1HF0A

Crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
128
Chain Sequence
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCTAMER-BINDING TRANSCRIPTION FACTOR 1
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 128
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hf0A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1hf0A01
4DW6A 2WUSR 3ZOBA 2WIUB 1QP4A 4DZJA 2BNNA 3JR9A 1JUSA 4B4CA 1FEXA 1ZQ3P 1RPEL 1JKQC 2HSGA 4RDUA 1X2LA 2DTZA 5EZGA 2VKVA 9ANTA 3TP3A 4QSHA 2CUEA 3PXPA 1IDYA 1RKTA 2ELKA 4FBIA 1Q1VA 1SFOJ 1LFBA 2Y9ZA 2KT0A 2JCGA 2DA6A 1BW5A 5FKNA 1RZRD 3BR5A 5E3LA 3ZKCA 2DMUA 1QPZA 1WI3A 2VUMJ 3JXCL 3K7AJ 4DYQA 2DA7A 1IG7A 1FIAA 3GBFA 3R1FA 1VF9A 2Y0SN 1XS9A 2EF8A 3KXAA 4Z58A 3IV5A 5EGOA 5C4XJ 2EBIA 2ICTA 1POGA 4J1WA 4D7NA 4X6AJ 4XRSA 4V2GA 2Y31A 1ZAYA 1ZVVA 1QVUA 2COBA 3MKLA 5J1UA 4NDLA 3BQZA 3JRIA 2JMWA 5FLMJ 3U3WA 2IEKA 1YRNB 3S16J 4NDWA 2ZB9A 2LYRA 2P81A 4EEFG 1XC5A 5EG0A 3QYXA 2GZUA 2DMQA 1H89C 2CSFA 1WCMJ 2FJRA 4Y7NJ 2EZHA 5M5WJ 1TWFJ 1AHDP 4BBRJ 3B7HA 5IP7J 3Q0VA 3E7LA 3S15J 4B3AA 2YUSA 3HOZJ 5F04A 1MBHA 5F08A 2HDDA 1Y9QA 4D7MA 4JX4A 1RR7A 3HDDA 1E3OC 2W48A 3HEFA 1U8BA 2L0KA 2EBYA 2M8GX 3ZHMA 1R69A 3JRAA 4C3HJ 3BQYA 1R9TJ 4XRMA 3IH4A 3TW7A 5EGOB 4YG1A 3S2HJ 3LSJA 4Z59A 1XG1A 3OSGA 3FYAA 1ETWA 4MO7A 1AKHA 2JA7J 2LTPA 3GBGA 5J1YA 3D1NI 1RIOA 1JFTA 3BDNA 1ZUGA 1PERL 3OP9A 3QWGA 2JWTA 1MSEC 1QRYA 5C44J 2B63J 3ZQFA 5EG0B 1WETA 2OF7A 4HNVA 1SQ8A 4A69C 1U9OA 4IHWA 1O4XA 4Z5HA 1JT6A 5GP9A 2R5ZA 3FIWA 5K7HA 1GUUA 1QQAA 3G1OA 2LYQA 3HGYA 2KZ8A 3BT9A 3SFIA 3TRBA 3BG5A 3UFDA 1RPWA 2O7OA 2JVLA 1TC3C 2OFYA 4A3CJ 1LCDA 2DMNA 1JJ8C 4G12A 5C4JJ 1TWHJ 1WIZA 3QF3A 2PUEA 3WHBA 2M34A 2GRLA 2ID3A 2R7ZJ 3FISA 1DU0A 4GQMA 4BY7J 5IYDJ 3VK0A 5M3FJ 3SCHA 2KEJA 4W1UA 3F51A 3BTCA 2HOSA 3WHCA 3JRBA 2HOAA 5A7LA 3JREA 1IRZA 4Y52J 5EZHA 2DA5A 1MSFC 2IBDA 4I6UA 1AKHB 1RETA 2EQRA 1F36A 1LFUP 3CQZJ 1BA5A 4D5FA 3S8QA 2DA3A 4JCXA 1IUFA 5FJ8J 4BKXA 4A3DJ 3OQMA 2O9LA 3I4MJ 4YG4A 3S1NJ 2IU7A 4J1XA 3A01A 1ZPQA 1WH7A 1MNMC 1WH8A 3HZIB 2R5ZB 2O8KA 5F1JA 2CQXA 1YSEA 2PUFA 3HBLA 3G7DA 1JKRC 1NEQA 2HQ5A 3F0CA 2XRLA 3HGGA 1YRNA 4F8DA 5E3MA 1POUA 1LQCA 2DMPA 2GBYA 3BR2A 3OIOA 1FIPA 4PU8A 2CJJA 4M3GA 4XK4A 3BG3A 1G2HA 2NS8A 4IHYA 4AYBN 4UUTA 4IA8A 1JKPC 4UUSA 2K9NA 1LE8A 2LY9A 1DU6A 4Y42A 2G0EA 4S0HB 3HOVJ 1B0NA 1ZZ6A 4MCXA 1QP7A 4JCYA 4I8TA 3JXBC 1VPWA 5EYRA 2XJ3A 1IC8A 2CROA 5FKLA 3CMYA 2IVGA 2XPVA 4M3BA 4FE7A 1PNRA 1LMB3 2TRTA 2M9HA 5EF6A 2ME6A 2PPXA 3GTLJ 2IUOA 5E3OA 1ENHA 5EEAA 1IJWC 4PU7A 5IYBJ 2N8GA 3JXDL 3A01B 5IPAA 3RKQA 1RZSA 4I76A 5M5XJ 1EFAA 4MIMA 4X4DA 2VI6A 3RZOJ 3BR3A 2R0QC 4IEJA 3IH2A 4M3FA 4C3IJ 4A93J 2DA1A 2XPWA 5DTDA 2QCOA 2X48A 4C3JJ 3JRDA 1IGNA 3L1PA 1HDPA 1JUMA 2LK2A 5DS9A 1DW9A 2MEZA 3ZQCA 3CLCA 1MBEA 2JK3A 1IV6A 4X4GA 2L7FP 1UHSA 3QQAA 3ZQGA 1CQTA 3SJMA 4GHJA 4UUSB 1LE8B 1K83J 3HOUJ 3BR6A 2GLOA 4X4HA 3CECA 4A3MJ 4O8BA 5HODA 3ZQHA 5IP6A 5C3EJ 1ETXA 2PUGA 4YG7B 3W6VA 1RZRA 1JGGA 1PRAA 1FTTA 2E19A 4I6TA 2IVQA 5F0CA 4M6VA 1B72A 1ETVA 2LD5A 3G1LA 2XGCA 4L5EA 3DEWA 1OCTC 3CDLA 4PU4C 1WPKA 3BTJA 2JN6A 3OMTA 2H8RA 3BG9A 1P7JA 4D5CA 3S1QJ 2EZKA 3BS3A 2FQ4A 3BD1A 1H88C 1TWAJ 1RKWA 1ZR2A 2K9SA 1LLIA 1GDTA 3LOCA 3JRHA 3S1RJ 2NVYJ 2XPUA 2DJNA 5K7FA 2BNMA 4B1RA 4BBSJ 2K40A 3GTMJ 3G5GA 5IP9J 1NK3P 3LFPA 5K98B 2R5YA 1ZR4A 1ZZ8A 1HF0A 1TWGJ 3PM1A 1T56A 3QQ6A 5EDNA 1B8IB 1UTXA 4MFEA 1Y1WJ 1XWRA 1BDIA 1ETQA 2LFBA 2VKEA 3TW6A 4AC0A 1MBKA 1T33A 2ECCA 1MBGA 3ZQIA 5K7ZA 1OCPA 2PUDA 4AUXA 4QTRA 3O8HA 1UXCA 2L9RA 3MN2A 2E2IJ 2LR8A 1B72B 4Z5CA 1I50J 1U9NA 2MSYA 2VPRA 4GFBA 2EWTA 1X58A 2NVXJ 1HLVA 1NK2P 4YBAA 2LP0A 2R1JL 2IAIA 2PMZN 1OFCX 1F43A 2QF7A 1JJ6C 1ZS4A 2TCTA 3LNQA 4M3DA 2BJCA 1HCRA 3DNVB 4IVZA 1ITYA 1ZK8A 2WAQN 5F27A 2ME0A 3ZHIA 1IDZA 2XGDA 2NVTJ 3VPRA 1Z77A 3RZDJ 2LYLA 2WV1A 3LISA 2R5YB 2ICPA 1AU7A 2JJ7A 4JP0A 5E3NA 4A3LJ 4FTHA 1QVTA 1PRUA 1HDDC 1I6HJ 4FISA 3HKZN 1A6IA 3GN5A 2Y30A 4LOCA 2L7ZA 3O8GA 2Y9YA 2K9QA 2EZIA 1Z0XA 1MH4A 1R63A 2JA5J 1BW6A 3FMYA 4FN3A 3GTPJ 3PO2J 2L7MP 3EUSA 4XIDA 1MH3A 2HXOA 4JX6A 4IHXA 2AO9A 1JFSA 4XICA 4I6ZA 3A02A 1FJLA 2E1OA 4A3JJ 4JYKA 2XSDC 3FK6A 2AXVA 2EH3A 2HOTA 2IV1A 1UMQA 2LYSA 2L49A 2GM4A 3UKGA 1ORKA 2AHQA 2R93J 4XRSG 3KJXA 1OJLA 3OOUA 2DA2A 2I10A 4X4CA 2ID6A 3CCYA 2O4AA 2NS7A 1W0TA 2PUAA 2HXIA 2LKXA 3RZZA 5F0FA 1VFCA 3H5TA 2DN0A 3MLFA 5FKMA 4IHVA 4MFDA 3MVPA 2AXZA 5GPAA 2B5AA 2KPJA 2XI8A 1QQBA 3HOYJ 5J1RA 2M0CA 1PUFA 1GVDA 2EZLA 4DYCA 3GN5B 1CJGA 4A3IJ 4FE4A 1X57A 3OQOA 3M3YJ 5BNGA 1X2NA 3BTIA 1L1MA 4PU3C 3FYMA 5F0HA 2LCVA 2OPTA 2FX0A 2YS9A 3FKIJ 4A3EJ 1JTXA 2WB1N 5JLWA 1B8IA 1MBFA 1JKOC 2MQKA 2R63A 3LSGA 1SANA 3GTJJ 4A3GJ 2NOGA 2Y2ZA 1OSLA 3JRCA 3HB9A 1BL0A 2AW6A 2DMTA 4X4BA 4X4FA 1BDHA 3IH3A 2IVBA 3JRGA 2PUBA 2JA6J 4YARA 1ETYA 4A3KJ 2A6CA 4RBOA 2E2JJ 2R92J 3M4OJ 3IVPA 3B6CA 1ZZBA 3QPSA 4MCTA 3RQIA 3F6WA 4X1EA 3Q3SA 3OQNA 1ETOA 1ETKA 3GTQJ 4A3FJ 2MGQA 4QIWN 5IYCJ 1Y1VJ 4X4EA 1JH9A 4C2MJ 2RAEA 2AWIA 2E2HJ 1K61A 3LSRA 1QP0A 3CROL 4CYCA 1APLC 2XIUA 3S14J 3G1MA 2LYKA 2CRGA 1PUFB 5FLVA 3BR0A 3Q0UA 5FKKA 1P7IA 2PUCA 2CQQA 2HYJA 3GTKJ 1I3QJ 3KZ3A 3HOXJ 3TEDA 2LYJA 4W97A 5IOYA 2AUWA 1BJZA 1X2MA 3I4NJ 4I6RA 4DYRA 3O9XA 3B6AA 4MLOA 1VNDA 2DA4A 3F52A 1HOMA 2PE5A 4Z5DA 1ZZCA 2KEKA 2MG4A 3S17J 2BNOA 3SCFA 2MW8A 1D5YA 4IWRA 1JTYA 1LCCA 3OSFA 2LVSA 3H0GJ 3SCGA 4J19A 3FK7A 3BTLA 3QPLA 1JWLA 1ZZ7A 1EF4A 1RESA 4M3EA 4BXXJ 4JX5A 5M5YJ 4JQDA 2KEIA 5M3MJ 2CUFA 1GV2A 3Q0WA 3ZQLA 4X4IA 1H8AC 3TP0A 1W0UA 1QPIA 2JA8J 1ZGWA 1VI0A 1UXDA 2XGEA 4ABZA 2L8NA 4BY1J 2OR1L 3LSPA 1UG2A 1TWCJ 4CYCB 3GTGJ 1GV5A 1ZKGA 2X6OA 1PRVA 4V2FA 5JLXA 2KDZA 2ECBA 3DCFA 1JUPA 2XB5A 1ADRA 5IOZA 2CU7A 1NERA 5FKOA 1S7EA 1MBJA 3JRFA 1NTCA 3PO3J 2LLKA 1WH5A 3SDGA 1U78A 3S1MJ 2LYPA 3C2BA 2FJ1A 2H1KA 4FCYA 2HINA 2XB0X 1DWKA 5J3LA 3K2AA 3HM5A 3HOWJ 2AXUA 1ZZ9A 2HI3A 1WGXA 2X9DA 5GPCA 1JT0A 2XCJA 1A5JA 2GRMA 2O49A 4DZPA 1Y7YA 1WH6A 3NAUA 1GT0C 4OB4A 3GTOJ 3NARA 2NVQJ 2YU9J 3S2DJ 2M2EA 2PIJA 3BR1A 3H3VK 1ZTRA 1FTZA 2D5VA 2O38A 4A3BJ 2FD5A 3A03A
chains in the Genus database with same CATH superfamily
2KMUA 2KZVA 4IKFA 2JVGA 3ZOBA 4I7HA 2DPUA 3BJOA 1QP4A 3E5XA 2DFFA 3WTTC 3T0YA 2IS6A 1OCOH 1ZGJA 5EZGA 1HW2A 1WZ2A 1B1BA 4XM3A 4QSHA 4HDUA 2H27A 1RKTA 1E0EA 2M3AA 2YR2A 4M73A 1SFOJ 4BUPA 3G3ZA 4D0PA 2Y9ZA 2A6TA 3HPHA 1LDDA 1QPZA 1WI3A 2VUMJ 4ER6A 3WG9A 3JXCL 1KGSA 2VC0A 3K7AJ 2WV0A 3TL4X 3GBFA 4M9SA 3GF2A 3R1FA 1XDSA 1RNLA 2VE8A 3KXAA 2R7OA 1VQ6I 2XDVA 4Z58A 5EGOA 5C4XJ 1POGA 1D1CA 2NAZA 1USSA 3E6MA 3EUKL 1ZG1A 4X6AJ 3E3VA 2LREA 4XRSA 1S3JA 2Y31A 1ZVVA 1QVUA 2KZGA 5J1UA 4NDLA 2EFQA 2F5VA 3BQZA 4GGGA 4YEJA 1ZYRF 2E7WA 5FLMJ 3U3WA 2IEKA 1YRNB 2EFOA 2O03A 1AA7A 3CTAA 2DI3A 2UUZA 4XOTA 3QYXA 3A9XA 1D8JA 2EZHA 3DU5A 4CICA 3ECHA 5JR3A 1J75A 1HW1A 3LSTA 3B7HA 2GA1A 1KA8A 1H9GA 3E5UA 1RR7A 1E3OC 2F4IA 1E3PA 2YX4A 4PSWA 4IHSA 4C3HJ 3BQYA 1R9TJ 4C2TA 4XRMA 1IXCA 3GVAA 3GXOA 3I9V2 3S2HJ 3OYNA 3LSJA 1BOAA 1T0FA 2R7QA 1OYYA 1BN5A 1ETWA 4MO7A 3P9KA 5ILVA 2LTPA 3D1NI 3ZMVA 3QOWA 5B66C 3RYPA 1OISA 1HBXG 3CF2A 1DPUA 1QRYA 5C44J 2QBYA 2MC3A 2E5NA 3HRTA 3O3KA 4R79A 3ISPA 1U5TC 2P8TA 3GEZA 4A69C 2J7UA 3FBIB 4Z5HA 1JT6A 5GP9A 2PXBA 3G1OA 3R09A 1C0WA 1VQOI 3SFIA 3AFHA 3AG3H 4ESJA 4P55A 2UWMA 2PXVA 4XKCA 2PUEA 3CZ6A 2M34A 3WHBA 1Z3XA 1W5CC 2JVHA 1XTAA 4BY7J 1U8RA 4B8XA 4E7LA 1T39A 2IPQX 3IRRA 5IYDJ 2ZKZA 4OAYA 3VK0A 1KU9A 1KU3A 4YRVA 3SCHA 2KEJA 4W1UA 3BTCA 3J7YJ 3WHCA 5HNFA 1MD0A 2HOAA 3JREA 1IRZA 3R60A 1XD7A 4P5OA 5EZHA 3L7WA 2DA5A 1YJ9I 1A6QA 1RETA 4ENMA 4G94A 3CQZJ 3E6DA 2LKPA 1IN8A 2M5WA 3S8QA 2M8EA 2DA3A 3V8LA 3DF8A 3D5LA 3CC4I 3OQMA 2HVSA 2O9LA 4YG4A 3S1NJ 5JUWA 4J1XA 3A01A 1WH7A 4KT5C 1MNMC 1T38A 1SFKA 2EINH 2AS5F 1YSEA 1EH8A 2OZUA 4RS8A 1JKRC 1LDKB 2OD5A 4RLQA 4PJJA 4XSXF 1YRNA 3LAPA 4F8DA 3JSOA 2P5KA 3PIOF 4BQNA 2GBYA 3BR2A 2D2WA 3K4LA 4AIHA 3DV8A 3M07A 3QWLA 4XK4A 2PI0A 1G2HA 4IHYA 4A6DA 4ESBA 1UHWA 2L4AA 2X51A 2K9NA 2DODA 1WJ5A 2G0EA 4RB3C 4MCXA 4Y42A 4I8TA 4ZZLA 3CMEI 3JXBC 3MCZA 3QP5A 1IZ1A 1DDNA 2QEXI 2CROA 2Q0OA 2F5FA 2OUMA 1R49A 3OS1A 5EF6A 3GTLJ 2QSHX 3HTUA 2O0YA 2ZJ2A 4R1HA 4NQWB 1SD5A 1J5YA 2L01A 3RQ4A 3JXDL 2Q1ZB 1BIBA 2KIQA 3RKQA 1RZSA 4I76A 2I5UA 1HC8A 2K9LA 3U9GA 2QENA 2VI6A 5DCFA 3RZOJ 2WWYA 2QZ8A 4BQAA 3IH2A 4O3MA 3WGHA 3D5SC 2IXSA 1OYWA 2XPWA 2DA1A 2L2OA 2QCOA 5D8KB 2KFDA 4ZYHA 3GMEA 2Y0MA 3CMMA 3L1PA 3ZP5A 3K6GA 1DW9A 5TRDA 2VIXA 3FDYA 3KP5A 2KIMA 1LJ9A 3OS0A 1IV6A 1UHSA 1VQMI 1BI0A 3ZQGA 1V5EA 1LE8B 1K83J 2ELJA 1F5TA 3KP4A 1NW3A 1YW9A 4A3MJ 2G7HA 3ZQHA 5IP6A 4XRFA 1JXSA 1P2FA 3CCRI 2JZYA 3H9JA 2PUGA 4YG7B 3FXLA 2Y0SA 2E19A 1YO5C 1D1BA 2E1MB 4M6VA 3KL4A 5HLGA 1JI8A 4PU4C 1YX3A 1Y8RB 4BEHA 3JSPA 3KPHA 2R7VA 2L9VA 3K9TA 2F5DA 2R7FA 1TT0A 3ZGKA 1J2XA 2FQ4A 3RKYA 3G6EI 4KA4A 3BD1A 2WY7Q 2OQRA 4XKWA 1MDMA 2FQ3A 2K9SA 5F6FA 3WE3A 2Y69H 3W2VA 3OL4A 2XPUA 4XLPF 3W2AA 1ZAOA 4ER5A 4B1RA 1O3RA 1STZA 2NVUB 5IP9J 3LFPA 2HCSA 2R5YA 1ZR4A 3ZMUA 1ZZ8A 1W7PA 1HF0A 4UNOA 3PM1A 1T56A 1K6YA 1YS7A 1O3SA 1B8IB 4LD5A 2CQKA 2DJIA 3EDPA 4XQFA 1Y0NA 3I64A 4JQFA 5HVQC 1BDIA 2H6BA 4A0XA 1MBKA 1T33A 1QZYA 1MBGA 3CLOA 5K7ZA 3TFLA 1OCCH 3QYFA 4QTRA 1BBYA 4CCMA 3VYTB 4BHCA 2E2IJ 2PN6A 4Z5CA 1U9NA 3FBNB 2BXYA 2DU9A 1J59A 5D5WB 2EWTA 3P9CA 4Y13A 1NK2P 2EA2A 3CCMI 2BY3A 3IAS2 4OIOF 2OJED 1OCZH 1JJ6C 3LNQA 2KJCA 3E5QA 3MWMA 2X6WA 2BJCA 1HCRA 1EA3A 1I6XA 2ISZA 3LSIA 3X2QH 2XGDA 2F4MB 2XUBA 5DM7F 3CCEI 2NVTJ 4CZZA 1P4AA 2ICPA 1AU7A 3GFMA 4JP0A 1QVTA 2HZDA 1FZPB 1PRUA 3NWSA 1MMAA 1QHHD 4HDVA 3HKZN 4YG2F 3GN5A 2FOKA 4LOCA 2FF4A 4ITVA 4L0ZB 1FYMA 2VT3A 3A4CA 2RNJA 4FN3A 3R0JA 3WTZA 1MH3A 2V79A 1HKQA 4AVZA 3WTWC 2AO9A 3IP4B 4RM2A 3S2WA 2VBZA 1FJLA 4G6TB 3FXJA 2PXLA 2XF5A 1QB2A 5BS6A 4JYKA 2XSDC 3OYDA 3I56I 2HOTA 2AXVA 3BZCA 3P9IA 1ORKA 3GW2A 4OBMA 1G6NA 3KJXA 1OJLA 2RKHA 2DA2A 3RSNA 2ID6A 2PJRB 4E7IA 2LDUA 2XAGA 4E7JA 2HXIA 3GLXA 1T08B 1WJDA 4CUGA 3H35A 1WI9A 1VFCA 3W2WA 2LBFA 3H5TA 3LSKA 1CGPA 2Z9OA 3F9KA 2XI8A 1QQBA 4RGSA 3MKYB 5D6FA 5CLSA 2P6SA 3FM3A 4KT6A 4G8XA 1WJAA 2QQ8A 3OQOA 1FPQA 1EH7A 3QRFF 3CDHA 3J80K 2A07F 2DO7A 4HX4A 1JGSA 2LCVA 3KYLA 2G9WA 4AYBA 1VQLI 3A1YA 1S5LC 1BI3A 2ZMEB 3KYCB 3KE2A 2V9VA 5JLWA 1B8IA 4IRIA 1JKOC 3GYHX 2LKSA 3LSGA 1TP4A 3MZ8A 3ELKA 5CJ9A 4D1QA 3OYMA 3GTJJ 4A3GJ 2OTJI 2ODRD 1CF7A 4X4BA 2IVBA 2PFBA 3JRGA 2JA6J 4YARA 3M8EA 5B3SH 4P96A 2IP2A 3WODF 2R92J 2E2JJ 3C3WA 2VQHA 4BU2A 2FRHA 1A04A 4HW0A 3Q3SA 5CYVA 3OYEA 1TNSA 5DRYA 2GIZA 5IT9Z 4X4EA 1V54H 5TJJA 1Z6RA 4XL9A 3OKZA 4OIQF 3TO9A 3K69A 4YIRX 3LAJA 3IHUA 4ENKA 1SC7A 1APLC 3G1MA 3TEPA 2L4MA 3PJRA 1YX5A 2OAZA 3GTKJ 1G3WA 4HRAA 1I3QJ 3SYTA 3ROUA 2LYJA 2QM3A 4W97A 4HBLA 2AUWA 3O9XA 3B6AA 1HOMA 2DYSH 2MG4A 3DWLE 2DBBA 2LVSA 1Z1DA 2K02A 1BC8C 2ZC2A 4J19A 1XSDA 4UVCA 2K85A 1ZZ7A 5E79C 1TL8A 2P7CB 1Z9CA 2Z16A 4Y33A 5M3MJ 3IRQA 2P0WA 3ULQB 4HSRA 4CCOA 5AONA 3F72A 2DT5A 4E70A 3M8FA 2LLVA 2O61A 2IRFG 1VI0A 1X4PA 4UY8I 3OWQA 4BY1J 2ZJQF 2XAUA 2OBPA 1D1AA 1TWCJ 3LMMA 4XBFA 3GTGJ 1ZKGA 3BLYA 4CSWA 1LNWA 1I5ZA 4PJMA 4E7ZA 3LSMA 4V2FA 5JLXA 3DBRB 1D5VA 3MEJA 1NERA 5H6QA 2Q2EB 3FX3A 3MMYB 3JRFA 2V6EA 5FB2A 3SEZA 3N05A 2H1KA 3GFIA 4F93B 5JFRA 3VYSB 2J5OA 3K2AA 4KIBA 2DDAA 5LEJA 4KUMA 5GPCA 2W00A 5H6RA 2XKOA 2BOLA 3MKWB 3K70D 4WXCA 4B47A 2O49A 1FT9A 3BROA 2WAFA 3HUGB 5LHGA 4OB4A 1X1PA 2EIMH 1R58A 2NVQJ 2M2EA 3G2BA 2PMZA 4PGGA 1HQCA 2HVQA 1ZTRA 4IO9F 3PE5A 4A3BJ 2HU9A 3FM5A 5HS8A 2X0LA 2ZJRF 1YFHA 2WIUB 2EFPA 4A6EA 4RAZA 4DZJA 2A5YB 4B4CA 1ZQ3P 2RN7A 3CMAI 1U5TA 4Q2JA 2DT6A 2W85A 4EJVA 1ON1A 2DTZA 4LB5A 2VKVA 3ZMTA 4B43A 9ANTA 2PBIA 3K4CA 4HRIA 5AIQA 4FBIA 2ELKA 2VBYA 1LFBA 4IQJA 2EV6A 2JCGA 2KT0A 2ADUA 2VBWA 1Z21A 2W24A 3GUUA 4RGUA 4ZTFA 3RKXA 5E1WA 4ZYAA 2CH0A 1IG7A 3C2HA 2IA2A 1VF9A 3CUQB 2KJBA 3HHGA 3BJAA 3T5XA 2DW4A 4J1WA 4EKGA 4M6XA 2MD5A 2UXNA 2J5PA 4D7NA 2NYXA 2LF8A 4U0WA 4CZCA 1F1ZA 2FMYA 4CCNA 4PGHA 5DUKA 1ZAYA 1USTA 3RYRA 3TOBA 4NDWA 5B1AH 4ZJZA 4EEFG 5EG0A 3MZHA 2DMQA 5F1RA 1H89C 2CSFA 2E1NA 5D4SA 2PXEA 2H94A 3GZ6A 3KETA 3SXYA 3S15J 2CQNA 4LGWA 2YUSA 5F04A 1MBHA 2HDDA 4D7MA 1TLHB 1X4OA 2XRNA 3FKJA 4XOPA 2L0KA 4Y17A 3L2CA 2EBYA 5LD2C 3ZHMA 1R7JA 4S05A 3OIPA 3IH4A 5EGOB 2Q2EA 2K27A 2VPLA 3OSGA 3S3OA 5FFXA 3OL3A 1X1BA 1AKHA 4HZFA 5DTRA 1J9IA 2ZO4A 5D5UB 1ZUGA 2JWTA 1IRGA 5HS9A 1R1VA 1RI7A 4WXHA 5ILUA 2FA5A 5FD5A 1WETA 2F48A 2FNAA 4HNVA 3VB2A 1O4XA 2R5ZA 3FIWA 5K7HA 4IRGA 2M45A 1SMYF 2NRAC 3TO6A 3T8TA 3TRBA 3CCUI 3JW4A 2O7OA 2JA2A 5L3FA 5LEKA 2IW5A 2ZCWA 4A3CJ 2F6CA 1L3LA 1LCDA 2Z1DA 1I27A 1L0OC 2KIUA 1WIZA 1VQ8I 3RJPA 2VJ5A 4UXNA 3FISA 1B9MA 1T2KA 1DU0A 4L18B 4LLNA 3KEQA 1A35A 1QGPA 2HTJA 4HEA2 5ICEA 3QOPA 1HXDA 1HQ1A 4BHBA 2BW3B 3J81Z 4X0GA 3CCQI 3EPZA 6PAXA 1SD4A 2R7TA 2QGUA 1IF1A 4I6UA 4U7BA 3GCMA 2B7EA 1XMKA 1F36A 1LFUP 1KQ0A 5B5EC 1BA5A 1W5SA 4EMSA 3CUQA 4JCXA 4BKXA 4A3DJ 2RREA 2QBYB 3C2GA 4ETSA 4G7OF 2QWWA 1ZPQA 2STTA 3DBLB 2O8KA 3ERMA 4II2A 3AL0B 3ZR8X 2DOFA 3GO5A 4F91B 2PUFA 3VWSA 4I99C 1Y8QB 3DU6A 4EJWA 1VQ9I 2FE3A 4UVAA 1POUA 2DMPA 3OIOA 4KJZA 3B02A 4HV5A 3HSEA 4FX4A 1ZRFA 1B6AA 3OMYA 2BGCA 3QP6A 3ZMZA 4PU8A 3BG3A 2PG4A 4YIIA 1AOYA 4HLYA 2EK5A 2QSGX 3DP7A 3FXRA 4AIKA 3F8FA 1XGSA 1BC7C 1DU6A 1G3TA 4S0HB 1YITI 2JT1A 2OA4A 4JOMA 5E1ZB 1VPWA 4ANJA 2X1DA 2XJ3A 3ONQA 2QKMB 3ABUA 3CMYA 1PNRA 3QPTA 4M3BA 4FE7A 1Z6TA 2TRTA 2AXTC 3BPXA 3FZVA 1ZARA 4LK1F 4I01A 1B4AA 1GVJA 2DFIA 5EEAA 2K4BA 5DD8A 3BC8A 5IYBJ 2N8GA 2IJLA 5JVGF 4GDFA 1K4SA 4BAYA 3A01B 5IPAA 3EYYA 3CCVI 2NOJB 2E7XA 3GLLA 5M5XJ 2KDOA 5KNLA 1S7AA 3TDZC 3L2WA 4X4DA 1Z05A 3KP2A 2R0QC 2CSOA 4IEJA 5FLXK 2KP6A 3F8NA 2BVMA 1MJBA 1RIOH 1IGNA 2HQAA 4LG0B 1HDPA 1YW7A 1F9NA 2V1NA 3CLCA 3LQXA 2BHYA 3GX4X 3UWPA 3QYEA 1IN7A 5HS7A 3QQAA 2W25A 4ON0A 4BE2A 2L9SA 3L2QA 4F55A 2RNGA 1ERDA 3OIQA 3CECA 4X4HA 4C30A 4UHTA 5C3EJ 5B1BH 1R5HA 2FXAA 1ETXA 3WTVC 2L1PA 5TISC 2VBXA 1ZGAA 4QPOA 1FTTA 1IV8A 1PRAA 5F0CA 1B72A 1ZHFA 3DEWA 2RV8A 1OCTC 2F5CA 3CP2A 2YX7A 2BW3A 2EWNA 2FBKA 3BTJA 2BXZA 5GTIC 5LHHA 5CKTA 1R4NB 3HOTA 1QHGA 1B9NA 3BG9A 1P7JA 5H2FC 2ELHA 3BS3A 2EIKH 1K78A 3H3ZA 4IVNA 3TGNA 4OINF 1REPC 1H88C 5LGTA 1ZR2A 1GDTA 3JRHA 4EZIA 3S1RJ 4MNUA 4GYIA 3WTXC 4BJTA 2BNMA 3IKTA 5DV5A 3GTMJ 4EVIA 5K98B 4M74A 1SVLA 1R71A 4EGZA 1TWGJ 2E71A 2IT0A 1XDUA 1K4TA 3I59A 5EDNA 3SEQA 3WGIA 1UTXA 3H3UA 4Q5SF 2QSFX 2DAOA 2RQPA 3H5NA 3PFYA 4C2UA 1RZ4A 4XNFA 2R7DA 1XWRA 2VKEA 2GAUA 4ER3A 3ZQIA 2XSJC 1OCPA 4AUXA 4Q47A 1JHHA 4L9JA 2L9RA 2XIGA 1H9TA 1I50J 2MSYA 1BM9A 1LVAA 1K7AA 1UB9A 2JQEA 5DUIA 4FT8A 4BEHB 1JHFA 1G3YA 3K70C 2NVXJ 1HLVA 2QQBA 3I54A 2V4JC 2IAIA 1I1GA 2HNHA 2JRTA 2QF7A 1ZS4A 3F6OA 2ZXHA 1X1AA 5E20A 1MDMB 4E7KA 2HWVA 4EATA 3J81K 1Z7LA 2O6GE 4EK9A 3C18A 2HPIA 2C6YA 1VZ0A 1Z77A 5DYMA 2FBHA 3K4MA 2LYLA 3PSIA 2WV1A 3LISA 2X85A 2R5YB 1TNTA 1W7PB 5E3NA 5H20A 2DXIA 2ZBKA 2F5EA 4G7HF 1I6HJ 4PJNA 4EQQA 1A6IA 1U3EM 2Y30A 4DQ2A 4U7DA 2K9QA 3U1DA 1DP7P 4M71A 3FMYA 1R63A 4LG0A 1LQ1A 2CUJA 3PO2J 1MMSA 1DGWY 2HCNA 3EUAA 3TOAA 5ICCA 4GCVA 2HXOA 5GAGJ 1LDJA 3CD6I 4ZTJA 5LLQA 3E6BA 3HRSA 4E6KG 3HTSB 2ZXIA 2HFHA 4RM3A 2OCCH 1SFUA 4S04A 2L49A 2GM4A 3IC7A 2XXQA 3LFUA 4L5IA 2VODA 1YJWI 1R22A 4HPQA 1YLFA 1MZBA 2M4GA 4XLCA 4BXFA 3ASOH 3NWTA 5L3EA 2Q8KA 2ZNZA 2LKXA 3S3NA 4WX9A 3OYFA 3A0BC 1TT5B 1ACIA 2KLOA 5EEGA 3RZZA 5GAEJ 3CUOA 2DN0A 3J80Z 1KONA 2ETHA 3AG2H 2VEOA 5D5XB 2B5AA 2KPJA 3HKZA 3VYUB 4B3XA 2QLZA 1WJEA 3OR2C 4RB1A 5J1RA 4WK8F 2EA4A 1IUYA 1PUFA 3GN5B 2XASA 2XAQA 3B73A 4DYCA 4FE4A 3LL7A 4KDPA 2YBDA 2DOAA 1WKMA 3BTIA 1L1MA 4PU3C 3CCJI 2QA4I 1QPMA 1E17A 2YS9A 3FKIJ 4ZC3A 3FMRA 3EUHC 3PQJA 4G6QA 2WB1N 3HRMA 3AG1H 2IS4A 3SFZA 4OAZA 5LFAA 1SD6A 3TQNA 4IL6C 2GXBA 2NOGA 3HB9A 2E5ZA 1BL0A 2HZTA 1BDHA 2XGXA 3IH3A 5TGTA 4A3KJ 4RAFA 1E3HA 3M4OJ 3BCAA 3QPSA 4MCTA 3M9AA 1X3ZB 3Q9VA 5DTMA 1ETOA 3C7JA 4OU0A 2Y48A 1OYIA 4N9IA 4QIWN 2LBFB 4C2MJ 2L54A 2ZSHB 2A05A 2AWIA 2LY2A 4HV6A 4ER0A 2GXAA 2UXXA 2H8WA 3QODA 1RRJA 2COMA 2CGPA 2CMPA 2L5QA 4CYCA 1QP0A 3CROL 1YJNI 2LYKA 4U0VA 2KPMA 3A0HC 2M30A 5DTQA 2GQQA 3FHZA 1KQ9A 3H5AA 3BJ6A 5FLVA 3IWFA 2HKOA 4H4KC 3KZ3A 3HOXJ 1PP8F 2A68F 4ZZDA 4YELA 3W6JB 5LGUA 2JUCA 3I4NJ 4I6RA 4DYRA 1VNDA 2DA4A 4HLXA 2FEZA 4DGWB 2VN2A 4CCKA 5EEHA 1PJRA 3SCFA 1FMWA 1Y39A 2XXAA 3OSFA 1CF7B 4BGDA 5J6XA 3BTLA 4RB2C 3PQKA 1RESA 4CGZA 1ZG5A 5M5YJ 3BG6A 2ZXWH 1YW8A 4JQDA 1O57A 2IGOA 2XAFA 4CA0A 4X4IA 1A31A 1FSEA 3MD2A 1WFXA 1W0UA 1QPIA 1ZGWA 3CJNA 2XGEA 2FSWA 4ABZA 4CDGA 3LSPA 1UG2A 1TZLA 4CHUA 5L3CA 3MQ0A 2V9KA 2AQFA 2JUGA 1YIOA 1X1DA 1M1EB 2UV1A 1LKXA 2WY8Q 2KDZA 1JUPA 2XB5A 4O5VA 2FFHA 2VQGA 1ADRA 2CU7A 3WU1B 1S6LA 1FYKA 5ILSA 2DFEA 3W6KB 2HR3A 3D5RC 3VSLA 2XF7A 2JPBA 3DKXA 2O3FA 1NTCA 3H9GA 4IOAF 1WRJA 2ZXJA 1OCRH 2LLKA 2W7NA 3C2BA 5BPDA 4FCYA 2OZ6A 1DP3A 2V1UA 3QOEA 4HX7A 3E6CC 3HM5A 2AXUA 2HI3A 2PX9A 2XV4S 3PUFA 5HOOA 4RLFA 1WJCA 4DZPA 5HLTA 3PSFA 1Y7YA 3NAUA 2M87A 4MTDA 3GTOJ 4DE8A 3NARA 5CQGA 1W1WE 5JI6A 1R1UA 3EYIA 1HSJA 1IN4A 2D5VA 1FTZA 1QA6A 1SAUA 2R93J 3QYBA 3CCLI 2BVLA 3PL8A 1UAAA 2V6CA 1R5GA 1SFEA 2P4WA 1FEXA 1RPEL 1P4XA 2M0MA 4RDUA 4ZDPA 3TP3A 1X3UA 2GWRA 4E7SA 1T0FC 4XONA 1DULA 5HDKA 1Q1VA 3SQNA 2K3PA 1RUNA 2PMHA 3KCCA 3ZMDA 2DA6A 2DLLA 2KL4A 3GFLA 1BW5A 1RZRD 1XPXA 4E7HA 3ZKCA 4EM0B 2XAJA 2DYRH 2JRMA 3DPUA 3P7NA 1IRFA 2DA7A 1VQPI 4UV8A 3DTIA 3OYLA 2Y0SN 1XS9A 2EF8A 1XB4A 1OR7A 2MH9A 4A5MA 2ICTA 4XR6A 4RB0A 2PJPA 2EFWA 2HDWA 3AL0C 1X3WB 2L7KA 2LG4A 2COBA 4NC7A 2WC2A 3JRIA 2JMWA 4CO8A 4PK4A 1TQMA 2YPRA 1NHAA 4EJTA 2ZB9A 3GWZA 4YFXF 4KICA 2LYRA 2HYFA 2M1BA 1VTNC 4IRHA 1U5TB 1DGRM 4DIQA 5IY5H 2FJRA 3SR4A 1TWFJ 4PZJA 4LLLA 4BBRJ 5LGNA 1FMVA 2B0LA 1FOWA 3Q0VA 5IP7J 3E7LA 3DLLF 3M1CA 4B3AA 5CQEA 5GAHi 1LEBA 3HOZJ 5CVJA 5F08A 5BMZA 1Y9QA 2O8XA 3H36A 1ZLJA 4B48A 4JX4A 4LFUA 2W82A 3OOPA 5J8FA 1O7LA 4BNCA 2A6EF 3ECOA 2M8GX 1V5FA 3A2KA 3OY9A 5A2QZ 1R69A 1ZG3A 1LFPA 2GA2A 3TW7A 5HDGA 5IT3A 2A6HF 2QVOA 1XG1A 2Z33A 1HW5A 2ISYA 2JA7J 3SHFA 1LUJB 3KP3A 1XSVA 3WU2C 5GTHC 3BDNA 2I8DA 1VQ5I 1FYLA 3K10A 5DEQA 3I55I 1AWCA 1IW7F 3PFIA 1MSEC 5BQTA 2X4HA 1XGNA 2B63J 1Z7UA 3ZQFA 5EG0B 1ZRDA 1XX5A 1KYWA 1SQ8A 1UHMA 1U9OA 3K4BA 3RPUD 3G4SI 1QQAA 5KK1A 4AIJA 2HKXA 5KAFC 3MKZA 1YOVB 3UFDA 5FO5A 1ZN2A 5CPRB 2E36A 2JVLA 3DEUA 4BYYA 4HSTA 2OFYA 3HXLA 3A9YA 5C4JJ 2NNNA 4DOZA 3LA3A 4WXDA 2FUG2 3LA2A 2R7ZJ 4GQMA 2CO5A 1Z91A 2KIFA 1O7FA 2HQRA 4WF2A 3HYIA 4PJ0C 5M3FJ 2CFXA 4OWRB 5D6EA 3JRBA 2G7UA 4UB8C 3NQOA 1V4RA 2A5WA 3PNTA 2VLAA 3ZXSA 3HZJA 3HPGA 1MSFC 1G4DA 1AKHB 4P1WA 3JAMZ 2JPCA 3D0SA 3IUOA 4FHTA 3TBIA 4D5FA 3AKZA 1IUFA 2GIVA 1TBXA 2VC1A 2IU7A 2ESNA 3PNVA 3CJRB 2PXPA 2CV2A 1WH8A 1RC9A 2R5ZB 3UNGC 2CQXA 1MKMA 3HBLA 3OS2A 3VWBA 3G7DA 2OV7A 1Q1HA 1NEQA 2HQ5A 2XVCA 3I4PA 2IS2A 3F0CA 2XRLA 3HGGA 4CH7A 4NB5A 4HX8A 4YFNF 3I5UA 2KRFA 1S72I 2NS8A 1OLTA 2NXNB 4AYBN 4UUSA 1O3QA 2K5CA 2F2EA 2MD0A 2CWEA 2P5LC 3HOVJ 1QP7A 2FBIA 4Q4ZF 1W5TA 1ZZ6A 1ZREA 2DTRA 5JVTA 3VYRB 3WG7H 2HOEA 3NROA 3HIFA 5FKLA 2XPVA 2O5RA 2P6TA 4HQMA 3V7SA 1LMB3 2ME6A 2PXKA 2IUOA 1N77A 1ENHA 3NDBB 1ULYA 1U0JA 5FLXZ 5HLIA 3G73A 4BL0B 3WTYC 1T6SA 3DQVC 1LPQA 3RCOA 5DDGA 1D3YA 1V5GA 3KP7A 4G9YA 2DK5A 3BR3A 4ZYGA 4PDKA 2WA0A 4A93J 4DJAA 2EB7A 5DTDA 4MGRA 4C3JJ 3JRDA 4M72A 3L2VA 3GUDA 4FASD 2EJRA 2MEZA 5J4VA 3BPVA 2LOOA 3ZQCA 3BDDA 3L9FA 2ESHA 4X4GA 2L7FP 3DKWA 4GHJA 1CQTA 5HDNA 3SJMA 2LSOA 3HRUA 3BR6A 1SVMA 5LRSA 4O8BA 1WWXA 2MABA 5HODA 1IAWA 3C1DA 2XHKA 4NNJA 3U2RA 4FETA 1EH6A 4N9HA 3N4MA 5E8GA 1P9QC 1MIJA 2MA3A 2WADA 4II3A 5J4YA 4L5EA 1PVEA 3IWZA 3CDLA 2QYOA 3MEXA 3GZCA 1J7KA 4D5CA 1RR8C 5A2QK 2EZKA 2OU2A 2LC2A 3CP8A 1XCBA 1HKSA 2HVRA 1FLIA 3ZRGA 3GZDC 5K1YA 1RKWA 1Z3YA 4L0YB 2AXLA 2NVYJ 1U2ZA 4KISA 5K7FA 2JSCA 3IKVA 2LY1A 4BBSJ 4NUBA 4C9YA 3G5GA 3FWEA 4YFKF 2R7WA 4QPQA 1XMAA 1QQIA 1NG6A 3H5RA 3QU3A 1GLNA 4MFEA 3OYAA 2OTLI 5J47A 4AD9A 3ABTA 5KHDA 1Y1WJ 2FU4A 2LFBA 3DM5A 3TW6A 2ECCA 3FXKA 4B09A 2PXTA 2E1MC 2PUDA 2PXFA 2A3SA 3O8HA 1UXCA 3HSFA 3MN2A 1B72B 2PLYA 3LWFA 4GFBA 3ABLH 2D1VA 2PEXA 3DEEA 1VQKI 2R7SA 1FOXA 1LEAA 1P4WA 3I58A 1FWZA 4EV0A 1X58A 1FOKA 3AG4H 1KU7A 5E17F 3K2ZA 4LG3A 5DRTA 2R1JL 2PMZN 2XF6A 1K78B 1F43A 1FC3A 2EPFA 2B9SA 3FXOA 2TCTA 1FBUA 4F52A 4XSZF 3I53A 1ITYA 1YI2I 2WAQN 5F27A 2VL8A 2ME0A 4BDZA 3VPRA 3DBHB 3JAMK 2RDPA 3RZDJ 4XN0A 2CW8A 3DTEA 3CCSI 1Y0UA 3NEUA 3Q9SA 4XLNF 3I59B 1HDDC 3DKYA 3OR1C 2F4OB 2IGKA 2NNYA 1S8NA 4HF1A 3F3XA 2Y9YA 3O8GA 3MFKA 2VJIA 2EZIA 1XMXA 1Z0XA 1MH4A 2V1DA 3Q5FA 1BW6A 3DLAA 4PFPA 5K5QA 5HLHA 4G7ZF 3GTPJ 3EUSA 5FRNA 3KZYA 1JFSA 4XICA 1N78A 4AM3A 2E1OA 3TELA 3RKWA 1PYVA 5LHIA 3DXJF 3FK6A 2EH3A 1UMQA 2LYSA 2PXUA 3UKGA 2CQ7A 5GAGi 2AHQA 2IA1A 3LA7A 4IJAA 3OOUA 4X4CA 1IXSB 3T1BA 4I09A 3CCYA 1WJFA 2PUAA 4DBQA 1MMNA 3HL2A 3CJTB 1E2XA 3MLFA 1MNDA 2VJJA 2LNMA 3MVPA 2AXZA 2QUFA 2VOPA 3HOYJ 5EJCA 4J01A 1DUXC 2JQ7A 1GVDA 4BDYA 4ZH4F 3QPHA 4A3IJ 1X57A 1FBSA 4IPAA 1X2NA 3BG7A 4XMYA 4F3QA 3FYMA 5FROA 5F0HA 1MJAA 4MQ9F 1KYZA 2PQ8A 2VQLA 2MLGA 3N97A 1LB2A 4V19K 1BR2A 1MBFA 3WGGA 2MQKA 1SANA 2BEOA 1UZCA 4XN3A 2CUZA 2Y2ZA 1R1TA 2AW6A 2DMTA 4LB6B 2MXDA 3UR3C 4KIFA 1GHCA 2PUBA 4QWQA 1ETYA 2VASA 1W36D 2BY2A 3SDBA 3IVPA 3F8BA 1ZZBA 3F6WA 2VT2A 4KMUX 4F92B 4EQZA 4DE9A 2MGQA 1NH3A 3FHNA 1JE8A 1JH9A 4EKIA 1S9HA 2E2HJ 1K61A 2OC6A 4TV7A 4U87A 5AIPA 5E1XA 3CC2I 1R5ID 1QZZA 2YSRA 2CRGA 1PUFB 5ED4A 3ZMSA 5CVRA 1K79A 4GRIA 3Q0UA 5FKKA 1P6RA 1P7IA 2CQQA 2HYJA 3U21A 2HPMA 1RUOA 2EV5A 2ZMEC 3WTUC 2WB1A 1BJZA 5J40A 1V55H 2H1LA 4MLOA 3F52A 4DBRA 4H0EA 3ZN0A 1ZZCA 2KEKA 4N4NB 3S17J 4AIDA 2DT7B 3H0GJ 5DSXA 4E4HA 3SCGA 5GADJ 3K4JA 4OIRF 1JWLA 2LF7A 5D5VB 4RGXA 1MMDA 1KU2A 3L2UA 4JX5A 4XLHA 4BXXJ 4F7ZA 1WJBA 2E60A 2KEIA 2WAEA 3FXMA 4LIVA 2CUFA 1QNTA 1UELB 4ZDLA 3ZQLA 1T8IA 3CC7I 1S7OA 3TP0A 2LLWA 1GXQA 4HAMA 1UXDA 4MTEA 2IA0A 1BJAA 3OWTA 4CYCB 1GV5A 1FBQA 1D0YA 2X6OA 1PRVA 4RAYA 4IHTA 2QQ9A 4EM2A 4U0YA 3TMOA 1IN6A 1XSXA 3L09A 3TDUC 1QBJA 3COAC 5FKOA 1S7EA 1MBJA 3PO3J 1U78A 1XCVA 3SDGA 3F23A 3S1MJ 2LYPA 5ERIA 1QZXA 2VONA 2DPDA 2XB0X 4CYDA 3ZCOA 3KIOA 1DWKA 3SZPA 2CW7A 5J3LA 3V4GA 3K4KA 4I0AA 1ZZ9A 4BXUA 4M9XA 2VXZA 2X9DA 3ME5A 2XCJA 1A5JA 2VKHA 2STWA 2ICWG 1N75A 2VKDA 2BZTA 2CV0A 2PIJA 3BR1A 4PCQA 2VE9A 1MMGA 3CJQB 3H3VK 3G0TA 4HYEA 2LNBA 2FD5A 4BACA 4DW6A 1X19A 2WUSR 1MFQC 4Q48A 3VFZA 3QU6A 2L02A 4KIGA 4IOCF 1F4KA 1EKEA 2BE5F 3KEYA 5LRRA 1JUSA 2W4SA 3JR9A 1VQ4I 2BNNA 2K4JA 1JKQC 2D45A 3HG9A 2HSGA 2M4HA 3FF5A 1K6OA 3DPLC 1X2LA 3MZYA 2VOOA 3H1CA 2CUEA 3ASNH 1IDYA 3PXPA 1Y56A 3R4KA 2V9PA 3R61A 3F6VA 1WQ2A 2ZFUA 4HG2A 3VOEA 4HNTA 5FKNA 3VODA 3BR5A 4IXAA 3WU0A 5DT2A 5E3LA 2DMUA 4XORA 3KZIC 2DK8A 2VQCA 2M4KA 5ICFA 4DYQA 1FIAA 4ZYDA 3L2RA 4KNYA 3M8JA 1QZEA 1FY7A 3IV5A 4BHPA 5DM6F 2EBIA 2M7AA 3R6SA 2HDCA 2ACJA 1UJ8A 4N0BA 3ZQQA 4ZDOA 4V2GA 3CF5F 1MJ9A 1D8KA 3MKLA 4BE1A 4KFCA 3S16J 3HC7A 3KEOA 2P81A 1XC5A 4HQEA 4LK0F 1W7PD 3HSRA 1UCRA 3RDIA 2RQQA 2GZUA 1BOBA 1WCMJ 4Y7NJ 2DQRA 5M5WJ 1UFMA 5BOXA 4D9JA 2IS1A 1AHDP 2D1HA 2BY0A 3F22A 1A36A 2XKPA 3M1EA 3V7CA 3OV8A 3HDDA 2W48A 3HEFA 1U8BA 3K1NA 3CUQC 3JRAA 4XKBA 2HGCA 3FMSA 1J0RA 2TDXA 4YG1A 5HNHA 4BQQA 4Z59A 3BZ6A 5FD6A 1SEUA 2X1EA 4OMZA 1SVOA 3FYAA 2CW0F 3HOSA 3GBGA 5J1YA 1RIOA 4KN7X 1JFTA 4QLCU 1PERL 4BS9A 3OP9A 3J7ZI 4A12A 4GXOA 3QWGA 1KQ8A 3LQRA 1LVKA 1PP7U 2LMDA 2OF7A 2A61A 2QQAA 3CDIA 4IHWA 3I71A 1IXRC 1GUUA 2LYQA 2BY1A 3K0LA 4JK1X 3HGYA 2KZ8A 3BT9A 1XGOA 4EJOA 3VSKA 3BG5A 1RPWA 4L9NA 1TC3C 1WSUA 2DMNA 4I98B 1JJ8C 2XROA 4G12A 1TWHJ 3QF3A 1TW2A 4FQGA 2W1OA 1FSHA 2GRLA 2ID3A 2GOMA 1PDNC 3F51A 2HOSA 3WE2A 3H9QA 4KN4X 5A7LA 3FXUA 5D4RA 2MH2A 3OYJA 3A9ZA 4Y52J 3ABMH 1VQ7I 1TQPA 4ENJA 3JCUC 2IBDA 5CVUA 2EQRA 3K1PA 1W4MA 3QAHA 2RC4A 4GYGA 4MEXF 4NQWA 4L9VA 5FJ8J 2M7BA 2KQRA 3DPTA 4WWCA 3I4MJ 2VXDA 2H09A 3KZZA 1R4MB 3HZIB 3RI4A 5F1JA 4N4OB 1OQYA 4KITB 2RVCA 2W84A 4BJ6C 1OKRA 1R6RA 4XLFA 2PXQA 3GZDA 2UZKA 4AVPA 5E3MA 1YIJI 1LQCA 2LRDA 1G3SA 1FIPA 2P7VB 2V1XA 1G59A 2CV1A 1QU3A 2CJJA 1YE9A 4M3GA 1R36A 2CFOA 2ZJPF 4UUTA 4IA8A 3AAFA 1JKPC 2PXDA 1LE8A 1I3AA 2LY9A 4M6YA 1B0NA 4JCYA 3PUBA 2CS3A 3LQQA 2R7RA 3EQLF 4R8HA 2MFZA 5EYRA 1IC8A 2QKLB 1X1CA 2IVGA 2HTSA 4M9ZA 4EJUA 2M9HA 3DFGA 2PPXA 2EILH 4LLGF 5F64A 1HKTA 5E3OA 4ENNA 1IJWC 5CVIA 4PU7A 1W36C 4G6DA 5JHUA 1HA8A 1UG0A 5DD4A 2Z5UA 3PIPF 1EFAA 1D0ZA 4MIMA 2MC4A 1YS6A 3NZLA 1YQAA 3SZTA 3EETA 4M3FA 3ABKH 4C3IJ 4IQ4A 1O3TA 2X48A 3F8MA 1BIAA 1GXPA 1BI2A 2H6CA 1JUMA 2LK2A 1S29A 5DS9A 2DFHA 5E18F 1ZELA 4EGYA 1MBEA 2JK3A 2L3DA 1FP2A 4LMYA 3E97A 4RA2A 4UUSB 3HOUJ 2GLOA 5LBQA 1T95A 2CG4A 4ASNA 4P9FA 3RTRA 1J09A 5K5OA 1SMTA 3W6VA 1RZRA 1JGGA 3J7AO 2K7LA 3H92A 3IAM2 3S3MA 1DPRA 5BPIA 2IVQA 4I6TA 2R4GA 4HF0A 1ETVA 1H0MA 2X1CA 4O6JA 2LD5A 2EIJH 2XGCA 3G1LA 3I0TA 3BCBA 4Z2YA 2GOXB 3HHHA 1WPKA 1N25A 2HYGD 3SX0A 3J7AY 4NC8A 2JN6A 3P5JA 3OMTA 2H8RA 1D0XA 2Z2SB 2JTVA 2K3FA 3V42A 2DQLA 3S1QJ 2WTEA 3S32A 4KYWA 4J00A 1BR1A 4ER7A 1TWAJ 1LLIA 2FNPA 3LOCA 2V7FA 2HEOA 2ZSIB 2HFZA 2DJNA 3IL2A 2YU3A 3BZKA 2E34A 2K40A 1NK3P 3ERED 2X6XA 3KLOA 3QQ6A 3E1SA 3CESA 2BYVE 1MNEA 5CVVA 5L3DA 3VEPA 4XLEA 4HF2A 1ETQA 4AC0A 5FGMA 5JHFA 4RGRA 4Y15A 2W57A 3BY6A 3QFIA 2EV0A 3O2PE 2LR8A 2VPRA 1I39A 3KLNA 4A5NA 3WTSC 4A0YA 1I1SA 4YIFA 3M9LA 2Z99A 4YBAA 2LP0A 3KP6A 1OFCX 1ZLKA 1OMIA 2PMUA 2E1CA 3NXHA 4M3DA 2PJRA 5KCMA 4JBAA 3DNVB 4IVZA 3OYIA 1YTYA 2A69F 1FP1D 1ZK8A 5J8CA 3ZHIA 4Z6YA 1IDZA 4IF4A 5K5RA 4WCGA 1YYVA 2VB6A 3KYDB 1IRXA 4PUSA 1PUEE 4I0BA 2ZFWA 2JJ7A 3RPUA 4A3LJ 4FTHA 3ZQ7A 4FISA 4ESFA 4GO1A 3ESWB 1IN5A 2L7ZA 4KMFA 4RAGA 1ZRCA 2JA5J 1QO0D 2Z3YA 4MHGA 2L9NA 5L3GA 2XC7A 2L7MP 4XKVA 4I2OA 4XIDA 4JX6A 3S93A 1MGTA 2XAHA 2ZMEA 3JTGA 4IHXA 3OYBA 4I6ZA 2K86A 3A02A 2JSPA 3U1KA 3CO7C 1EV7A 4A3JJ 3LFKA 3FMQA 2IVMA 1V3FA 4L5JA 4K2EA 2P5VA 3REOA 3RIRA 2IV1A 3QOXA 4WVLA 4XRSG 1WHUA 2I10A 2LYCA 3I3LA 1R00A 1SFXA 4ZYEA 2J7WA 2WAQA 2O4AA 1U6GA 4OOIA 2KRCA 1BR4A 1R23A 2NS7A 1W0TA 3ZN1A 4HNUA 1Y6IA 2R7UA 5F0FA 2RGVA 2VJ4A 3K1MA 4I02A 5FFZA 2WBMA 5FKMA 4DNCA 4IHVA 2X6YA 4MFDA 1XGMA 4NC6A 3ZPXA 5GPAA 3O6BB 3MAJA 2M0CA 1CJGA 2EZLA 4LJZF 5KVRA 3M3YJ 5BNGA 4BQOA 1XN7A 4CXFA 3OYCA 3OYGA 2KRHA 2MLKA 2OPTA 4PFOA 2FX0A 2K9MA 3F8CA 4A3EJ 2FMLA 1JTXA 4B44A 1TW3A 4UVBA 5DCMB 2R63A 3H0DA 3OYHA 3BWGA 1HSTA 1OSLA 3JRCA 4X4FA 3ML6A 1ZH5A 2V3CC 4PJLA 3DTKA 3S8PA 2A6CA 2DDBA 4RBOA 3B6CA 3JTHA 3NRVA 2HQNA 5GAHJ 4Y4RA 3RQIA 3W3CA 5E8IA 4X1EA 1FNNA 3R0AA 3OQNA 1ETKA 3GTQJ 5L3BA 4A3FJ 3KFWX 3KX2A 5IYCJ 2IGMA 1Y1VJ 1DQUA 2KKOA 4RMNA 3SZGA 2RAEA 1G8XA 3M7GA 4IX7A 3K4NA 4PSXA 4AWXB 3T8RA 3LSRA 3ZPLA 4L9TA 2XXPA 2FOWA 4LIUA 3S14J 2XIUA 2ZNYA 2KHMA 5IT9K 1B59A 3L00A 3BR0A 1SD7A 4CCLA 2PUCA 4EM1A 2HS5A 2NS0A 1TTYA 3TEDA 1T98A 5KAIC 1P92A 1ODDA 1BI1A 3F21A 4BE0A 5IOYA 1X2MA 1EJ9A 4MEYF 2PE5A 4UV9A 4Z5DA 4U88A 2BNOA 4IWRA 2MW8A 1D5YA 3V8KA 2IGNA 1JTYA 1LCCA 2OQGA 2Y75A 4Y3OA 2BBYA 3CLQA 2MYSA 3FK7A 3QPLA 1OPCA 3TKYA 3FXQA 1EF4A 4M3EA 3VDXA 1FX7A 2R3SA 4AU7A 3HUGA 3EUHA 2GZWA 2BV6A 2MBFA 1GV2A 3GZNB 3PNYA 3Q0WA 4A0ZA 1H8AC 4LITA 2GXGA 1SAXA 2JA8J 4MQVA 2L8NA 1YHQI 2LH9A 2OR1L 3V7RA 1YG2A 3CO6C 3RPQA 4BH9A 2DCEA 3TO7A 3GFJA 4UB6C 4P9UA 1ON2A 2ECBA 3DCFA 3LSHA 4BJ5C 5IOZA 1OR7C 4CCJA 4A2UA 5FRMA 2E35A 1WH5A 1MW7A 2FJ1A 4IZZA 1ONVA 4UUVA 2HINA 2V26A 1IO2A 2AQEA 4NHJA 1VQNI 3HOWJ 1FOYA 4OIPF 1JT0A 1WGXA 1U2WA 2OCEA 2BHZA 3GZ5A 5D8LB 2GRMA 4HOBA 2R7XA 1TQIA 3BP8A 3E0JB 5DCMA 4OMYA 1GT0C 5ICGA 1WH6A 1WVRA 4NBQA 4FX0A 3S2DJ 2YU9J 1NG7A 3HJEA 3OYKA 3G71I 4XLAA 1Z67A 2EFNA 3V8JA 2O38A 2CYYA 2DOEA 2KISA 4HA8A 1KZHA 3BOQA 3A03A
chains in the Genus database with same CATH topology
4DW6A 2WUSR 3ZOBA 2WIUB 1QP4A 4DZJA 2BNNA 3JR9A 1JUSA 4B4CA 1FEXA 1ZQ3P 1RPEL 1JKQC 2HSGA 4RDUA 1X2LA 2DTZA 5EZGA 2VKVA 9ANTA 3TP3A 4QSHA 2CUEA 3PXPA 1IDYA 1RKTA 2ELKA 4FBIA 1Q1VA 1SFOJ 1LFBA 2Y9ZA 2KT0A 2JCGA 2DA6A 1BW5A 5FKNA 1RZRD 3BR5A 5E3LA 3ZKCA 2DMUA 1QPZA 1WI3A 2VUMJ 3JXCL 3K7AJ 4DYQA 2DA7A 1IG7A 1FIAA 3GBFA 3R1FA 1VF9A 2Y0SN 1XS9A 2EF8A 3KXAA 4Z58A 3IV5A 5EGOA 5C4XJ 2EBIA 2ICTA 1POGA 4J1WA 4D7NA 4X6AJ 4XRSA 4V2GA 2Y31A 1ZAYA 1ZVVA 1QVUA 2COBA 3MKLA 5J1UA 4NDLA 3BQZA 3JRIA 2JMWA 5FLMJ 3U3WA 2IEKA 1YRNB 3S16J 4NDWA 2ZB9A 2LYRA 2P81A 4EEFG 1XC5A 5EG0A 3QYXA 2GZUA 2DMQA 1H89C 2CSFA 1WCMJ 2FJRA 4Y7NJ 2EZHA 5M5WJ 1TWFJ 1AHDP 4BBRJ 3B7HA 5IP7J 3Q0VA 3E7LA 3S15J 4B3AA 2YUSA 3HOZJ 5F04A 1MBHA 5F08A 2HDDA 1Y9QA 4D7MA 4JX4A 1RR7A 3HDDA 1E3OC 2W48A 3HEFA 1U8BA 2L0KA 2EBYA 2M8GX 3ZHMA 1R69A 3JRAA 4C3HJ 3BQYA 1R9TJ 4XRMA 3IH4A 3TW7A 5EGOB 4YG1A 3S2HJ 3LSJA 4Z59A 1XG1A 3OSGA 3FYAA 1ETWA 4MO7A 1AKHA 2JA7J 2LTPA 3GBGA 5J1YA 3D1NI 1RIOA 1JFTA 3BDNA 1ZUGA 1PERL 3OP9A 3QWGA 2JWTA 1MSEC 1QRYA 5C44J 2B63J 3ZQFA 5EG0B 1WETA 2OF7A 4HNVA 1SQ8A 4A69C 1U9OA 4IHWA 1O4XA 4Z5HA 1JT6A 5GP9A 2R5ZA 3FIWA 5K7HA 1GUUA 1QQAA 3G1OA 2LYQA 3HGYA 2KZ8A 3BT9A 3SFIA 3TRBA 3BG5A 3UFDA 1RPWA 2O7OA 2JVLA 1TC3C 2OFYA 4A3CJ 1LCDA 2DMNA 1JJ8C 4G12A 5C4JJ 1TWHJ 1WIZA 3QF3A 2PUEA 3WHBA 2M34A 2GRLA 2ID3A 2R7ZJ 3FISA 1DU0A 4GQMA 4BY7J 5IYDJ 3VK0A 5M3FJ 3SCHA 2KEJA 4W1UA 3F51A 3BTCA 2HOSA 3WHCA 3JRBA 2HOAA 5A7LA 3JREA 1IRZA 4Y52J 5EZHA 2DA5A 1MSFC 2IBDA 4I6UA 1AKHB 1RETA 2EQRA 1F36A 1LFUP 3CQZJ 1BA5A 4D5FA 3S8QA 2DA3A 4JCXA 1IUFA 5FJ8J 4BKXA 4A3DJ 3OQMA 2O9LA 3I4MJ 4YG4A 3S1NJ 2IU7A 4J1XA 3A01A 1ZPQA 1WH7A 1MNMC 1WH8A 3HZIB 2R5ZB 2O8KA 5F1JA 2CQXA 1YSEA 2PUFA 3HBLA 3G7DA 1JKRC 1NEQA 2HQ5A 3F0CA 2XRLA 3HGGA 1YRNA 4F8DA 5E3MA 1POUA 1LQCA 2DMPA 2GBYA 3BR2A 3OIOA 1FIPA 4PU8A 2CJJA 4M3GA 4XK4A 3BG3A 1G2HA 2NS8A 4IHYA 4AYBN 4UUTA 4IA8A 1JKPC 4UUSA 2K9NA 1LE8A 2LY9A 1DU6A 4Y42A 2G0EA 4S0HB 3HOVJ 1B0NA 1ZZ6A 4MCXA 1QP7A 4JCYA 4I8TA 3JXBC 1VPWA 5EYRA 2XJ3A 1IC8A 2CROA 5FKLA 3CMYA 2IVGA 2XPVA 4M3BA 4FE7A 1PNRA 1LMB3 2TRTA 2M9HA 5EF6A 2ME6A 2PPXA 3GTLJ 2IUOA 5E3OA 1ENHA 5EEAA 1IJWC 4PU7A 5IYBJ 2N8GA 3JXDL 3A01B 5IPAA 3RKQA 1RZSA 4I76A 5M5XJ 1EFAA 4MIMA 4X4DA 2VI6A 3RZOJ 3BR3A 2R0QC 4IEJA 3IH2A 4M3FA 4C3IJ 4A93J 2DA1A 2XPWA 5DTDA 2QCOA 2X48A 4C3JJ 3JRDA 1IGNA 3L1PA 1HDPA 1JUMA 2LK2A 5DS9A 1DW9A 2MEZA 3ZQCA 3CLCA 1MBEA 2JK3A 1IV6A 4X4GA 2L7FP 1UHSA 3QQAA 3ZQGA 1CQTA 3SJMA 4GHJA 4UUSB 1LE8B 1K83J 3HOUJ 3BR6A 2GLOA 4X4HA 3CECA 4A3MJ 4O8BA 5HODA 3ZQHA 5IP6A 5C3EJ 1ETXA 2PUGA 4YG7B 3W6VA 1RZRA 1JGGA 1PRAA 1FTTA 2E19A 4I6TA 2IVQA 5F0CA 4M6VA 1B72A 1ETVA 2LD5A 3G1LA 2XGCA 4L5EA 3DEWA 1OCTC 3CDLA 4PU4C 1WPKA 3BTJA 2JN6A 3OMTA 2H8RA 3BG9A 1P7JA 4D5CA 3S1QJ 2EZKA 3BS3A 2FQ4A 3BD1A 1H88C 1TWAJ 1RKWA 1ZR2A 2K9SA 1LLIA 1GDTA 3LOCA 3JRHA 3S1RJ 2NVYJ 2XPUA 2DJNA 5K7FA 2BNMA 4B1RA 4BBSJ 2K40A 3GTMJ 3G5GA 5IP9J 1NK3P 3LFPA 5K98B 2R5YA 1ZR4A 1ZZ8A 1HF0A 1TWGJ 3PM1A 1T56A 3QQ6A 5EDNA 1B8IB 1UTXA 4MFEA 1Y1WJ 1XWRA 1BDIA 1ETQA 2LFBA 2VKEA 3TW6A 4AC0A 1MBKA 1T33A 2ECCA 1MBGA 3ZQIA 5K7ZA 1OCPA 2PUDA 4AUXA 4QTRA 3O8HA 1UXCA 2L9RA 3MN2A 2E2IJ 2LR8A 1B72B 4Z5CA 1I50J 1U9NA 2MSYA 2VPRA 4GFBA 2EWTA 1X58A 2NVXJ 1HLVA 1NK2P 4YBAA 2LP0A 2R1JL 2IAIA 2PMZN 1OFCX 1F43A 2QF7A 1JJ6C 1ZS4A 2TCTA 3LNQA 4M3DA 2BJCA 1HCRA 3DNVB 4IVZA 1ITYA 1ZK8A 2WAQN 5F27A 2ME0A 3ZHIA 1IDZA 2XGDA 2NVTJ 3VPRA 1Z77A 3RZDJ 2LYLA 2WV1A 3LISA 2R5YB 2ICPA 1AU7A 2JJ7A 4JP0A 5E3NA 4A3LJ 4FTHA 1QVTA 1PRUA 1HDDC 1I6HJ 4FISA 3HKZN 1A6IA 3GN5A 2Y30A 4LOCA 2L7ZA 3O8GA 2Y9YA 2K9QA 2EZIA 1Z0XA 1MH4A 1R63A 2JA5J 1BW6A 3FMYA 4FN3A 3GTPJ 3PO2J 2L7MP 3EUSA 4XIDA 1MH3A 2HXOA 4JX6A 4IHXA 2AO9A 1JFSA 4XICA 4I6ZA 3A02A 1FJLA 2E1OA 4A3JJ 4JYKA 2XSDC 3FK6A 2AXVA 2EH3A 2HOTA 2IV1A 1UMQA 2LYSA 2L49A 2GM4A 3UKGA 1ORKA 2AHQA 2R93J 4XRSG 3KJXA 1OJLA 3OOUA 2DA2A 2I10A 4X4CA 2ID6A 3CCYA 2O4AA 2NS7A 1W0TA 2PUAA 2HXIA 2LKXA 3RZZA 5F0FA 1VFCA 3H5TA 2DN0A 3MLFA 5FKMA 4IHVA 4MFDA 3MVPA 2AXZA 5GPAA 2B5AA 2KPJA 2XI8A 1QQBA 3HOYJ 5J1RA 2M0CA 1PUFA 1GVDA 2EZLA 4DYCA 3GN5B 1CJGA 4A3IJ 4FE4A 1X57A 3OQOA 3M3YJ 5BNGA 1X2NA 3BTIA 1L1MA 4PU3C 3FYMA 5F0HA 2LCVA 2OPTA 2FX0A 2YS9A 3FKIJ 4A3EJ 1JTXA 2WB1N 5JLWA 1B8IA 1MBFA 1JKOC 2MQKA 2R63A 3LSGA 1SANA 3GTJJ 4A3GJ 2NOGA 2Y2ZA 1OSLA 3JRCA 3HB9A 1BL0A 2AW6A 2DMTA 4X4BA 4X4FA 1BDHA 3IH3A 2IVBA 3JRGA 2PUBA 2JA6J 4YARA 1ETYA 4A3KJ 2A6CA 4RBOA 2E2JJ 2R92J 3M4OJ 3IVPA 3B6CA 1ZZBA 3QPSA 4MCTA 3RQIA 3F6WA 4X1EA 3Q3SA 3OQNA 1ETOA 1ETKA 3GTQJ 4A3FJ 2MGQA 4QIWN 5IYCJ 1Y1VJ 4X4EA 1JH9A 4C2MJ 2RAEA 2AWIA 2E2HJ 1K61A 3LSRA 1QP0A 3CROL 4CYCA 1APLC 2XIUA 3S14J 3G1MA 2LYKA 2CRGA 1PUFB 5FLVA 3BR0A 3Q0UA 5FKKA 1P7IA 2PUCA 2CQQA 2HYJA 3GTKJ 1I3QJ 3KZ3A 3HOXJ 3TEDA 2LYJA 4W97A 5IOYA 2AUWA 1BJZA 1X2MA 3I4NJ 4I6RA 4DYRA 3O9XA 3B6AA 4MLOA 1VNDA 2DA4A 3F52A 1HOMA 2PE5A 4Z5DA 1ZZCA 2KEKA 2MG4A 3S17J 2BNOA 3SCFA 2MW8A 1D5YA 4IWRA 1JTYA 1LCCA 3OSFA 2LVSA 3H0GJ 3SCGA 4J19A 3FK7A 3BTLA 3QPLA 1JWLA 1ZZ7A 1EF4A 1RESA 4M3EA 4BXXJ 4JX5A 5M5YJ 4JQDA 2KEIA 5M3MJ 2CUFA 1GV2A 3Q0WA 3ZQLA 4X4IA 1H8AC 3TP0A 1W0UA 1QPIA 2JA8J 1ZGWA 1VI0A 1UXDA 2XGEA 4ABZA 2L8NA 4BY1J 2OR1L 3LSPA 1UG2A 1TWCJ 4CYCB 3GTGJ 1GV5A 1ZKGA 2X6OA 1PRVA 4V2FA 5JLXA 2KDZA 2ECBA 3DCFA 1JUPA 2XB5A 1ADRA 5IOZA 2CU7A 1NERA 5FKOA 1S7EA 1MBJA 3JRFA 1NTCA 3PO3J 2LLKA 1WH5A 3SDGA 1U78A 3S1MJ 2LYPA 3C2BA 2FJ1A 2H1KA 4FCYA 2HINA 2XB0X 1DWKA 5J3LA 3K2AA 3HM5A 3HOWJ 2AXUA 1ZZ9A 2HI3A 1WGXA 2X9DA 5GPCA 1JT0A 2XCJA 1A5JA 2GRMA 2O49A 4DZPA 1Y7YA 1WH6A 3NAUA 1GT0C 4OB4A 3GTOJ 3NARA 2NVQJ 2YU9J 3S2DJ 2M2EA 2PIJA 3BR1A 3H3VK 1ZTRA 1FTZA 2D5VA 2O38A 4A3BJ 2FD5A 3A03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DW6 A;  2WUS R;  3ZOB A;  2WIU B;  1QP4 A;  4DZJ A;  2BNN A;  3JR9 A;  1JUS A;  4B4C A;  1FEX A;  1ZQ3 P;  1RPE L;  1JKQ C;  2HSG A;  4RDU A;  1X2L A;  2DTZ A;  5EZG A;  2VKV A;  9ANT A;  3TP3 A;  4QSH A;  2CUE A;  3PXP A;  1IDY A;  1RKT A;  2ELK A;  4FBI A;  1Q1V A;  1SFO J;  1LFB A;  2Y9Z A;  2KT0 A;  2JCG A;  2DA6 A;  1BW5 A;  5FKN A;  1RZR D;  3BR5 A;  5E3L A;  3ZKC A;  2DMU A;  1QPZ A;  1WI3 A;  2VUM J;  3JXC L;  3K7A J;  4DYQ A;  2DA7 A;  1IG7 A;  1FIA A;  3GBF A;  3R1F A;  1VF9 A;  2Y0S N;  1XS9 A;  2EF8 A;  3KXA A;  4Z58 A;  3IV5 A;  5EGO A;  5C4X J;  2EBI A;  2ICT A;  1POG A;  4J1W A;  4D7N A;  4X6A J;  4XRS A;  4V2G A;  2Y31 A;  1ZAY A;  1ZVV A;  1QVU A;  2COB A;  3MKL A;  5J1U A;  4NDL A;  3BQZ A;  3JRI A;  2JMW A;  5FLM J;  3U3W A;  2IEK A;  1YRN B;  3S16 J;  4NDW A;  2ZB9 A;  2LYR A;  2P81 A;  4EEF G;  1XC5 A;  5EG0 A;  3QYX A;  2GZU A;  2DMQ A;  1H89 C;  2CSF A;  1WCM J;  2FJR A;  4Y7N J;  2EZH A;  5M5W J;  1TWF J;  1AHD P;  4BBR J;  3B7H A;  5IP7 J;  3Q0V A;  3E7L A;  3S15 J;  4B3A A;  2YUS A;  3HOZ J;  5F04 A;  1MBH A;  5F08 A;  2HDD A;  1Y9Q A;  4D7M A;  4JX4 A;  1RR7 A;  3HDD A;  1E3O C;  2W48 A;  3HEF A;  1U8B A;  2L0K A;  2EBY A;  2M8G X;  3ZHM A;  1R69 A;  3JRA A;  4C3H J;  3BQY A;  1R9T J;  4XRM A;  3IH4 A;  3TW7 A;  5EGO B;  4YG1 A;  3S2H J;  3LSJ A;  4Z59 A;  1XG1 A;  3OSG A;  3FYA A;  1ETW A;  4MO7 A;  1AKH A;  2JA7 J;  2LTP A;  3GBG A;  5J1Y A;  3D1N I;  1RIO A;  1JFT A;  3BDN A;  1ZUG A;  1PER L;  3OP9 A;  3QWG A;  2JWT A;  1MSE C;  1QRY A;  5C44 J;  2B63 J;  3ZQF A;  5EG0 B;  1WET A;  2OF7 A;  4HNV A;  1SQ8 A;  4A69 C;  1U9O A;  4IHW A;  1O4X A;  4Z5H A;  1JT6 A;  5GP9 A;  2R5Z A;  3FIW A;  5K7H A;  1GUU A;  1QQA A;  3G1O A;  2LYQ A;  3HGY A;  2KZ8 A;  3BT9 A;  3SFI A;  3TRB A;  3BG5 A;  3UFD A;  1RPW A;  2O7O A;  2JVL A;  1TC3 C;  2OFY A;  4A3C J;  1LCD A;  2DMN A;  1JJ8 C;  4G12 A;  5C4J J;  1TWH J;  1WIZ A;  3QF3 A;  2PUE A;  3WHB A;  2M34 A;  2GRL A;  2ID3 A;  2R7Z J;  3FIS A;  1DU0 A;  4GQM A;  4BY7 J;  5IYD J;  3VK0 A;  5M3F J;  3SCH A;  2KEJ A;  4W1U A;  3F51 A;  3BTC A;  2HOS A;  3WHC A;  3JRB A;  2HOA A;  5A7L A;  3JRE A;  1IRZ A;  4Y52 J;  5EZH A;  2DA5 A;  1MSF C;  2IBD A;  4I6U A;  1AKH B;  1RET A;  2EQR A;  1F36 A;  1LFU P;  3CQZ J;  1BA5 A;  4D5F A;  3S8Q A;  2DA3 A;  4JCX A;  1IUF A;  5FJ8 J;  4BKX A;  4A3D J;  3OQM A;  2O9L A;  3I4M J;  4YG4 A;  3S1N J;  2IU7 A;  4J1X A;  3A01 A;  1ZPQ A;  1WH7 A;  1MNM C;  1WH8 A;  3HZI B;  2R5Z B;  2O8K A;  5F1J A;  2CQX A;  1YSE A;  2PUF A;  3HBL A;  3G7D A;  1JKR C;  1NEQ A;  2HQ5 A;  3F0C A;  2XRL A;  3HGG A;  1YRN A;  4F8D A;  5E3M A;  1POU A;  1LQC A;  2DMP A;  2GBY A;  3BR2 A;  3OIO A;  1FIP A;  4PU8 A;  2CJJ A;  4M3G A;  4XK4 A;  3BG3 A;  1G2H A;  2NS8 A;  4IHY A;  4AYB N;  4UUT A;  4IA8 A;  1JKP C;  4UUS A;  2K9N A;  1LE8 A;  2LY9 A;  1DU6 A;  4Y42 A;  2G0E A;  4S0H B;  3HOV J;  1B0N A;  1ZZ6 A;  4MCX A;  1QP7 A;  4JCY A;  4I8T A;  3JXB C;  1VPW A;  5EYR A;  2XJ3 A;  1IC8 A;  2CRO A;  5FKL A;  3CMY A;  2IVG A;  2XPV A;  4M3B A;  4FE7 A;  1PNR A;  1LMB 3;  2TRT A;  2M9H A;  5EF6 A;  2ME6 A;  2PPX A;  3GTL J;  2IUO A;  5E3O A;  1ENH A;  5EEA A;  1IJW C;  4PU7 A;  5IYB J;  2N8G A;  3JXD L;  3A01 B;  5IPA A;  3RKQ A;  1RZS A;  4I76 A;  5M5X J;  1EFA A;  4MIM A;  4X4D A;  2VI6 A;  3RZO J;  3BR3 A;  2R0Q C;  4IEJ A;  3IH2 A;  4M3F A;  4C3I J;  4A93 J;  2DA1 A;  2XPW A;  5DTD A;  2QCO A;  2X48 A;  4C3J J;  3JRD A;  1IGN A;  3L1P A;  1HDP A;  1JUM A;  2LK2 A;  5DS9 A;  1DW9 A;  2MEZ A;  3ZQC A;  3CLC A;  1MBE A;  2JK3 A;  1IV6 A;  4X4G A;  2L7F P;  1UHS A;  3QQA A;  3ZQG A;  1CQT A;  3SJM A;  4GHJ A;  4UUS B;  1LE8 B;  1K83 J;  3HOU J;  3BR6 A;  2GLO A;  4X4H A;  3CEC A;  4A3M J;  4O8B A;  5HOD A;  3ZQH A;  5IP6 A;  5C3E J;  1ETX A;  2PUG A;  4YG7 B;  3W6V A;  1RZR A;  1JGG A;  1PRA A;  1FTT A;  2E19 A;  4I6T A;  2IVQ A;  5F0C A;  4M6V A;  1B72 A;  1ETV A;  2LD5 A;  3G1L A;  2XGC A;  4L5E A;  3DEW A;  1OCT C;  3CDL A;  4PU4 C;  1WPK A;  3BTJ A;  2JN6 A;  3OMT A;  2H8R A;  3BG9 A;  1P7J A;  4D5C A;  3S1Q J;  2EZK A;  3BS3 A;  2FQ4 A;  3BD1 A;  1H88 C;  1TWA J;  1RKW A;  1ZR2 A;  2K9S A;  1LLI A;  1GDT A;  3LOC A;  3JRH A;  3S1R J;  2NVY J;  2XPU A;  2DJN A;  5K7F A;  2BNM A;  4B1R A;  4BBS J;  2K40 A;  3GTM J;  3G5G A;  5IP9 J;  1NK3 P;  3LFP A;  5K98 B;  2R5Y A;  1ZR4 A;  1ZZ8 A;  1HF0 A;  1TWG J;  3PM1 A;  1T56 A;  3QQ6 A;  5EDN A;  1B8I B;  1UTX A;  4MFE A;  1Y1W J;  1XWR A;  1BDI A;  1ETQ A;  2LFB A;  2VKE A;  3TW6 A;  4AC0 A;  1MBK A;  1T33 A;  2ECC A;  1MBG A;  3ZQI A;  5K7Z A;  1OCP A;  2PUD A;  4AUX A;  4QTR A;  3O8H A;  1UXC A;  2L9R A;  3MN2 A;  2E2I J;  2LR8 A;  1B72 B;  4Z5C A;  1I50 J;  1U9N A;  2MSY A;  2VPR A;  4GFB A;  2EWT A;  1X58 A;  2NVX J;  1HLV A;  1NK2 P;  4YBA A;  2LP0 A;  2R1J L;  2IAI A;  2PMZ N;  1OFC X;  1F43 A;  2QF7 A;  1JJ6 C;  1ZS4 A;  2TCT A;  3LNQ A;  4M3D A;  2BJC A;  1HCR A;  3DNV B;  4IVZ A;  1ITY A;  1ZK8 A;  2WAQ N;  5F27 A;  2ME0 A;  3ZHI A;  1IDZ A;  2XGD A;  2NVT J;  3VPR A;  1Z77 A;  3RZD J;  2LYL A;  2WV1 A;  3LIS A;  2R5Y B;  2ICP A;  1AU7 A;  2JJ7 A;  4JP0 A;  5E3N A;  4A3L J;  4FTH A;  1QVT A;  1PRU A;  1HDD C;  1I6H J;  4FIS A;  3HKZ N;  1A6I A;  3GN5 A;  2Y30 A;  4LOC A;  2L7Z A;  3O8G A;  2Y9Y A;  2K9Q A;  2EZI A;  1Z0X A;  1MH4 A;  1R63 A;  2JA5 J;  1BW6 A;  3FMY A;  4FN3 A;  3GTP J;  3PO2 J;  2L7M P;  3EUS A;  4XID A;  1MH3 A;  2HXO A;  4JX6 A;  4IHX A;  2AO9 A;  1JFS A;  4XIC A;  4I6Z A;  3A02 A;  1FJL A;  2E1O A;  4A3J J;  4JYK A;  2XSD C;  3FK6 A;  2AXV A;  2EH3 A;  2HOT A;  2IV1 A;  1UMQ A;  2LYS A;  2L49 A;  2GM4 A;  3UKG A;  1ORK A;  2AHQ A;  2R93 J;  4XRS G;  3KJX A;  1OJL A;  3OOU A;  2DA2 A;  2I10 A;  4X4C A;  2ID6 A;  3CCY A;  2O4A A;  2NS7 A;  1W0T A;  2PUA A;  2HXI A;  2LKX A;  3RZZ A;  5F0F A;  1VFC A;  3H5T A;  2DN0 A;  3MLF A;  5FKM A;  4IHV A;  4MFD A;  3MVP A;  2AXZ A;  5GPA A;  2B5A A;  2KPJ A;  2XI8 A;  1QQB A;  3HOY J;  5J1R A;  2M0C A;  1PUF A;  1GVD A;  2EZL A;  4DYC A;  3GN5 B;  1CJG A;  4A3I J;  4FE4 A;  1X57 A;  3OQO A;  3M3Y J;  5BNG A;  1X2N A;  3BTI A;  1L1M A;  4PU3 C;  3FYM A;  5F0H A;  2LCV A;  2OPT A;  2FX0 A;  2YS9 A;  3FKI J;  4A3E J;  1JTX A;  2WB1 N;  5JLW A;  1B8I A;  1MBF A;  1JKO C;  2MQK A;  2R63 A;  3LSG A;  1SAN A;  3GTJ J;  4A3G J;  2NOG A;  2Y2Z A;  1OSL A;  3JRC A;  3HB9 A;  1BL0 A;  2AW6 A;  2DMT A;  4X4B A;  4X4F A;  1BDH A;  3IH3 A;  2IVB A;  3JRG A;  2PUB A;  2JA6 J;  4YAR A;  1ETY A;  4A3K J;  2A6C A;  4RBO A;  2E2J J;  2R92 J;  3M4O J;  3IVP A;  3B6C A;  1ZZB A;  3QPS A;  4MCT A;  3RQI A;  3F6W A;  4X1E A;  3Q3S A;  3OQN A;  1ETO A;  1ETK A;  3GTQ J;  4A3F J;  2MGQ A;  4QIW N;  5IYC J;  1Y1V J;  4X4E A;  1JH9 A;  4C2M J;  2RAE A;  2AWI A;  2E2H J;  1K61 A;  3LSR A;  1QP0 A;  3CRO L;  4CYC A;  1APL C;  2XIU A;  3S14 J;  3G1M A;  2LYK A;  2CRG A;  1PUF B;  5FLV A;  3BR0 A;  3Q0U A;  5FKK A;  1P7I A;  2PUC A;  2CQQ A;  2HYJ A;  3GTK J;  1I3Q J;  3KZ3 A;  3HOX J;  3TED A;  2LYJ A;  4W97 A;  5IOY A;  2AUW A;  1BJZ A;  1X2M A;  3I4N J;  4I6R A;  4DYR A;  3O9X A;  3B6A A;  4MLO A;  1VND A;  2DA4 A;  3F52 A;  1HOM A;  2PE5 A;  4Z5D A;  1ZZC A;  2KEK A;  2MG4 A;  3S17 J;  2BNO A;  3SCF A;  2MW8 A;  1D5Y A;  4IWR A;  1JTY A;  1LCC A;  3OSF A;  2LVS A;  3H0G J;  3SCG A;  4J19 A;  3FK7 A;  3BTL A;  3QPL A;  1JWL A;  1ZZ7 A;  1EF4 A;  1RES A;  4M3E A;  4BXX J;  4JX5 A;  5M5Y J;  4JQD A;  2KEI A;  5M3M J;  2CUF A;  1GV2 A;  3Q0W A;  3ZQL A;  4X4I A;  1H8A C;  3TP0 A;  1W0U A;  1QPI A;  2JA8 J;  1ZGW A;  1VI0 A;  1UXD A;  2XGE A;  4ABZ A;  2L8N A;  4BY1 J;  2OR1 L;  3LSP A;  1UG2 A;  1TWC J;  4CYC B;  3GTG J;  1GV5 A;  1ZKG A;  2X6O A;  1PRV A;  4V2F A;  5JLX A;  2KDZ A;  2ECB A;  3DCF A;  1JUP A;  2XB5 A;  1ADR A;  5IOZ A;  2CU7 A;  1NER A;  5FKO A;  1S7E A;  1MBJ A;  3JRF A;  1NTC A;  3PO3 J;  2LLK A;  1WH5 A;  3SDG A;  1U78 A;  3S1M J;  2LYP A;  3C2B A;  2FJ1 A;  2H1K A;  4FCY A;  2HIN A;  2XB0 X;  1DWK A;  5J3L A;  3K2A A;  3HM5 A;  3HOW J;  2AXU A;  1ZZ9 A;  2HI3 A;  1WGX A;  2X9D A;  5GPC A;  1JT0 A;  2XCJ A;  1A5J A;  2GRM A;  2O49 A;  4DZP A;  1Y7Y A;  1WH6 A;  3NAU A;  1GT0 C;  4OB4 A;  3GTO J;  3NAR A;  2NVQ J;  2YU9 J;  3S2D J;  2M2E A;  2PIJ A;  3BR1 A;  3H3V K;  1ZTR A;  1FTZ A;  2D5V A;  2O38 A;  4A3B J;  2FD5 A;  3A03 A; 
#chains in the Genus database with same CATH topology
 2KMU A;  2KZV A;  4IKF A;  2JVG A;  3ZOB A;  4I7H A;  2DPU A;  3BJO A;  1QP4 A;  3E5X A;  2DFF A;  3WTT C;  3T0Y A;  2IS6 A;  1OCO H;  1ZGJ A;  5EZG A;  1HW2 A;  1WZ2 A;  1B1B A;  4XM3 A;  4QSH A;  4HDU A;  2H27 A;  1RKT A;  1E0E A;  2M3A A;  2YR2 A;  4M73 A;  1SFO J;  4BUP A;  3G3Z A;  4D0P A;  2Y9Z A;  2A6T A;  3HPH A;  1LDD A;  1QPZ A;  1WI3 A;  2VUM J;  4ER6 A;  3WG9 A;  3JXC L;  1KGS A;  2VC0 A;  3K7A J;  2WV0 A;  3TL4 X;  3GBF A;  4M9S A;  3GF2 A;  3R1F A;  1XDS A;  1RNL A;  2VE8 A;  3KXA A;  2R7O A;  1VQ6 I;  2XDV A;  4Z58 A;  5EGO A;  5C4X J;  1POG A;  1D1C A;  2NAZ A;  1USS A;  3E6M A;  3EUK L;  1ZG1 A;  4X6A J;  3E3V A;  2LRE A;  4XRS A;  1S3J A;  2Y31 A;  1ZVV A;  1QVU A;  2KZG A;  5J1U A;  4NDL A;  2EFQ A;  2F5V A;  3BQZ A;  4GGG A;  4YEJ A;  1ZYR F;  2E7W A;  5FLM J;  3U3W A;  2IEK A;  1YRN B;  2EFO A;  2O03 A;  1AA7 A;  3CTA A;  2DI3 A;  2UUZ A;  4XOT A;  3QYX A;  3A9X A;  1D8J A;  2EZH A;  3DU5 A;  4CIC A;  3ECH A;  5JR3 A;  1J75 A;  1HW1 A;  3LST A;  3B7H A;  2GA1 A;  1KA8 A;  1H9G A;  3E5U A;  1RR7 A;  1E3O C;  2F4I A;  1E3P A;  2YX4 A;  4PSW A;  4IHS A;  4C3H J;  3BQY A;  1R9T J;  4C2T A;  4XRM A;  1IXC A;  3GVA A;  3GXO A;  3I9V 2;  3S2H J;  3OYN A;  3LSJ A;  1BOA A;  1T0F A;  2R7Q A;  1OYY A;  1BN5 A;  1ETW A;  4MO7 A;  3P9K A;  5ILV A;  2LTP A;  3D1N I;  3ZMV A;  3QOW A;  5B66 C;  3RYP A;  1OIS A;  1HBX G;  3CF2 A;  1DPU A;  1QRY A;  5C44 J;  2QBY A;  2MC3 A;  2E5N A;  3HRT A;  3O3K A;  4R79 A;  3ISP A;  1U5T C;  2P8T A;  3GEZ A;  4A69 C;  2J7U A;  3FBI B;  4Z5H A;  1JT6 A;  5GP9 A;  2PXB A;  3G1O A;  3R09 A;  1C0W A;  1VQO I;  3SFI A;  3AFH A;  3AG3 H;  4ESJ A;  4P55 A;  2UWM A;  2PXV A;  4XKC A;  2PUE A;  3CZ6 A;  2M34 A;  3WHB A;  1Z3X A;  1W5C C;  2JVH A;  1XTA A;  4BY7 J;  1U8R A;  4B8X A;  4E7L A;  1T39 A;  2IPQ X;  3IRR A;  5IYD J;  2ZKZ A;  4OAY A;  3VK0 A;  1KU9 A;  1KU3 A;  4YRV A;  3SCH A;  2KEJ A;  4W1U A;  3BTC A;  3J7Y J;  3WHC A;  5HNF A;  1MD0 A;  2HOA A;  3JRE A;  1IRZ A;  3R60 A;  1XD7 A;  4P5O A;  5EZH A;  3L7W A;  2DA5 A;  1YJ9 I;  1A6Q A;  1RET A;  4ENM A;  4G94 A;  3CQZ J;  3E6D A;  2LKP A;  1IN8 A;  2M5W A;  3S8Q A;  2M8E A;  2DA3 A;  3V8L A;  3DF8 A;  3D5L A;  3CC4 I;  3OQM A;  2HVS A;  2O9L A;  4YG4 A;  3S1N J;  5JUW A;  4J1X A;  3A01 A;  1WH7 A;  4KT5 C;  1MNM C;  1T38 A;  1SFK A;  2EIN H;  2AS5 F;  1YSE A;  1EH8 A;  2OZU A;  4RS8 A;  1JKR C;  1LDK B;  2OD5 A;  4RLQ A;  4PJJ A;  4XSX F;  1YRN A;  3LAP A;  4F8D A;  3JSO A;  2P5K A;  3PIO F;  4BQN A;  2GBY A;  3BR2 A;  2D2W A;  3K4L A;  4AIH A;  3DV8 A;  3M07 A;  3QWL A;  4XK4 A;  2PI0 A;  1G2H A;  4IHY A;  4A6D A;  4ESB A;  1UHW A;  2L4A A;  2X51 A;  2K9N A;  2DOD A;  1WJ5 A;  2G0E A;  4RB3 C;  4MCX A;  4Y42 A;  4I8T A;  4ZZL A;  3CME I;  3JXB C;  3MCZ A;  3QP5 A;  1IZ1 A;  1DDN A;  2QEX I;  2CRO A;  2Q0O A;  2F5F A;  2OUM A;  1R49 A;  3OS1 A;  5EF6 A;  3GTL J;  2QSH X;  3HTU A;  2O0Y A;  2ZJ2 A;  4R1H A;  4NQW B;  1SD5 A;  1J5Y A;  2L01 A;  3RQ4 A;  3JXD L;  2Q1Z B;  1BIB A;  2KIQ A;  3RKQ A;  1RZS A;  4I76 A;  2I5U A;  1HC8 A;  2K9L A;  3U9G A;  2QEN A;  2VI6 A;  5DCF A;  3RZO J;  2WWY A;  2QZ8 A;  4BQA A;  3IH2 A;  4O3M A;  3WGH A;  3D5S C;  2IXS A;  1OYW A;  2XPW A;  2DA1 A;  2L2O A;  2QCO A;  5D8K B;  2KFD A;  4ZYH A;  3GME A;  2Y0M A;  3CMM A;  3L1P A;  3ZP5 A;  3K6G A;  1DW9 A;  5TRD A;  2VIX A;  3FDY A;  3KP5 A;  2KIM A;  1LJ9 A;  3OS0 A;  1IV6 A;  1UHS A;  1VQM I;  1BI0 A;  3ZQG A;  1V5E A;  1LE8 B;  1K83 J;  2ELJ A;  1F5T A;  3KP4 A;  1NW3 A;  1YW9 A;  4A3M J;  2G7H A;  3ZQH A;  5IP6 A;  4XRF A;  1JXS A;  1P2F A;  3CCR I;  2JZY A;  3H9J A;  2PUG A;  4YG7 B;  3FXL A;  2Y0S A;  2E19 A;  1YO5 C;  1D1B A;  2E1M B;  4M6V A;  3KL4 A;  5HLG A;  1JI8 A;  4PU4 C;  1YX3 A;  1Y8R B;  4BEH A;  3JSP A;  3KPH A;  2R7V A;  2L9V A;  3K9T A;  2F5D A;  2R7F A;  1TT0 A;  3ZGK A;  1J2X A;  2FQ4 A;  3RKY A;  3G6E I;  4KA4 A;  3BD1 A;  2WY7 Q;  2OQR A;  4XKW A;  1MDM A;  2FQ3 A;  2K9S A;  5F6F A;  3WE3 A;  2Y69 H;  3W2V A;  3OL4 A;  2XPU A;  4XLP F;  3W2A A;  1ZAO A;  4ER5 A;  4B1R A;  1O3R A;  1STZ A;  2NVU B;  5IP9 J;  3LFP A;  2HCS A;  2R5Y A;  1ZR4 A;  3ZMU A;  1ZZ8 A;  1W7P A;  1HF0 A;  4UNO A;  3PM1 A;  1T56 A;  1K6Y A;  1YS7 A;  1O3S A;  1B8I B;  4LD5 A;  2CQK A;  2DJI A;  3EDP A;  4XQF A;  1Y0N A;  3I64 A;  4JQF A;  5HVQ C;  1BDI A;  2H6B A;  4A0X A;  1MBK A;  1T33 A;  1QZY A;  1MBG A;  3CLO A;  5K7Z A;  3TFL A;  1OCC H;  3QYF A;  4QTR A;  1BBY A;  4CCM A;  3VYT B;  4BHC A;  2E2I J;  2PN6 A;  4Z5C A;  1U9N A;  3FBN B;  2BXY A;  2DU9 A;  1J59 A;  5D5W B;  2EWT A;  3P9C A;  4Y13 A;  1NK2 P;  2EA2 A;  3CCM I;  2BY3 A;  3IAS 2;  4OIO F;  2OJE D;  1OCZ H;  1JJ6 C;  3LNQ A;  2KJC A;  3E5Q A;  3MWM A;  2X6W A;  2BJC A;  1HCR A;  1EA3 A;  1I6X A;  2ISZ A;  3LSI A;  3X2Q H;  2XGD A;  2F4M B;  2XUB A;  5DM7 F;  3CCE I;  2NVT J;  4CZZ A;  1P4A A;  2ICP A;  1AU7 A;  3GFM A;  4JP0 A;  1QVT A;  2HZD A;  1FZP B;  1PRU A;  3NWS A;  1MMA A;  1QHH D;  4HDV A;  3HKZ N;  4YG2 F;  3GN5 A;  2FOK A;  4LOC A;  2FF4 A;  4ITV A;  4L0Z B;  1FYM A;  2VT3 A;  3A4C A;  2RNJ A;  4FN3 A;  3R0J A;  3WTZ A;  1MH3 A;  2V79 A;  1HKQ A;  4AVZ A;  3WTW C;  2AO9 A;  3IP4 B;  4RM2 A;  3S2W A;  2VBZ A;  1FJL A;  4G6T B;  3FXJ A;  2PXL A;  2XF5 A;  1QB2 A;  5BS6 A;  4JYK A;  2XSD C;  3OYD A;  3I56 I;  2HOT A;  2AXV A;  3BZC A;  3P9I A;  1ORK A;  3GW2 A;  4OBM A;  1G6N A;  3KJX A;  1OJL A;  2RKH A;  2DA2 A;  3RSN A;  2ID6 A;  2PJR B;  4E7I A;  2LDU A;  2XAG A;  4E7J A;  2HXI A;  3GLX A;  1T08 B;  1WJD A;  4CUG A;  3H35 A;  1WI9 A;  1VFC A;  3W2W A;  2LBF A;  3H5T A;  3LSK A;  1CGP A;  2Z9O A;  3F9K A;  2XI8 A;  1QQB A;  4RGS A;  3MKY B;  5D6F A;  5CLS A;  2P6S A;  3FM3 A;  4KT6 A;  4G8X A;  1WJA A;  2QQ8 A;  3OQO A;  1FPQ A;  1EH7 A;  3QRF F;  3CDH A;  3J80 K;  2A07 F;  2DO7 A;  4HX4 A;  1JGS A;  2LCV A;  3KYL A;  2G9W A;  4AYB A;  1VQL I;  3A1Y A;  1S5L C;  1BI3 A;  2ZME B;  3KYC B;  3KE2 A;  2V9V A;  5JLW A;  1B8I A;  4IRI A;  1JKO C;  3GYH X;  2LKS A;  3LSG A;  1TP4 A;  3MZ8 A;  3ELK A;  5CJ9 A;  4D1Q A;  3OYM A;  3GTJ J;  4A3G J;  2OTJ I;  2ODR D;  1CF7 A;  4X4B A;  2IVB A;  2PFB A;  3JRG A;  2JA6 J;  4YAR A;  3M8E A;  5B3S H;  4P96 A;  2IP2 A;  3WOD F;  2R92 J;  2E2J J;  3C3W A;  2VQH A;  4BU2 A;  2FRH A;  1A04 A;  4HW0 A;  3Q3S A;  5CYV A;  3OYE A;  1TNS A;  5DRY A;  2GIZ A;  5IT9 Z;  4X4E A;  1V54 H;  5TJJ A;  1Z6R A;  4XL9 A;  3OKZ A;  4OIQ F;  3TO9 A;  3K69 A;  4YIR X;  3LAJ A;  3IHU A;  4ENK A;  1SC7 A;  1APL C;  3G1M A;  3TEP A;  2L4M A;  3PJR A;  1YX5 A;  2OAZ A;  3GTK J;  1G3W A;  4HRA A;  1I3Q J;  3SYT A;  3ROU A;  2LYJ A;  2QM3 A;  4W97 A;  4HBL A;  2AUW A;  3O9X A;  3B6A A;  1HOM A;  2DYS H;  2MG4 A;  3DWL E;  2DBB A;  2LVS A;  1Z1D A;  2K02 A;  1BC8 C;  2ZC2 A;  4J19 A;  1XSD A;  4UVC A;  2K85 A;  1ZZ7 A;  5E79 C;  1TL8 A;  2P7C B;  1Z9C A;  2Z16 A;  4Y33 A;  5M3M J;  3IRQ A;  2P0W A;  3ULQ B;  4HSR A;  4CCO A;  5AON A;  3F72 A;  2DT5 A;  4E70 A;  3M8F A;  2LLV A;  2O61 A;  2IRF G;  1VI0 A;  1X4P A;  4UY8 I;  3OWQ A;  4BY1 J;  2ZJQ F;  2XAU A;  2OBP A;  1D1A A;  1TWC J;  3LMM A;  4XBF A;  3GTG J;  1ZKG A;  3BLY A;  4CSW A;  1LNW A;  1I5Z A;  4PJM A;  4E7Z A;  3LSM A;  4V2F A;  5JLX A;  3DBR B;  1D5V A;  3MEJ A;  1NER A;  5H6Q A;  2Q2E B;  3FX3 A;  3MMY B;  3JRF A;  2V6E A;  5FB2 A;  3SEZ A;  3N05 A;  2H1K A;  3GFI A;  4F93 B;  5JFR A;  3VYS B;  2J5O A;  3K2A A;  4KIB A;  2DDA A;  5LEJ A;  4KUM A;  5GPC A;  2W00 A;  5H6R A;  2XKO A;  2BOL A;  3MKW B;  3K70 D;  4WXC A;  4B47 A;  2O49 A;  1FT9 A;  3BRO A;  2WAF A;  3HUG B;  5LHG A;  4OB4 A;  1X1P A;  2EIM H;  1R58 A;  2NVQ J;  2M2E A;  3G2B A;  2PMZ A;  4PGG A;  1HQC A;  2HVQ A;  1ZTR A;  4IO9 F;  3PE5 A;  4A3B J;  2HU9 A;  3FM5 A;  5HS8 A;  2X0L A;  2ZJR F;  1YFH A;  2WIU B;  2EFP A;  4A6E A;  4RAZ A;  4DZJ A;  2A5Y B;  4B4C A;  1ZQ3 P;  2RN7 A;  3CMA I;  1U5T A;  4Q2J A;  2DT6 A;  2W85 A;  4EJV A;  1ON1 A;  2DTZ A;  4LB5 A;  2VKV A;  3ZMT A;  4B43 A;  9ANT A;  2PBI A;  3K4C A;  4HRI A;  5AIQ A;  4FBI A;  2ELK A;  2VBY A;  1LFB A;  4IQJ A;  2EV6 A;  2JCG A;  2KT0 A;  2ADU A;  2VBW A;  1Z21 A;  2W24 A;  3GUU A;  4RGU A;  4ZTF A;  3RKX A;  5E1W A;  4ZYA A;  2CH0 A;  1IG7 A;  3C2H A;  2IA2 A;  1VF9 A;  3CUQ B;  2KJB A;  3HHG A;  3BJA A;  3T5X A;  2DW4 A;  4J1W A;  4EKG A;  4M6X A;  2MD5 A;  2UXN A;  2J5P A;  4D7N A;  2NYX A;  2LF8 A;  4U0W A;  4CZC A;  1F1Z A;  2FMY A;  4CCN A;  4PGH A;  5DUK A;  1ZAY A;  1UST A;  3RYR A;  3TOB A;  4NDW A;  5B1A H;  4ZJZ A;  4EEF G;  5EG0 A;  3MZH A;  2DMQ A;  5F1R A;  1H89 C;  2CSF A;  2E1N A;  5D4S A;  2PXE A;  2H94 A;  3GZ6 A;  3KET A;  3SXY A;  3S15 J;  2CQN A;  4LGW A;  2YUS A;  5F04 A;  1MBH A;  2HDD A;  4D7M A;  1TLH B;  1X4O A;  2XRN A;  3FKJ A;  4XOP A;  2L0K A;  4Y17 A;  3L2C A;  2EBY A;  5LD2 C;  3ZHM A;  1R7J A;  4S05 A;  3OIP A;  3IH4 A;  5EGO B;  2Q2E A;  2K27 A;  2VPL A;  3OSG A;  3S3O A;  5FFX A;  3OL3 A;  1X1B A;  1AKH A;  4HZF A;  5DTR A;  1J9I A;  2ZO4 A;  5D5U B;  1ZUG A;  2JWT A;  1IRG A;  5HS9 A;  1R1V A;  1RI7 A;  4WXH A;  5ILU A;  2FA5 A;  5FD5 A;  1WET A;  2F48 A;  2FNA A;  4HNV A;  3VB2 A;  1O4X A;  2R5Z A;  3FIW A;  5K7H A;  4IRG A;  2M45 A;  1SMY F;  2NRA C;  3TO6 A;  3T8T A;  3TRB A;  3CCU I;  3JW4 A;  2O7O A;  2JA2 A;  5L3F A;  5LEK A;  2IW5 A;  2ZCW A;  4A3C J;  2F6C A;  1L3L A;  1LCD A;  2Z1D A;  1I27 A;  1L0O C;  2KIU A;  1WIZ A;  1VQ8 I;  3RJP A;  2VJ5 A;  4UXN A;  3FIS A;  1B9M A;  1T2K A;  1DU0 A;  4L18 B;  4LLN A;  3KEQ A;  1A35 A;  1QGP A;  2HTJ A;  4HEA 2;  5ICE A;  3QOP A;  1HXD A;  1HQ1 A;  4BHB A;  2BW3 B;  3J81 Z;  4X0G A;  3CCQ I;  3EPZ A;  6PAX A;  1SD4 A;  2R7T A;  2QGU A;  1IF1 A;  4I6U A;  4U7B A;  3GCM A;  2B7E A;  1XMK A;  1F36 A;  1LFU P;  1KQ0 A;  5B5E C;  1BA5 A;  1W5S A;  4EMS A;  3CUQ A;  4JCX A;  4BKX A;  4A3D J;  2RRE A;  2QBY B;  3C2G A;  4ETS A;  4G7O F;  2QWW A;  1ZPQ A;  2STT A;  3DBL B;  2O8K A;  3ERM A;  4II2 A;  3AL0 B;  3ZR8 X;  2DOF A;  3GO5 A;  4F91 B;  2PUF A;  3VWS A;  4I99 C;  1Y8Q B;  3DU6 A;  4EJW A;  1VQ9 I;  2FE3 A;  4UVA A;  1POU A;  2DMP A;  3OIO A;  4KJZ A;  3B02 A;  4HV5 A;  3HSE A;  4FX4 A;  1ZRF A;  1B6A A;  3OMY A;  2BGC A;  3QP6 A;  3ZMZ A;  4PU8 A;  3BG3 A;  2PG4 A;  4YII A;  1AOY A;  4HLY A;  2EK5 A;  2QSG X;  3DP7 A;  3FXR A;  4AIK A;  3F8F A;  1XGS A;  1BC7 C;  1DU6 A;  1G3T A;  4S0H B;  1YIT I;  2JT1 A;  2OA4 A;  4JOM A;  5E1Z B;  1VPW A;  4ANJ A;  2X1D A;  2XJ3 A;  3ONQ A;  2QKM B;  3ABU A;  3CMY A;  1PNR A;  3QPT A;  4M3B A;  4FE7 A;  1Z6T A;  2TRT A;  2AXT C;  3BPX A;  3FZV A;  1ZAR A;  4LK1 F;  4I01 A;  1B4A A;  1GVJ A;  2DFI A;  5EEA A;  2K4B A;  5DD8 A;  3BC8 A;  5IYB J;  2N8G A;  2IJL A;  5JVG F;  4GDF A;  1K4S A;  4BAY A;  3A01 B;  5IPA A;  3EYY A;  3CCV I;  2NOJ B;  2E7X A;  3GLL A;  5M5X J;  2KDO A;  5KNL A;  1S7A A;  3TDZ C;  3L2W A;  4X4D A;  1Z05 A;  3KP2 A;  2R0Q C;  2CSO A;  4IEJ A;  5FLX K;  2KP6 A;  3F8N A;  2BVM A;  1MJB A;  1RIO H;  1IGN A;  2HQA A;  4LG0 B;  1HDP A;  1YW7 A;  1F9N A;  2V1N A;  3CLC A;  3LQX A;  2BHY A;  3GX4 X;  3UWP A;  3QYE A;  1IN7 A;  5HS7 A;  3QQA A;  2W25 A;  4ON0 A;  4BE2 A;  2L9S A;  3L2Q A;  4F55 A;  2RNG A;  1ERD A;  3OIQ A;  3CEC A;  4X4H A;  4C30 A;  4UHT A;  5C3E J;  5B1B H;  1R5H A;  2FXA A;  1ETX A;  3WTV C;  2L1P A;  5TIS C;  2VBX A;  1ZGA A;  4QPO A;  1FTT A;  1IV8 A;  1PRA A;  5F0C A;  1B72 A;  1ZHF A;  3DEW A;  2RV8 A;  1OCT C;  2F5C A;  3CP2 A;  2YX7 A;  2BW3 A;  2EWN A;  2FBK A;  3BTJ A;  2BXZ A;  5GTI C;  5LHH A;  5CKT A;  1R4N B;  3HOT A;  1QHG A;  1B9N A;  3BG9 A;  1P7J A;  5H2F C;  2ELH A;  3BS3 A;  2EIK H;  1K78 A;  3H3Z A;  4IVN A;  3TGN A;  4OIN F;  1REP C;  1H88 C;  5LGT A;  1ZR2 A;  1GDT A;  3JRH A;  4EZI A;  3S1R J;  4MNU A;  4GYI A;  3WTX C;  4BJT A;  2BNM A;  3IKT A;  5DV5 A;  3GTM J;  4EVI A;  5K98 B;  4M74 A;  1SVL A;  1R71 A;  4EGZ A;  1TWG J;  2E71 A;  2IT0 A;  1XDU A;  1K4T A;  3I59 A;  5EDN A;  3SEQ A;  3WGI A;  1UTX A;  3H3U A;  4Q5S F;  2QSF X;  2DAO A;  2RQP A;  3H5N A;  3PFY A;  4C2U A;  1RZ4 A;  4XNF A;  2R7D A;  1XWR A;  2VKE A;  2GAU A;  4ER3 A;  3ZQI A;  2XSJ C;  1OCP A;  4AUX A;  4Q47 A;  1JHH A;  4L9J A;  2L9R A;  2XIG A;  1H9T A;  1I50 J;  2MSY A;  1BM9 A;  1LVA A;  1K7A A;  1UB9 A;  2JQE A;  5DUI A;  4FT8 A;  4BEH B;  1JHF A;  1G3Y A;  3K70 C;  2NVX J;  1HLV A;  2QQB A;  3I54 A;  2V4J C;  2IAI A;  1I1G A;  2HNH A;  2JRT A;  2QF7 A;  1ZS4 A;  3F6O A;  2ZXH A;  1X1A A;  5E20 A;  1MDM B;  4E7K A;  2HWV A;  4EAT A;  3J81 K;  1Z7L A;  2O6G E;  4EK9 A;  3C18 A;  2HPI A;  2C6Y A;  1VZ0 A;  1Z77 A;  5DYM A;  2FBH A;  3K4M A;  2LYL A;  3PSI A;  2WV1 A;  3LIS A;  2X85 A;  2R5Y B;  1TNT A;  1W7P B;  5E3N A;  5H20 A;  2DXI A;  2ZBK A;  2F5E A;  4G7H F;  1I6H J;  4PJN A;  4EQQ A;  1A6I A;  1U3E M;  2Y30 A;  4DQ2 A;  4U7D A;  2K9Q A;  3U1D A;  1DP7 P;  4M71 A;  3FMY A;  1R63 A;  4LG0 A;  1LQ1 A;  2CUJ A;  3PO2 J;  1MMS A;  1DGW Y;  2HCN A;  3EUA A;  3TOA A;  5ICC A;  4GCV A;  2HXO A;  5GAG J;  1LDJ A;  3CD6 I;  4ZTJ A;  5LLQ A;  3E6B A;  3HRS A;  4E6K G;  3HTS B;  2ZXI A;  2HFH A;  4RM3 A;  2OCC H;  1SFU A;  4S04 A;  2L49 A;  2GM4 A;  3IC7 A;  2XXQ A;  3LFU A;  4L5I A;  2VOD A;  1YJW I;  1R22 A;  4HPQ A;  1YLF A;  1MZB A;  2M4G A;  4XLC A;  4BXF A;  3ASO H;  3NWT A;  5L3E A;  2Q8K A;  2ZNZ A;  2LKX A;  3S3N A;  4WX9 A;  3OYF A;  3A0B C;  1TT5 B;  1ACI A;  2KLO A;  5EEG A;  3RZZ A;  5GAE J;  3CUO A;  2DN0 A;  3J80 Z;  1KON A;  2ETH A;  3AG2 H;  2VEO A;  5D5X B;  2B5A A;  2KPJ A;  3HKZ A;  3VYU B;  4B3X A;  2QLZ A;  1WJE A;  3OR2 C;  4RB1 A;  5J1R A;  4WK8 F;  2EA4 A;  1IUY A;  1PUF A;  3GN5 B;  2XAS A;  2XAQ A;  3B73 A;  4DYC A;  4FE4 A;  3LL7 A;  4KDP A;  2YBD A;  2DOA A;  1WKM A;  3BTI A;  1L1M A;  4PU3 C;  3CCJ I;  2QA4 I;  1QPM A;  1E17 A;  2YS9 A;  3FKI J;  4ZC3 A;  3FMR A;  3EUH C;  3PQJ A;  4G6Q A;  2WB1 N;  3HRM A;  3AG1 H;  2IS4 A;  3SFZ A;  4OAZ A;  5LFA A;  1SD6 A;  3TQN A;  4IL6 C;  2GXB A;  2NOG A;  3HB9 A;  2E5Z A;  1BL0 A;  2HZT A;  1BDH A;  2XGX A;  3IH3 A;  5TGT A;  4A3K J;  4RAF A;  1E3H A;  3M4O J;  3BCA A;  3QPS A;  4MCT A;  3M9A A;  1X3Z B;  3Q9V A;  5DTM A;  1ETO A;  3C7J A;  4OU0 A;  2Y48 A;  1OYI A;  4N9I A;  4QIW N;  2LBF B;  4C2M J;  2L54 A;  2ZSH B;  2A05 A;  2AWI A;  2LY2 A;  4HV6 A;  4ER0 A;  2GXA A;  2UXX A;  2H8W A;  3QOD A;  1RRJ A;  2COM A;  2CGP A;  2CMP A;  2L5Q A;  4CYC A;  1QP0 A;  3CRO L;  1YJN I;  2LYK A;  4U0V A;  2KPM A;  3A0H C;  2M30 A;  5DTQ A;  2GQQ A;  3FHZ A;  1KQ9 A;  3H5A A;  3BJ6 A;  5FLV A;  3IWF A;  2HKO A;  4H4K C;  3KZ3 A;  3HOX J;  1PP8 F;  2A68 F;  4ZZD A;  4YEL A;  3W6J B;  5LGU A;  2JUC A;  3I4N J;  4I6R A;  4DYR A;  1VND A;  2DA4 A;  4HLX A;  2FEZ A;  4DGW B;  2VN2 A;  4CCK A;  5EEH A;  1PJR A;  3SCF A;  1FMW A;  1Y39 A;  2XXA A;  3OSF A;  1CF7 B;  4BGD A;  5J6X A;  3BTL A;  4RB2 C;  3PQK A;  1RES A;  4CGZ A;  1ZG5 A;  5M5Y J;  3BG6 A;  2ZXW H;  1YW8 A;  4JQD A;  1O57 A;  2IGO A;  2XAF A;  4CA0 A;  4X4I A;  1A31 A;  1FSE A;  3MD2 A;  1WFX A;  1W0U A;  1QPI A;  1ZGW A;  3CJN A;  2XGE A;  2FSW A;  4ABZ A;  4CDG A;  3LSP A;  1UG2 A;  1TZL A;  4CHU A;  5L3C A;  3MQ0 A;  2V9K A;  2AQF A;  2JUG A;  1YIO A;  1X1D A;  1M1E B;  2UV1 A;  1LKX A;  2WY8 Q;  2KDZ A;  1JUP A;  2XB5 A;  4O5V A;  2FFH A;  2VQG A;  1ADR A;  2CU7 A;  3WU1 B;  1S6L A;  1FYK A;  5ILS A;  2DFE A;  3W6K B;  2HR3 A;  3D5R C;  3VSL A;  2XF7 A;  2JPB A;  3DKX A;  2O3F A;  1NTC A;  3H9G A;  4IOA F;  1WRJ A;  2ZXJ A;  1OCR H;  2LLK A;  2W7N A;  3C2B A;  5BPD A;  4FCY A;  2OZ6 A;  1DP3 A;  2V1U A;  3QOE A;  4HX7 A;  3E6C C;  3HM5 A;  2AXU A;  2HI3 A;  2PX9 A;  2XV4 S;  3PUF A;  5HOO A;  4RLF A;  1WJC A;  4DZP A;  5HLT A;  3PSF A;  1Y7Y A;  3NAU A;  2M87 A;  4MTD A;  3GTO J;  4DE8 A;  3NAR A;  5CQG A;  1W1W E;  5JI6 A;  1R1U A;  3EYI A;  1HSJ A;  1IN4 A;  2D5V A;  1FTZ A;  1QA6 A;  1SAU A;  2R93 J;  3QYB A;  3CCL I;  2BVL A;  3PL8 A;  1UAA A;  2V6C A;  1R5G A;  1SFE A;  2P4W A;  1FEX A;  1RPE L;  1P4X A;  2M0M A;  4RDU A;  4ZDP A;  3TP3 A;  1X3U A;  2GWR A;  4E7S A;  1T0F C;  4XON A;  1DUL A;  5HDK A;  1Q1V A;  3SQN A;  2K3P A;  1RUN A;  2PMH A;  3KCC A;  3ZMD A;  2DA6 A;  2DLL A;  2KL4 A;  3GFL A;  1BW5 A;  1RZR D;  1XPX A;  4E7H A;  3ZKC A;  4EM0 B;  2XAJ A;  2DYR H;  2JRM A;  3DPU A;  3P7N A;  1IRF A;  2DA7 A;  1VQP I;  4UV8 A;  3DTI A;  3OYL A;  2Y0S N;  1XS9 A;  2EF8 A;  1XB4 A;  1OR7 A;  2MH9 A;  4A5M A;  2ICT A;  4XR6 A;  4RB0 A;  2PJP A;  2EFW A;  2HDW A;  3AL0 C;  1X3W B;  2L7K A;  2LG4 A;  2COB A;  4NC7 A;  2WC2 A;  3JRI A;  2JMW A;  4CO8 A;  4PK4 A;  1TQM A;  2YPR A;  1NHA A;  4EJT A;  2ZB9 A;  3GWZ A;  4YFX F;  4KIC A;  2LYR A;  2HYF A;  2M1B A;  1VTN C;  4IRH A;  1U5T B;  1DGR M;  4DIQ A;  5IY5 H;  2FJR A;  3SR4 A;  1TWF J;  4PZJ A;  4LLL A;  4BBR J;  5LGN A;  1FMV A;  2B0L A;  1FOW A;  3Q0V A;  5IP7 J;  3E7L A;  3DLL F;  3M1C A;  4B3A A;  5CQE A;  5GAH i;  1LEB A;  3HOZ J;  5CVJ A;  5F08 A;  5BMZ A;  1Y9Q A;  2O8X A;  3H36 A;  1ZLJ A;  4B48 A;  4JX4 A;  4LFU A;  2W82 A;  3OOP A;  5J8F A;  1O7L A;  4BNC A;  2A6E F;  3ECO A;  2M8G X;  1V5F A;  3A2K A;  3OY9 A;  5A2Q Z;  1R69 A;  1ZG3 A;  1LFP A;  2GA2 A;  3TW7 A;  5HDG A;  5IT3 A;  2A6H F;  2QVO A;  1XG1 A;  2Z33 A;  1HW5 A;  2ISY A;  2JA7 J;  3SHF A;  1LUJ B;  3KP3 A;  1XSV A;  3WU2 C;  5GTH C;  3BDN A;  2I8D A;  1VQ5 I;  1FYL A;  3K10 A;  5DEQ A;  3I55 I;  1AWC A;  1IW7 F;  3PFI A;  1MSE C;  5BQT A;  2X4H A;  1XGN A;  2B63 J;  1Z7U A;  3ZQF A;  5EG0 B;  1ZRD A;  1XX5 A;  1KYW A;  1SQ8 A;  1UHM A;  1U9O A;  3K4B A;  3RPU D;  3G4S I;  1QQA A;  5KK1 A;  4AIJ A;  2HKX A;  5KAF C;  3MKZ A;  1YOV B;  3UFD A;  5FO5 A;  1ZN2 A;  5CPR B;  2E36 A;  2JVL A;  3DEU A;  4BYY A;  4HST A;  2OFY A;  3HXL A;  3A9Y A;  5C4J J;  2NNN A;  4DOZ A;  3LA3 A;  4WXD A;  2FUG 2;  3LA2 A;  2R7Z J;  4GQM A;  2CO5 A;  1Z91 A;  2KIF A;  1O7F A;  2HQR A;  4WF2 A;  3HYI A;  4PJ0 C;  5M3F J;  2CFX A;  4OWR B;  5D6E A;  3JRB A;  2G7U A;  4UB8 C;  3NQO A;  1V4R A;  2A5W A;  3PNT A;  2VLA A;  3ZXS A;  3HZJ A;  3HPG A;  1MSF C;  1G4D A;  1AKH B;  4P1W A;  3JAM Z;  2JPC A;  3D0S A;  3IUO A;  4FHT A;  3TBI A;  4D5F A;  3AKZ A;  1IUF A;  2GIV A;  1TBX A;  2VC1 A;  2IU7 A;  2ESN A;  3PNV A;  3CJR B;  2PXP A;  2CV2 A;  1WH8 A;  1RC9 A;  2R5Z B;  3UNG C;  2CQX A;  1MKM A;  3HBL A;  3OS2 A;  3VWB A;  3G7D A;  2OV7 A;  1Q1H A;  1NEQ A;  2HQ5 A;  2XVC A;  3I4P A;  2IS2 A;  3F0C A;  2XRL A;  3HGG A;  4CH7 A;  4NB5 A;  4HX8 A;  4YFN F;  3I5U A;  2KRF A;  1S72 I;  2NS8 A;  1OLT A;  2NXN B;  4AYB N;  4UUS A;  1O3Q A;  2K5C A;  2F2E A;  2MD0 A;  2CWE A;  2P5L C;  3HOV J;  1QP7 A;  2FBI A;  4Q4Z F;  1W5T A;  1ZZ6 A;  1ZRE A;  2DTR A;  5JVT A;  3VYR B;  3WG7 H;  2HOE A;  3NRO A;  3HIF A;  5FKL A;  2XPV A;  2O5R A;  2P6T A;  4HQM A;  3V7S A;  1LMB 3;  2ME6 A;  2PXK A;  2IUO A;  1N77 A;  1ENH A;  3NDB B;  1ULY A;  1U0J A;  5FLX Z;  5HLI A;  3G73 A;  4BL0 B;  3WTY C;  1T6S A;  3DQV C;  1LPQ A;  3RCO A;  5DDG A;  1D3Y A;  1V5G A;  3KP7 A;  4G9Y A;  2DK5 A;  3BR3 A;  4ZYG A;  4PDK A;  2WA0 A;  4A93 J;  4DJA A;  2EB7 A;  5DTD A;  4MGR A;  4C3J J;  3JRD A;  4M72 A;  3L2V A;  3GUD A;  4FAS D;  2EJR A;  2MEZ A;  5J4V A;  3BPV A;  2LOO A;  3ZQC A;  3BDD A;  3L9F A;  2ESH A;  4X4G A;  2L7F P;  3DKW A;  4GHJ A;  1CQT A;  5HDN A;  3SJM A;  2LSO A;  3HRU A;  3BR6 A;  1SVM A;  5LRS A;  4O8B A;  1WWX A;  2MAB A;  5HOD A;  1IAW A;  3C1D A;  2XHK A;  4NNJ A;  3U2R A;  4FET A;  1EH6 A;  4N9H A;  3N4M A;  5E8G A;  1P9Q C;  1MIJ A;  2MA3 A;  2WAD A;  4II3 A;  5J4Y A;  4L5E A;  1PVE A;  3IWZ A;  3CDL A;  2QYO A;  3MEX A;  3GZC A;  1J7K A;  4D5C A;  1RR8 C;  5A2Q K;  2EZK A;  2OU2 A;  2LC2 A;  3CP8 A;  1XCB A;  1HKS A;  2HVR A;  1FLI A;  3ZRG A;  3GZD C;  5K1Y A;  1RKW A;  1Z3Y A;  4L0Y B;  2AXL A;  2NVY J;  1U2Z A;  4KIS A;  5K7F A;  2JSC A;  3IKV A;  2LY1 A;  4BBS J;  4NUB A;  4C9Y A;  3G5G A;  3FWE A;  4YFK F;  2R7W A;  4QPQ A;  1XMA A;  1QQI A;  1NG6 A;  3H5R A;  3QU3 A;  1GLN A;  4MFE A;  3OYA A;  2OTL I;  5J47 A;  4AD9 A;  3ABT A;  5KHD A;  1Y1W J;  2FU4 A;  2LFB A;  3DM5 A;  3TW6 A;  2ECC A;  3FXK A;  4B09 A;  2PXT A;  2E1M C;  2PUD A;  2PXF A;  2A3S A;  3O8H A;  1UXC A;  3HSF A;  3MN2 A;  1B72 B;  2PLY A;  3LWF A;  4GFB A;  3ABL H;  2D1V A;  2PEX A;  3DEE A;  1VQK I;  2R7S A;  1FOX A;  1LEA A;  1P4W A;  3I58 A;  1FWZ A;  4EV0 A;  1X58 A;  1FOK A;  3AG4 H;  1KU7 A;  5E17 F;  3K2Z A;  4LG3 A;  5DRT A;  2R1J L;  2PMZ N;  2XF6 A;  1K78 B;  1F43 A;  1FC3 A;  2EPF A;  2B9S A;  3FXO A;  2TCT A;  1FBU A;  4F52 A;  4XSZ F;  3I53 A;  1ITY A;  1YI2 I;  2WAQ N;  5F27 A;  2VL8 A;  2ME0 A;  4BDZ A;  3VPR A;  3DBH B;  3JAM K;  2RDP A;  3RZD J;  4XN0 A;  2CW8 A;  3DTE A;  3CCS I;  1Y0U A;  3NEU A;  3Q9S A;  4XLN F;  3I59 B;  1HDD C;  3DKY A;  3OR1 C;  2F4O B;  2IGK A;  2NNY A;  1S8N A;  4HF1 A;  3F3X A;  2Y9Y A;  3O8G A;  3MFK A;  2VJI A;  2EZI A;  1XMX A;  1Z0X A;  1MH4 A;  2V1D A;  3Q5F A;  1BW6 A;  3DLA A;  4PFP A;  5K5Q A;  5HLH A;  4G7Z F;  3GTP J;  3EUS A;  5FRN A;  3KZY A;  1JFS A;  4XIC A;  1N78 A;  4AM3 A;  2E1O A;  3TEL A;  3RKW A;  1PYV A;  5LHI A;  3DXJ F;  3FK6 A;  2EH3 A;  1UMQ A;  2LYS A;  2PXU A;  3UKG A;  2CQ7 A;  5GAG i;  2AHQ A;  2IA1 A;  3LA7 A;  4IJA A;  3OOU A;  4X4C A;  1IXS B;  3T1B A;  4I09 A;  3CCY A;  1WJF A;  2PUA A;  4DBQ A;  1MMN A;  3HL2 A;  3CJT B;  1E2X A;  3MLF A;  1MND A;  2VJJ A;  2LNM A;  3MVP A;  2AXZ A;  2QUF A;  2VOP A;  3HOY J;  5EJC A;  4J01 A;  1DUX C;  2JQ7 A;  1GVD A;  4BDY A;  4ZH4 F;  3QPH A;  4A3I J;  1X57 A;  1FBS A;  4IPA A;  1X2N A;  3BG7 A;  4XMY A;  4F3Q A;  3FYM A;  5FRO A;  5F0H A;  1MJA A;  4MQ9 F;  1KYZ A;  2PQ8 A;  2VQL A;  2MLG A;  3N97 A;  1LB2 A;  4V19 K;  1BR2 A;  1MBF A;  3WGG A;  2MQK A;  1SAN A;  2BEO A;  1UZC A;  4XN3 A;  2CUZ A;  2Y2Z A;  1R1T A;  2AW6 A;  2DMT A;  4LB6 B;  2MXD A;  3UR3 C;  4KIF A;  1GHC A;  2PUB A;  4QWQ A;  1ETY A;  2VAS A;  1W36 D;  2BY2 A;  3SDB A;  3IVP A;  3F8B A;  1ZZB A;  3F6W A;  2VT2 A;  4KMU X;  4F92 B;  4EQZ A;  4DE9 A;  2MGQ A;  1NH3 A;  3FHN A;  1JE8 A;  1JH9 A;  4EKI A;  1S9H A;  2E2H J;  1K61 A;  2OC6 A;  4TV7 A;  4U87 A;  5AIP A;  5E1X A;  3CC2 I;  1R5I D;  1QZZ A;  2YSR A;  2CRG A;  1PUF B;  5ED4 A;  3ZMS A;  5CVR A;  1K79 A;  4GRI A;  3Q0U A;  5FKK A;  1P6R A;  1P7I A;  2CQQ A;  2HYJ A;  3U21 A;  2HPM A;  1RUO A;  2EV5 A;  2ZME C;  3WTU C;  2WB1 A;  1BJZ A;  5J40 A;  1V55 H;  2H1L A;  4MLO A;  3F52 A;  4DBR A;  4H0E A;  3ZN0 A;  1ZZC A;  2KEK A;  4N4N B;  3S17 J;  4AID A;  2DT7 B;  3H0G J;  5DSX A;  4E4H A;  3SCG A;  5GAD J;  3K4J A;  4OIR F;  1JWL A;  2LF7 A;  5D5V B;  4RGX A;  1MMD A;  1KU2 A;  3L2U A;  4JX5 A;  4XLH A;  4BXX J;  4F7Z A;  1WJB A;  2E60 A;  2KEI A;  2WAE A;  3FXM A;  4LIV A;  2CUF A;  1QNT A;  1UEL B;  4ZDL A;  3ZQL A;  1T8I A;  3CC7 I;  1S7O A;  3TP0 A;  2LLW A;  1GXQ A;  4HAM A;  1UXD A;  4MTE A;  2IA0 A;  1BJA A;  3OWT A;  4CYC B;  1GV5 A;  1FBQ A;  1D0Y A;  2X6O A;  1PRV A;  4RAY A;  4IHT A;  2QQ9 A;  4EM2 A;  4U0Y A;  3TMO A;  1IN6 A;  1XSX A;  3L09 A;  3TDU C;  1QBJ A;  3COA C;  5FKO A;  1S7E A;  1MBJ A;  3PO3 J;  1U78 A;  1XCV A;  3SDG A;  3F23 A;  3S1M J;  2LYP A;  5ERI A;  1QZX A;  2VON A;  2DPD A;  2XB0 X;  4CYD A;  3ZCO A;  3KIO A;  1DWK A;  3SZP A;  2CW7 A;  5J3L A;  3V4G A;  3K4K A;  4I0A A;  1ZZ9 A;  4BXU A;  4M9X A;  2VXZ A;  2X9D A;  3ME5 A;  2XCJ A;  1A5J A;  2VKH A;  2STW A;  2ICW G;  1N75 A;  2VKD A;  2BZT A;  2CV0 A;  2PIJ A;  3BR1 A;  4PCQ A;  2VE9 A;  1MMG A;  3CJQ B;  3H3V K;  3G0T A;  4HYE A;  2LNB A;  2FD5 A;  4BAC A;  4DW6 A;  1X19 A;  2WUS R;  1MFQ C;  4Q48 A;  3VFZ A;  3QU6 A;  2L02 A;  4KIG A;  4IOC F;  1F4K A;  1EKE A;  2BE5 F;  3KEY A;  5LRR A;  1JUS A;  2W4S A;  3JR9 A;  1VQ4 I;  2BNN A;  2K4J A;  1JKQ C;  2D45 A;  3HG9 A;  2HSG A;  2M4H A;  3FF5 A;  1K6O A;  3DPL C;  1X2L A;  3MZY A;  2VOO A;  3H1C A;  2CUE A;  3ASN H;  1IDY A;  3PXP A;  1Y56 A;  3R4K A;  2V9P A;  3R61 A;  3F6V A;  1WQ2 A;  2ZFU A;  4HG2 A;  3VOE A;  4HNT A;  5FKN A;  3VOD A;  3BR5 A;  4IXA A;  3WU0 A;  5DT2 A;  5E3L A;  2DMU A;  4XOR A;  3KZI C;  2DK8 A;  2VQC A;  2M4K A;  5ICF A;  4DYQ A;  1FIA A;  4ZYD A;  3L2R A;  4KNY A;  3M8J A;  1QZE A;  1FY7 A;  3IV5 A;  4BHP A;  5DM6 F;  2EBI A;  2M7A A;  3R6S A;  2HDC A;  2ACJ A;  1UJ8 A;  4N0B A;  3ZQQ A;  4ZDO A;  4V2G A;  3CF5 F;  1MJ9 A;  1D8K A;  3MKL A;  4BE1 A;  4KFC A;  3S16 J;  3HC7 A;  3KEO A;  2P81 A;  1XC5 A;  4HQE A;  4LK0 F;  1W7P D;  3HSR A;  1UCR A;  3RDI A;  2RQQ A;  2GZU A;  1BOB A;  1WCM J;  4Y7N J;  2DQR A;  5M5W J;  1UFM A;  5BOX A;  4D9J A;  2IS1 A;  1AHD P;  2D1H A;  2BY0 A;  3F22 A;  1A36 A;  2XKP A;  3M1E A;  3V7C A;  3OV8 A;  3HDD A;  2W48 A;  3HEF A;  1U8B A;  3K1N A;  3CUQ C;  3JRA A;  4XKB A;  2HGC A;  3FMS A;  1J0R A;  2TDX A;  4YG1 A;  5HNH A;  4BQQ A;  4Z59 A;  3BZ6 A;  5FD6 A;  1SEU A;  2X1E A;  4OMZ A;  1SVO A;  3FYA A;  2CW0 F;  3HOS A;  3GBG A;  5J1Y A;  1RIO A;  4KN7 X;  1JFT A;  4QLC U;  1PER L;  4BS9 A;  3OP9 A;  3J7Z I;  4A12 A;  4GXO A;  3QWG A;  1KQ8 A;  3LQR A;  1LVK A;  1PP7 U;  2LMD A;  2OF7 A;  2A61 A;  2QQA A;  3CDI A;  4IHW A;  3I71 A;  1IXR C;  1GUU A;  2LYQ A;  2BY1 A;  3K0L A;  4JK1 X;  3HGY A;  2KZ8 A;  3BT9 A;  1XGO A;  4EJO A;  3VSK A;  3BG5 A;  1RPW A;  4L9N A;  1TC3 C;  1WSU A;  2DMN A;  4I98 B;  1JJ8 C;  2XRO A;  4G12 A;  1TWH J;  3QF3 A;  1TW2 A;  4FQG A;  2W1O A;  1FSH A;  2GRL A;  2ID3 A;  2GOM A;  1PDN C;  3F51 A;  2HOS A;  3WE2 A;  3H9Q A;  4KN4 X;  5A7L A;  3FXU A;  5D4R A;  2MH2 A;  3OYJ A;  3A9Z A;  4Y52 J;  3ABM H;  1VQ7 I;  1TQP A;  4ENJ A;  3JCU C;  2IBD A;  5CVU A;  2EQR A;  3K1P A;  1W4M A;  3QAH A;  2RC4 A;  4GYG A;  4MEX F;  4NQW A;  4L9V A;  5FJ8 J;  2M7B A;  2KQR A;  3DPT A;  4WWC A;  3I4M J;  2VXD A;  2H09 A;  3KZZ A;  1R4M B;  3HZI B;  3RI4 A;  5F1J A;  4N4O B;  1OQY A;  4KIT B;  2RVC A;  2W84 A;  4BJ6 C;  1OKR A;  1R6R A;  4XLF A;  2PXQ A;  3GZD A;  2UZK A;  4AVP A;  5E3M A;  1YIJ I;  1LQC A;  2LRD A;  1G3S A;  1FIP A;  2P7V B;  2V1X A;  1G59 A;  2CV1 A;  1QU3 A;  2CJJ A;  1YE9 A;  4M3G A;  1R36 A;  2CFO A;  2ZJP F;  4UUT A;  4IA8 A;  3AAF A;  1JKP C;  2PXD A;  1LE8 A;  1I3A A;  2LY9 A;  4M6Y A;  1B0N A;  4JCY A;  3PUB A;  2CS3 A;  3LQQ A;  2R7R A;  3EQL F;  4R8H A;  2MFZ A;  5EYR A;  1IC8 A;  2QKL B;  1X1C A;  2IVG A;  2HTS A;  4M9Z A;  4EJU A;  2M9H A;  3DFG A;  2PPX A;  2EIL H;  4LLG F;  5F64 A;  1HKT A;  5E3O A;  4ENN A;  1IJW C;  5CVI A;  4PU7 A;  1W36 C;  4G6D A;  5JHU A;  1HA8 A;  1UG0 A;  5DD4 A;  2Z5U A;  3PIP F;  1EFA A;  1D0Z A;  4MIM A;  2MC4 A;  1YS6 A;  3NZL A;  1YQA A;  3SZT A;  3EET A;  4M3F A;  3ABK H;  4C3I J;  4IQ4 A;  1O3T A;  2X48 A;  3F8M A;  1BIA A;  1GXP A;  1BI2 A;  2H6C A;  1JUM A;  2LK2 A;  1S29 A;  5DS9 A;  2DFH A;  5E18 F;  1ZEL A;  4EGY A;  1MBE A;  2JK3 A;  2L3D A;  1FP2 A;  4LMY A;  3E97 A;  4RA2 A;  4UUS B;  3HOU J;  2GLO A;  5LBQ A;  1T95 A;  2CG4 A;  4ASN A;  4P9F A;  3RTR A;  1J09 A;  5K5O A;  1SMT A;  3W6V A;  1RZR A;  1JGG A;  3J7A O;  2K7L A;  3H92 A;  3IAM 2;  3S3M A;  1DPR A;  5BPI A;  2IVQ A;  4I6T A;  2R4G A;  4HF0 A;  1ETV A;  1H0M A;  2X1C A;  4O6J A;  2LD5 A;  2EIJ H;  2XGC A;  3G1L A;  3I0T A;  3BCB A;  4Z2Y A;  2GOX B;  3HHH A;  1WPK A;  1N25 A;  2HYG D;  3SX0 A;  3J7A Y;  4NC8 A;  2JN6 A;  3P5J A;  3OMT A;  2H8R A;  1D0X A;  2Z2S B;  2JTV A;  2K3F A;  3V42 A;  2DQL A;  3S1Q J;  2WTE A;  3S32 A;  4KYW A;  4J00 A;  1BR1 A;  4ER7 A;  1TWA J;  1LLI A;  2FNP A;  3LOC A;  2V7F A;  2HEO A;  2ZSI B;  2HFZ A;  2DJN A;  3IL2 A;  2YU3 A;  3BZK A;  2E34 A;  2K40 A;  1NK3 P;  3ERE D;  2X6X A;  3KLO A;  3QQ6 A;  3E1S A;  3CES A;  2BYV E;  1MNE A;  5CVV A;  5L3D A;  3VEP A;  4XLE A;  4HF2 A;  1ETQ A;  4AC0 A;  5FGM A;  5JHF A;  4RGR A;  4Y15 A;  2W57 A;  3BY6 A;  3QFI A;  2EV0 A;  3O2P E;  2LR8 A;  2VPR A;  1I39 A;  3KLN A;  4A5N A;  3WTS C;  4A0Y A;  1I1S A;  4YIF A;  3M9L A;  2Z99 A;  4YBA A;  2LP0 A;  3KP6 A;  1OFC X;  1ZLK A;  1OMI A;  2PMU A;  2E1C A;  3NXH A;  4M3D A;  2PJR A;  5KCM A;  4JBA A;  3DNV B;  4IVZ A;  3OYI A;  1YTY A;  2A69 F;  1FP1 D;  1ZK8 A;  5J8C A;  3ZHI A;  4Z6Y A;  1IDZ A;  4IF4 A;  5K5R A;  4WCG A;  1YYV A;  2VB6 A;  3KYD B;  1IRX A;  4PUS A;  1PUE E;  4I0B A;  2ZFW A;  2JJ7 A;  3RPU A;  4A3L J;  4FTH A;  3ZQ7 A;  4FIS A;  4ESF A;  4GO1 A;  3ESW B;  1IN5 A;  2L7Z A;  4KMF A;  4RAG A;  1ZRC A;  2JA5 J;  1QO0 D;  2Z3Y A;  4MHG A;  2L9N A;  5L3G A;  2XC7 A;  2L7M P;  4XKV A;  4I2O A;  4XID A;  4JX6 A;  3S93 A;  1MGT A;  2XAH A;  2ZME A;  3JTG A;  4IHX A;  3OYB A;  4I6Z A;  2K86 A;  3A02 A;  2JSP A;  3U1K A;  3CO7 C;  1EV7 A;  4A3J J;  3LFK A;  3FMQ A;  2IVM A;  1V3F A;  4L5J A;  4K2E A;  2P5V A;  3REO A;  3RIR A;  2IV1 A;  3QOX A;  4WVL A;  4XRS G;  1WHU A;  2I10 A;  2LYC A;  3I3L A;  1R00 A;  1SFX A;  4ZYE A;  2J7W A;  2WAQ A;  2O4A A;  1U6G A;  4OOI A;  2KRC A;  1BR4 A;  1R23 A;  2NS7 A;  1W0T A;  3ZN1 A;  4HNU A;  1Y6I A;  2R7U A;  5F0F A;  2RGV A;  2VJ4 A;  3K1M A;  4I02 A;  5FFZ A;  2WBM A;  5FKM A;  4DNC A;  4IHV A;  2X6Y A;  4MFD A;  1XGM A;  4NC6 A;  3ZPX A;  5GPA A;  3O6B B;  3MAJ A;  2M0C A;  1CJG A;  2EZL A;  4LJZ F;  5KVR A;  3M3Y J;  5BNG A;  4BQO A;  1XN7 A;  4CXF A;  3OYC A;  3OYG A;  2KRH A;  2MLK A;  2OPT A;  4PFO A;  2FX0 A;  2K9M A;  3F8C A;  4A3E J;  2FML A;  1JTX A;  4B44 A;  1TW3 A;  4UVB A;  5DCM B;  2R63 A;  3H0D A;  3OYH A;  3BWG A;  1HST A;  1OSL A;  3JRC A;  4X4F A;  3ML6 A;  1ZH5 A;  2V3C C;  4PJL A;  3DTK A;  3S8P A;  2A6C A;  2DDB A;  4RBO A;  3B6C A;  3JTH A;  3NRV A;  2HQN A;  5GAH J;  4Y4R A;  3RQI A;  3W3C A;  5E8I A;  4X1E A;  1FNN A;  3R0A A;  3OQN A;  1ETK A;  3GTQ J;  5L3B A;  4A3F J;  3KFW X;  3KX2 A;  5IYC J;  2IGM A;  1Y1V J;  1DQU A;  2KKO A;  4RMN A;  3SZG A;  2RAE A;  1G8X A;  3M7G A;  4IX7 A;  3K4N A;  4PSX A;  4AWX B;  3T8R A;  3LSR A;  3ZPL A;  4L9T A;  2XXP A;  2FOW A;  4LIU A;  3S14 J;  2XIU A;  2ZNY A;  2KHM A;  5IT9 K;  1B59 A;  3L00 A;  3BR0 A;  1SD7 A;  4CCL A;  2PUC A;  4EM1 A;  2HS5 A;  2NS0 A;  1TTY A;  3TED A;  1T98 A;  5KAI C;  1P92 A;  1ODD A;  1BI1 A;  3F21 A;  4BE0 A;  5IOY A;  1X2M A;  1EJ9 A;  4MEY F;  2PE5 A;  4UV9 A;  4Z5D A;  4U88 A;  2BNO A;  4IWR A;  2MW8 A;  1D5Y A;  3V8K A;  2IGN A;  1JTY A;  1LCC A;  2OQG A;  2Y75 A;  4Y3O A;  2BBY A;  3CLQ A;  2MYS A;  3FK7 A;  3QPL A;  1OPC A;  3TKY A;  3FXQ A;  1EF4 A;  4M3E A;  3VDX A;  1FX7 A;  2R3S A;  4AU7 A;  3HUG A;  3EUH A;  2GZW A;  2BV6 A;  2MBF A;  1GV2 A;  3GZN B;  3PNY A;  3Q0W A;  4A0Z A;  1H8A C;  4LIT A;  2GXG A;  1SAX A;  2JA8 J;  4MQV A;  2L8N A;  1YHQ I;  2LH9 A;  2OR1 L;  3V7R A;  1YG2 A;  3CO6 C;  3RPQ A;  4BH9 A;  2DCE A;  3TO7 A;  3GFJ A;  4UB6 C;  4P9U A;  1ON2 A;  2ECB A;  3DCF A;  3LSH A;  4BJ5 C;  5IOZ A;  1OR7 C;  4CCJ A;  4A2U A;  5FRM A;  2E35 A;  1WH5 A;  1MW7 A;  2FJ1 A;  4IZZ A;  1ONV A;  4UUV A;  2HIN A;  2V26 A;  1IO2 A;  2AQE A;  4NHJ A;  1VQN I;  3HOW J;  1FOY A;  4OIP F;  1JT0 A;  1WGX A;  1U2W A;  2OCE A;  2BHZ A;  3GZ5 A;  5D8L B;  2GRM A;  4HOB A;  2R7X A;  1TQI A;  3BP8 A;  3E0J B;  5DCM A;  4OMY A;  1GT0 C;  5ICG A;  1WH6 A;  1WVR A;  4NBQ A;  4FX0 A;  3S2D J;  2YU9 J;  1NG7 A;  3HJE A;  3OYK A;  3G71 I;  4XLA A;  1Z67 A;  2EFN A;  3V8J A;  2O38 A;  2CYY A;  2DOE A;  2KIS A;  4HA8 A;  1KZH A;  3BOQ A;  3A03 A; 
#chains in the Genus database with same CATH homology
 4DW6 A;  2WUS R;  3ZOB A;  2WIU B;  1QP4 A;  4DZJ A;  2BNN A;  3JR9 A;  1JUS A;  4B4C A;  1FEX A;  1ZQ3 P;  1RPE L;  1JKQ C;  2HSG A;  4RDU A;  1X2L A;  2DTZ A;  5EZG A;  2VKV A;  9ANT A;  3TP3 A;  4QSH A;  2CUE A;  3PXP A;  1IDY A;  1RKT A;  2ELK A;  4FBI A;  1Q1V A;  1SFO J;  1LFB A;  2Y9Z A;  2KT0 A;  2JCG A;  2DA6 A;  1BW5 A;  5FKN A;  1RZR D;  3BR5 A;  5E3L A;  3ZKC A;  2DMU A;  1QPZ A;  1WI3 A;  2VUM J;  3JXC L;  3K7A J;  4DYQ A;  2DA7 A;  1IG7 A;  1FIA A;  3GBF A;  3R1F A;  1VF9 A;  2Y0S N;  1XS9 A;  2EF8 A;  3KXA A;  4Z58 A;  3IV5 A;  5EGO A;  5C4X J;  2EBI A;  2ICT A;  1POG A;  4J1W A;  4D7N A;  4X6A J;  4XRS A;  4V2G A;  2Y31 A;  1ZAY A;  1ZVV A;  1QVU A;  2COB A;  3MKL A;  5J1U A;  4NDL A;  3BQZ A;  3JRI A;  2JMW A;  5FLM J;  3U3W A;  2IEK A;  1YRN B;  3S16 J;  4NDW A;  2ZB9 A;  2LYR A;  2P81 A;  4EEF G;  1XC5 A;  5EG0 A;  3QYX A;  2GZU A;  2DMQ A;  1H89 C;  2CSF A;  1WCM J;  2FJR A;  4Y7N J;  2EZH A;  5M5W J;  1TWF J;  1AHD P;  4BBR J;  3B7H A;  5IP7 J;  3Q0V A;  3E7L A;  3S15 J;  4B3A A;  2YUS A;  3HOZ J;  5F04 A;  1MBH A;  5F08 A;  2HDD A;  1Y9Q A;  4D7M A;  4JX4 A;  1RR7 A;  3HDD A;  1E3O C;  2W48 A;  3HEF A;  1U8B A;  2L0K A;  2EBY A;  2M8G X;  3ZHM A;  1R69 A;  3JRA A;  4C3H J;  3BQY A;  1R9T J;  4XRM A;  3IH4 A;  3TW7 A;  5EGO B;  4YG1 A;  3S2H J;  3LSJ A;  4Z59 A;  1XG1 A;  3OSG A;  3FYA A;  1ETW A;  4MO7 A;  1AKH A;  2JA7 J;  2LTP A;  3GBG A;  5J1Y A;  3D1N I;  1RIO A;  1JFT A;  3BDN A;  1ZUG A;  1PER L;  3OP9 A;  3QWG A;  2JWT A;  1MSE C;  1QRY A;  5C44 J;  2B63 J;  3ZQF A;  5EG0 B;  1WET A;  2OF7 A;  4HNV A;  1SQ8 A;  4A69 C;  1U9O A;  4IHW A;  1O4X A;  4Z5H A;  1JT6 A;  5GP9 A;  2R5Z A;  3FIW A;  5K7H A;  1GUU A;  1QQA A;  3G1O A;  2LYQ A;  3HGY A;  2KZ8 A;  3BT9 A;  3SFI A;  3TRB A;  3BG5 A;  3UFD A;  1RPW A;  2O7O A;  2JVL A;  1TC3 C;  2OFY A;  4A3C J;  1LCD A;  2DMN A;  1JJ8 C;  4G12 A;  5C4J J;  1TWH J;  1WIZ A;  3QF3 A;  2PUE A;  3WHB A;  2M34 A;  2GRL A;  2ID3 A;  2R7Z J;  3FIS A;  1DU0 A;  4GQM A;  4BY7 J;  5IYD J;  3VK0 A;  5M3F J;  3SCH A;  2KEJ A;  4W1U A;  3F51 A;  3BTC A;  2HOS A;  3WHC A;  3JRB A;  2HOA A;  5A7L A;  3JRE A;  1IRZ A;  4Y52 J;  5EZH A;  2DA5 A;  1MSF C;  2IBD A;  4I6U A;  1AKH B;  1RET A;  2EQR A;  1F36 A;  1LFU P;  3CQZ J;  1BA5 A;  4D5F A;  3S8Q A;  2DA3 A;  4JCX A;  1IUF A;  5FJ8 J;  4BKX A;  4A3D J;  3OQM A;  2O9L A;  3I4M J;  4YG4 A;  3S1N J;  2IU7 A;  4J1X A;  3A01 A;  1ZPQ A;  1WH7 A;  1MNM C;  1WH8 A;  3HZI B;  2R5Z B;  2O8K A;  5F1J A;  2CQX A;  1YSE A;  2PUF A;  3HBL A;  3G7D A;  1JKR C;  1NEQ A;  2HQ5 A;  3F0C A;  2XRL A;  3HGG A;  1YRN A;  4F8D A;  5E3M A;  1POU A;  1LQC A;  2DMP A;  2GBY A;  3BR2 A;  3OIO A;  1FIP A;  4PU8 A;  2CJJ A;  4M3G A;  4XK4 A;  3BG3 A;  1G2H A;  2NS8 A;  4IHY A;  4AYB N;  4UUT A;  4IA8 A;  1JKP C;  4UUS A;  2K9N A;  1LE8 A;  2LY9 A;  1DU6 A;  4Y42 A;  2G0E A;  4S0H B;  3HOV J;  1B0N A;  1ZZ6 A;  4MCX A;  1QP7 A;  4JCY A;  4I8T A;  3JXB C;  1VPW A;  5EYR A;  2XJ3 A;  1IC8 A;  2CRO A;  5FKL A;  3CMY A;  2IVG A;  2XPV A;  4M3B A;  4FE7 A;  1PNR A;  1LMB 3;  2TRT A;  2M9H A;  5EF6 A;  2ME6 A;  2PPX A;  3GTL J;  2IUO A;  5E3O A;  1ENH A;  5EEA A;  1IJW C;  4PU7 A;  5IYB J;  2N8G A;  3JXD L;  3A01 B;  5IPA A;  3RKQ A;  1RZS A;  4I76 A;  5M5X J;  1EFA A;  4MIM A;  4X4D A;  2VI6 A;  3RZO J;  3BR3 A;  2R0Q C;  4IEJ A;  3IH2 A;  4M3F A;  4C3I J;  4A93 J;  2DA1 A;  2XPW A;  5DTD A;  2QCO A;  2X48 A;  4C3J J;  3JRD A;  1IGN A;  3L1P A;  1HDP A;  1JUM A;  2LK2 A;  5DS9 A;  1DW9 A;  2MEZ A;  3ZQC A;  3CLC A;  1MBE A;  2JK3 A;  1IV6 A;  4X4G A;  2L7F P;  1UHS A;  3QQA A;  3ZQG A;  1CQT A;  3SJM A;  4GHJ A;  4UUS B;  1LE8 B;  1K83 J;  3HOU J;  3BR6 A;  2GLO A;  4X4H A;  3CEC A;  4A3M J;  4O8B A;  5HOD A;  3ZQH A;  5IP6 A;  5C3E J;  1ETX A;  2PUG A;  4YG7 B;  3W6V A;  1RZR A;  1JGG A;  1PRA A;  1FTT A;  2E19 A;  4I6T A;  2IVQ A;  5F0C A;  4M6V A;  1B72 A;  1ETV A;  2LD5 A;  3G1L A;  2XGC A;  4L5E A;  3DEW A;  1OCT C;  3CDL A;  4PU4 C;  1WPK A;  3BTJ A;  2JN6 A;  3OMT A;  2H8R A;  3BG9 A;  1P7J A;  4D5C A;  3S1Q J;  2EZK A;  3BS3 A;  2FQ4 A;  3BD1 A;  1H88 C;  1TWA J;  1RKW A;  1ZR2 A;  2K9S A;  1LLI A;  1GDT A;  3LOC A;  3JRH A;  3S1R J;  2NVY J;  2XPU A;  2DJN A;  5K7F A;  2BNM A;  4B1R A;  4BBS J;  2K40 A;  3GTM J;  3G5G A;  5IP9 J;  1NK3 P;  3LFP A;  5K98 B;  2R5Y A;  1ZR4 A;  1ZZ8 A;  1HF0 A;  1TWG J;  3PM1 A;  1T56 A;  3QQ6 A;  5EDN A;  1B8I B;  1UTX A;  4MFE A;  1Y1W J;  1XWR A;  1BDI A;  1ETQ A;  2LFB A;  2VKE A;  3TW6 A;  4AC0 A;  1MBK A;  1T33 A;  2ECC A;  1MBG A;  3ZQI A;  5K7Z A;  1OCP A;  2PUD A;  4AUX A;  4QTR A;  3O8H A;  1UXC A;  2L9R A;  3MN2 A;  2E2I J;  2LR8 A;  1B72 B;  4Z5C A;  1I50 J;  1U9N A;  2MSY A;  2VPR A;  4GFB A;  2EWT A;  1X58 A;  2NVX J;  1HLV A;  1NK2 P;  4YBA A;  2LP0 A;  2R1J L;  2IAI A;  2PMZ N;  1OFC X;  1F43 A;  2QF7 A;  1JJ6 C;  1ZS4 A;  2TCT A;  3LNQ A;  4M3D A;  2BJC A;  1HCR A;  3DNV B;  4IVZ A;  1ITY A;  1ZK8 A;  2WAQ N;  5F27 A;  2ME0 A;  3ZHI A;  1IDZ A;  2XGD A;  2NVT J;  3VPR A;  1Z77 A;  3RZD J;  2LYL A;  2WV1 A;  3LIS A;  2R5Y B;  2ICP A;  1AU7 A;  2JJ7 A;  4JP0 A;  5E3N A;  4A3L J;  4FTH A;  1QVT A;  1PRU A;  1HDD C;  1I6H J;  4FIS A;  3HKZ N;  1A6I A;  3GN5 A;  2Y30 A;  4LOC A;  2L7Z A;  3O8G A;  2Y9Y A;  2K9Q A;  2EZI A;  1Z0X A;  1MH4 A;  1R63 A;  2JA5 J;  1BW6 A;  3FMY A;  4FN3 A;  3GTP J;  3PO2 J;  2L7M P;  3EUS A;  4XID A;  1MH3 A;  2HXO A;  4JX6 A;  4IHX A;  2AO9 A;  1JFS A;  4XIC A;  4I6Z A;  3A02 A;  1FJL A;  2E1O A;  4A3J J;  4JYK A;  2XSD C;  3FK6 A;  2AXV A;  2EH3 A;  2HOT A;  2IV1 A;  1UMQ A;  2LYS A;  2L49 A;  2GM4 A;  3UKG A;  1ORK A;  2AHQ A;  2R93 J;  4XRS G;  3KJX A;  1OJL A;  3OOU A;  2DA2 A;  2I10 A;  4X4C A;  2ID6 A;  3CCY A;  2O4A A;  2NS7 A;  1W0T A;  2PUA A;  2HXI A;  2LKX A;  3RZZ A;  5F0F A;  1VFC A;  3H5T A;  2DN0 A;  3MLF A;  5FKM A;  4IHV A;  4MFD A;  3MVP A;  2AXZ A;  5GPA A;  2B5A A;  2KPJ A;  2XI8 A;  1QQB A;  3HOY J;  5J1R A;  2M0C A;  1PUF A;  1GVD A;  2EZL A;  4DYC A;  3GN5 B;  1CJG A;  4A3I J;  4FE4 A;  1X57 A;  3OQO A;  3M3Y J;  5BNG A;  1X2N A;  3BTI A;  1L1M A;  4PU3 C;  3FYM A;  5F0H A;  2LCV A;  2OPT A;  2FX0 A;  2YS9 A;  3FKI J;  4A3E J;  1JTX A;  2WB1 N;  5JLW A;  1B8I A;  1MBF A;  1JKO C;  2MQK A;  2R63 A;  3LSG A;  1SAN A;  3GTJ J;  4A3G J;  2NOG A;  2Y2Z A;  1OSL A;  3JRC A;  3HB9 A;  1BL0 A;  2AW6 A;  2DMT A;  4X4B A;  4X4F A;  1BDH A;  3IH3 A;  2IVB A;  3JRG A;  2PUB A;  2JA6 J;  4YAR A;  1ETY A;  4A3K J;  2A6C A;  4RBO A;  2E2J J;  2R92 J;  3M4O J;  3IVP A;  3B6C A;  1ZZB A;  3QPS A;  4MCT A;  3RQI A;  3F6W A;  4X1E A;  3Q3S A;  3OQN A;  1ETO A;  1ETK A;  3GTQ J;  4A3F J;  2MGQ A;  4QIW N;  5IYC J;  1Y1V J;  4X4E A;  1JH9 A;  4C2M J;  2RAE A;  2AWI A;  2E2H J;  1K61 A;  3LSR A;  1QP0 A;  3CRO L;  4CYC A;  1APL C;  2XIU A;  3S14 J;  3G1M A;  2LYK A;  2CRG A;  1PUF B;  5FLV A;  3BR0 A;  3Q0U A;  5FKK A;  1P7I A;  2PUC A;  2CQQ A;  2HYJ A;  3GTK J;  1I3Q J;  3KZ3 A;  3HOX J;  3TED A;  2LYJ A;  4W97 A;  5IOY A;  2AUW A;  1BJZ A;  1X2M A;  3I4N J;  4I6R A;  4DYR A;  3O9X A;  3B6A A;  4MLO A;  1VND A;  2DA4 A;  3F52 A;  1HOM A;  2PE5 A;  4Z5D A;  1ZZC A;  2KEK A;  2MG4 A;  3S17 J;  2BNO A;  3SCF A;  2MW8 A;  1D5Y A;  4IWR A;  1JTY A;  1LCC A;  3OSF A;  2LVS A;  3H0G J;  3SCG A;  4J19 A;  3FK7 A;  3BTL A;  3QPL A;  1JWL A;  1ZZ7 A;  1EF4 A;  1RES A;  4M3E A;  4BXX J;  4JX5 A;  5M5Y J;  4JQD A;  2KEI A;  5M3M J;  2CUF A;  1GV2 A;  3Q0W A;  3ZQL A;  4X4I A;  1H8A C;  3TP0 A;  1W0U A;  1QPI A;  2JA8 J;  1ZGW A;  1VI0 A;  1UXD A;  2XGE A;  4ABZ A;  2L8N A;  4BY1 J;  2OR1 L;  3LSP A;  1UG2 A;  1TWC J;  4CYC B;  3GTG J;  1GV5 A;  1ZKG A;  2X6O A;  1PRV A;  4V2F A;  5JLX A;  2KDZ A;  2ECB A;  3DCF A;  1JUP A;  2XB5 A;  1ADR A;  5IOZ A;  2CU7 A;  1NER A;  5FKO A;  1S7E A;  1MBJ A;  3JRF A;  1NTC A;  3PO3 J;  2LLK A;  1WH5 A;  3SDG A;  1U78 A;  3S1M J;  2LYP A;  3C2B A;  2FJ1 A;  2H1K A;  4FCY A;  2HIN A;  2XB0 X;  1DWK A;  5J3L A;  3K2A A;  3HM5 A;  3HOW J;  2AXU A;  1ZZ9 A;  2HI3 A;  1WGX A;  2X9D A;  5GPC A;  1JT0 A;  2XCJ A;  1A5J A;  2GRM A;  2O49 A;  4DZP A;  1Y7Y A;  1WH6 A;  3NAU A;  1GT0 C;  4OB4 A;  3GTO J;  3NAR A;  2NVQ J;  2YU9 J;  3S2D J;  2M2E A;  2PIJ A;  3BR1 A;  3H3V K;  1ZTR A;  1FTZ A;  2D5V A;  2O38 A;  4A3B J;  2FD5 A;  3A03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...