 3RZZA 4XLAA 1BJAA 2ETHA 1ZQ3P 1BR4A 1O4XA 1YFHA 2WUSR 2E1MC 2ZFUA 3ESWB 1QNTA 3RQIA 2NNYA 4YEJA 3MLFA 1IXCA 4X4DA 1QU3A 3F8CA 3BCBA 1Z05A 5IT9K 2HS5A 3I4NJ 2KHMA 3OYLA 2HQNA 3HGGA 2K86A 1UHMA 1ZAOA 4HDUA 1DU0A 4ESBA 2HCNA 4ESFA 1MNMC 3VWBA 2PUAA 3S15J 1ETWA 1S7OA 2PLYA 3FXOA 1K4SA 3CC4I 1NK3P 4AWXB 3Q3SA 4E7JA 3ERMA 3WTWC 3S3MA 5D5XB 1OISA 4IHYA 2A69F 1BN5A 2E1OA 4HNVA 3S2DJ 3WTVC 4MIMA 1BC7C 4CCNA 4XSXF 1WRJA 1YRNA 4A3MJ 3PJRA 3BDNA 4I98B 3CLQA 3BG9A 1ZGAA 1GVDA 4Z5CA 3D0SA 2JZYA 3GTGJ 1Z21A 1X4OA 2JRMA 1R9TJ 4RGRA 1LE8B 4PU3C 4M6YA 3OS0A 1J75A 2NVXJ 4Q48A 3R0JA 4XKBA 3F8FA 3QU6A 3BCAA 2X6OA 3OIQA 3VEPA 3O6BB 3HXLA 1ETYA 2PX9A 3GVAA 3K1MA 3J81K 4J01A 3FKJA 3T0YA 1QO0D 3HOYJ 4ZZLA 3SZGA 1NERA 2YR2A 5FD6A 4N4OB 3RKYA 5F1JA 2PG4A 1E3OC 4JP0A 1TP4A 1R00A 1WWXA 3REOA 1Z7LA 1LNWA 4ABZA 1FOYA 4L5JA 2BNNA 2M4HA 3LSKA 1VF9A 1LMB3 3ZPLA 1BBYA 3HUGB 1CGPA 1IF1A 1TT0A 3BG3A 4ZYHA 1IGNA 4E7HA 1HDDC 4KISA 1UG0A 2HWVA 2Y0MA 3K1NA 3CMEI 3C7JA 3FXJA 5E79C 1LJ9A 2M0CA 4KIFA 3ECOA 1G4DA 3GZDA 1T0FC 3A9XA 4XN0A 3PSIA 2QM3A 3K4KA 3M07A 1HC8A 1LDDA 2CU7A 2F5DA 3QYBA 4D5FA 2L5QA 2ZXIA 1HSJA 2EBIA 1P4WA 5FLMJ 3GTMJ 2VKDA 4XRSG 1KYWA 1Q1HA 1PNRA 2R1JL 4CZZA 4HBLA 2FOWA 3HRMA 3K10A 3L2QA 4YG4A 2R7TA 3LSPA 1EA3A 1TZLA 1G3SA 5FKNA 2BEOA 2MW8A 2F5FA 2HCSA 2IU7A 1FOWA 3WHCA 2XGDA 2PXVA 4JX5A 4IZZA 1FEXA 2AQFA 2EQRA 3MAJA 4WVLA 2L7ZA 2VC0A 3TO9A 3V7RA 3SEQA 5E3MA 4YBAA 2N8GA 1VQ4I 1ETVA 2KJCA 4OWRB 1FTZA 2FJRA 1TWGJ 2HPIA 4U7DA 2KLOA 3I58A 3CUQC 3AL0C 3ZN0A 2PXLA 2R5YB 3OIPA 5BNGA 3N05A 3GXOA 4RAZA 4LK0F 4B8XA 3HOVJ 2J7UA 2DDAA 2IXSA 2GIZA 1E17A 2NOGA 4A0ZA 2CQKA 5FLXK 2HDCA 3H35A 4CICA 2DPUA 1TBXA 3ERED 5CLSA 2AXTC 1P4XA 5DSXA 3GFMA 1BIBA 1P92A 4M6VA 1VPWA 2Y48A 4A0XA 2DA3A 4C9YA 3GEZA 1SAUA 2HINA 3HKZN 3IH4A 4GYIA 2AHQA 2E71A 2IRFG 2BZTA 2MQKA 3E3VA 2PE5A 2Y2ZA 2E36A 4Y13A 3H36A 2PMZA 2L01A 1FPQA 2MYSA 4NB5A 2KPJA 4I99C 2PFBA 3ZQIA 4ZDLA 3ZGKA 4AIJA 2D45A 4OIQF 3K6GA 2NRAC 3HEFA 3VYRB 3EUHC 5TRDA 4LLLA 4ER5A 4BHCA 3EYIA 2DYSH 2GM4A 2M45A 3DBLB 1JT0A 3H9JA 1IN4A 4ZH4F 4YIRX 2JA7J 5DTDA 1BJZA 2NNNA 4GXOA 2KL4A 4RS8A 3BPXA 2LY2A 5DEQA 3H1CA 1EJ9A 2L02A 1SFKA 2LYSA 2O49A 1D5VA 2R5ZB 3DEEA 3HKZA 3FXKA 3K0LA 3O8GA 2Q2EA 3ULQB 2EFWA 4YARA 4ENMA 3W6VA 5D6EA 2VBYA 5HODA 1W0TA 2LYRA 3NZLA 1SD7A 4Q47A 3UKGA 1T39A 3BR3A 3GTKJ 1JH9A 1A35A 3BG5A 4IWRA 2O7OA 2W4SA 4RAGA 4BNCA 3PFYA 2LY1A 2LTPA 3ZMTA 3ZQHA 4S04A 1WQ2A 2IVQA 4I6RA 4RDUA 3M3YJ 3SXYA 5E20A 2VJJA 3HDDA 3JXDL 3IV5A 1HLVA 2XGEA 1UTXA 3QOWA 2M0MA 1R4MB 4HRAA 2VOPA 1OCZH 2DFEA 5HLIA 4FISA 1VQ9I 2R7VA 3BT9A 3J7ZI 3PO3J 2LYPA 1FX7A 2CS3A 5IYDJ 4AVPA 1PUEE 4FQGA 5FKLA 5KNLA 3F23A 2JQEA 2HVQA 3HSFA 3RPUA 3QP6A 1KYZA 2NYXA 4I02A 3TEPA 5C4JJ 4A3BJ 3WTXC 2O61A 4M9ZA 2JUGA 5GADJ 4ZYEA 3LSGA 3G71I 4U87A 1HKSA 5CVUA 3KE2A 1Y1WJ 2DA5A 3GUDA 4HSRA 1R36A 5FKMA 3G4SI 4EVIA 5ICGA 1XPXA 4Y42A 4JQDA 4UY8I 1CF7B 4ESJA 2I5UA 2W48A 4C3JJ 1T33A 3JSOA 1DDNA 2GZUA 3KP2A 2PXKA 1LFUP 4OOIA 1T98A 3FK7A 3F21A 4GO1A 2L9SA 2LBFA 2RQQA 1NH3A 1X1PA 4KJZA 5F1RA 4CXFA 5M5YJ 2FRHA 1B9NA 2FJ1A 3BJAA 3DEUA 2WTEA 3LISA 4X4GA 1IZ1A 1QVUA 1X57A 4J1XA 2ZXJA 2LH9A 4NC7A 2K7LA 4O5VA 3DPTA 1N25A 3TP0A 3TFLA 2V6CA 2IV1A 2XRLA 3BDDA 1MBGA 3HHGA 2VQGA 4CCKA 3GO5A 2EZHA 2LOOA 3FXRA 4EGYA 2NVTJ 3FYAA 3CJNA 4ETSA 3JRDA 5D4SA 1RUNA 1XMXA 3PIOF 5CYVA 2AQEA 1Z6TA 3OMYA 3W2AA 2AO9A 1WJCA 2K3PA 3R61A 5CVJA 1Y7YA 3U1DA 2BJCA 2W24A 3K2AA 2ECCA 4HQMA 2VKHA 3A1YA 4FE4A 5HLGA 2K9NA 3S17J 2I8DA 5F64A 3GFLA 3LA2A 4I0BA 2CQNA 2EFQA 2CUEA 2O8KA 2ZKZA 2BE5F 4BQOA 1P4AA 2XRNA 3CUQA 4LIUA 4YG7B 2DU9A 3QWLA 1X2LA 2DMTA 2M2EA 2JK3A 3OYNA 5FLVA 2VKEA 1H88C 4NNJA 4UNOA 1JGSA 3K4LA 2VJ5A 1D1BA 2QF7A 2W1OA 5DUKA 3NARA 1Y8RB 1MBKA 2AXVA 3BWGA 2EF8A 1V4RA 3HZIB 4UUTA 2DT6A 4G7OF 4IPAA 3PNYA 1USTA 4BS9A 4OIOF 5LRSA 3HZJA 1I6HJ 3M8FA 2XPVA 4A12A 2LC2A 4J00A 3BLYA 3SZTA 3RJPA 2HNHA 3HJEA 4M6XA 3A02A 3ML6A 2H94A 3FMQA 2VQLA 2XAQA 2R5YA 4OMYA 4OAZA 1DU6A 4XOTA 4LGWA 1IN5A 2PUBA 2F4IA 2CSFA 3OP9A 4HV5A 3EUAA 4G94A 2A05A 5JFRA 1W7PB 3C1DA 4RLQA 4EQZA 2QZ8A 2HTJA 2EZKA 2LMDA 3K9TA 3KEQA 3QYEA 1IN6A 2Z5UA 1OCCH 3K4JA 1ZRFA 3L9FA 3Q9SA 4HNUA 1DUXC 4MQ9F 3FX3A 4BQQA 1V5EA 4FX4A 1AKHB 2PUFA 3H5RA 5K5RA 3NROA 4Y17A 4ENJA 1OMIA 1U9OA 4D9JA 3G6EI 2EINH 2H6BA 5H20A 4M3FA 4XONA 3CMAI 2V6EA 1BI2A 3EUKL 3E6BA 2DMNA 1B1BA 2FQ3A 3HPHA 2IS1A 3T1BA 3IVPA 3OL3A 5LEJA 1ODDA 4WXHA 2BY2A 1UFMA 4A6EA 4YRVA 3KP4A 1PDNC 3BOQA 3BR0A 2X1CA 2JMWA 3F9KA 3TKYA 5B66C 2FBHA 1R71A 3CLCA 2XB0X 1BDIA 3LSRA 2WAQN 1K83J 2E19A 4V2GA 2HEOA 2R7QA 3T8TA 2L9VA 3HUGA 1K4TA 3M9AA 1IUYA 1U3EM 1FMVA 2ID3A 3KP3A 3J80K 5AIQA 2E2JJ 4ER0A 1P7IA 3J81Z 3S3OA 4BEHB 1OYWA 1ON2A 4ASNA 3RSNA 2MD0A 4B44A 1YRNB 2STWA 1PVEA 2IS2A 2XF6A 1DW9A 3TOAA 3PQJA 2PUCA 2F5VA 5E17F 3QOPA 4ZZDA 1FBSA 2FF4A 2Y9ZA 2M7AA 1NG6A 2MC3A 1MSFC 2K9SA 3LSTA 4HW0A 4PJ0C 1QA6A 3CTAA 3HB9A 4X4BA 1JXSA 4MFEA 2QBYA 3ASOH 1ZPQA 2VBWA 1WCMJ 5DD8A 4CSWA 1DULA 4J19A 1MJAA 4LIVA 3OYKA 2CFOA 5A2QZ 1ZRDA 3ZCOA 1UXDA 2YX7A 3FIWA 3CECA 1EH7A 3GZ6A 1HW2A 3B6CA 1VTNC 4HA8A 3V8LA 1IDYA 1QZXA 4FHTA 3HRSA 1ZGWA 1LEAA 4AYBN 3ZRGA 2E1NA 2O8XA 5E3OA 2WV1A 3QPTA 4C3IJ 4XL9A 1R69A 2GXGA 1BIAA 5CKTA 4LG3A 2O6GE 1RETA 2FFHA 1QZEA 4KA4A 2R7DA 1Z9CA
chains in the Genus database with same CATH topology
3RZZA 2HOTA 1ZQ3P 1O4XA 2WUSR 5F0FA 1U78A 3RQIA 3MLFA 4X4DA 1ETXA 2WB1N 1K61A 1ORKA 4X4HA 2DJNA 3I4NJ 1ADRA 2OR1L 1WPKA 4IEJA 1QPIA 1ZVVA 1ITYA 5E3NA 1IC8A 1XC5A 3HGGA 2IEKA 1F36A 4LOCA 3HOZJ 4I76A 1DU0A 1IUFA 3OSFA 3B6AA 2CQXA 4XRMA 2LKXA 1MNMC 2PUAA 3S15J 1ETWA 3HGYA 1TWAJ 1NK3P 3Q3SA 4IHYA 1RESA 3RZOJ 2LYQA 2E1OA 4HNVA 3S2DJ 5DS9A 2MSYA 4A3FJ 4MIMA 3Q0WA 1YRNA 4A3MJ 2VPRA 3G1MA 3JRGA 3BDNA 1MSEC 1PRVA 1U9NA 1JTXA 2LFBA 3BG9A 1GVDA 3MKLA 4W1UA 1JKPC 1B72A 5FKOA 3S2HJ 3GTGJ 4Z5CA 1DWKA 5C4XJ 3S14J 1R9TJ 3HOUJ 3HBLA 2GBYA 3BTIA 1B72B 2CJJA 2M34A 1PUFB 1LE8B 4I6UA 4PU3C 1P7JA 5EEAA 2NVXJ 1MBEA 2JCGA 4D7MA 1OJLA 2ME0A 2X9DA 1PERL 2X6OA 4AUXA 2R5ZA 2MGQA 1TC3C 1GT0C 2NVQJ 2KEJA 4A3LJ 1QPZA 1ETYA 5EG0A 2EZIA 3SDGA 4FBIA 3QF3A 1Y1VJ 3BD1A 3HOYJ 1POUA 1L1MA 2R0QC 2M9HA 1NERA 3B7HA 3FK6A 1UHSA 2WIUB 5GPAA 3BTCA 5F1JA 1APLC 4O8BA 4MFDA 2IAIA 4I8TA 1E3OC 4JP0A 2Y0SN 4A3GJ 1QQBA 2JA5J 2LK2A 4QIWN 2EWTA 4I6TA 4ABZA 2LY9A 4G12A 3BR1A 5GP9A 2ZB9A 2BNNA 5M3MJ 5C3EJ 1VF9A 1LMB3 1JT6A 1MH4A 3BG3A 1IGNA 5K98B 1HDDC 3GTJJ 1UG2A 1X2NA 3IH3A 1NEQA 2B63J 2L49A 2M0CA 1HF0A 4AC0A 3C2BA 1ZZ7A 1JTYA 2R7ZJ 3L1PA 2HOAA 1VFCA 1FIPA 4DZPA 2VKVA 1QP7A 2TCTA 3E7LA 2R92J 4I6ZA 2XJ3A 3MN2A 2CU7A 3DNVB 2OF7A 1NK2P 4D5FA 1Q1VA 4C3HJ 1JFSA 3BR5A 1JKOC 2EBIA 5FLMJ 3GTMJ 3SJMA 4XRSG 3F6WA 2LCVA 1QRYA 1PNRA 4JCXA 3DEWA 2ECBA 3JRBA 3TEDA 4GHJA 2Y30A 3JREA 2R1JL 2MG4A 2AUWA 4YG4A 2DMPA 2IBDA 3JRHA 1ZZ6A 1WI3A 2JJ7A 3U3WA 3LSPA 2HI3A 4A3EJ 5FKNA 2MW8A 3OQNA 2IU7A 1AKHA 1Y9QA 3WHCA 2XGDA 1QP4A 4B4CA 2LD5A 4JX5A 1FEXA 5EDNA 2EQRA 3SCHA 5K7ZA 2L7ZA 2QCOA 3JRAA 1ZAYA 2K9QA 5E3MA 4YBAA 2N8GA 1ETVA 1FTZA 2FJRA 1BW6A 1TWGJ 1VI0A 5IPAA 4D7NA 3ZHIA 2LP0A 3ZOBA 5JLXA 2ICPA 3GN5A 4CYCB 1HDPA 1Z77A 3TRBA 2E2IJ 1B0NA 1BA5A 3NAUA 2ICTA 1RKWA 2AXZA 2R5YB 3CDLA 5BNGA 2RAEA 3HOVJ 1W0UA 4UUSA 2HSGA 1ZK8A 2NOGA 1POGA 1XWRA 2XIUA 4EEFG 2XB5A 3BR2A 2LYJA 2FX0A 4X4EA 3JXBC 4JX6A 5EGOA 2MEZA 4DZJA 1RZRA 4M6VA 4IHXA 2Y9YA 2XCJA 1VPWA 2DA3A 1CJGA 3BS3A 1XS9A 2HINA 3HKZN 1ZUGA 1ZZBA 3IH4A 2AHQA 2MQKA 2PE5A 2Y2ZA 1WH7A 2XSDC 2DTZA 2PUEA 2DA1A 2YUSA 2JA8J 4XIDA 2KPJA 3ZQIA 2EZLA 1HCRA 2DA2A 2I10A 4B1RA 1WH8A 3HEFA 2COBA 4BKXA 2GM4A 1JT0A 3VK0A 3TW6A 2JA7J 3ZKCA 5DTDA 1BJZA 4BY7J 2AWIA 3A01B 3BTJA 3BTLA 4Z59A 3HOWJ 2NS7A 2O4AA 3FKIJ 1I50J 2CUFA 5EYRA 5C44J 2O49A 2LYSA 2JN6A 3Q0VA 2R5ZB 5F0HA 4YG1A 1D5YA 5IP6A 4PU7A 3O8GA 2E2HJ 1H8AC 4YARA 3F0CA 3W6VA 3FISA 4L5EA 2HQ5A 4Y7NJ 5HODA 5J1UA 1W0TA 4GFBA 2LYRA 3HM5A 3UKGA 3GTKJ 3BR3A 2B5AA 4B3AA 1JH9A 3SFIA 1JKRC 1LCDA 3BG5A 4IWRA 2O7OA 1R63A 1WIZA 2KT0A 3G1LA 3OQOA 1IG7A 2LTPA 3ZQHA 4RBOA 4BY1J 3BQZA 4A3IJ 2O9LA 3G1OA 5E3LA 5EF6A 4XRSA 4RDUA 2IVQA 2LYLA 5K7HA 3M3YJ 4CYCA 1ZR2A 3HDDA 3JXDL 4GQMA 3IV5A 1HLVA 2XGEA 3S16J 1JKQC 2ID6A 1UTXA 2PIJA 4X1EA 1QP0A 4QTRA 3GBGA 1F43A 1QVTA 3TP3A 3G7DA 4BBRJ 4J1WA 1IJWC 1ZZ9A 4DW6A 3GTQJ 4FISA 4MCTA 1BW5A 4M3GA 2G0EA 3BT9A 3JRCA 3PO3J 2EBYA 2LYPA 2KEIA 1GDTA 5IYDJ 1LFBA 3QWGA 5K7FA 5FKLA 2IVGA 1ZZ8A 3DCFA 2LLKA 4A3JJ 4W97A 3JRFA 3OIOA 4DYQA 4V2FA 5C4JJ 4A3BJ 1AU7A 1CQTA 3JRIA 4BBSJ 3ZQCA 2PUGA 3LSGA 2ME6A 3S8QA 1Y1WJ 2IUOA 3ZHMA 2DA5A 4Z5DA 2DN0A 5FKMA 5IYCJ 2Y31A 4Y42A 4JQDA 1RIOA 1LLIA 1TWHJ 4A93J 2W48A 4C3JJ 2VUMJ 1T33A 2GZUA 1LFUP 3GBFA 3LNQA 3FK7A 5M5XJ 2VI6A 1B8IA 4NDLA 5M5WJ 2ELKA 2CQQA 4QSHA 2KZ8A 4OB4A 5M5YJ 1RR7A 2D5VA 3ZQLA 2JA6J 3FMYA 2FJ1A 1UXCA 1PRAA 3LISA 4X4GA 1QVUA 1X57A 2DMUA 4J1XA 1FIAA 1RZRD 4PU8A 4S0HB 4D5CA 4F8DA 1ETKA 1PUFA 1LE8A 2R63A 4IA8A 3UFDA 3TP0A 2IV1A 2O38A 2XRLA 1MBGA 3S1MJ 1G2HA 2EZHA 3CQZJ 1OCPA 1BL0A 1LQCA 2NVTJ 4FE7A 3FYAA 1WGXA 3JR9A 2AW6A 3JRDA 1JGGA 2DA7A 4JX4A 3S1QJ 3KJXA 1UMQA 1TWCJ 1X2MA 4FCYA 2AO9A 1HOMA 2GRMA 1Y7YA 2BJCA 3K2AA 2ECCA 2M8GX 3A03A 5F0CA 1ZR4A 5FJ8J 2NS8A 4FE4A 1EFAA 2JWTA 4M3BA 5EZGA 2GLOA 4XK4A 2K9NA 2FQ4A 3S17J 1ZKGA 1SQ8A 3F51A 1ETQA 1RKTA 3PO2J 2KDZA 2CROA 2H8RA 2X48A 2L8NA 1BDHA 1MBHA 2CUEA 1WETA 2O8KA 1JFTA 2XPWA 3BQYA 3D1NI 5F04A 2XPUA 4M3EA 5EG0B 3H3VK 1OCTC 4YG7B 1X58A 1X2LA 2DMTA 2M2EA 3OQMA 1JUMA 2JK3A 5FLVA 1JUPA 2VKEA 1H88C 5IP9J 2LYKA 1EF4A 2QF7A 3QQAA 2K40A 3NARA 1B8IB 1MBKA 2L7FP 3GTPJ 5J1RA 1PRUA 2AXVA 2XI8A 2EF8A 3HZIB 4UUTA 4FTHA 4Y52J 4X4CA 1TWFJ 3RZDJ 4IHVA 2JVLA 1IRZA 3QYXA 3HOXJ 1I6HJ 2LR8A 2XPVA 1VNDA 4PU4C 4BXXJ 3GN5B 9ANTA 2PPXA 4A3CJ 3A02A 4JYKA 1OSLA 1GV2A 1ZTRA 2R5YA 1DU6A 2NVYJ 3GTOJ 2PUDA 2DA6A 5F27A 2OFYA 4X6AJ 3QPSA 1NTCA 2DMQA 1JUSA 3A01A 2PUBA 1JJ6C 3KZ3A 2CSFA 1Z0XA 2HYJA 1ZZCA 3OP9A 1A6IA 3QPLA 4A3KJ 2BNOA 5IYBJ 4Z58A 3G5GA 2EZKA 1SFOJ 4I6RA 4JCYA 3F52A 4MO7A 2H1KA 1MBJA 3H0GJ 2R93J 3H5TA 1AKHB 2PUFA 1XG1A 1FTTA 1U9OA 3ZQGA 2L7MP 3ZQFA 3R1FA 3VPRA 3PM1A 2FD5A 5EGOB 3SCGA 5F08A 1JJ8C 4Z5HA 1QQAA 1ETOA 4X4FA 2CRGA 4M3FA 5IP7J 1MBFA 5GPCA 3OSGA 2DMNA 4UUSB 2XGCA 1IV6A 2L9RA 1T56A 3CCYA 1AHDP 3IVPA 1RPEL 5FKKA 4A3DJ 4XICA 3JXCL 3IH2A 5EZHA 1A5JA 3BR0A 3SCFA 3LOCA 3LSJA 2JMWA 2KEKA 3BR6A 3CLCA 2OPTA 2XB0X 3K7AJ 2GRLA 1BDIA 2YU9J 3LSRA 2WAQN 1K83J 2E19A 4V2GA 2YS9A 1OFCX 1I3QJ 3TW7A 1FJLA 4MCXA 3FYMA 3LFPA 3OMTA 2P81A 1SANA 1ENHA 2AXUA 2BNMA 4MLOA 2HXOA 2ID3A 5IOYA 3RKQA 3S1NJ 3M4OJ 3Q0UA 5M3FJ 2E2JJ 1P7IA 3OOUA 2L0KA 5J1YA 3S1RJ 1RPWA 3MVPA 4M3DA 1YSEA 1YRNB 2PMZN 1DW9A 2A6CA 2PUCA 3KXAA 4NDWA 4DYRA 3GTLJ 3CMYA 2LVSA 2Y9ZA 2HXIA 2HDDA 1MSFC 3QQ6A 2K9SA 1WH5A 1GV5A 1LCCA 3HB9A 4A69C 4IHWA 4X4BA 4MFEA 5A7LA 1S7EA 1ZPQA 3O9XA 1WCMJ 4J19A 4DYCA 2EH3A 2TRTA 5IOZA 3WHBA 1UXDA 2DA4A 3FIWA 3CECA 1JWLA 5J3LA 3B6CA 3I4MJ 5JLWA 3PXPA 1IDZA 1WH6A 4FN3A 1IDYA 1MH3A 1H89C 3CROL 3O8HA 1ZGWA 4X4IA 1ZS4A 4AYBN 2HOSA 2IVBA 1RZSA 5E3OA 2WV1A 4IVZA 4C3IJ 4C2MJ 1U8BA 1R69A 3EUSA 1RETA 1GUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZZ A;  2HOT A;  1ZQ3 P;  1O4X A;  2WUS R;  5F0F A;  1U78 A;  3RQI A;  3MLF A;  4X4D A;  1ETX A;  2WB1 N;  1K61 A;  1ORK A;  4X4H A;  2DJN A;  3I4N J;  1ADR A;  2OR1 L;  1WPK A;  4IEJ A;  1QPI A;  1ZVV A;  1ITY A;  5E3N A;  1IC8 A;  1XC5 A;  3HGG A;  2IEK A;  1F36 A;  4LOC A;  3HOZ J;  4I76 A;  1DU0 A;  1IUF A;  3OSF A;  3B6A A;  2CQX A;  4XRM A;  2LKX A;  1MNM C;  2PUA A;  3S15 J;  1ETW A;  3HGY A;  1TWA J;  1NK3 P;  3Q3S A;  4IHY A;  1RES A;  3RZO J;  2LYQ A;  2E1O A;  4HNV A;  3S2D J;  5DS9 A;  2MSY A;  4A3F J;  4MIM A;  3Q0W A;  1YRN A;  4A3M J;  2VPR A;  3G1M A;  3JRG A;  3BDN A;  1MSE C;  1PRV A;  1U9N A;  1JTX A;  2LFB A;  3BG9 A;  1GVD A;  3MKL A;  4W1U A;  1JKP C;  1B72 A;  5FKO A;  3S2H J;  3GTG J;  4Z5C A;  1DWK A;  5C4X J;  3S14 J;  1R9T J;  3HOU J;  3HBL A;  2GBY A;  3BTI A;  1B72 B;  2CJJ A;  2M34 A;  1PUF B;  1LE8 B;  4I6U A;  4PU3 C;  1P7J A;  5EEA A;  2NVX J;  1MBE A;  2JCG A;  4D7M A;  1OJL A;  2ME0 A;  2X9D A;  1PER L;  2X6O A;  4AUX A;  2R5Z A;  2MGQ A;  1TC3 C;  1GT0 C;  2NVQ J;  2KEJ A;  4A3L J;  1QPZ A;  1ETY A;  5EG0 A;  2EZI A;  3SDG A;  4FBI A;  3QF3 A;  1Y1V J;  3BD1 A;  3HOY J;  1POU A;  1L1M A;  2R0Q C;  2M9H A;  1NER A;  3B7H A;  3FK6 A;  1UHS A;  2WIU B;  5GPA A;  3BTC A;  5F1J A;  1APL C;  4O8B A;  4MFD A;  2IAI A;  4I8T A;  1E3O C;  4JP0 A;  2Y0S N;  4A3G J;  1QQB A;  2JA5 J;  2LK2 A;  4QIW N;  2EWT A;  4I6T A;  4ABZ A;  2LY9 A;  4G12 A;  3BR1 A;  5GP9 A;  2ZB9 A;  2BNN A;  5M3M J;  5C3E J;  1VF9 A;  1LMB 3;  1JT6 A;  1MH4 A;  3BG3 A;  1IGN A;  5K98 B;  1HDD C;  3GTJ J;  1UG2 A;  1X2N A;  3IH3 A;  1NEQ A;  2B63 J;  2L49 A;  2M0C A;  1HF0 A;  4AC0 A;  3C2B A;  1ZZ7 A;  1JTY A;  2R7Z J;  3L1P A;  2HOA A;  1VFC A;  1FIP A;  4DZP A;  2VKV A;  1QP7 A;  2TCT A;  3E7L A;  2R92 J;  4I6Z A;  2XJ3 A;  3MN2 A;  2CU7 A;  3DNV B;  2OF7 A;  1NK2 P;  4D5F A;  1Q1V A;  4C3H J;  1JFS A;  3BR5 A;  1JKO C;  2EBI A;  5FLM J;  3GTM J;  3SJM A;  4XRS G;  3F6W A;  2LCV A;  1QRY A;  1PNR A;  4JCX A;  3DEW A;  2ECB A;  3JRB A;  3TED A;  4GHJ A;  2Y30 A;  3JRE A;  2R1J L;  2MG4 A;  2AUW A;  4YG4 A;  2DMP A;  2IBD A;  3JRH A;  1ZZ6 A;  1WI3 A;  2JJ7 A;  3U3W A;  3LSP A;  2HI3 A;  4A3E J;  5FKN A;  2MW8 A;  3OQN A;  2IU7 A;  1AKH A;  1Y9Q A;  3WHC A;  2XGD A;  1QP4 A;  4B4C A;  2LD5 A;  4JX5 A;  1FEX A;  5EDN A;  2EQR A;  3SCH A;  5K7Z A;  2L7Z A;  2QCO A;  3JRA A;  1ZAY A;  2K9Q A;  5E3M A;  4YBA A;  2N8G A;  1ETV A;  1FTZ A;  2FJR A;  1BW6 A;  1TWG J;  1VI0 A;  5IPA A;  4D7N A;  3ZHI A;  2LP0 A;  3ZOB A;  5JLX A;  2ICP A;  3GN5 A;  4CYC B;  1HDP A;  1Z77 A;  3TRB A;  2E2I J;  1B0N A;  1BA5 A;  3NAU A;  2ICT A;  1RKW A;  2AXZ A;  2R5Y B;  3CDL A;  5BNG A;  2RAE A;  3HOV J;  1W0U A;  4UUS A;  2HSG A;  1ZK8 A;  2NOG A;  1POG A;  1XWR A;  2XIU A;  4EEF G;  2XB5 A;  3BR2 A;  2LYJ A;  2FX0 A;  4X4E A;  3JXB C;  4JX6 A;  5EGO A;  2MEZ A;  4DZJ A;  1RZR A;  4M6V A;  4IHX A;  2Y9Y A;  2XCJ A;  1VPW A;  2DA3 A;  1CJG A;  3BS3 A;  1XS9 A;  2HIN A;  3HKZ N;  1ZUG A;  1ZZB A;  3IH4 A;  2AHQ A;  2MQK A;  2PE5 A;  2Y2Z A;  1WH7 A;  2XSD C;  2DTZ A;  2PUE A;  2DA1 A;  2YUS A;  2JA8 J;  4XID A;  2KPJ A;  3ZQI A;  2EZL A;  1HCR A;  2DA2 A;  2I10 A;  4B1R A;  1WH8 A;  3HEF A;  2COB A;  4BKX A;  2GM4 A;  1JT0 A;  3VK0 A;  3TW6 A;  2JA7 J;  3ZKC A;  5DTD A;  1BJZ A;  4BY7 J;  2AWI A;  3A01 B;  3BTJ A;  3BTL A;  4Z59 A;  3HOW J;  2NS7 A;  2O4A A;  3FKI J;  1I50 J;  2CUF A;  5EYR A;  5C44 J;  2O49 A;  2LYS A;  2JN6 A;  3Q0V A;  2R5Z B;  5F0H A;  4YG1 A;  1D5Y A;  5IP6 A;  4PU7 A;  3O8G A;  2E2H J;  1H8A C;  4YAR A;  3F0C A;  3W6V A;  3FIS A;  4L5E A;  2HQ5 A;  4Y7N J;  5HOD A;  5J1U A;  1W0T A;  4GFB A;  2LYR A;  3HM5 A;  3UKG A;  3GTK J;  3BR3 A;  2B5A A;  4B3A A;  1JH9 A;  3SFI A;  1JKR C;  1LCD A;  3BG5 A;  4IWR A;  2O7O A;  1R63 A;  1WIZ A;  2KT0 A;  3G1L A;  3OQO A;  1IG7 A;  2LTP A;  3ZQH A;  4RBO A;  4BY1 J;  3BQZ A;  4A3I J;  2O9L A;  3G1O A;  5E3L A;  5EF6 A;  4XRS A;  4RDU A;  2IVQ A;  2LYL A;  5K7H A;  3M3Y J;  4CYC A;  1ZR2 A;  3HDD A;  3JXD L;  4GQM A;  3IV5 A;  1HLV A;  2XGE A;  3S16 J;  1JKQ C;  2ID6 A;  1UTX A;  2PIJ A;  4X1E A;  1QP0 A;  4QTR A;  3GBG A;  1F43 A;  1QVT A;  3TP3 A;  3G7D A;  4BBR J;  4J1W A;  1IJW C;  1ZZ9 A;  4DW6 A;  3GTQ J;  4FIS A;  4MCT A;  1BW5 A;  4M3G A;  2G0E A;  3BT9 A;  3JRC A;  3PO3 J;  2EBY A;  2LYP A;  2KEI A;  1GDT A;  5IYD J;  1LFB A;  3QWG A;  5K7F A;  5FKL A;  2IVG A;  1ZZ8 A;  3DCF A;  2LLK A;  4A3J J;  4W97 A;  3JRF A;  3OIO A;  4DYQ A;  4V2F A;  5C4J J;  4A3B J;  1AU7 A;  1CQT A;  3JRI A;  4BBS J;  3ZQC A;  2PUG A;  3LSG A;  2ME6 A;  3S8Q A;  1Y1W J;  2IUO A;  3ZHM A;  2DA5 A;  4Z5D A;  2DN0 A;  5FKM A;  5IYC J;  2Y31 A;  4Y42 A;  4JQD A;  1RIO A;  1LLI A;  1TWH J;  4A93 J;  2W48 A;  4C3J J;  2VUM J;  1T33 A;  2GZU A;  1LFU P;  3GBF A;  3LNQ A;  3FK7 A;  5M5X J;  2VI6 A;  1B8I A;  4NDL A;  5M5W J;  2ELK A;  2CQQ A;  4QSH A;  2KZ8 A;  4OB4 A;  5M5Y J;  1RR7 A;  2D5V A;  3ZQL A;  2JA6 J;  3FMY A;  2FJ1 A;  1UXC A;  1PRA A;  3LIS A;  4X4G A;  1QVU A;  1X57 A;  2DMU A;  4J1X A;  1FIA A;  1RZR D;  4PU8 A;  4S0H B;  4D5C A;  4F8D A;  1ETK A;  1PUF A;  1LE8 A;  2R63 A;  4IA8 A;  3UFD A;  3TP0 A;  2IV1 A;  2O38 A;  2XRL A;  1MBG A;  3S1M J;  1G2H A;  2EZH A;  3CQZ J;  1OCP A;  1BL0 A;  1LQC A;  2NVT J;  4FE7 A;  3FYA A;  1WGX A;  3JR9 A;  2AW6 A;  3JRD A;  1JGG A;  2DA7 A;  4JX4 A;  3S1Q J;  3KJX A;  1UMQ A;  1TWC J;  1X2M A;  4FCY A;  2AO9 A;  1HOM A;  2GRM A;  1Y7Y A;  2BJC A;  3K2A A;  2ECC A;  2M8G X;  3A03 A;  5F0C A;  1ZR4 A;  5FJ8 J;  2NS8 A;  4FE4 A;  1EFA A;  2JWT A;  4M3B A;  5EZG A;  2GLO A;  4XK4 A;  2K9N A;  2FQ4 A;  3S17 J;  1ZKG A;  1SQ8 A;  3F51 A;  1ETQ A;  1RKT A;  3PO2 J;  2KDZ A;  2CRO A;  2H8R A;  2X48 A;  2L8N A;  1BDH A;  1MBH A;  2CUE A;  1WET A;  2O8K A;  1JFT A;  2XPW A;  3BQY A;  3D1N I;  5F04 A;  2XPU A;  4M3E A;  5EG0 B;  3H3V K;  1OCT C;  4YG7 B;  1X58 A;  1X2L A;  2DMT A;  2M2E A;  3OQM A;  1JUM A;  2JK3 A;  5FLV A;  1JUP A;  2VKE A;  1H88 C;  5IP9 J;  2LYK A;  1EF4 A;  2QF7 A;  3QQA A;  2K40 A;  3NAR A;  1B8I B;  1MBK A;  2L7F P;  3GTP J;  5J1R A;  1PRU A;  2AXV A;  2XI8 A;  2EF8 A;  3HZI B;  4UUT A;  4FTH A;  4Y52 J;  4X4C A;  1TWF J;  3RZD J;  4IHV A;  2JVL A;  1IRZ A;  3QYX A;  3HOX J;  1I6H J;  2LR8 A;  2XPV A;  1VND A;  4PU4 C;  4BXX J;  3GN5 B;  9ANT A;  2PPX A;  4A3C J;  3A02 A;  4JYK A;  1OSL A;  1GV2 A;  1ZTR A;  2R5Y A;  1DU6 A;  2NVY J;  3GTO J;  2PUD A;  2DA6 A;  5F27 A;  2OFY A;  4X6A J;  3QPS A;  1NTC A;  2DMQ A;  1JUS A;  3A01 A;  2PUB A;  1JJ6 C;  3KZ3 A;  2CSF A;  1Z0X A;  2HYJ A;  1ZZC A;  3OP9 A;  1A6I A;  3QPL A;  4A3K J;  2BNO A;  5IYB J;  4Z58 A;  3G5G A;  2EZK A;  1SFO J;  4I6R A;  4JCY A;  3F52 A;  4MO7 A;  2H1K A;  1MBJ A;  3H0G J;  2R93 J;  3H5T A;  1AKH B;  2PUF A;  1XG1 A;  1FTT A;  1U9O A;  3ZQG A;  2L7M P;  3ZQF A;  3R1F A;  3VPR A;  3PM1 A;  2FD5 A;  5EGO B;  3SCG A;  5F08 A;  1JJ8 C;  4Z5H A;  1QQA A;  1ETO A;  4X4F A;  2CRG A;  4M3F A;  5IP7 J;  1MBF A;  5GPC A;  3OSG A;  2DMN A;  4UUS B;  2XGC A;  1IV6 A;  2L9R A;  1T56 A;  3CCY A;  1AHD P;  3IVP A;  1RPE L;  5FKK A;  4A3D J;  4XIC A;  3JXC L;  3IH2 A;  5EZH A;  1A5J A;  3BR0 A;  3SCF A;  3LOC A;  3LSJ A;  2JMW A;  2KEK A;  3BR6 A;  3CLC A;  2OPT A;  2XB0 X;  3K7A J;  2GRL A;  1BDI A;  2YU9 J;  3LSR A;  2WAQ N;  1K83 J;  2E19 A;  4V2G A;  2YS9 A;  1OFC X;  1I3Q J;  3TW7 A;  1FJL A;  4MCX A;  3FYM A;  3LFP A;  3OMT A;  2P81 A;  1SAN A;  1ENH A;  2AXU A;  2BNM A;  4MLO A;  2HXO A;  2ID3 A;  5IOY A;  3RKQ A;  3S1N J;  3M4O J;  3Q0U A;  5M3F J;  2E2J J;  1P7I A;  3OOU A;  2L0K A;  5J1Y A;  3S1R J;  1RPW A;  3MVP A;  4M3D A;  1YSE A;  1YRN B;  2PMZ N;  1DW9 A;  2A6C A;  2PUC A;  3KXA A;  4NDW A;  4DYR A;  3GTL J;  3CMY A;  2LVS A;  2Y9Z A;  2HXI A;  2HDD A;  1MSF C;  3QQ6 A;  2K9S A;  1WH5 A;  1GV5 A;  1LCC A;  3HB9 A;  4A69 C;  4IHW A;  4X4B A;  4MFE A;  5A7L A;  1S7E A;  1ZPQ A;  3O9X A;  1WCM J;  4J19 A;  4DYC A;  2EH3 A;  2TRT A;  5IOZ A;  3WHB A;  1UXD A;  2DA4 A;  3FIW A;  3CEC A;  1JWL A;  5J3L A;  3B6C A;  3I4M J;  5JLW A;  3PXP A;  1IDZ A;  1WH6 A;  4FN3 A;  1IDY A;  1MH3 A;  1H89 C;  3CRO L;  3O8H A;  1ZGW A;  4X4I A;  1ZS4 A;  4AYB N;  2HOS A;  2IVB A;  1RZS A;  5E3O A;  2WV1 A;  4IVZ A;  4C3I J;  4C2M J;  1U8B A;  1R69 A;  3EUS A;  1RET A;  1GUU A; 
#chains in the Genus database with same CATH topology
 1XMK A;  1X3W B;  3L2C A;  4PJM A;  4KN4 X;  2LG4 A;  2H1L A;  2E7X A;  3WTZ A;  4MNU A;  4BXF A;  1MMA A;  2F5E A;  2VIX A;  4EKG A;  1QPM A;  2WB1 N;  1K61 A;  3RQ4 A;  1ORK A;  2CG4 A;  4X4H A;  2DJN A;  3IL2 A;  1LFP A;  2FML A;  2WWY A;  1IC8 A;  3SDB A;  4L18 B;  3HOZ J;  5LGU A;  3H9Q A;  2CQX A;  1I3A A;  1S9H A;  1YW9 A;  4F3Q A;  4F55 A;  5K5Q A;  5L3D A;  2KIQ A;  3H5N A;  2ZSI B;  4QLC U;  1RES A;  2XXP A;  3F8N A;  1VQ6 I;  2LYQ A;  2GQQ A;  2TDX A;  1JHH A;  2KKO A;  4A3F J;  2ZNY A;  2BVM A;  4KN7 X;  3Q0W A;  4Z2Y A;  3G1M A;  3JRG A;  2PBI A;  1ZG1 A;  1PRV A;  1FC3 A;  1U9N A;  1WI9 A;  2LFB A;  1JKP C;  5LFA A;  3ABK H;  4V19 K;  1PUF B;  4H0E A;  4I6U A;  3ZMV A;  4IL6 C;  2Z16 A;  4DBR A;  5EEA A;  5HDK A;  1PP7 U;  1SVM A;  2F48 A;  4OAY A;  1OJL A;  4ZYD A;  5LRR A;  2MXD A;  4EKI A;  3E5X A;  3HG9 A;  4AUX A;  2R5Z A;  1GT0 C;  1QPZ A;  2EZI A;  2M1B A;  4HX8 A;  3QF3 A;  5HS7 A;  4AM3 A;  3FK6 A;  4LB6 B;  1UHS A;  5L3E A;  2ZNZ A;  2BXZ A;  3PNT A;  4OIR F;  4O8B A;  4MFD A;  2IAI A;  4CUG A;  2L1P A;  4P96 A;  5AON A;  2DQR A;  1MIJ A;  2XVC A;  1WZ2 A;  2Y0S N;  1K79 A;  3FMR A;  1X1D A;  3F72 A;  4EMS A;  2EWT A;  2LRD A;  5E1W A;  2XAU A;  3S32 A;  3BY6 A;  3DKW A;  5M3M J;  1ACI A;  5KAI C;  3TO6 A;  1JT6 A;  3TMO A;  3GTJ J;  2A6E F;  3TOB A;  2L49 A;  2B63 J;  4QPO A;  4EQQ A;  1HF0 A;  4AC0 A;  3WTT C;  2L7K A;  4ZC3 A;  2CYY A;  4DQ2 A;  1SEU A;  2E5N A;  1QP7 A;  2TCT A;  2J5O A;  1MND A;  3I3L A;  2XJ3 A;  3LQX A;  2F4M B;  4S05 A;  2JVH A;  2KIU A;  2EV5 A;  3WU1 B;  2MBF A;  3SJM A;  2JRT A;  3F6W A;  4JCX A;  2GAU A;  3DEW A;  3JRE A;  2ZCW A;  4WWC A;  2DMP A;  2PEX A;  1ZZ6 A;  1QB2 A;  1SFX A;  1XSD A;  4CZC A;  1YS6 A;  2Q2E B;  2HI3 A;  4A3E J;  2BVL A;  1AKH A;  3WU2 C;  1K7A A;  3OL4 A;  2GIV A;  3S3N A;  4IVN A;  2JA2 A;  3WGI A;  2LD5 A;  2QSG X;  2V1U A;  4U0W A;  1Y56 A;  5K7Z A;  2A68 F;  1IXR C;  4PSW A;  3JRA A;  3B02 A;  2FEZ A;  3CES A;  2FA5 A;  3EUH A;  4WCG A;  3NDB B;  3GN5 A;  5E8I A;  1HDP A;  3U21 A;  4IX7 A;  2HQR A;  4XLE A;  1B0N A;  2V4J C;  1BA5 A;  5DM6 F;  3ZPX A;  2ACJ A;  1E0E A;  1YTY A;  2JUC A;  2V1X A;  3C2G A;  1VQ8 I;  2JQ7 A;  4O6J A;  4C2U A;  2RAE A;  3VSK A;  2ESN A;  4RAY A;  4PFP A;  3DP7 A;  1W0U A;  2HSG A;  4HX7 A;  5D4R A;  2XB5 A;  3BR2 A;  2HZD A;  4JX6 A;  2XV4 S;  1SD6 A;  2V1N A;  1B9M A;  4KMF A;  1MMS A;  4P5O A;  2RGV A;  2Y9Y A;  2IGO A;  3QRF F;  3BS3 A;  1XS9 A;  3RDI A;  4LK1 F;  2QLZ A;  1WH7 A;  2HZT A;  1G3Y A;  1MDM B;  4N9H A;  1MMN A;  4GYG A;  4HLX A;  3J7A O;  5LGT A;  2P0W A;  2I10 A;  5DCM A;  4G7H F;  1E3H A;  5JUW A;  2DLL A;  5HLH A;  1FP1 D;  2W84 A;  2XAH A;  2W85 A;  2CGP A;  3BTJ A;  2QSF X;  1FMW A;  2O4A A;  3FKI J;  2CUF A;  2HVR A;  5EYR A;  5C44 J;  1T8I A;  2JN6 A;  5F0H A;  1IO2 A;  4EJO A;  1XCV A;  2DQL A;  5IY5 H;  3UNG C;  1H8A C;  2E2H J;  3FIS A;  3E6C C;  3E6M A;  5J1U A;  4OBM A;  3SYT A;  3DLA A;  4HV6 A;  1WVR A;  2CW7 A;  3MZH A;  3SFI A;  1JKR C;  4TV7 A;  1LCD A;  2P5L C;  4NUB A;  2Y69 H;  5D5W B;  2OCE A;  2MA3 A;  1F9N A;  5CQG A;  2XKP A;  2KT0 A;  1R63 A;  1WIZ A;  3BZ6 A;  2JTV A;  3RIR A;  4A3I J;  2LYL A;  4XRS A;  4WXD A;  2QKM B;  5KHD A;  3FXQ A;  1T0F A;  3M8J A;  4DIQ A;  3N97 A;  3QOE A;  4X1E A;  2FBK A;  3GWZ A;  3H9G A;  3I59 B;  1QVT A;  1RNL A;  2DO7 A;  2G0E A;  3CUQ B;  2DK8 A;  4IOA F;  1T08 B;  1GDT A;  3SR4 A;  4KFC A;  1F1Z A;  1OQY A;  1S7A A;  2LLK A;  2NS0 A;  4W97 A;  3JRF A;  3OIO A;  4DYQ A;  1SC7 A;  1L3L A;  1HBX G;  3BRO A;  1IN7 A;  3ROU A;  4DOZ A;  3ISP A;  1WFX A;  5K1Y A;  3RYP A;  4G8X A;  4BBS J;  3GLL A;  1HW1 A;  2OZ6 A;  1KA8 A;  2ADU A;  4Z5D A;  2DN0 A;  3OYC A;  1C0W A;  3EYY A;  3AKZ A;  1RIO A;  1XGO A;  1LLI A;  1U5T C;  2HYG D;  4L9T A;  5DTM A;  1I27 A;  3GBF A;  5J47 A;  1MNE A;  1B8I A;  3OY9 A;  3K4M A;  4NDL A;  3JTG A;  2A3S A;  2X51 A;  2EA4 A;  1W5S A;  4NC8 A;  4OB4 A;  1RR7 A;  2D5V A;  3ZQL A;  1UXC A;  5CQE A;  1SD4 A;  3E0J B;  2DMU A;  4JOM A;  2V9V A;  4PU8 A;  1I1G A;  4F8D A;  1ETK A;  3K69 A;  1LE8 A;  3UFD A;  3IWZ A;  1AOY A;  1LUJ B;  4QWQ A;  2KDO A;  1W7P A;  3ZXS A;  1OCP A;  2IVM A;  4MEY F;  1LQC A;  1SFE A;  1D3Y A;  4XLN F;  3GLX A;  1JGG A;  2E5Z A;  1X4P A;  2DA7 A;  1MW7 A;  3P9C A;  2CV0 A;  2QSH X;  4WK8 F;  3IKT A;  1UMQ A;  4RB0 A;  1TWC J;  3M7G A;  4JK1 X;  1T2K A;  2D1V A;  4FCY A;  1HOM A;  3GZD C;  3L7W A;  3OWT A;  4YFK F;  1ZHF A;  4R1H A;  2VEO A;  5E18 F;  3HTU A;  2QBY B;  1EFA A;  2JWT A;  5EZG A;  2LKS A;  4B48 A;  4IQ4 A;  1OLT A;  2GLO A;  2FQ4 A;  2EIJ H;  3KL4 A;  1ZKG A;  1SQ8 A;  1RKT A;  2VAS A;  1QHG A;  3JSP A;  2OAZ A;  3W6J B;  2CV1 A;  3PO2 J;  2CRO A;  3M1E A;  4P55 A;  3KX2 A;  4RLF A;  1BDH A;  1WET A;  4L9V A;  1PJR A;  4RA2 A;  1W36 D;  1LEB A;  2AXL A;  3D1N I;  1H9T A;  2OA4 A;  2KZG A;  4A5M A;  3A9Z A;  3HPG A;  4M3E A;  1OCT C;  1X58 A;  3D5S C;  2GOX B;  3AG3 H;  1JUM A;  2IW5 A;  4NBQ A;  2DFH A;  1JUP A;  3OYA A;  2R7R A;  3KLN A;  1RIO H;  1FOK A;  1DPR A;  4BJT A;  1G3W A;  3HC7 A;  4ENN A;  2QUF A;  2LYK A;  1EF4 A;  2KPM A;  1IXS B;  4FX0 A;  2XXA A;  1Y8Q B;  3GTP J;  5J1R A;  5D8K B;  4EAT A;  4EV0 A;  4EJT A;  2BY0 A;  3S8P A;  4FTH A;  2MC4 A;  4Y52 J;  4L9N A;  4UUV A;  2ELH A;  4F52 A;  3RZD J;  2JVL A;  2WY7 Q;  2RQP A;  4I01 A;  3QYX A;  1SD5 A;  3WG7 H;  3TBI A;  2LR8 A;  5FFX A;  2X6Y A;  3ZMS A;  4PU4 C;  4IRI A;  1XB4 A;  2IP2 A;  2M5W A;  3GN5 B;  4NQW B;  1XD7 A;  4KUM A;  3VYS B;  4A3C J;  2HTS A;  3VYT B;  5J8C A;  1ZTR A;  1XN7 A;  3G2B A;  1E3P A;  1FLI A;  1WJF A;  3H5A A;  3GTO J;  2DA6 A;  2DMQ A;  1JUS A;  1YHQ I;  4Q2J A;  3R0A A;  2HYJ A;  5JI6 A;  4D0P A;  1GHC A;  4A3K J;  1HXD A;  3G5G A;  4EGZ A;  2F4O B;  1WHU A;  5ILV A;  4OMZ A;  3F52 A;  2KRF A;  3CJR B;  5CVI A;  2H1K A;  1MBJ A;  5GAE J;  3H0G J;  3H5T A;  4UVA A;  2X85 A;  3BG7 A;  1FP2 A;  1WJE A;  1ZG3 A;  2XRO A;  2Z9O A;  3U1K A;  2H6C A;  1NHA A;  3PM1 A;  5L3G A;  5DM7 F;  2BXY A;  1JJ8 C;  3T5X A;  4IF4 A;  4X4F A;  4M9X A;  5IP7 J;  1MBF A;  3BG6 A;  4UUS B;  1YX5 A;  3MMY B;  2L9R A;  1T56 A;  2PMH A;  1RPE L;  1I1S A;  5L3F A;  2A5W A;  3E97 A;  3HRT A;  4FT8 A;  3LSJ A;  3SCF A;  4OIN F;  5B3S H;  5DRT A;  2LLV A;  3M8E A;  1UB9 A;  2KEK A;  3QP5 A;  3BR6 A;  4LLN A;  3K7A J;  2YU9 J;  2L3D A;  1DQU A;  1I3Q J;  1FJL A;  1ZYR F;  2XUB A;  5IT3 A;  4L0Y B;  3ASN H;  4BEH A;  2AXU A;  2BNM A;  2HXO A;  4JBA A;  2XAF A;  3Q0U A;  3H3Z A;  5AIP A;  3OOU A;  2L0K A;  3S1R J;  3U9G A;  1RPW A;  3D5L A;  2A07 F;  1YSE A;  3O3K A;  2QQ9 A;  3D5R C;  2HFZ A;  3KXA A;  4HNT A;  4NDW A;  4ANJ A;  3CMY A;  3OR2 C;  3BJ6 A;  1EH6 A;  2HXI A;  2HDD A;  2Q0O A;  4DGW B;  2WAE A;  1WH5 A;  4HYE A;  1GV5 A;  1LCC A;  4A69 C;  5A7L A;  1S7E A;  2IA1 A;  1GLN A;  4XBF A;  1ZRE A;  2MH9 A;  5J6X A;  2TRT A;  2EFP A;  5IOZ A;  1VQK I;  3WHB A;  2DA4 A;  4PGH A;  1JWL A;  4BE2 A;  2VJI A;  5JLW A;  3CCJ I;  1ZS4 A;  5HOO A;  1HQ1 A;  3OYM A;  4LD5 A;  4P9F A;  4HRI A;  4HQE A;  5TIS C;  1MMG A;  2XC7 A;  4E7K A;  1FYM A;  2DDB A;  4Y3O A;  3EUS A;  1KQ8 A;  2WV0 A;  2FUG 2;  1Z6R A;  1DGR M;  3NWS A;  4Y33 A;  3LQR A;  4M71 A;  2JPC A;  5B1A H;  3KPH A;  4RGX A;  1K78 B;  2M4G A;  4BXU A;  1XGN A;  4XSZ F;  1VQP I;  1OCO H;  4BE1 A;  1YE9 A;  4IEJ A;  1VQL I;  3VB2 A;  3VSL A;  4LOC A;  4E7I A;  2PQ8 A;  4I76 A;  2V9P A;  1IUF A;  4CGZ A;  4HDV A;  3B6A A;  4KNY A;  2EFO A;  1U0J A;  2Z3Y A;  2HVS A;  4XRM A;  2LKX A;  2LF7 A;  3DKY A;  3C18 A;  3ME5 A;  2BY1 A;  2Q1Z B;  2ZSH B;  3WE2 A;  1TWA J;  2V9K A;  1SFU A;  4E70 A;  1WJA A;  1R7J A;  5DS9 A;  3ZMU A;  2MSY A;  1MDM A;  2Z33 A;  3MQ0 A;  3GFI A;  1WKM A;  1Y6I A;  2ODR D;  1L0O C;  4XKV A;  2M8E A;  2VT3 A;  3K70 C;  1HW5 A;  3MKL A;  3QU3 A;  1Z67 A;  1DWK A;  3HBL A;  2GBY A;  3BTI A;  1B72 B;  4Q5S F;  1R22 A;  3CCM I;  1Z3Y A;  3GW2 A;  2OQG A;  4AVZ A;  4RMN A;  4D1Q A;  4O3M A;  3CD6 I;  4D7M A;  3WG9 A;  2ME0 A;  2X6X A;  4XMY A;  5GAG i;  2P5V A;  3CZ6 A;  3OS2 A;  2M3A A;  3MKW B;  2MGQ A;  3FXM A;  2OV7 A;  2NVQ J;  2KEJ A;  3OV8 A;  1MZB A;  4UV8 A;  4KIG A;  4BGD A;  1FYL A;  5DDG A;  2R7W A;  4FBI A;  1OKR A;  1L1M A;  2CO5 A;  2M9H A;  3KFW X;  4UXN A;  3BJO A;  1APL C;  1RC9 A;  3MCZ A;  1ON1 A;  5FGM A;  2P7C B;  3ZQ7 A;  2R7O A;  2LK2 A;  2PXB A;  4MHG A;  4QIW N;  4I6T A;  2QQ8 A;  2NVU B;  3BR1 A;  3K4C A;  2ZB9 A;  3L2U A;  5C3E J;  3K4B A;  4L5I A;  2FNP A;  3TDU C;  1J0R A;  1T38 A;  1HKQ A;  1MH4 A;  3NWT A;  5K98 B;  3V42 A;  3DM5 A;  1KU3 A;  1YIJ I;  1UG2 A;  1X2N A;  3CJQ B;  3FXU A;  4A0Y A;  4EJU A;  5FRN A;  5DRY A;  3C2B A;  1ZZ7 A;  2K5C A;  2R7Z J;  2HOA A;  3LFK A;  2UWM A;  2R92 J;  4AIH A;  4I6Z A;  3HSE A;  5DYM A;  1QQI A;  5LHI A;  1BI1 A;  1BOB A;  3J7A Y;  5HVQ C;  1FNN A;  2BHY A;  2GXA A;  4C3H J;  3BR5 A;  2HOE A;  3JW4 A;  2DK5 A;  2O9L A;  1U6G A;  1GXP A;  5IT9 Z;  3JRB A;  3TED A;  4GHJ A;  1UJ8 A;  3P5J A;  3RPU D;  3FZV A;  4CH7 A;  1SVO A;  4RM2 A;  1WI3 A;  3MD2 A;  1T6S A;  4QPQ A;  4C2T A;  4B09 A;  3MZ8 A;  1U5T B;  3HSR A;  1ZRC A;  1D0X A;  2PXE A;  1R1V A;  2JT1 A;  3BC8 A;  3VOE A;  4B4C A;  2GOM A;  4ER7 A;  3ABU A;  5EDN A;  4ER3 A;  2CMP A;  2QCO A;  1O3R A;  1FBQ A;  3WOD F;  1FSH A;  1XCB A;  3R4K A;  4IXA A;  5FD5 A;  3SQN A;  2VLA A;  1O3Q A;  1BW6 A;  4RB2 C;  1VI0 A;  1I6X A;  2K4J A;  3ZHI A;  1B6A A;  1TNT A;  4CCO A;  3ZOB A;  5J40 A;  2ICP A;  1Z77 A;  3TRB A;  1YYV A;  2E2I J;  4ZTJ A;  5ILS A;  2ICT A;  2V1D A;  4E7S A;  1G6N A;  2AXZ A;  2K4B A;  3CDL A;  2KJB A;  2ZC2 A;  1DP7 P;  4IJA A;  1POG A;  3I55 I;  1FZP B;  2QGU A;  3FHN A;  3LSM A;  5TJJ A;  1KZH A;  1WJB A;  2FX0 A;  3NQO A;  4PUS A;  5TGT A;  4X4E A;  5EGO A;  2MEZ A;  3V8K A;  3BZC A;  2CQ7 A;  4DZJ A;  1RZR A;  4YIF A;  1R6R A;  2LSO A;  2XCJ A;  3MEJ A;  1CJG A;  2HU9 A;  1YIT I;  4HG2 A;  5FFZ A;  2PN6 A;  2KIS A;  4HST A;  1DP3 A;  1KU9 A;  2XSD C;  3S93 A;  3M9L A;  2PUE A;  1Y39 A;  2YUS A;  1FOX A;  3ECH A;  4KIT B;  1K6Y A;  1IW7 F;  4XID A;  1SAX A;  2JA8 J;  2PXU A;  5EEH A;  2EZL A;  3KP5 A;  3VYU B;  4I2O A;  1IRF A;  2DA2 A;  2DTR A;  4B1R A;  2DFF A;  4ON0 A;  1A04 A;  4XLH A;  2COB A;  1LVA A;  3RYR A;  4BAC A;  1WJ5 A;  3VK0 A;  5EJC A;  3KP7 A;  1LDK B;  3CCU I;  1X3Z B;  4BY7 J;  2AWI A;  1CF7 A;  3A01 B;  1X1B A;  3W2W A;  1VQO I;  1TNS A;  3HOW J;  1BM9 A;  2XSJ C;  4UB6 C;  2DXI A;  2IS6 A;  2LYC A;  5IP6 A;  2XF7 A;  3LA7 A;  3F0C A;  2P6T A;  1U2W A;  1P2F A;  1LPQ A;  5LBQ A;  2HQ5 A;  4BE0 A;  3FWE A;  3I9V 2;  2LLW A;  4B3A A;  1R5H A;  3PL8 A;  2R7X A;  1R4N B;  3IHU A;  4EJW A;  3CF5 F;  4N9I A;  5J4V A;  5J4Y A;  4YFN F;  2BGC A;  3OYB A;  1X1A A;  2FXA A;  3CLO A;  4G6T B;  5B1B H;  4ZDP A;  1IG7 A;  3OQO A;  1MFQ C;  3HTS B;  4ZDO A;  4RGS A;  3COA C;  3G1O A;  3IAS 2;  5E3L A;  1MGT A;  5EF6 A;  2EIK H;  3KZI C;  5K7H A;  4CHU A;  4CYC A;  3L2V A;  4PJJ A;  3GZN B;  5LGN A;  4GQM A;  2PJP A;  3S16 J;  1JKQ C;  1QP0 A;  2XKO A;  3GBG A;  1F43 A;  1JI8 A;  2EV0 A;  4DE9 A;  4BBR J;  4J1W A;  1IJW C;  3A9Y A;  3L2W A;  4DW6 A;  2M30 A;  4MCT A;  1BW5 A;  5KVR A;  2X6W A;  2YBD A;  1BC8 C;  2NXN B;  2EBY A;  2KEI A;  3PSF A;  4UVB A;  4PJN A;  3JCU C;  2IVG A;  1ZZ8 A;  2DOD A;  3DCF A;  4A3J J;  1XX5 A;  2F2E A;  3GFJ A;  3I56 I;  2K9M A;  2VC1 A;  2MLG A;  1CQT A;  5E8G A;  1S72 I;  3IAM 2;  2RC4 A;  1R23 A;  2ME6 A;  2RRE A;  4MGR A;  3S8Q A;  1LVK A;  4RAF A;  2IUO A;  3EQL F;  1KQ9 A;  4A2U A;  1D1C A;  1ZGJ A;  2R7F A;  1BI0 A;  3K1P A;  1V5F A;  4HAM A;  6PAX A;  3ZR8 X;  5EEG A;  4MEX F;  5M5X J;  2DT7 B;  2ELK A;  2CQQ A;  1YS7 A;  3I54 A;  4NQW A;  4QSH A;  1YI2 I;  2B9S A;  2IS4 A;  5GTH C;  3FMY A;  4RB1 A;  2BOL A;  1S3J A;  2IA2 A;  5BPI A;  2NOJ B;  5DD4 A;  1FIA A;  4A5N A;  2RVC A;  4S0H B;  3KZY A;  1PUF A;  5LD2 C;  3V7C A;  1ZEL A;  3G3Z A;  2R63 A;  4IA8 A;  2O38 A;  2ISZ A;  1O57 A;  2WB1 A;  2BW3 B;  4LFU A;  2ZJQ F;  1TTY A;  5HNH A;  2PI0 A;  3S1M J;  3CQZ J;  3DTE A;  5ICE A;  3PUF A;  4FE7 A;  3WE3 A;  3I0T A;  3RTR A;  3JR9 A;  2AW6 A;  1P6R A;  3QAH A;  2KIM A;  3MZY A;  4Y15 A;  3LAJ A;  4JX4 A;  2A6T A;  2CWE A;  1X2M A;  2VT2 A;  1USS A;  2BBY A;  3RCO A;  1SVL A;  2GRM A;  3IUO A;  3I71 A;  5DCF A;  2VXZ A;  4HLY A;  2C6Y A;  2M8G X;  3A03 A;  4M9S A;  3OYD A;  5FJ8 J;  2BY3 A;  3FDY A;  4HX4 A;  4LB5 A;  4M3B A;  4WF2 A;  2BYV E;  1PYV A;  1S6L A;  2HKO A;  3F51 A;  2ICW G;  2KDZ A;  2L8N A;  1ERD A;  2PXP A;  1MBH A;  2KZV A;  2P4W A;  5H6Q A;  3BQY A;  2E60 A;  5F04 A;  2WAD A;  2XPU A;  1TL8 A;  5EG0 B;  3SEZ A;  3H3V K;  3PE5 A;  3N4M A;  3TO7 A;  2K27 A;  3DU5 A;  5IP9 J;  2VL8 A;  5J8F A;  4GDF A;  4HF1 A;  3E5Q A;  2EFN A;  2GZW A;  3W2V A;  1J7K A;  4HZF A;  2UXX A;  1PRU A;  2L7F P;  2XI8 A;  4AU7 A;  2OQR A;  3IWF A;  2W57 A;  1YJ9 I;  2GA2 A;  2O3F A;  4E6K G;  4IHV A;  1YW8 A;  3HOX J;  3KZZ A;  1G59 A;  4BXX J;  2DW4 A;  4ZTF A;  1W1W E;  3FXL A;  9ANT A;  3CMM A;  5DT2 A;  3MEX A;  4JYK A;  2ZBK A;  2AS5 F;  3OYG A;  1OSL A;  2ZFW A;  2WAQ A;  3E1S A;  3LQQ A;  2IGM A;  2W25 A;  2PUD A;  1XTA A;  3ABM H;  3B73 A;  2HQA A;  3FF5 A;  3QPS A;  4X6A J;  1NTC A;  3NXH A;  1Z0X A;  2VPL A;  1A6I A;  3KYC B;  2KRH A;  3TEL A;  2HGC A;  3O2P E;  4EM2 A;  1VQN I;  4E7Z A;  1SFO J;  4JCY A;  4LG0 A;  2GXB A;  2RNJ A;  4HOB A;  1TQP A;  2XXQ A;  4DE8 A;  3SFZ A;  2MFZ A;  1D1A A;  2ZME B;  3P9K A;  2QQB A;  1XG1 A;  1R1U A;  2FNA A;  2LDU A;  1FYK A;  1FTT A;  3ZQG A;  1ZH5 A;  2L7M P;  1BOA A;  2O5R A;  3R1F A;  3LAP A;  2DOF A;  2FD5 A;  3HYI A;  5F08 A;  1QQA A;  2PXQ A;  1ETO A;  1OYY A;  4BYY A;  2CRG A;  4Z6Y A;  2KIF A;  1D8J A;  3A0B C;  1R5G A;  3I5U A;  5GPC A;  3OYF A;  5KK1 A;  1IV6 A;  2XGC A;  1AHD P;  2EA2 A;  4U7B A;  4CA0 A;  5FKK A;  3IKV A;  1LDJ A;  4XIC A;  1HQC A;  3VOD A;  3V4G A;  2IA0 A;  3WGG A;  4FAS D;  1PP8 F;  3SX0 A;  5EZH A;  1RZ4 A;  3SHF A;  1OPC A;  3LOC A;  2XAJ A;  4ITV A;  1ZLJ A;  4MTD A;  1WSU A;  4RM3 A;  3OYH A;  4AD9 A;  3DU6 A;  4GRI A;  2OPT A;  3F8B A;  2VXD A;  3C2H A;  3UR3 C;  3L2R A;  1I5Z A;  1TW3 A;  4ZYG A;  1GVJ A;  2EIL H;  1V3F A;  2YS9 A;  1KGS A;  4XQF A;  1OFC X;  5LLQ A;  4EM0 B;  3TW7 A;  1F4K A;  1VZ0 A;  5GAG J;  3FYM A;  3OMT A;  2P81 A;  3PUB A;  1ENH A;  1FBU A;  2G7U A;  4MLO A;  4KIB A;  5IOY A;  2CW8 A;  3A0H C;  4B3X A;  2UZK A;  3CP8 A;  3RKQ A;  2EIM H;  3M4O J;  2CSO A;  5M3F J;  2KMU A;  3AG1 H;  3CCV I;  4HEA 2;  2FSW A;  1KON A;  4PCQ A;  2R7U A;  2PMZ N;  5K5O A;  3F6O A;  4KT6 A;  5JVT A;  2VQH A;  2V7F A;  1J09 A;  3GX4 X;  4G6D A;  4X0G A;  4WXC A;  1ZG5 A;  4NHJ A;  4XR6 A;  2OJE D;  3UWP A;  3MFK A;  4M73 A;  4XLC A;  1UHW A;  4PFO A;  3OWQ A;  3AG4 H;  3JTH A;  3O9X A;  3WTS C;  5JHF A;  3CCE I;  2EB7 A;  4DYC A;  4ENK A;  4PDK A;  4YII A;  2ZXW H;  2EH3 A;  5ILU A;  2PXD A;  5DTR A;  1LQ1 A;  4YG2 F;  5HNF A;  3CCR I;  3I59 A;  2OCC H;  2FU4 A;  3DPU A;  4EZI A;  1WH6 A;  4FN3 A;  1MH3 A;  3LWF A;  4B47 A;  1H89 C;  3O8H A;  3CC2 I;  4X4I A;  2E1M B;  1Z7U A;  4Y4R A;  5KAF C;  2NAZ A;  2VBZ A;  1RZS A;  2IVB A;  2Z1D A;  4IVZ A;  5HS8 A;  3KYL A;  2QQA A;  1Z3X A;  2QKL B;  2W00 A;  1U8B A;  4M72 A;  3TL4 X;  5FO5 A;  1ULY A;  1IAW A;  4KT5 C;  4XM3 A;  2HPM A;  1FT9 A;  3L00 A;  5HDG A;  1K78 A;  1BR2 A;  2VE9 A;  1QZY A;  1V5G A;  5F6F A;  2HOT A;  2J7W A;  2Z2S B;  1XGM A;  2CW0 F;  4MTE A;  3A4C A;  5FLX Z;  1BR1 A;  1R5I D;  5F0F A;  1U78 A;  3J7Y J;  1YIO A;  1KU7 A;  1MJ9 A;  4KIC A;  2J5P A;  1ETX A;  2HYF A;  3SZP A;  2Y75 A;  4IO9 F;  3DXJ F;  1XSX A;  1YLF A;  1ADR A;  1Y0N A;  2OR1 L;  1WPK A;  4XKC A;  2VB6 A;  1QPI A;  5FRM A;  1EV7 A;  2WBM A;  3KEO A;  4ZJZ A;  2HFH A;  4F92 B;  1XC5 A;  5E3N A;  1ITY A;  2IEK A;  4G6Q A;  1F36 A;  2H8W A;  2MH2 A;  3OSF A;  2Z99 A;  5H2F C;  3OS1 A;  4HF0 A;  1IN8 A;  1A6Q A;  2R7S A;  4LMY A;  4BAY A;  3RI4 A;  2LF8 A;  3HGY A;  4I09 A;  4BH9 A;  4BL0 B;  1T95 A;  2X0L A;  1YOV B;  5ERI A;  1SMT A;  3RZO J;  2HR3 A;  2PJR A;  2QEN A;  4U0V A;  2VOD A;  1D8K A;  1O7F A;  2VPR A;  3K4N A;  4RB3 C;  5BMZ A;  1S8N A;  4JQF A;  1MSE C;  4W1U A;  1JTX A;  1B72 A;  1ZAY A;  3S2H J;  5FKO A;  3LL7 A;  4IHT A;  5C4X J;  2ISY A;  2RDP A;  3S14 J;  3HOU J;  2CJJ A;  2M34 A;  2VQC A;  1P7J A;  2OUM A;  2DI3 A;  1MBE A;  2JCG A;  1ZVV A;  2X9D A;  1PER L;  3PQK A;  4HPQ A;  1TC3 C;  5B5E C;  4A3L J;  5EG0 A;  1FWZ A;  1W7P D;  3SDG A;  5ED4 A;  1Y1V J;  3BD1 A;  2PXT A;  5L3C A;  1POU A;  2R0Q C;  1FSE A;  2WY8 Q;  3B7H A;  1A31 A;  1W5T A;  2WIU B;  2B7E A;  5GPA A;  3BTC A;  1HA8 A;  3WU0 A;  3CCS I;  2V79 A;  1N75 A;  4YEL A;  4A3G J;  1QQB A;  2JA5 J;  3G73 A;  1W4M A;  4IHS A;  2LRE A;  1YQA A;  2P8T A;  2LY9 A;  4G12 A;  5GP9 A;  3FBI B;  3F22 A;  3QYF A;  3MKZ A;  4M74 A;  2L54 A;  3KP6 A;  3IH3 A;  5HLT A;  1NEQ A;  2VOO A;  4E4H A;  3VFZ A;  3K2Z A;  3CF2 A;  1JTY A;  2M87 A;  3R60 A;  1UZC A;  3L1P A;  2O03 A;  3F8M A;  1FIP A;  3KEY A;  4MQV A;  4DZP A;  2VKV A;  2LBF B;  1VFC A;  3PNV A;  3E7L A;  4ER6 A;  4KMU X;  3CO7 C;  4UVC A;  3MN2 A;  3DNV B;  2OF7 A;  4FET A;  1NK2 P;  1Q1V A;  2CUJ A;  3T8R A;  1OR7 C;  2DPD A;  1JFS A;  1JKO C;  1XDS A;  2LCV A;  1QRY A;  3E6D A;  4CDG A;  1W36 C;  2ECB A;  3HIF A;  2Y30 A;  1RI7 A;  3WTU C;  2MG4 A;  4IKF A;  2AUW A;  2IBD A;  3GF2 A;  4IOC F;  2XAS A;  3JRH A;  4OU0 A;  2JJ7 A;  3U3W A;  3OQN A;  2ZME A;  3DWL E;  1Y9Q A;  1QZZ A;  2ZJR F;  2W82 A;  2YU3 A;  1QP4 A;  1ONV A;  3SCH A;  2DAO A;  1YO5 C;  3DPL C;  1G3T A;  4XRF A;  2K9Q A;  1MJB A;  2Q8K A;  1EH8 A;  2GWR A;  2RNG A;  3OKZ A;  5IPA A;  2D1H A;  3ZMZ A;  4D7N A;  2LP0 A;  3RKX A;  5JLX A;  3R09 A;  1Y0U A;  2VN2 A;  4LJZ F;  4CYC B;  3CUO A;  4XKW A;  2A5Y B;  4OIP F;  3P7N A;  4BJ5 C;  3NAU A;  2BW3 A;  2H09 A;  1RKW A;  3VWS A;  4CCL A;  2X1D A;  2HKX A;  1EKE A;  3RPQ A;  4UUS A;  3IRR A;  1ZK8 A;  2PMU A;  1XWR A;  2XIU A;  2E7W A;  2KFD A;  4XLP F;  4EEF G;  2LYJ A;  5GTI C;  4LLG F;  2IJL A;  3JXB C;  2MD5 A;  4A6D A;  1U8R A;  5FB2 A;  3DV8 A;  1Z1D A;  3HRU A;  3ZP5 A;  4IHX A;  2DT5 A;  1J9I A;  2DBB A;  1P9Q C;  2G9W A;  1DGW Y;  3W3C A;  1XGS A;  3GME A;  1U2Z A;  1ZUG A;  1ZZB A;  3I53 A;  2YX4 A;  4WX9 A;  1IV8 A;  4G9Y A;  1TQI A;  3HOS A;  3BP8 A;  2DTZ A;  2DA1 A;  1J5Y A;  2OZU A;  5CJ9 A;  3IP4 B;  4DNC A;  1HCR A;  2LNB A;  2CH0 A;  1WH8 A;  2P6S A;  4BKX A;  4R8H A;  1UCR A;  5DV5 A;  2JSP A;  4EM1 A;  5DUI A;  2DCE A;  3TW6 A;  4AID A;  1G8X A;  3ZKC A;  5D8L B;  4PK4 A;  1O7L A;  1YX3 A;  4Q4Z F;  1HST A;  5E1Z B;  3BTL A;  4F93 B;  4BDY A;  1M1E B;  1V55 H;  2NS7 A;  4Z59 A;  1I50 J;  3OOP A;  2B0L A;  2BV6 A;  4N0B A;  4KYW A;  3QFI A;  3Q0V A;  4AIK A;  5LEK A;  1KU2 A;  3GYH X;  4R79 A;  4YG1 A;  1D5Y A;  4PU7 A;  1QHH D;  3CP2 A;  3F6V A;  5JHU A;  2STT A;  2EWN A;  1D0Y A;  2IPQ X;  3RKW A;  2OTL I;  1JE8 A;  4L5E A;  3LSI A;  4Y7N J;  4GFB A;  1ZAR A;  3HM5 A;  2LNM A;  1I39 A;  2ZJ2 A;  3G0T A;  1VQ7 I;  2MLK A;  2B5A A;  4BQA A;  3LA3 A;  4CCJ A;  2XF5 A;  3I64 A;  3G1L A;  2XDV A;  2ELJ A;  4BY1 J;  4RBO A;  3BQZ A;  1D0Z A;  3AG2 H;  2FE3 A;  2XAG A;  3DQV C;  2OTJ I;  3C3W A;  1ZR2 A;  2L2O A;  1AWC A;  2XGX A;  3AFH A;  2ID6 A;  3TGN A;  2ZJP F;  1RUO A;  2PIJ A;  1LKX A;  2YSR A;  4QTR A;  1A36 A;  4F7Z A;  3TP3 A;  3JAM Z;  3G7D A;  1O3S A;  1ZZ9 A;  2K02 A;  3GTQ J;  4P9U A;  1MKM A;  4M3G A;  3JRC A;  2P5K A;  1LFB A;  3KET A;  5CVR A;  5K7F A;  2IT0 A;  3QWG A;  4GGG A;  1J2X A;  4GCV A;  3PFI A;  1X19 A;  1YJN I;  4V2F A;  2JVG A;  3GZC A;  3LFU A;  2DOE A;  1AU7 A;  3V8J A;  4PZJ A;  3JRI A;  4U88 A;  3ZQC A;  1X1C A;  2PUG A;  4BHP A;  1OYI A;  4BHB A;  3ZHM A;  2HDW A;  2OU2 A;  3PIP F;  5IYC J;  2Y31 A;  2QA4 I;  2EJR A;  2QEX I;  3DBR B;  1SMY F;  1TWH J;  3OYE A;  4A93 J;  2VUM J;  4XOP A;  1MD0 A;  4BU2 A;  1N78 A;  5ICF A;  4U0Y A;  1R1T A;  3LNQ A;  1E2X A;  2L4A A;  2VI6 A;  2EK5 A;  2WAF A;  3KCC A;  3Q9V A;  3BZK A;  5M5W J;  2KZ8 A;  3ZMD A;  2OBP A;  4P1W A;  2CUZ A;  2ZME C;  2JA6 J;  1QGP A;  1PRA A;  4XLF A;  3L09 A;  4BUP A;  2CFX A;  3CCL I;  2V3C C;  1KQ0 A;  5L3B A;  1RZR D;  3DF8 A;  3FBN B;  3WGH A;  4D5C A;  4L0Z B;  3EET A;  2A6H F;  4EK9 A;  1TLH B;  1NW3 A;  2QYO A;  2L4M A;  4EJV A;  3E5U A;  4UHT A;  3WTY C;  3CDH A;  4H4K C;  1BL0 A;  1G2H A;  1B4A A;  3OR1 C;  3ZQQ A;  3KYD B;  4YFX F;  5D5U B;  3A2K A;  1WGX A;  2DYR H;  4BQN A;  3KIO A;  1QBJ A;  3DTK A;  4I8T A;  3S2W A;  3U2R A;  4LG0 B;  3DBH B;  2R4G A;  3EDP A;  2O0Y A;  2Y0S A;  3S1Q J;  3KJX A;  3K70 D;  5GAH J;  4ZYA A;  5F0C A;  1ZR4 A;  4KDP A;  2NS8 A;  3CJT B;  2E1C A;  4I7H A;  4XK4 A;  2ZO4 A;  3DTI A;  1IRX A;  1ETQ A;  4PJL A;  3ONQ A;  1H0M A;  5CPR B;  1K6O A;  2X48 A;  2H8R A;  4E7L A;  1MMD A;  3V7S A;  2JSC A;  1UAA A;  3AL0 B;  1JFT A;  2UXN A;  2XPW A;  1VQ5 I;  1HKT A;  3VDX A;  5JVG F;  3GCM A;  3H0D A;  3F3X A;  3Q5F A;  2KQR A;  1J59 A;  1AA7 A;  2FOK A;  3OQM A;  5FRO A;  1ZLK A;  3HHH A;  3QQA A;  2K40 A;  4UV9 A;  5KCM A;  3QPH A;  1YG2 A;  1B8I B;  2P7V B;  3QOD A;  2K3F A;  2YPR A;  4K2E A;  1IRG A;  3OYI A;  1RRJ A;  5HS9 A;  1O3T A;  4UB8 C;  4PSX A;  4X4C A;  1TWF J;  4II2 A;  3CC7 I;  1IRZ A;  4C30 A;  1V54 H;  1GXQ A;  1VND A;  1U5T A;  2D2W A;  2F6C A;  2OC6 A;  2RN7 A;  2PPX A;  2VJ4 A;  1UEL B;  1R49 A;  3X2Q H;  3BPV A;  2L9N A;  1GV2 A;  2DFI A;  3W6K B;  1BI3 A;  1TQM A;  1OR7 A;  3CDI A;  2NVY J;  2H27 A;  5F27 A;  1VQM I;  2OFY A;  2BHZ A;  3LSH A;  3M1C A;  4PGG A;  3A01 A;  5H6R A;  1JJ6 C;  3KZ3 A;  4B43 A;  1ZZC A;  2COM A;  1H9G A;  3QPL A;  2BNO A;  3EPZ A;  2KP6 A;  3FM5 A;  1XSV A;  5IYB J;  4XNF A;  3NEU A;  3MKY B;  2PJR B;  4BDZ A;  1DPU A;  3GUU A;  4Z58 A;  4II3 A;  4CO8 A;  4N4N B;  3TDZ C;  1TT5 B;  1LB2 A;  2EV6 A;  4CCM A;  2IGN A;  4L9J A;  4XOR A;  2E35 A;  4MO7 A;  2X1E A;  4AYB A;  2VBX A;  1OCR H;  2K85 A;  3KLO A;  3LMM A;  3H3U A;  3CCQ I;  1N77 A;  2M7B A;  2R93 J;  1STZ A;  2ESH A;  1XMA A;  3DLL F;  4NC6 A;  2F5C A;  4IQJ A;  3ZQF A;  3VPR A;  5EGO B;  1JHF A;  3H92 A;  5E1X A;  5LHG A;  3SCG A;  4Z5H A;  3ABT A;  5JR3 A;  3DFG A;  1RR8 C;  4G7Z F;  3IRQ A;  5A2Q K;  3OSG A;  2R3S A;  3CCY A;  4DJA A;  3TQN A;  4CYD A;  2RV8 A;  3FHZ A;  1YJW I;  4A3D J;  1Z91 A;  2ZXH A;  3JXC L;  3IH2 A;  1S5L C;  2JPB A;  2QWW A;  5BPD A;  1A5J A;  2VON A;  3FM3 A;  3DKX A;  1TW2 A;  1YW7 A;  2A61 A;  1REP C;  5D6F A;  2E34 A;  2GRL A;  2VE8 A;  1XDU A;  4MCX A;  2V26 A;  3P9I A;  4LIT A;  3LFP A;  1SAN A;  3I4P A;  3J80 Z;  3S1N J;  2WC2 A;  3OYJ A;  5J1Y A;  5DCM B;  3HOT A;  2X4H A;  3MVP A;  4M3D A;  2PXF A;  2UV1 A;  2DOA A;  1NG7 A;  1R58 A;  4IRG A;  2A6C A;  2FBI A;  4DYR A;  3GTL J;  5D5V B;  1FY7 A;  2LVS A;  3GZ5 A;  5GAH i;  2DJI A;  3ELK A;  3JAM K;  2W7N A;  1F5T A;  2WA0 A;  3QQ6 A;  2RKH A;  2K9L A;  5BOX A;  5BS6 A;  2EPF A;  4IHW A;  5CVV A;  1B59 A;  4F91 B;  2IGK A;  2OD5 A;  2LKP A;  4BJ6 C;  5HDN A;  2GA1 A;  5ICC A;  2QVO A;  5LHH A;  5DTQ A;  2MAB A;  1X3U A;  3ZN1 A;  4DBQ A;  2UUZ A;  3R6S A;  1S29 A;  1ZN2 A;  3NRV A;  4RGU A;  2KRC A;  4I0A A;  1W5C C;  5J3L A;  3I4M J;  1IDZ A;  3PXP A;  3CRO L;  3CO6 C;  2HOS A;  3MWM A;  2CV2 A;  3FMS A;  4HF2 A;  3QOX A;  2FMY A;  3IC7 A;  2G7H A;  4C2M J;  1WJD A;  2M4K A;  5BQT A;  4XN3 A;  4IRH A;  3AAF A;  2XHK A;  3ABL H;  3HL2 A;  2XIG A;  1GUU A;  3RZZ A;  4XLA A;  1BJA A;  2ETH A;  1ZQ3 P;  1BR4 A;  1O4X A;  1YFH A;  2WUS R;  2E1M C;  2ZFU A;  3ESW B;  1QNT A;  3RQI A;  2NNY A;  4YEJ A;  3MLF A;  1IXC A;  4X4D A;  1QU3 A;  3F8C A;  3BCB A;  1Z05 A;  5IT9 K;  2HS5 A;  3I4N J;  2KHM A;  3OYL A;  2HQN A;  3HGG A;  2K86 A;  1UHM A;  1ZAO A;  4HDU A;  1DU0 A;  4ESB A;  2HCN A;  4ESF A;  1MNM C;  3VWB A;  2PUA A;  3S15 J;  1ETW A;  1S7O A;  2PLY A;  3FXO A;  1K4S A;  3CC4 I;  1NK3 P;  4AWX B;  3Q3S A;  4E7J A;  3ERM A;  3WTW C;  3S3M A;  5D5X B;  1OIS A;  4IHY A;  2A69 F;  1BN5 A;  2E1O A;  4HNV A;  3S2D J;  3WTV C;  4MIM A;  1BC7 C;  4CCN A;  4XSX F;  1WRJ A;  1YRN A;  4A3M J;  3PJR A;  3BDN A;  4I98 B;  3CLQ A;  3BG9 A;  1ZGA A;  1GVD A;  4Z5C A;  3D0S A;  2JZY A;  3GTG J;  1Z21 A;  1X4O A;  2JRM A;  1R9T J;  4RGR A;  1LE8 B;  4PU3 C;  4M6Y A;  3OS0 A;  1J75 A;  2NVX J;  4Q48 A;  3R0J A;  4XKB A;  3F8F A;  3QU6 A;  3BCA A;  2X6O A;  3OIQ A;  3VEP A;  3O6B B;  3HXL A;  1ETY A;  2PX9 A;  3GVA A;  3K1M A;  3J81 K;  4J01 A;  3FKJ A;  3T0Y A;  1QO0 D;  3HOY J;  4ZZL A;  3SZG A;  1NER A;  2YR2 A;  5FD6 A;  4N4O B;  3RKY A;  5F1J A;  2PG4 A;  1E3O C;  4JP0 A;  1TP4 A;  1R00 A;  1WWX A;  3REO A;  1Z7L A;  1LNW A;  4ABZ A;  1FOY A;  4L5J A;  2BNN A;  2M4H A;  3LSK A;  1VF9 A;  1LMB 3;  3ZPL A;  1BBY A;  3HUG B;  1CGP A;  1IF1 A;  1TT0 A;  3BG3 A;  4ZYH A;  1IGN A;  4E7H A;  1HDD C;  4KIS A;  1UG0 A;  2HWV A;  2Y0M A;  3K1N A;  3CME I;  3C7J A;  3FXJ A;  5E79 C;  1LJ9 A;  2M0C A;  4KIF A;  3ECO A;  1G4D A;  3GZD A;  1T0F C;  3A9X A;  4XN0 A;  3PSI A;  2QM3 A;  3K4K A;  3M07 A;  1HC8 A;  1LDD A;  2CU7 A;  2F5D A;  3QYB A;  4D5F A;  2L5Q A;  2ZXI A;  1HSJ A;  2EBI A;  1P4W A;  5FLM J;  3GTM J;  2VKD A;  4XRS G;  1KYW A;  1Q1H A;  1PNR A;  2R1J L;  4CZZ A;  4HBL A;  2FOW A;  3HRM A;  3K10 A;  3L2Q A;  4YG4 A;  2R7T A;  3LSP A;  1EA3 A;  1TZL A;  1G3S A;  5FKN A;  2BEO A;  2MW8 A;  2F5F A;  2HCS A;  2IU7 A;  1FOW A;  3WHC A;  2XGD A;  2PXV A;  4JX5 A;  4IZZ A;  1FEX A;  2AQF A;  2EQR A;  3MAJ A;  4WVL A;  2L7Z A;  2VC0 A;  3TO9 A;  3V7R A;  3SEQ A;  5E3M A;  4YBA A;  2N8G A;  1VQ4 I;  1ETV A;  2KJC A;  4OWR B;  1FTZ A;  2FJR A;  1TWG J;  2HPI A;  4U7D A;  2KLO A;  3I58 A;  3CUQ C;  3AL0 C;  3ZN0 A;  2PXL A;  2R5Y B;  3OIP A;  5BNG A;  3N05 A;  3GXO A;  4RAZ A;  4LK0 F;  4B8X A;  3HOV J;  2J7U A;  2DDA A;  2IXS A;  2GIZ A;  1E17 A;  2NOG A;  4A0Z A;  2CQK A;  5FLX K;  2HDC A;  3H35 A;  4CIC A;  2DPU A;  1TBX A;  3ERE D;  5CLS A;  2AXT C;  1P4X A;  5DSX A;  3GFM A;  1BIB A;  1P92 A;  4M6V A;  1VPW A;  2Y48 A;  4A0X A;  2DA3 A;  4C9Y A;  3GEZ A;  1SAU A;  2HIN A;  3HKZ N;  3IH4 A;  4GYI A;  2AHQ A;  2E71 A;  2IRF G;  2BZT A;  2MQK A;  3E3V A;  2PE5 A;  2Y2Z A;  2E36 A;  4Y13 A;  3H36 A;  2PMZ A;  2L01 A;  1FPQ A;  2MYS A;  4NB5 A;  2KPJ A;  4I99 C;  2PFB A;  3ZQI A;  4ZDL A;  3ZGK A;  4AIJ A;  2D45 A;  4OIQ F;  3K6G A;  2NRA C;  3HEF A;  3VYR B;  3EUH C;  5TRD A;  4LLL A;  4ER5 A;  4BHC A;  3EYI A;  2DYS H;  2GM4 A;  2M45 A;  3DBL B;  1JT0 A;  3H9J A;  1IN4 A;  4ZH4 F;  4YIR X;  2JA7 J;  5DTD A;  1BJZ A;  2NNN A;  4GXO A;  2KL4 A;  4RS8 A;  3BPX A;  2LY2 A;  5DEQ A;  3H1C A;  1EJ9 A;  2L02 A;  1SFK A;  2LYS A;  2O49 A;  1D5V A;  2R5Z B;  3DEE A;  3HKZ A;  3FXK A;  3K0L A;  3O8G A;  2Q2E A;  3ULQ B;  2EFW A;  4YAR A;  4ENM A;  3W6V A;  5D6E A;  2VBY A;  5HOD A;  1W0T A;  2LYR A;  3NZL A;  1SD7 A;  4Q47 A;  3UKG A;  1T39 A;  3BR3 A;  3GTK J;  1JH9 A;  1A35 A;  3BG5 A;  4IWR A;  2O7O A;  2W4S A;  4RAG A;  4BNC A;  3PFY A;  2LY1 A;  2LTP A;  3ZMT A;  3ZQH A;  4S04 A;  1WQ2 A;  2IVQ A;  4I6R A;  4RDU A;  3M3Y J;  3SXY A;  5E20 A;  2VJJ A;  3HDD A;  3JXD L;  3IV5 A;  1HLV A;  2XGE A;  1UTX A;  3QOW A;  2M0M A;  1R4M B;  4HRA A;  2VOP A;  1OCZ H;  2DFE A;  5HLI A;  4FIS A;  1VQ9 I;  2R7V A;  3BT9 A;  3J7Z I;  3PO3 J;  2LYP A;  1FX7 A;  2CS3 A;  5IYD J;  4AVP A;  1PUE E;  4FQG A;  5FKL A;  5KNL A;  3F23 A;  2JQE A;  2HVQ A;  3HSF A;  3RPU A;  3QP6 A;  1KYZ A;  2NYX A;  4I02 A;  3TEP A;  5C4J J;  4A3B J;  3WTX C;  2O61 A;  4M9Z A;  2JUG A;  5GAD J;  4ZYE A;  3LSG A;  3G71 I;  4U87 A;  1HKS A;  5CVU A;  3KE2 A;  1Y1W J;  2DA5 A;  3GUD A;  4HSR A;  1R36 A;  5FKM A;  3G4S I;  4EVI A;  5ICG A;  1XPX A;  4Y42 A;  4JQD A;  4UY8 I;  1CF7 B;  4ESJ A;  2I5U A;  2W48 A;  4C3J J;  1T33 A;  3JSO A;  1DDN A;  2GZU A;  3KP2 A;  2PXK A;  1LFU P;  4OOI A;  1T98 A;  3FK7 A;  3F21 A;  4GO1 A;  2L9S A;  2LBF A;  2RQQ A;  1NH3 A;  1X1P A;  4KJZ A;  5F1R A;  4CXF A;  5M5Y J;  2FRH A;  1B9N A;  2FJ1 A;  3BJA A;  3DEU A;  2WTE A;  3LIS A;  4X4G A;  1IZ1 A;  1QVU A;  1X57 A;  4J1X A;  2ZXJ A;  2LH9 A;  4NC7 A;  2K7L A;  4O5V A;  3DPT A;  1N25 A;  3TP0 A;  3TFL A;  2V6C A;  2IV1 A;  2XRL A;  3BDD A;  1MBG A;  3HHG A;  2VQG A;  4CCK A;  3GO5 A;  2EZH A;  2LOO A;  3FXR A;  4EGY A;  2NVT J;  3FYA A;  3CJN A;  4ETS A;  3JRD A;  5D4S A;  1RUN A;  1XMX A;  3PIO F;  5CYV A;  2AQE A;  1Z6T A;  3OMY A;  3W2A A;  2AO9 A;  1WJC A;  2K3P A;  3R61 A;  5CVJ A;  1Y7Y A;  3U1D A;  2BJC A;  2W24 A;  3K2A A;  2ECC A;  4HQM A;  2VKH A;  3A1Y A;  4FE4 A;  5HLG A;  2K9N A;  3S17 J;  2I8D A;  5F64 A;  3GFL A;  3LA2 A;  4I0B A;  2CQN A;  2EFQ A;  2CUE A;  2O8K A;  2ZKZ A;  2BE5 F;  4BQO A;  1P4A A;  2XRN A;  3CUQ A;  4LIU A;  4YG7 B;  2DU9 A;  3QWL A;  1X2L A;  2DMT A;  2M2E A;  2JK3 A;  3OYN A;  5FLV A;  2VKE A;  1H88 C;  4NNJ A;  4UNO A;  1JGS A;  3K4L A;  2VJ5 A;  1D1B A;  2QF7 A;  2W1O A;  5DUK A;  3NAR A;  1Y8R B;  1MBK A;  2AXV A;  3BWG A;  2EF8 A;  1V4R A;  3HZI B;  4UUT A;  2DT6 A;  4G7O F;  4IPA A;  3PNY A;  1UST A;  4BS9 A;  4OIO F;  5LRS A;  3HZJ A;  1I6H J;  3M8F A;  2XPV A;  4A12 A;  2LC2 A;  4J00 A;  3BLY A;  3SZT A;  3RJP A;  2HNH A;  3HJE A;  4M6X A;  3A02 A;  3ML6 A;  2H94 A;  3FMQ A;  2VQL A;  2XAQ A;  2R5Y A;  4OMY A;  4OAZ A;  1DU6 A;  4XOT A;  4LGW A;  1IN5 A;  2PUB A;  2F4I A;  2CSF A;  3OP9 A;  4HV5 A;  3EUA A;  4G94 A;  2A05 A;  5JFR A;  1W7P B;  3C1D A;  4RLQ A;  4EQZ A;  2QZ8 A;  2HTJ A;  2EZK A;  2LMD A;  3K9T A;  3KEQ A;  3QYE A;  1IN6 A;  2Z5U A;  1OCC H;  3K4J A;  1ZRF A;  3L9F A;  3Q9S A;  4HNU A;  1DUX C;  4MQ9 F;  3FX3 A;  4BQQ A;  1V5E A;  4FX4 A;  1AKH B;  2PUF A;  3H5R A;  5K5R A;  3NRO A;  4Y17 A;  4ENJ A;  1OMI A;  1U9O A;  4D9J A;  3G6E I;  2EIN H;  2H6B A;  5H20 A;  4M3F A;  4XON A;  3CMA I;  2V6E A;  1BI2 A;  3EUK L;  3E6B A;  2DMN A;  1B1B A;  2FQ3 A;  3HPH A;  2IS1 A;  3T1B A;  3IVP A;  3OL3 A;  5LEJ A;  1ODD A;  4WXH A;  2BY2 A;  1UFM A;  4A6E A;  4YRV A;  3KP4 A;  1PDN C;  3BOQ A;  3BR0 A;  2X1C A;  2JMW A;  3F9K A;  3TKY A;  5B66 C;  2FBH A;  1R71 A;  3CLC A;  2XB0 X;  1BDI A;  3LSR A;  2WAQ N;  1K83 J;  2E19 A;  4V2G A;  2HEO A;  2R7Q A;  3T8T A;  2L9V A;  3HUG A;  1K4T A;  3M9A A;  1IUY A;  1U3E M;  1FMV A;  2ID3 A;  3KP3 A;  3J80 K;  5AIQ A;  2E2J J;  4ER0 A;  1P7I A;  3J81 Z;  3S3O A;  4BEH B;  1OYW A;  1ON2 A;  4ASN A;  3RSN A;  2MD0 A;  4B44 A;  1YRN B;  2STW A;  1PVE A;  2IS2 A;  2XF6 A;  1DW9 A;  3TOA A;  3PQJ A;  2PUC A;  2F5V A;  5E17 F;  3QOP A;  4ZZD A;  1FBS A;  2FF4 A;  2Y9Z A;  2M7A A;  1NG6 A;  2MC3 A;  1MSF C;  2K9S A;  3LST A;  4HW0 A;  4PJ0 C;  1QA6 A;  3CTA A;  3HB9 A;  4X4B A;  1JXS A;  4MFE A;  2QBY A;  3ASO H;  1ZPQ A;  2VBW A;  1WCM J;  5DD8 A;  4CSW A;  1DUL A;  4J19 A;  1MJA A;  4LIV A;  3OYK A;  2CFO A;  5A2Q Z;  1ZRD A;  3ZCO A;  1UXD A;  2YX7 A;  3FIW A;  3CEC A;  1EH7 A;  3GZ6 A;  1HW2 A;  3B6C A;  1VTN C;  4HA8 A;  3V8L A;  1IDY A;  1QZX A;  4FHT A;  3HRS A;  1ZGW A;  1LEA A;  4AYB N;  3ZRG A;  2E1N A;  2O8X A;  5E3O A;  2WV1 A;  3QPT A;  4C3I J;  4XL9 A;  1R69 A;  2GXG A;  1BIA A;  5CKT A;  4LG3 A;  2O6G E;  1RET A;  2FFH A;  1QZE A;  4KA4 A;  2R7D A;  1Z9C A; 
#chains in the Genus database with same CATH homology
 3RZZ A;  2HOT A;  1ZQ3 P;  1O4X A;  2WUS R;  5F0F A;  1U78 A;  3RQI A;  3MLF A;  4X4D A;  1ETX A;  2WB1 N;  1K61 A;  1ORK A;  4X4H A;  2DJN A;  3I4N J;  1ADR A;  2OR1 L;  1WPK A;  4IEJ A;  1QPI A;  1ZVV A;  1ITY A;  5E3N A;  1IC8 A;  1XC5 A;  3HGG A;  2IEK A;  1F36 A;  4LOC A;  3HOZ J;  4I76 A;  1DU0 A;  1IUF A;  3OSF A;  3B6A A;  2CQX A;  4XRM A;  2LKX A;  1MNM C;  2PUA A;  3S15 J;  1ETW A;  3HGY A;  1TWA J;  1NK3 P;  3Q3S A;  4IHY A;  1RES A;  3RZO J;  2LYQ A;  2E1O A;  4HNV A;  3S2D J;  5DS9 A;  2MSY A;  4A3F J;  4MIM A;  3Q0W A;  1YRN A;  4A3M J;  2VPR A;  3G1M A;  3JRG A;  3BDN A;  1MSE C;  1PRV A;  1U9N A;  1JTX A;  2LFB A;  3BG9 A;  1GVD A;  3MKL A;  4W1U A;  1JKP C;  1B72 A;  5FKO A;  3S2H J;  3GTG J;  4Z5C A;  1DWK A;  5C4X J;  3S14 J;  1R9T J;  3HOU J;  3HBL A;  2GBY A;  3BTI A;  1B72 B;  2CJJ A;  2M34 A;  1PUF B;  1LE8 B;  4I6U A;  4PU3 C;  1P7J A;  5EEA A;  2NVX J;  1MBE A;  2JCG A;  4D7M A;  1OJL A;  2ME0 A;  2X9D A;  1PER L;  2X6O A;  4AUX A;  2R5Z A;  2MGQ A;  1TC3 C;  1GT0 C;  2NVQ J;  2KEJ A;  4A3L J;  1QPZ A;  1ETY A;  5EG0 A;  2EZI A;  3SDG A;  4FBI A;  3QF3 A;  1Y1V J;  3BD1 A;  3HOY J;  1POU A;  1L1M A;  2R0Q C;  2M9H A;  1NER A;  3B7H A;  3FK6 A;  1UHS A;  2WIU B;  5GPA A;  3BTC A;  5F1J A;  1APL C;  4O8B A;  4MFD A;  2IAI A;  4I8T A;  1E3O C;  4JP0 A;  2Y0S N;  4A3G J;  1QQB A;  2JA5 J;  2LK2 A;  4QIW N;  2EWT A;  4I6T A;  4ABZ A;  2LY9 A;  4G12 A;  3BR1 A;  5GP9 A;  2ZB9 A;  2BNN A;  5M3M J;  5C3E J;  1VF9 A;  1LMB 3;  1JT6 A;  1MH4 A;  3BG3 A;  1IGN A;  5K98 B;  1HDD C;  3GTJ J;  1UG2 A;  1X2N A;  3IH3 A;  1NEQ A;  2B63 J;  2L49 A;  2M0C A;  1HF0 A;  4AC0 A;  3C2B A;  1ZZ7 A;  1JTY A;  2R7Z J;  3L1P A;  2HOA A;  1VFC A;  1FIP A;  4DZP A;  2VKV A;  1QP7 A;  2TCT A;  3E7L A;  2R92 J;  4I6Z A;  2XJ3 A;  3MN2 A;  2CU7 A;  3DNV B;  2OF7 A;  1NK2 P;  4D5F A;  1Q1V A;  4C3H J;  1JFS A;  3BR5 A;  1JKO C;  2EBI A;  5FLM J;  3GTM J;  3SJM A;  4XRS G;  3F6W A;  2LCV A;  1QRY A;  1PNR A;  4JCX A;  3DEW A;  2ECB A;  3JRB A;  3TED A;  4GHJ A;  2Y30 A;  3JRE A;  2R1J L;  2MG4 A;  2AUW A;  4YG4 A;  2DMP A;  2IBD A;  3JRH A;  1ZZ6 A;  1WI3 A;  2JJ7 A;  3U3W A;  3LSP A;  2HI3 A;  4A3E J;  5FKN A;  2MW8 A;  3OQN A;  2IU7 A;  1AKH A;  1Y9Q A;  3WHC A;  2XGD A;  1QP4 A;  4B4C A;  2LD5 A;  4JX5 A;  1FEX A;  5EDN A;  2EQR A;  3SCH A;  5K7Z A;  2L7Z A;  2QCO A;  3JRA A;  1ZAY A;  2K9Q A;  5E3M A;  4YBA A;  2N8G A;  1ETV A;  1FTZ A;  2FJR A;  1BW6 A;  1TWG J;  1VI0 A;  5IPA A;  4D7N A;  3ZHI A;  2LP0 A;  3ZOB A;  5JLX A;  2ICP A;  3GN5 A;  4CYC B;  1HDP A;  1Z77 A;  3TRB A;  2E2I J;  1B0N A;  1BA5 A;  3NAU A;  2ICT A;  1RKW A;  2AXZ A;  2R5Y B;  3CDL A;  5BNG A;  2RAE A;  3HOV J;  1W0U A;  4UUS A;  2HSG A;  1ZK8 A;  2NOG A;  1POG A;  1XWR A;  2XIU A;  4EEF G;  2XB5 A;  3BR2 A;  2LYJ A;  2FX0 A;  4X4E A;  3JXB C;  4JX6 A;  5EGO A;  2MEZ A;  4DZJ A;  1RZR A;  4M6V A;  4IHX A;  2Y9Y A;  2XCJ A;  1VPW A;  2DA3 A;  1CJG A;  3BS3 A;  1XS9 A;  2HIN A;  3HKZ N;  1ZUG A;  1ZZB A;  3IH4 A;  2AHQ A;  2MQK A;  2PE5 A;  2Y2Z A;  1WH7 A;  2XSD C;  2DTZ A;  2PUE A;  2DA1 A;  2YUS A;  2JA8 J;  4XID A;  2KPJ A;  3ZQI A;  2EZL A;  1HCR A;  2DA2 A;  2I10 A;  4B1R A;  1WH8 A;  3HEF A;  2COB A;  4BKX A;  2GM4 A;  1JT0 A;  3VK0 A;  3TW6 A;  2JA7 J;  3ZKC A;  5DTD A;  1BJZ A;  4BY7 J;  2AWI A;  3A01 B;  3BTJ A;  3BTL A;  4Z59 A;  3HOW J;  2NS7 A;  2O4A A;  3FKI J;  1I50 J;  2CUF A;  5EYR A;  5C44 J;  2O49 A;  2LYS A;  2JN6 A;  3Q0V A;  2R5Z B;  5F0H A;  4YG1 A;  1D5Y A;  5IP6 A;  4PU7 A;  3O8G A;  2E2H J;  1H8A C;  4YAR A;  3F0C A;  3W6V A;  3FIS A;  4L5E A;  2HQ5 A;  4Y7N J;  5HOD A;  5J1U A;  1W0T A;  4GFB A;  2LYR A;  3HM5 A;  3UKG A;  3GTK J;  3BR3 A;  2B5A A;  4B3A A;  1JH9 A;  3SFI A;  1JKR C;  1LCD A;  3BG5 A;  4IWR A;  2O7O A;  1R63 A;  1WIZ A;  2KT0 A;  3G1L A;  3OQO A;  1IG7 A;  2LTP A;  3ZQH A;  4RBO A;  4BY1 J;  3BQZ A;  4A3I J;  2O9L A;  3G1O A;  5E3L A;  5EF6 A;  4XRS A;  4RDU A;  2IVQ A;  2LYL A;  5K7H A;  3M3Y J;  4CYC A;  1ZR2 A;  3HDD A;  3JXD L;  4GQM A;  3IV5 A;  1HLV A;  2XGE A;  3S16 J;  1JKQ C;  2ID6 A;  1UTX A;  2PIJ A;  4X1E A;  1QP0 A;  4QTR A;  3GBG A;  1F43 A;  1QVT A;  3TP3 A;  3G7D A;  4BBR J;  4J1W A;  1IJW C;  1ZZ9 A;  4DW6 A;  3GTQ J;  4FIS A;  4MCT A;  1BW5 A;  4M3G A;  2G0E A;  3BT9 A;  3JRC A;  3PO3 J;  2EBY A;  2LYP A;  2KEI A;  1GDT A;  5IYD J;  1LFB A;  3QWG A;  5K7F A;  5FKL A;  2IVG A;  1ZZ8 A;  3DCF A;  2LLK A;  4A3J J;  4W97 A;  3JRF A;  3OIO A;  4DYQ A;  4V2F A;  5C4J J;  4A3B J;  1AU7 A;  1CQT A;  3JRI A;  4BBS J;  3ZQC A;  2PUG A;  3LSG A;  2ME6 A;  3S8Q A;  1Y1W J;  2IUO A;  3ZHM A;  2DA5 A;  4Z5D A;  2DN0 A;  5FKM A;  5IYC J;  2Y31 A;  4Y42 A;  4JQD A;  1RIO A;  1LLI A;  1TWH J;  4A93 J;  2W48 A;  4C3J J;  2VUM J;  1T33 A;  2GZU A;  1LFU P;  3GBF A;  3LNQ A;  3FK7 A;  5M5X J;  2VI6 A;  1B8I A;  4NDL A;  5M5W J;  2ELK A;  2CQQ A;  4QSH A;  2KZ8 A;  4OB4 A;  5M5Y J;  1RR7 A;  2D5V A;  3ZQL A;  2JA6 J;  3FMY A;  2FJ1 A;  1UXC A;  1PRA A;  3LIS A;  4X4G A;  1QVU A;  1X57 A;  2DMU A;  4J1X A;  1FIA A;  1RZR D;  4PU8 A;  4S0H B;  4D5C A;  4F8D A;  1ETK A;  1PUF A;  1LE8 A;  2R63 A;  4IA8 A;  3UFD A;  3TP0 A;  2IV1 A;  2O38 A;  2XRL A;  1MBG A;  3S1M J;  1G2H A;  2EZH A;  3CQZ J;  1OCP A;  1BL0 A;  1LQC A;  2NVT J;  4FE7 A;  3FYA A;  1WGX A;  3JR9 A;  2AW6 A;  3JRD A;  1JGG A;  2DA7 A;  4JX4 A;  3S1Q J;  3KJX A;  1UMQ A;  1TWC J;  1X2M A;  4FCY A;  2AO9 A;  1HOM A;  2GRM A;  1Y7Y A;  2BJC A;  3K2A A;  2ECC A;  2M8G X;  3A03 A;  5F0C A;  1ZR4 A;  5FJ8 J;  2NS8 A;  4FE4 A;  1EFA A;  2JWT A;  4M3B A;  5EZG A;  2GLO A;  4XK4 A;  2K9N A;  2FQ4 A;  3S17 J;  1ZKG A;  1SQ8 A;  3F51 A;  1ETQ A;  1RKT A;  3PO2 J;  2KDZ A;  2CRO A;  2H8R A;  2X48 A;  2L8N A;  1BDH A;  1MBH A;  2CUE A;  1WET A;  2O8K A;  1JFT A;  2XPW A;  3BQY A;  3D1N I;  5F04 A;  2XPU A;  4M3E A;  5EG0 B;  3H3V K;  1OCT C;  4YG7 B;  1X58 A;  1X2L A;  2DMT A;  2M2E A;  3OQM A;  1JUM A;  2JK3 A;  5FLV A;  1JUP A;  2VKE A;  1H88 C;  5IP9 J;  2LYK A;  1EF4 A;  2QF7 A;  3QQA A;  2K40 A;  3NAR A;  1B8I B;  1MBK A;  2L7F P;  3GTP J;  5J1R A;  1PRU A;  2AXV A;  2XI8 A;  2EF8 A;  3HZI B;  4UUT A;  4FTH A;  4Y52 J;  4X4C A;  1TWF J;  3RZD J;  4IHV A;  2JVL A;  1IRZ A;  3QYX A;  3HOX J;  1I6H J;  2LR8 A;  2XPV A;  1VND A;  4PU4 C;  4BXX J;  3GN5 B;  9ANT A;  2PPX A;  4A3C J;  3A02 A;  4JYK A;  1OSL A;  1GV2 A;  1ZTR A;  2R5Y A;  1DU6 A;  2NVY J;  3GTO J;  2PUD A;  2DA6 A;  5F27 A;  2OFY A;  4X6A J;  3QPS A;  1NTC A;  2DMQ A;  1JUS A;  3A01 A;  2PUB A;  1JJ6 C;  3KZ3 A;  2CSF A;  1Z0X A;  2HYJ A;  1ZZC A;  3OP9 A;  1A6I A;  3QPL A;  4A3K J;  2BNO A;  5IYB J;  4Z58 A;  3G5G A;  2EZK A;  1SFO J;  4I6R A;  4JCY A;  3F52 A;  4MO7 A;  2H1K A;  1MBJ A;  3H0G J;  2R93 J;  3H5T A;  1AKH B;  2PUF A;  1XG1 A;  1FTT A;  1U9O A;  3ZQG A;  2L7M P;  3ZQF A;  3R1F A;  3VPR A;  3PM1 A;  2FD5 A;  5EGO B;  3SCG A;  5F08 A;  1JJ8 C;  4Z5H A;  1QQA A;  1ETO A;  4X4F A;  2CRG A;  4M3F A;  5IP7 J;  1MBF A;  5GPC A;  3OSG A;  2DMN A;  4UUS B;  2XGC A;  1IV6 A;  2L9R A;  1T56 A;  3CCY A;  1AHD P;  3IVP A;  1RPE L;  5FKK A;  4A3D J;  4XIC A;  3JXC L;  3IH2 A;  5EZH A;  1A5J A;  3BR0 A;  3SCF A;  3LOC A;  3LSJ A;  2JMW A;  2KEK A;  3BR6 A;  3CLC A;  2OPT A;  2XB0 X;  3K7A J;  2GRL A;  1BDI A;  2YU9 J;  3LSR A;  2WAQ N;  1K83 J;  2E19 A;  4V2G A;  2YS9 A;  1OFC X;  1I3Q J;  3TW7 A;  1FJL A;  4MCX A;  3FYM A;  3LFP A;  3OMT A;  2P81 A;  1SAN A;  1ENH A;  2AXU A;  2BNM A;  4MLO A;  2HXO A;  2ID3 A;  5IOY A;  3RKQ A;  3S1N J;  3M4O J;  3Q0U A;  5M3F J;  2E2J J;  1P7I A;  3OOU A;  2L0K A;  5J1Y A;  3S1R J;  1RPW A;  3MVP A;  4M3D A;  1YSE A;  1YRN B;  2PMZ N;  1DW9 A;  2A6C A;  2PUC A;  3KXA A;  4NDW A;  4DYR A;  3GTL J;  3CMY A;  2LVS A;  2Y9Z A;  2HXI A;  2HDD A;  1MSF C;  3QQ6 A;  2K9S A;  1WH5 A;  1GV5 A;  1LCC A;  3HB9 A;  4A69 C;  4IHW A;  4X4B A;  4MFE A;  5A7L A;  1S7E A;  1ZPQ A;  3O9X A;  1WCM J;  4J19 A;  4DYC A;  2EH3 A;  2TRT A;  5IOZ A;  3WHB A;  1UXD A;  2DA4 A;  3FIW A;  3CEC A;  1JWL A;  5J3L A;  3B6C A;  3I4M J;  5JLW A;  3PXP A;  1IDZ A;  1WH6 A;  4FN3 A;  1IDY A;  1MH3 A;  1H89 C;  3CRO L;  3O8H A;  1ZGW A;  4X4I A;  1ZS4 A;  4AYB N;  2HOS A;  2IVB A;  1RZS A;  5E3O A;  2WV1 A;  4IVZ A;  4C3I J;  4C2M J;  1U8B A;  1R69 A;  3EUS A;  1RET A;  1GUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...