1HF0A

Crystal structure of the dna-binding domain of oct-1 bound to dna as a dimer
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
153
structure length
128
Chain Sequence
LEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDAERKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFSNRRQKEKRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OCTAMER-BINDING TRANSCRIPTION FACTOR 1
publication title Differential Dimer Activities of the Transcription Factor Oct-1 by DNA-Induced Interface Swapping
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 43
structure length 128
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
A PF00157 Pou Pou domain - N-terminal to homeobox domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1hf0A02
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1hf0A01
5EG0B 1X2MA 2LY9A 5E3NA 2GRMA 5GPAA 2K9NA 4AYBN 1MH4A 1K61A 3I4MJ 4X4IA 3FISA 3BR5A 4CYCA 5C44J 1ZQ3P 1FTZA 1PERL 5IP7J 2DMPA 2KPJA 3PO2J 2EQRA 4W97A 2MQKA 1B0NA 2ID3A 4PU8A 2JMWA 1YRNB 4FE4A 1UXCA 4BKXA 2NVYJ 3PXPA 3OSGA 4Z5DA 1WPKA 2IVBA 3BD1A 2W48A 2GBYA 3BTLA 3Q0UA 1MBKA 1F43A 3HEFA 3O9XA 4DYRA 3CMYA 4Z59A 5M3FJ 3HKZN 5IP6A 1DU6A 3TW6A 4IHXA 1B8IB 5FKMA 1ZUGA 1JFSA 1TWCJ 1LFUP 2E2HJ 3CQZJ 3JXDL 3GBGA 4JX6A 2DA2A 1ZKGA 3B6CA 4JCXA 2LTPA 2IUOA 2ECBA 1Z0XA 2WB1N 5DS9A 4I6RA 4YG1A 1RESA 1ADRA 2HDDA 1WIZA 2M34A 4BY1J 3SFIA 3HGGA 3QPLA 1JT0A 1TWGJ 1ZZ8A 2DMNA 2LFBA 1U78A 3S14J 1MSFC 2E1OA 2H8RA 1LE8B 2XCJA 1SANA 3LSJA 1K83J 2DMQA 3NAUA 4IHYA 1IC8A 2LCVA 2WAQN 5E3OA 2L0KA 2O8KA 2IV1A 1JUSA 4IEJA 5BNGA 2LYSA 1FJLA 1Q1VA 5FLVA 3LSPA 1H88C 2LYLA 4Z58A 2PPXA 2KEKA 1S7EA 2CUEA 4C3IJ 2VUMJ 2AXVA 4X4GA 3PO3J 4BBRJ 1B72B 4Y42A 3BTCA 4AC0A 3F6WA 2BJCA 4C3JJ 2CQQA 2E19A 2AUWA 1LMB3 4XIDA 2XPUA 4D5CA 4A3JJ 3GTKJ 2ID6A 1NTCA 1ZPQA 2MEZA 3ZOBA 2LK2A 3S2HJ 3GBFA 1BJZA 2AO9A 5J1YA 1B72A 4LOCA 2PUFA 1HDDC 1PRAA 1BW5A 2HXOA 3B7HA 1IRZA 2NS8A 2OR1L 1APLC 1UMQA 2K9SA 4M3DA 1TWHJ 3OSFA 1FEXA 4NDWA 3F52A 4C2MJ 1ORKA 3B6AA 3BR0A 1JKRC 4A3MJ 1JGGA 2YS9A 3S17J 3OQNA 3DEWA 4A69C 1O4XA 3KJXA 4A93J 1JWLA 3ZQHA 4PU7A 2M9HA 1ZGWA 4JYKA 1ZAYA 3JRBA 5IPAA 2LYPA 4DZPA 3QQ6A 2O4AA 1AHDP 1WGXA 5EGOB 5F0HA 1GV2A 3JREA 1ENHA 2PMZN 1QP4A 5J1UA 4JX5A 2I10A 4HNVA 2VKVA 3RZOJ 2FD5A 4IHVA 1X58A 2VI6A 3ZQCA 3I4NJ 4O8BA 3FYMA 5E3MA 4NDLA 5EGOA 1IJWC 2DJNA 2R5ZB 1BW6A 2BNNA 2PUEA 3TRBA 5EDNA 2DA1A 4GFBA 3GTOJ 1TC3C 3RQIA 1ETQA 4D7MA 2DTZA 1QP0A 1OFCX 3HGYA 2COBA 1ZR2A 3IH2A 2O9LA 1I6HJ 3JXBC 2EZIA 1RZRD 2K9QA 3GTGJ 3LNQA 3S15J 4PU3C 2EZKA 1RETA 1MBEA 2N8GA 5M3MJ 3F0CA 3SCHA 3PM1A 4X4FA 1AKHB 3G1MA 1GUUA 1POGA 3JR9A 4J1XA 4MIMA 1H8AC 1MH3A 2CJJA 2EZLA 3GTLJ 3BDNA 4I6UA 3VPRA 1ZZBA 1H89C 1ETKA 3IH4A 3EUSA 5EG0A 2PIJA 3FIWA 4RDUA 1JKQC 5F27A 3HOVJ 3TW7A 2MG4A 3OIOA 3UFDA 1ETYA 5IP9J 4YBAA 2HOAA 2L7FP 2NOGA 2GRLA 1ZZCA 3GTPJ 1WH5A 3Q0WA 3D1NI 1YRNA 5K7ZA 5FKKA 4RBOA 1LCCA 2HXIA 4EEFG 2CUFA 1ZZ7A 3HB9A 4FCYA 3LISA 2L7MP 2R63A 4A3GJ 5M5XJ 1T33A 2L49A 3OOUA 4S0HB 3KXAA 4XICA 4XRSA 3BQZA 1W0UA 1ITYA 2KZ8A 2DA5A 1ETWA 4X4DA 2E2JJ 3A03A 1UHSA 4FN3A 3FK6A 2LLKA 1AU7A 2DA3A 1B8IA 2E2IJ 1F36A 4X4EA 2XSDC 1LLIA 4A3CJ 2XIUA 2LVSA 4BY7J 5IYCJ 1DU0A 2NVXJ 2CSFA 4X4HA 5E3LA 3TEDA 3QWGA 4X4BA 1Y9QA 3OQOA 3K7AJ 2HYJA 3JRHA 4MLOA 2JA5J 3O8GA 4MO7A 1XWRA 3HOXJ 5EF6A 2HSGA 4XK4A 4Z5HA 2IBDA 3S16J 3MN2A 1I3QJ 2R0QC 3M4OJ 3RZZA 1LE8A 4DYCA 2IAIA 1RKTA 2EF8A 4DZJA 1GV5A 4Y7NJ 2M2EA 1P7IA 1Y7YA 1HCRA 1UXDA 1JFTA 4GHJA 3JRAA 4A3LJ 2WUSR 3DCFA 5FKLA 1MNMC 1X57A 3ZQFA 1IDYA 4V2GA 2P81A 3GTJJ 5C4XJ 5FKNA 1R63A 2PUCA 1MBJA 2OFYA 1U9OA 4GQMA 1JT6A 1ZS4A 2XB0X 1WETA 1XC5A 5DTDA 2FX0A 1RZRA 1ZTRA 4A3IJ 2YU9J 2JA8J 3HDDA 1ZK8A 2LR8A 4JCYA 4M3GA 4B4CA 3S1NJ 1OJLA 3QPSA 4I76A 1GT0C 2LP0A 2LD5A 1WCMJ 1Y1WJ 2HOTA 3SJMA 1MSEC 2CROA 1MBGA 2QCOA 1OCPA 1PUFB 4I6TA 4YG4A 2R1JL 1BDHA 1RPEL 3IH3A 4MFEA 3ZKCA 4V2FA 2XPWA 2XPVA 4MCXA 2GM4A 3CCYA 3TP3A 1RPWA 3F51A 5EZGA 1ETVA 2BNOA 2XB5A 3M3YJ 4FTHA 3KZ3A 2AXUA 4J19A 2IEKA 1NEQA 5M5YJ 1POUA 1UTXA 3E7LA 2LYJA 4D5FA 3G1OA 4A3KJ 4FISA 3LSGA 2Y31A 1G2HA 1IUFA 3Q3SA 4I6ZA 4IVZA 2WV1A 3BQYA 3A01B 1VPWA 4M3EA 4JQDA 3BR6A 3HBLA 5IOYA 2DN0A 5IYBJ 4DYQA 3L1PA 4BXXJ 3HM5A 1TWFJ 2H1KA 3FMYA 9ANTA 1UG2A 2RAEA 2R5ZA 4XRMA 2JA6J 1QQBA 1Z77A 2LYKA 1U9NA 1JUPA 1NERA 3OMTA 3S2DJ 3LOCA 2ELKA 1Y1VJ 3UKGA 2Y30A 1U8BA 3OQMA 4QSHA 1XS9A 4UUTA 1MBFA 3BG3A 5K7FA 2XRLA 3ZHIA 3JRDA 2CQXA 3GN5B 3BR3A 2ICTA 3R1FA 4L5EA 1DWKA 2DA6A 2MSYA 3QF3A 1FIAA 5J3LA 1W0TA 1NK3P 1XG1A 4UUSB 3LSRA 1BL0A 3A02A 4OB4A 1LFBA 1AKHA 3FKIJ 2OF7A 2M0CA 2LYRA 3K2AA 2KEIA 1ZR4A 2TCTA 1TWAJ 2EWTA 2EZHA 3H5TA 5EZHA 4Z5CA 5HODA 1ETXA 1IG7A 4A3EJ 5FJ8J 2Y2ZA 4C3HJ 2IVGA 4IWRA 1DW9A 4UUSA 1HOMA 3OP9A 2DA7A 2G0EA 4CYCB 2PUBA 4PU4C 1OSLA 2Y9YA 5C4JJ 5F04A 2VPRA 3VK0A 3S1RJ 2B63J 1JKPC 1HDPA 1JTXA 3WHBA 3JRGA 1GDTA 4D7NA 1A6IA 2KT0A 2KEJA 2LYQA 2TRTA 3BG5A 5IOZA 2CRGA 1OCTC 1RZSA 1IV6A 3DNVB 3HOUJ 5F0CA 1A5JA 2HI3A 2R7ZJ 1L1MA 4QIWN 1EF4A 4B1RA 3MLFA 4IA8A 4FBIA 2GZUA 4YARA 3BR1A 1JTYA 2B5AA 2JA7J 2L7ZA 1LCDA 1VF9A 1HF0A 2JJ7A 4A3DJ 2JK3A 4XRSG 2PUAA 5EYRA 5F1JA 1WH6A 3JRCA 4Y52J 3LFPA 2DMTA 2BNMA 1BDIA 3ZQLA 4FE7A 2QF7A 2R5YB 2JN6A 2XGCA 2O49A 3U3WA 1HLVA 3BG9A 3QYXA 3O8HA 4QTRA 3CLCA 3G1LA 4IHWA 1MBHA 2R5YA 1PNRA 4BBSJ 1JKOC 2OPTA 2PUDA 3FK7A 2L8NA 3FYAA 2JVLA 3SCGA 1P7JA 2FJ1A 1X2LA 1JUMA 2ECCA 2FJRA 2AXZA 1VI0A 3JRFA 1FIPA 3H0GJ 2PUGA 3CDLA 4M6VA 1CQTA 3SCFA 2XI8A 2JCGA 1ETOA 3RZDJ 2ICPA 3SDGA 3GTQJ 3HZIB 3MKLA 2XGEA 3H3VK 2L9RA 2VKEA 4JX4A 3ZQGA 2EBIA 5F0FA 5C3EJ 3GTMJ 2AW6A 2YUSA 1VFCA 4X6AJ 1IGNA 1JJ8C 2M8GX 5FKOA 2D5VA 4X4CA 4MCTA 4MFDA 5EEAA 1D5YA 2Y9ZA 2EH3A 2HQ5A 2X9DA 3S1QJ 2PE5A 3HOZJ 2O7OA 2MW8A 1WI3A 3CECA 5JLXA 4ABZA 1FTTA 2AWIA 5K7HA 2Y0SN 3QQAA 3BS3A 2NVQJ 2EBYA 1X2NA 3NARA 5FLMJ 1QRYA 1R9TJ 2K40A 2XJ3A 2ME6A 2ZB9A 2R93J 1SQ8A 1JH9A 2HOSA 1PUFA 4M3BA 2X48A 3MVPA 3Q0VA 3G7DA 1QPZA 1LQCA 1PRVA 3HOWJ 2WIUB 5GP9A 1NK2P 3G5GA 2LKXA 2XGDA 4DW6A 2KDZA 3RKQA 1RKWA 3HOYJ 1QVTA 2IU7A 2NS7A 3TP0A 1ZVVA 1ZZ6A 2R92J 1T56A 1E3OC 5IYDJ 2DMUA 1WH8A 3ZQIA 3CROL 4J1WA 3A01A 1JJ6C 2MGQA 2FQ4A 1R69A 5F08A 4YG7B 3BTIA 3BT9A 1SFOJ 1QPIA 2ME0A 2CU7A 3JXCL 2IVQA 1RIOA 2GLOA 1VNDA 1RR7A 4X1EA 4I8TA 2HINA 3JRIA 3S8QA 2O38A 4G12A 5M5WJ 4F8DA 3IV5A 5GPCA 1I50J 1QP7A 1QQAA 3C2BA 1BA5A 3W6VA 3IVPA 2JWTA 5JLWA 2NVTJ 1PRUA 2AHQA 3BR2A 2A6CA 5K98B 1QVUA 4B3AA 4JP0A 3BTJA 3GN5A 5A7LA 1ZZ9A 1CJGA 4AUXA 2X6OA 3S1MJ 5J1RA 4A3BJ 3WHCA 4A3FJ 1IDZA 4M3FA 1YSEA 1WH7A 4W1UA 1EFAA 3ZHMA 1GVDA 2DA4A
chains in the Genus database with same CATH superfamily
4IO9F 3C3WA 5E3NA 2JQ7A 5GPAA 2PG4A 1MH4A 2DFEA 4XKCA 1O7FA 4YG2F 3OYIA 1K7AA 4CA0A 3UNGC 3VEPA 1ZQ3P 1PERL 4Q4ZF 2EIJH 4PJ0C 3QOPA 1B0NA 4PU8A 2CW7A 1S72I 1E0EA 5GTHC 3L2CA 3LSMA 2HDWA 3OYLA 2IVBA 3BD1A 4Z5DA 2E60A 2CW0F 2X4HA 3O9XA 3F8BA 4Z59A 3KLNA 4F92B 4IF4A 1T2KA 3HKZN 4YEJA 3ZMUA 4HF0A 4EZIA 1SAUA 5E1WA 2LKSA 1YQAA 4LB6B 5FKMA 1JFSA 3JXDL 4A12A 3BJ6A 1X4PA 2Q2EB 4BJ5C 2DA2A 1ZKGA 3FXOA 1HA8A 3H1CA 2IGMA 2IUOA 1SMYF 1RUNA 3MZYA 3U1KA 4CO8A 3H3UA 4XMYA 1HC8A 2WB1N 3IP4B 3ESWB 4YG1A 2Y48A 3ABTA 1P92A 1ADRA 4HBLA 1WIZA 2M34A 4BY1J 2PBIA 2Z5UA 3HGGA 3QPLA 2V1XA 1EH8A 4O5VA 3DF8A 2HVRA 2J5OA 2VODA 1R5ID 5LHIA 1U78A 4PFPA 2IGNA 3S14J 3TEPA 2M87A 1LE8B 3BG7A 4BXUA 3IHUA 3OYFA 2DMQA 3EYIA 4IHYA 4I99C 1LJ9A 2L0KA 4I0AA 4IEJA 1RC9A 2KPMA 4LLNA 4ZZDA 4XONA 2Z33A 4C3IJ 3S3MA 2KFDA 3ERMA 2E19A 4NHJA 2AUWA 2XPUA 3DWLE 3GTKJ 1Z1DA 2ID6A 1NTCA 3ZOBA 1GVJA 2VBXA 3S2HJ 2ZBKA 2AO9A 2PXUA 1B72A 3KEYA 4ZDOA 3ECOA 1ZARA 2K02A 4RGUA 2HXOA 3K69A 4B8XA 5FLXZ 1V5FA 4ESJA 4BE0A 2OR1L 5CPRB 2VJJA 3OSFA 3OYCA 2W85A 4R1HA 3HG9A 1D8JA 3ZPLA 3H5NA 3ERED 3DEWA 2G7UA 4G94A 4A69C 5LLQA 1JWLA 1A35A 4JYKA 4UV9A 2JVHA 5GTIC 2LYPA 3QQ6A 1TT0A 5HNHA 2LF8A 5F0HA 5EGOB 1GV2A 3EUHA 2R7VA 3BWGA 2HOEA 5J1UA 4CGZA 4JX5A 1R4NB 5CLSA 4HNVA 4ZJZA 3VSKA 1Y0UA 1X58A 2VI6A 2WAQA 3K2ZA 1XPXA 4BNCA 3FYMA 5E3MA 1IJWC 2ZO4A 1ZLKA 2VL8A 4N4NB 1W1WE 4FASD 5D5WB 2QSGX 2R7FA 4KT6A 4DE9A 2M4HA 3RQIA 1ETQA 1SVOA 2DTZA 5DRYA 1I6HJ 1EV7A 3K4NA 3AG3H 3FXLA 3HSEA 4IKFA 3GTGJ 1X1DA 1J5YA 2G7HA 2B7EA 3PUFA 3S15J 2EZKA 2CQ7A 2L3DA 3TO6A 3W2WA 5DTMA 2MFZA 3GX4X 3SCHA 1VQLI 1AKHB 2M5WA 4V19K 4HV6A 3JR9A 4ENNA 4X0GA 1D5VA 1MDMA 5FFZA 1H8AC 3RIRA 5TGTA 3BDNA 4H4KC 1D1BA 2HQNA 2LMDA 5DUKA 1BI1A 4LLGF 3NWTA 3RKXA 3IH4A 3CDIA 2PIJA 1MMSA 3PQKA 3AAFA 1QQIA 3TMOA 5GAGJ 2CQKA 2PMZA 3LMMA 2Z3YA 3KEQA 5DUIA 3U2RA 3GTPJ 2PXBA 2F6CA 3CJRB 1YRNA 1Y56A 1YW9A 3GCMA 1LNWA 1Z67A 4AWXB 4EEFG 2RNGA 4IOAF 2MBFA 1ONVA 5KCMA 2LSOA 4B09A 4FCYA 2R63A 4EKGA 4S0HB 3KXAA 2K3PA 1UZCA 3CD6I 2QBYA 3I5UA 4XRSA 4BDZA 3CCUI 2M7AA 5AONA 2KZ8A 1ETWA 3AG4H 3EQLF 1DGWY 1V4RA 3A03A 2A6EF 3FK6A 1R58A 1LUJB 4HV5A 5FFXA 2BW3B 2A61A 4E6KG 2R7TA 3WU1B 3TO9A 4XORA 4ITVA 2XIUA 5IYCJ 4BQNA 2VBWA 1PP7U 4AD9A 2CSFA 3GF2A 4U0VA 5JVTA 4ENMA 3TEDA 3QWGA 4L0ZB 3K4MA 3K7AJ 2PXKA 3KP6A 3M8EA 2JA5J 3QP5A 5EF6A 3H5AA 4XK4A 4XQFA 4Z5HA 5D6EA 3I58A 1K78B 1R00A 1ZG3A 2VE8A 1XX5A 4GYIA 3RZZA 1N25A 1S7AA 1RKTA 2K5CA 3MQ0A 1X19A 2NNNA 3NROA 3ZRGA 3ZCOA 4WK8F 1Y7YA 2Y69H 4A3LJ 2WUSR 1W7PA 5FKLA 1MNMC 4IX7A 3ZQFA 2EIKH 1V54H 2PJPA 2CYYA 3KFWX 1U9OA 3OYKA 3U21A 1WETA 1XC5A 5DTDA 5K5OA 1IRFA 3MFKA 4A3IJ 4RAGA 2LRDA 2K27A 3DPLC 4LJZF 3AKZA 4JCYA 2GA2A 3H3ZA 1MMDA 3FXJA 2LP0A 2KLOA 2LLVA 2M3AA 3AFHA 2DT6A 3L7WA 4PFOA 4EJVA 2CROA 3CZ6A 2FU4A 5E8IA 4I6TA 1BDHA 3HJEA 1J09A 1IO2A 4MFEA 2P6TA 3ZKCA 4BHBA 3PUBA 4ZYGA 1XB4A 3I59B 3BY6A 3ELKA 1RPWA 5EZGA 3M3YJ 2VBZA 4FTHA 4XNFA 1D0XA 3QYEA 2AXUA 5EEGA 1S8NA 2MC4A 3U1DA 5M5YJ 4EGYA 5E79C 3G1OA 4FISA 2BZTA 2Y31A 3A0BC 5JUWA 3Q3SA 4IVZA 4RAZA 3K4BA 3KCCA 4RM3A 1FBQA 3K6GA 4HYEA 1XGSA 4M3EA 3D5LA 4XN3A 1LFPA 3IL2A 3HBLA 5B1BH 1AA7A 3L1PA 4KJZA 2XC7A 2F5VA 2UUZA 3FMYA 2WV0A 2F4MB 2CW8A 4M9XA 4XRMA 1YITI 3O2PE 1EJ9A 5LHHA 1QQBA 2KIQA 1VQ4I 5FB2A 3OMTA 1XTAA 4OINF 3UKGA 4BJTA 1JXSA 1WWXA 2P5KA 2Y30A 2ZXWH 4QSHA 2DI3A 2HWVA 3BG3A 1PDNC 5BMZA 2CQXA 3LA3A 2A05A 5AIPA 3R1FA 4A2UA 5ILVA 2BXZA 4HEA2 2MSYA 1FIAA 3CUOA 3GWZA 1W0TA 1VQ7I 4IOCF 1B4AA 2HPIA 4PUSA 3FMRA 4M72A 5FROA 1KU9A 1MNDA 3HOTA 2TCTA 2ZFUA 5ILSA 2IS2A 2A6HF 5EZHA 2EWTA 4Z5CA 2K4BA 4A3EJ 1FPQA 1A6QA 2H27A 2IVGA 4Y15A 3J80Z 3L2QA 2HKOA 3KP5A 2M0MA 1E17A 4ZYEA 4HLYA 1OSLA 2Y9YA 2BVMA 3PE5A 3ZP5A 4CCNA 2W1OA 2EA2A 3S1RJ 2V79A 3JRGA 5K5RA 1A6IA 2KT0A 2JPBA 3C1DA 4BEHB 2KEJA 1RZSA 3QOEA 1IV6A 1TQIA 2FFHA 1WJBA 1Z9CA 3CMAI 2A6TA 4E7KA 2IA1A 1R36A 3FXUA 4QIWN 4B1RA 3F3XA 4WCGA 1PYVA 3GEZA 1JTYA 2ZJRF 5D5UB 1Y8QB 3E97A 3LSHA 3CCSI 3TDZC 4FQGA 2MYSA 1RR8C 3L00A 1VF9A 3GUDA 1LCDA 2JJ7A 2QQAA 4A3DJ 2R7UA 2JK3A 2BHZA 4NBQA 2RGVA 1I39A 2A07F 2XVCA 2GOXB 3GW2A 5F1JA 1LEAA 4I98B 3JRCA 1H9TA 3MKZA 2R7RA 3CCJI 3CESA 1Z7UA 1HXDA 1CGPA 1W5SA 3CLQA 4CH7A 2OU2A 4YIRX 1SVLA 2QGUA 4U87A 4ZYHA 4WX9A 4EJOA 1V5GA 2R5YA 1OCOH 2LKPA 2PUDA 3EDPA 4JBAA 3G0TA 1Z6RA 1P7JA 2FJ1A 2VB6A 1X2LA 5J8FA 3PNVA 2FJRA 1JGSA 1ZRDA 2EK5A 2XAGA 1R1TA 1NHAA 3TL4X 1QHHD 4M6VA 3QAHA 4PJLA 3RZDJ 1R6RA 4NC6A 3RYRA 2KHMA 2LDUA 4RLFA 2BHYA 2H6BA 2CFOA 2Y75A 2L01A 5KNLA 2OZ6A 3IKTA 3WG9A 1XMAA 3HUGA 2O6GE 2QYOA 4FT8A 2HS5A 1FYLA 1BC7C 1VFCA 4X6AJ 4I01A 4ASNA 5LRRA 5DT2A 2M8GX 3FHZA 2IGOA 5EEAA 3CP2A 2PE5A 1V5EA 1STZA 2HQ5A 1MJBA 4GO1A 5HS9A 5GADJ 5KVRA 1OKRA 2MW8A 2NS0A 1RRJA 1KGSA 4LIVA 4ABZA 2VJIA 3JAMZ 1F4KA 5K7HA 4G7HF 1M1EB 4KFCA 1P4WA 4BHCA 1X2NA 3NARA 2XJ3A 1WVRA 2ME6A 1SQ8A 2HOSA 2XXQA 4L0YB 3TO7A 4L5IA 3KJXA 3VOEA 4CSWA 3G7DA 1QPZA 2IT0A 1LQCA 3HOWJ 2WIUB 1IF1A 4DBQA 3V42A 4WWCA 4E7HA 2RQPA 3HRSA 2XGDA 4XKBA 2KRFA 3RKQA 1A31A 3IWZA 2OQRA 1FBUA 2DMUA 1WH8A 2CG4A 4HQEA 4B44A 5D5XB 3WTWC 1O3QA 4DBRA 3A01A 2MGQA 1R69A 4YG7B 1SFOJ 1OMIA 3DM5A 2IVQA 4G6QA 3IAM2 2GLOA 3PSFA 2ELJA 3SXYA 2D45A 2YU3A 2O38A 3LFKA 3WGGA 5M5WJ 3IV5A 1TP4A 4C9YA 1IXRC 4D0PA 2A68F 4BAYA 3W6VA 3BG6A 2XUBA 4IRIA 2NVTJ 2HZTA 2FQ3A 1WJ5A 2VT3A 3LQXA 3NXHA 1L0OC 5K98B 1QVUA 1Z7LA 3GZCA 2YPRA 5A7LA 4ZC3A 4ZDPA 3ZR8X 1YE9A 3EUHC 4KITB 1HBXG 5TJJA 4W1UA 3B73A 2FBKA 3CP8A 4NNJA 1XMKA 2K9NA 1K61A 3TELA 2X6WA 4F52A 1IXCA 3FISA 4C2TA 1XSXA 1FTZA 4P9UA 1J7KA 5IP7J 2EQRA 4W97A 2KJCA 2L7KA 2JMWA 2VC1A 4FE4A 3WU2C 4BKXA 2E1NA 2ELHA 2GBYA 3BTLA 1UAAA 2VKDA 5IT9K 3MMYB 3CMYA 3QFIA 2ZJQF 4B3XA 5M3FJ 4A0XA 4ER7A 2P7VB 5IP6A 2DCEA 3F72A 1IN4A 1B8IB 5DRTA 3GZ6A 2KZVA 1LDJA 3F8NA 1TWCJ 1ZLJA 1LFUP 3CQZJ 4JX6A 5F6FA 2LTPA 1VQOI 2RC4A 3R09A 2FNPA 3E5QA 4M6YA 1U0JA 2P7CB 3VDXA 3NEUA 3QU6A 3ABKH 3DTIA 2VQGA 4HZFA 3CUQC 2ICWG 3VFZA 1ZZ8A 2F2EA 1N77A 2R7SA 2QKMB 5A2QZ 2A69F 2A5YB 2KQRA 5E18F 1MSFC 3ZMVA 2H8RA 2PXDA 1K83J 1FX7A 3VYSB 5HDGA 3JTGA 2LCVA 3KYCB 3W2VA 4DNCA 5E3OA 2E1MB 3KZYA 2O8KA 4DQ2A 1JUSA 2IV1A 2LYSA 1FJLA 5FLVA 2LBFA 3LSPA 2LYLA 5H6QA 2QWWA 2CUEA 2AXVA 2VUMJ 1BOAA 3IRRA 4ZZLA 4Y42A 2O3FA 1JHFA 2MD5A 4HQMA 2CFXA 4HOBA 3T0YA 2XAUA 5EEHA 2W25A 1KU3A 5BS6A 1W36D 4ER6A 3GBFA 1OR7A 3CO6C 3EETA 4XLPF 3QYFA 3HKZA 1HDDC 4N0BA 1MNEA 4XLCA 1GLNA 2D1HA 4IRHA 4ZTJA 3WTUC 3PSIA 3BOQA 1APLC 3J81K 2Z99A 3F52A 2QLZA 4EQZA 1ORKA 3B6AA 1HQCA 3BR0A 1O3SA 1JGGA 3KL4A 2WY7Q 4U7DA 4XBFA 3KP3A 2WB1A 1O4XA 1X3ZB 3BZ6A 5E1ZB 2MC3A 1U5TC 3FKJA 3ZQHA 5JVGF 2EFNA 2X1CA 2F5DA 3WTXC 1YJWI 2CGPA 4PU7A 1KYZA 1TTYA 3HHGA 5IPAA 2JT1A 2M1BA 2O4AA 2LY2A 4ESBA 4JOMA 1FBSA 3UWPA 1O7LA 1QP4A 2BY1A 4LG0A 4G9YA 4ZDLA 3N97A 3I4NJ 4OIQF 1K6OA 1QU3A 2DQLA 5EGOA 4I02A 1SFKA 3CLOA 1OCCH 2R5ZB 3KEOA 1BW6A 1Y39A 1LQ1A 2D1VA 2DA1A 1BM9A 1TC3C 1OFCX 1ZR2A 2COBA 3PQJA 2O9LA 3JXBC 1LKXA 2EZIA 3BLYA 1SFXA 1RZRD 5DD4A 1HW1A 1TQMA 4M71A 3SYTA 1X3WB 1VQ8I 2OCCH 5HDKA 3CF5F 2EV6A 2NNYA 1MBEA 1UHMA 1Y6IA 4NB5A 1Z05A 2LLWA 3F0CA 5DYMA 3PM1A 4X4FA 1HKQA 1G3YA 2X1EA 4BUPA 1GUUA 2KDOA 2YR2A 4J1XA 1IN6A 4BYYA 2WTEA 1E3PA 1SD6A 2IW5A 5D8LB 4KNYA 2CJJA 2JSCA 3PIOF 3BPXA 3BZKA 1ETKA 4CZCA 5EG0A 4OMYA 4EK9A 2QUFA 4RDUA 1JKQC 2P4WA 2EFOA 4XL9A 1R5HA 2MG4A 1SD5A 3DKWA 3OIOA 5IP9J 1U2ZA 3UFDA 3H9GA 2HOAA 2Q1ZB 2L7FP 2XROA 4O6JA 1F9NA 3M8JA 3OY9A 2I5UA 3Q0WA 1MFQC 3D1NI 2XKPA 4RBOA 1LCCA 2HXIA 3ZQ7A 2M4GA 3GVAA 4RAFA 5CKTA 3RJPA 4DOZA 5DTQA 1VZ0A 3V7CA 3OOUA 4YIFA 3FF5A 2HQAA 1W5CC 2DQRA 2M4KA 3PFIA 4S05A 1ZELA 2E2JJ 4X4EA 2LG4A 1KONA 2L4MA 1NG7A 4I0BA 2VXZA 3S2WA 4F55A 2PEXA 1AU7A 2DFIA 2E2IJ 2UWMA 1LLIA 3VSLA 1IN7A 3A2KA 4BY7J 1IRGA 2AXTC 4GDFA 3F6VA 4X4HA 1QHGA 1QO0D 4X4BA 1Q1HA 1ZRCA 3OQOA 2JSPA 2BW3A 5JI6A 4UUVA 1FP2A 4MLOA 1FC3A 5FD6A 4MO7A 3GFMA 2EFPA 1XWRA 3NDBB 1USTA 3REOA 3S16J 3MN2A 1DGRM 2R0QC 5DM7F 2CH0A 5LEKA 1BC8C 2VLAA 4A5MA 3N4MA 4BS9A 5J47A 1P9QC 4DZJA 4Y7NJ 2R4GA 3MD2A 1P7IA 4PJNA 1JFTA 2X0LA 4DIQA 3JRAA 3DCFA 1K78A 2ESNA 3IAS2 2KKOA 2P81A 5FKNA 1R63A 1MBJA 2OFYA 3I64A 1H9GA 5FLXK 1ZS4A 1D0ZA 2XB0X 1FMVA 2FX0A 2KP6A 2WC2A 2JA8J 5L3DA 2HEOA 2XAHA 3OYBA 3DEUA 3K4KA 5H6RA 2LC2A 4B48A 2R7WA 3QPSA 2LD5A 1Y1WJ 1W4MA 2NOJB 3SJMA 4A5NA 1XGOA 1MSEC 3JW4A 1KQ8A 2RNJA 1PUFB 4D9JA 1KA8A 2GZWA 4E7LA 4G7ZF 2GM4A 3OL4A 3M8FA 4WXCA 1L3LA 2ZMEC 1D1CA 3AL0C 5LGUA 2BNOA 2BVLA 4J19A 2IEKA 5DCFA 1UTXA 2FBIA 1O3RA 1O57A 3HTSB 1MJAA 1ZG1A 3PFYA 1T08B 5GAGi 4HG2A 4I6ZA 1E2XA 5J4VA 2ZJ2A 1VPWA 4JQDA 5K1YA 1SD7A 3L2UA 2GAUA 3GFJA 3RTRA 2DFHA 2AXLA 3O6BB 4PJMA 2XRNA 2LYKA 2M8EA 3SZTA 3T1BA 2ISZA 1NERA 1I3AA 2YBDA 3S2DJ 2ELKA 4UVBA 3R6SA 2E7WA 5HLTA 1XS9A 1LDDA 5K7FA 2XRLA 3SR4A 3OYDA 4AIKA 4XLNF 3GN5B 2KL4A 3I3LA 4L5EA 4E7ZA 2DA6A 4MTEA 1MIJA 3E6BA 3Q9VA 2HQRA 2LYRA 2KEIA 3WU0A 1LVKA 1TWAJ 2EZHA 2O8XA 2ZXIA 4NUBA 5J6XA 5HODA 2Y2ZA 1B9MA 3R4KA 2EINH 1Z3YA 3CUQA 1MD0A 4C30A 2PUBA 4PU4C 2JRTA 2VPRA 4HRIA 3ME5A 1JTXA 3WHBA 1J75A 4YIIA 4D7NA 1FLIA 3CTAA 1R4MB 2HFZA 5IOZA 4MEXF 4BL0B 1YIJI 4F91B 1SC7A 4M74A 5F0CA 2X85A 1BI2A 5CVUA 2FBHA 1L1MA 1EF4A 3T8TA 3PNTA 1S7OA 1T38A 5LD2C 2ACJA 4BEHA 4U0YA 2PJRB 4PZJA 5TRDA 2DAOA 1HF0A 2E5NA 1D1AA 5ICEA 1AWCA 4GXOA 2NXNB 4IHTA 1FOYA 2DOEA 3LFPA 2BNMA 2HCNA 3ZQLA 4E4HA 2QF7A 2JN6A 2XGCA 2OTLI 4DJAA 4U7BA 4IPAA 1FSHA 4U0WA 3EPZA 3CLCA 4MHGA 5D5VB 4HX4A 2AQFA 3G1LA 2FE3A 2VOOA 2HTSA 1MBHA 3A9ZA 2OPTA 1HKTA 1S6LA 4XR6A 2JVLA 3SCGA 1TT5B 1VI0A 4UVAA 2MLKA 1U5TA 2CWEA 3JRFA 1FIPA 3K70C 1I6XA 1ACIA 2Z9OA 1CQTA 3SCFA 1JHHA 3I54A 3IKVA 3ABUA 3SDGA 4E70A 2XGEA 1G6NA 3H3VK 2L9RA 2VKEA 4JX4A 4ETSA 2EBIA 4KIGA 2H8WA 1YFHA 3P5JA 5ED4A 5F0FA 5C3EJ 3GTMJ 4QPQA 2ZSIB 3EYYA 1XDSA 3GLXA 1JJ8C 1OYYA 3R0JA 2XIGA 2WADA 3F6OA 4MFDA 2GIVA 4LLLA 2H09A 3H0DA 2V6CA 3KZZA 3HOZJ 4FHTA 4ENKA 2CV1A 1YHQI 1WI3A 2DYSH 5FRMA 3DKXA 5D6FA 1FTTA 1GXPA 4ZH4F 3SZGA 3QQAA 4LB5A 3BS3A 5FLMJ 1QRYA 2K40A 1YW8A 2ZB9A 3RKWA 4P5OA 2IA0A 4M3BA 3MVPA 3R0AA 1OYIA 3M1CA 4RB3C 3M7GA 2CO5A 1YS6A 5GP9A 5KAFC 3G5GA 2ZXJA 3D0SA 3NQOA 4ANJA 4LITA 2PMHA 2JVGA 4MGRA 3CJNA 2NVUB 2DYRH 1RKWA 4RB0A 1QVTA 5CVVA 3HOYJ 2IU7A 1UG0A 1OR7C 2DT5A 2Z16A 1S5LC 3ZQIA 3VB2A 1YI2I 3CROL 2H1LA 3ZMTA 3K1MA 4J1WA 2FQ4A 2IXSA 1WJCA 1WQ2A 3BTIA 5ICCA 2PXPA 2LOOA 1VNDA 3DEEA 4KICA 1W7PD 1DPUA 1U3EM 3JRIA 2HVQA 4HAMA 4L9TA 3KIOA 4F8DA 3RPUD 3OL3A 1QB2A 4UNOA 3C2BA 1BA5A 3IVPA 5JLWA 2MA3A 3QYBA 3LQQA 1PRUA 2BOLA 4HA8A 2AHQA 3BR2A 1OISA 4B3AA 1ZG5A 3KLOA 1MDMB 1CJGA 3EUKL 1WI9A 3E3VA 3V8JA 2X6OA 3I71A 4PGHA 1B9NA 3BC8A 4M3FA 3Q5FA 1EFAA 1IXSB 1SMTA 1BJAA 3QOXA 3K0LA 2J5PA 2LY9A 3KE2A 2KZGA 5L3BA 4RGRA 4AYBN 1T6SA 5J8CA 3GZNB 3BR5A 3K4JA 3DBRB 4EQQA 2UXXA 4CYCA 1I1SA 1TW2A 3PO2J 1EA3A 3OS1A 2MQKA 2E36A 1DPRA 1B6AA 1YRNB 3V4GA 3J7ZI 4BHPA 2V9PA 1BIBA 2JPCA 4BU2A 3OSGA 2V6EA 3VWBA 4EJTA 1ZREA 1SFUA 4NQWA 5E20A 1KQ0A 3D5SC 2IVMA 2UXNA 3Q0UA 2KISA 3A4CA 2PMUA 3HEFA 3QPTA 1F43A 3M1EA 1RIOH 4G8XA 2F5FA 2FA5A 2VQHA 2WY8Q 2QBYB 4BXFA 1BR1A 1R23A 3ROUA 2L54A 3TW6A 1REPC 4YFKF 2J7WA 1ZUGA 2JA2A 1NG6A 2ZNYA 3BP8A 5HVQC 2E2HJ 3BPVA 3GBGA 2PXLA 1AOYA 1HKSA 2ADUA 2RDPA 3B6CA 2HTJA 4HLXA 4ER0A 4JCXA 2KIFA 1TNTA 1Z0XA 5DS9A 4I6RA 1JT0A 2QQ8A 3F23A 1FYMA 1OYWA 2XAFA 1Y8RB 2DMNA 2LFBA 4GYGA 2PXEA 5J4YA 2K7LA 2W57A 1X4OA 2COMA 2E1OA 2VJ4A 2XCJA 1SANA 3LSJA 3RSNA 3CCVI 2PXQA 2ZMEA 3NAUA 4HNUA 3CF2A 4EKIA 5BNGA 1Q1VA 1W7PB 3I4PA 2L02A 2KEKA 1S7EA 4X4GA 1C0WA 1EH7A 3OYNA 2ZSHB 3FXQA 2BY2A 4RAYA 3CCRI 4WF2A 4AC0A 3K4LA 3QODA 1KQ9A 4M9ZA 2NRAC 1LMB3 5F64A 4XIDA 4A3JJ 3OYGA 1J0RA 2CS3A 2MEZA 2GXGA 2LK2A 1Y0NA 5JR3A 4HW0A 4EGZA 3BDDA 3JAMK 1FOKA 1BJZA 2X1DA 5DEQA 1F5TA 4BQAA 5J1YA 3WTYC 4LOCA 3DQVC 1D0YA 1BW5A 4KN4X 2OA4A 3A0HC 3B7HA 1IRZA 2NS8A 2QENA 1VTNC 1UMQA 4M3DA 4NDWA 1HSJA 1ZH5A 3ASNH 1JKRC 4XM3A 3FBIB 5HLHA 1BR2A 2YX7A 2VBYA 1ZGWA 1HW2A 1TNSA 3JRBA 1VQ9I 1ZGJA 1AHDP 4NC8A 2DK5A 2XAJA 1U2WA 3WG7H 3OR1C 3NZLA 4OIPF 5J40A 5BQTA 2I10A 4UY8I 2VKVA 1TL8A 2Y0MA 3CJTB 1SEUA 4IHVA 5TISC 4O8BA 3FM5A 3MWMA 1YO5C 2W4SA 2V1NA 2D2WA 1OCRH 2BNNA 2OC6A 3G6EI 4OBMA 5EDNA 3GTOJ 2KIUA 4D7MA 1QP0A 4OAZA 3HGYA 4EJWA 1IUYA 2K9QA 3LNQA 2E71A 3IWFA 4Y13A 1R22A 1UB9A 3E1SA 4PU3C 1RETA 2IS4A 3V8LA 5M3MJ 2W00A 2DPUA 3G1MA 1D8KA 5BPDA 1RZ4A 1CF7A 4HPQA 2DDBA 4MIMA 5DM6F 1XSVA 5AIQA 2MLGA 5L3CA 3CCMI 4G6TB 3P9CA 1ON2A 4XRFA 3E5XA 3GTLJ 4P55A 1PP8F 5GAHi 2XXAA 1MGTA 3TKYA 3W6KB 1WJAA 2JRMA 4EATA 4WVLA 3FIWA 5F27A 2OV7A 3LWFA 4KA4A 4L9JA 2PI0A 1ETYA 3M07A 2JZYA 2VN2A 1LB2A 4EMSA 2GRLA 4FX4A 2F5CA 5K7ZA 5FKKA 1MMNA 4PJJA 1ZZ7A 2CUFA 4RM2A 3WTSC 1P2FA 3LISA 2L7MP 4A3GJ 3S93A 1T33A 2L49A 3PL8A 5LRSA 2QEXI 2L9SA 2V9KA 4XICA 1G3SA 1W0UA 1ITYA 3H35A 2PQ8A 2Z1DA 2O5RA 2A5WA 3HHHA 1YX3A 3JSOA 2LLKA 1F36A 3MEXA 2QSHX 4HF1A 4YFNF 2Q2EA 4RMNA 1X1BA 5A2QK 5GAHJ 1FZPB 2MH9A 2OUMA 2DXIA 2NVXJ 4CICA 5E3LA 2ODRD 2HYJA 3OYAA 3OKZA 3OR2C 3OS2A 3TOBA 1G59A 4Q5SF 1I3QJ 5CVRA 5B5EC 5DTRA 4E7JA 1LE8A 4DYCA 4LGWA 3J7AO 1QZXA 4HSTA 2EF8A 3MZ8A 1GV5A 2BE5F 1VQNI 3ULQB 3RDIA 3HUGB 4GHJA 1FWZA 3HSFA 1V55H 2NYXA 3DU5A 4R79A 1X57A 3CMEI 4UV8A 3TQNA 4XSZF 1S9HA 5E17F 5C4XJ 3GTJJ 5HS8A 4BACA 1K79A 5ICGA 1JT6A 4CZZA 4WXDA 3R60A 2WA0A 4KDPA 1RZRA 1ZTRA 3I56I 3GFIA 1ZK8A 3F9KA 2IP2A 4LMYA 4M73A 2CQNA 4B4CA 1OPCA 3S1NJ 3OYMA 2OQGA 4I76A 1WCMJ 4ZTFA 2HOTA 4KIBA 4Q2JA 1YS7A 1MBGA 2VC0A 4A6EA 2OTJI 2R1JL 3BJAA 1RPEL 3IH3A 3LSKA 5HLIA 4V2FA 2XPVA 4B43A 3CCYA 3TP3A 4H0EA 3HL2A 3F51A 4IQ4A 4ON0A 5EJCA 2X6YA 1T8IA 2XF5A 1XCVA 1NEQA 4FX0A 4J00A 1N75A 1R5GA 2OZUA 4L9VA 3J81Z 4A3KJ 2AQEA 2P5VA 3LSGA 1G2HA 2PN6A 3MKWB 2ZKZA 2XF7A 3A01B 4CDGA 3HTUA 4AIDA 3I55I 4AM3A 3G2BA 3DPTA 3BR6A 5FD5A 4DYQA 4BXXJ 3HM5A 1I1GA 3GO5A 4BGDA 1TWFJ 2H1KA 2V4JC 3OV8A 4EM1A 9ANTA 2LNMA 1UG2A 2RAEA 2JA6J 4PSWA 1Z77A 2W84A 3G71I 4JK1X 3WTVC 3LOCA 1Y1VJ 2F4OB 5GAEJ 2F4IA 4XLAA 2DU9A 4G6DA 3LAPA 3OQMA 5ICFA 2R7OA 1MBFA 5HNFA 3ZQQA 3JRDA 1K4SA 3BR3A 3TDUC 1IZ1A 1DWKA 1X1PA 5J3LA 1XG1A 4UUSB 5IT3A 1BL0A 2K9MA 2I8DA 3OYJA 3ML6A 3CO7C 4OB4A 1AKHA 3FKIJ 3K2AA 1ZR4A 2EV0A 4EV0A 3H5TA 3KX2A 4IWRA 3CDHA 1YW7A 2PFBA 2QQBA 2EIMH 4PDKA 2CUJA 2MD0A 3FBNB 3OP9A 2G0EA 4HDVA 1KZHA 5C4JJ 5JFRA 5HDNA 3VK0A 3HRTA 2B63J 3LFUA 4J01A 1OCZH 2M30A 2BXYA 2STTA 2TRTA 2LYQA 3HOSA 3TFLA 1FY7A 1OCTC 3DNVB 1XMXA 4HRAA 2W7NA 4RS8A 1UJ8A 2HI3A 2LREA 3GYHX 3LAJA 2R7ZJ 3MLFA 4IA8A 1Z91A 2XASA 5KHDA 2PX9A 4FBIA 4YARA 3BR1A 3OWTA 3MKYB 2L7ZA 4U88A 3OS0A 3DTEA 1H0MA 2WAFA 2PUAA 5K5QA 5F1RA 4Y52J 2FUG2 1BDIA 3F8FA 4FE7A 1F1ZA 2PJRA 2O49A 3U3WA 4XKWA 1TLHB 1SFEA 2ZJPF 3QYXA 3O8HA 2NAZA 5DCMB 4IHSA 4ESFA 4IHWA 2B0LA 2HR3A 1VQ5I 3OOPA 4B47A 1PNRA 3S3OA 2QQ9A 5CVIA 3CMMA 2RV8A 5H2FC 2EB7A 1X1AA 1X3UA 3VYUB 1G8XA 3K9TA 3HC7A 2ZCWA 1B1BA 3C2GA 2PUGA 4IXAA 2R7QA 3CDLA 2LBFB 2JCGA 1ETOA 2ICPA 2STWA 4Y4RA 3SQNA 4BE1A 3GTQJ 2E34A 3J7AY 3MKLA 3S8PA 2R7DA 4II3A 3VODA 1KU2A 2VPLA 1GXQA 4Y33A 2QA4I 3D5RC 4YRVA 2CMPA 5FKOA 1Z3XA 2O03A 3DBHB 4CCMA 2D5VA 4OWRB 4E7SA 3KYLA 2VQCA 4KIFA 1D5YA 2YX4A 2X9DA 4KISA 3S1QJ 4OIOF 1JE8A 2O7OA 3V8KA 4WXHA 1FNNA 3N05A 5JLXA 3UR3C 3KP7A 2XKOA 2KRCA 1Z21A 4RB2C 1R9TJ 1QPMA 1EH6A 2V9VA 2VT2A 1G4DA 1OLTA 3ZMZA 2H94A 3KPHA 1JH9A 2X48A 3BCBA 2JTVA 3QPHA 1J2XA 1R7JA 3I59A 1BR4A 2VKHA 3S32A 2W82A 4LG0B 4BH9A 2LKXA 2E1MC 1SAXA 4M9SA 1YJ9I 4I09A 4DW6A 3LSTA 5FRNA 3PIPF 2EA4A 4UB8C 1ZZ6A 3QOWA 4UB6C 1T56A 2R92J 5IYDJ 1HQ1A 3FDYA 1MMGA 2RKHA 2GWRA 3SEQA 4EM0B 5F08A 4IVNA 2HDCA 3JXCL 1RIOA 4CCKA 4X1EA 3QP6A 4I8TA 2HINA 3S8QA 1UELB 4G12A 4RGSA 5GPCA 1I50J 2RREA 1QQAA 2WWYA 3MCZA 2L9VA 4AIJA 2ISYA 1YJNI 2HCSA 2V1UA 1E3HA 2RVCA 3A1YA 3CC7I 3BTJA 1MMAA 1MKMA 6PAXA 1ZZ9A 2L4AA 5ILUA 3CCQI 3S1MJ 2KIMA 3A9XA 2HYGD 3ZN0A 4A3BJ 3WHCA 3HRMA 1IDZA 3A9YA 2E5ZA 1MW7A 2V3CC 2HVSA 5LGNA 4ER5A 1IRXA 2DA4A 4IRGA 2EILH 1FT9A 1X2MA 5EG0B 2GRMA 4Z2YA 4I2OA 3G4SI 2LNBA 1JI8A 3I4MJ 4X4IA 2X51A 3LA2A 2Q8KA 5CYVA 3HRUA 5C44J 2LH9A 2K85A 3BJOA 2KPJA 2DMPA 4HDUA 2K86A 2ID3A 2DFFA 2V26A 1UXCA 4CHUA 2NVYJ 1N78A 2UV1A 5KAIC 3PXPA 1D3YA 1WPKA 2W48A 3GMEA 1RI7A 1MBKA 4K2EA 4N4OB 4Y17A 4F7ZA 1LEBA 4F93B 2M45A 4LK0F 4DYRA 1V3FA 3TGNA 2G9WA 2HYFA 2IS6A 2DO7A 1DU6A 2QVOA 1QZZA 4HSRA 4JQFA 4N9IA 4IHXA 2H6CA 5D4SA 1KU7A 3Q9SA 2HPMA 1HW5A 1IN8A 1NH3A 4AVPA 1T0FC 4EM2A 2Q0OA 5HOOA 2ESHA 2PXVA 2XF6A 3JCUC 3TBIA 4KUMA 1G3WA 2ECBA 4UVCA 2GOMA 1YG2A 4P1WA 1LVAA 1SD4A 2BYVE 5KK1A 4I7HA 1RESA 3KP4A 1QA6A 2HDDA 4YELA 1FOXA 3SFIA 3OYHA 3IRQA 1TWGJ 1NW3A 3FXKA 3SEZA 3E6CC 4Q48A 1XGNA 1ZGAA 2V1DA 4O3MA 1LDKB 2V7FA 4II2A 2JQEA 5LEJA 1IC8A 1W36C 1WJEA 2WAQN 4AYBA 3DV8A 3I53A 3MZHA 3F21A 3OIQA 1H88C 4Z58A 2PPXA 4QLCU 3OWQA 3TOAA 4LG3A 1XCBA 3PO3J 2IJLA 2YSRA 4BBRJ 1ZRFA 3K1PA 1B72B 3BTCA 3F6WA 4DGWB 4C3JJ 2BJCA 2CQQA 3M9AA 3B02A 4D5CA 4TV7A 1ZPQA 2XDVA 3ZMDA 2HGCA 4IL6C 1PVEA 2QM3A 1VQPI 4PSXA 3RPUA 4KYWA 2PUFA 2FOKA 2VONA 2AS5F 1PRAA 4G7OF 3HIFA 3OMYA 3CC2I 1YX5A 2Z2SB 1TBXA 3KP2A 2EJRA 2KJBA 1XN7A 2JUGA 1WKMA 1FEXA 2K9SA 2VASA 1QZYA 1TWHJ 1TZLA 1USSA 2R3SA 4CYDA 4S04A 4C2MJ 4A3MJ 1ZAOA 2YS9A 1YLFA 2VJ5A 3S17J 3OQNA 3PJRA 3EUAA 3ABMH 4A93J 4LFUA 4D1QA 1IN5A 1WJFA 1ZHFA 2M9HA 3P9KA 1ZAYA 2E35A 4MTDA 4DZPA 3K4CA 1QNTA 1WGXA 3JREA 1ENHA 2PMZN 3I0TA 2EFQA 3VWSA 2EV5A 4HF2A 3RZOJ 2EFWA 3GUUA 2FD5A 1YIOA 2MH2A 2XXPA 5HLGA 3GZDC 3ZQCA 4RA2A 2PXFA 1HSTA 1LPQA 4NDLA 3ASOH 2DJNA 2OCEA 1ERDA 4OAYA 3NWSA 1UHWA 1J9IA 2PUEA 3F8CA 3MEJA 3TRBA 4FETA 4GFBA 2OJED 3IH2A 5FO5A 3R61A 4C2UA 2FMYA 3J80K 2XSJC 2BY0A 3CJQB 3CCEI 2N8GA 3BROA 4R8HA 4CCLA 1BIAA 2L2OA 3BCAA 2OD5A 3RCOA 3O3KA 1POGA 5L3EA 3LL7A 4XOPA 4BDYA 3FWEA 1B59A 1MH3A 2HNHA 2EZLA 2GA1A 2M7BA 3CUQB 4I6UA 3VPRA 1ZZBA 1H89C 2HKXA 4QPOA 3L2WA 2FEZA 2XAQA 3EUSA 3WODF 3T5XA 3J7YJ 1TW3A 3AG2H 4CCOA 3RQ4A 5BOXA 3HOVJ 2R7XA 3H92A 3W3CA 2VIXA 1O3TA 3TW7A 4OOIA 4YBAA 2NOGA 2VOPA 5DD8A 3QRFF 1ZZCA 3H5RA 3RYPA 1BN5A 1WH5A 4Q47A 3FXMA 1ZYRF 1FSEA 3HB9A 3JSPA 4F3QA 4HNTA 5M5XJ 2RN7A 4PCQA 3FZVA 2P8TA 3U9GA 2L5QA 1DULA 3BQZA 3AG1H 2DA5A 2FMLA 2X6XA 4BQQA 4X4DA 1G3TA 2FXAA 5LBQA 4HX8A 1UHSA 3FXRA 4FN3A 1B8IA 2DA3A 1I27A 2K9LA 2XSDC 3FHNA 5B1AH 4A3CJ 2GQQA 2LF7A 2LVSA 4XLFA 1IAWA 1DU0A 3ZGKA 1T98A 1FP1D 4KN7X 1Y9QA 3WE3A 2F5EA 3DLLF 2ZXHA 3DBLB 3JRHA 1R1VA 1WSUA 3KYDB 1BI0A 3HPHA 3O8GA 3HOXJ 3KZIC 2HSGA 5JHFA 3DXJF 1U5TB 3E5UA 2IBDA 3G73A 1QBJA 3SZPA 2P6SA 3GLLA 4MNUA 3HXLA 3RKYA 3M4OJ 4AU7A 2IAIA 3H9JA 5CQEA 2DPDA 2M2EA 1WFXA 2WAEA 5BPIA 1HCRA 2GXBA 1UXDA 2ETHA 2IS1A 4XLEA 4MEYF 1IDYA 4V2GA 3HSRA 5CVJA 2PUCA 5L3FA 2IPQX 5ERIA 5CJ9A 4GQMA 3HPGA 3L09A 3P7NA 3L9FA 5E8GA 5FGMA 3SDBA 1FYKA 1W5TA 2YU9J 3NRVA 3HDDA 5H20A 2HFHA 3OYEA 2BBYA 1IW7F 2LR8A 1R71A 2HZDA 4ZYAA 4M3GA 2KMUA 3WTZA 5L3GA 1OJLA 2O0YA 1GT0C 1A36A 1P4AA 2ZFWA 3WE2A 3VYTB 3F22A 3GZ5A 2DTRA 2QCOA 2FNAA 1OCPA 3WGHA 4YG4A 2DJIA 2TDXA 3SX0A 1X1CA 2RQQA 2XPWA 4MCXA 3ZN1A 2IRFG 1ETVA 3HYIA 2XB5A 4LK1F 4UXNA 5LHGA 1ON1A 3KZ3A 1VQKI 4LIUA 1WZ2A 1POUA 3E7LA 3W2AA 4BJ6C 2LYJA 4D5FA 3IUOA 2PXTA 2E7XA 1S29A 1IUFA 2PLYA 1XGMA 2WV1A 3BQYA 4P96A 2WBMA 3KETA 4EJUA 2XHKA 2B9SA 1GHCA 4XSXF 4KT5C 5IOYA 5LGTA 2DN0A 5IYBJ 3H36A 1ODDA 2BGCA 1XDUA 3C18A 2R5ZA 2BEOA 2F48A 2QKLB 2DLLA 1U9NA 1JUPA 2CV2A 1U8BA 5E1XA 4UUTA 1MZBA 1R1UA 3ZHIA 4PK4A 5IY5H 2ICTA 4XN0A 3QF3A 4CXFA 2DODA 2P0WA 1NK3P 2K3FA 3LSRA 1T0FA 3A02A 1S3JA 2EWNA 1DUXC 1LFBA 2CSOA 3V7SA 2OF7A 2M0CA 5HS7A 4KMFA 3MAJA 2C6YA 1ETXA 1BBYA 1IG7A 2VXDA 3H9QA 3I9V2 3DFGA 5FJ8J 3ONQA 5CQGA 4C3HJ 4IJAA 1DW9A 4UUSA 2Y0SA 1R49A 4CCJA 1HOMA 1MJ9A 2DA7A 3RPQA 4CYCB 3ABLH 1UFMA 4QWQA 3E6DA 5F04A 2W24A 3CCLI 3K1NA 1JKPC 1HDPA 1GDTA 1VQ6I 2KRHA 3BG5A 3P9IA 2XGXA 4NQWB 2CRGA 4E7IA 4OU0A 3CC4I 4IZZA 3HOUJ 1A5JA 4A0YA 4EVIA 4IQJA 1PJRA 5DSXA 4Y3OA 1TQPA 1QGPA 2GXAA 2GZUA 2UZKA 1Z6TA 2B5AA 2K4JA 2JA7J 3E6MA 1XD7A 1U8RA 2QZ8A 4XRSG 2VEOA 3C2HA 5EYRA 5IT9Z 3GXOA 1WH6A 4L9NA 2DMTA 2E1CA 3BZCA 2L1PA 4AIHA 1P6RA 2DDAA 4PGGA 2R5YB 3FX3A 1QZEA 4GRIA 2DW4A 5JHUA 2XV4S 4BE2A 3T8RA 2MABA 3DP7A 3E0JB 1HLVA 3GFLA 2DK8A 3BG9A 3VYRB 4QTRA 2HU9A 2P5LC 3JTHA 1DP3A 3FMSA 4ER3A 3F8MA 2IGKA 3SHFA 2FSWA 4BBSJ 1JKOC 3FK7A 3IC7A 2L8NA 4ZYDA 3FYAA 2ZMEB 2LY1A 2EPFA 2FF4A 1T95A 1JUMA 2ZNZA 2ECCA 3AL0B 2AXZA 3ZMSA 4XOTA 5DCMA 3H0GJ 5LFAA 3ISPA 1BOBA 2O61A 3ZPXA 3DPUA 2BY3A 2A3SA 2XI8A 3V7RA 2QSFX 2FOWA 4P9FA 3ECHA 3HZIB 2JUCA 3ZQGA 1DQUA 1UCRA 3HZJA 5DV5A 3GZDA 4RLQA 3COAC 2AW6A 4ENJA 2YUSA 3K70D 3QWLA 1IGNA 3DKYA 4OIRF 2VE9A 4L18B 4OMZA 4X4CA 3OIPA 2FRHA 4MCTA 1U6GA 2Y9ZA 2EH3A 5D8KB 2DBBA 4LD5A 3LQRA 3FMQA 1WHUA 3WTTC 2DOFA 2VQLA 3CECA 3WGIA 3RI4A 4GCVA 2AWIA 1YYVA 1YOVB 2Y0SN 3LA7A 1DP7P 2NVQJ 2EBYA 2GIZA 3K10A 1KYWA 2MXDA 2R93J 4YFXF 1RNLA 1PUFA 3Q0VA 1ULYA 4A0ZA 4BQOA 1XSDA 1YTYA 4A6DA 1BI3A 1PRVA 1NK2P 4M6XA 3W6JB 3L2RA 3G3ZA 2KDZA 4GGGA 2NS7A 3TP0A 2ZC2A 1ZVVA 2IA2A 1E3OC 1K4TA 2CUZA 2OAZA 1VQMI 4DE8A 2DOAA 4MQVA 3S3NA 1JJ6C 1SVMA 4N9HA 4RB1A 3QU3A 1J59A 3BT9A 3DU6A 1QPIA 4KMUX 2ME0A 2CU7A 3PNYA 1OQYA 5B66C 1RR7A 2BV6A 1RUOA 3LSIA 5D4RA 1FOWA 1PUEE 4HX7A 1IV8A 1QP7A 1WRJA 3C7JA 4XLHA 1FMWA 2L9NA 3ZXSA 4UHTA 1T39A 1P4XA 2JWTA 3X2QH 4NC7A 4AVZA 4MQ9F 3DTKA 4L5JA 2CV0A 1A04A 3M9LA 4Z6YA 1EKEA 2LYCA 2A6CA 2DT7B 5DDGA 1K6YA 1WJDA 3FM3A 4JP0A 3SFZA 1CF7B 4RGXA 4CUGA 1DDNA 3GN5A 4AUXA 3DLAA 4XKVA 5J1RA 4A3FJ 3L2VA 1YSEA 1WH7A 2J7UA 5B3SH 3ZHMA 1ZN2A 2OBPA 1I5ZA 1GVDA
chains in the Genus database with same CATH topology
5EG0B 1X2MA 2LY9A 5E3NA 2GRMA 5GPAA 2K9NA 4AYBN 1MH4A 1K61A 3I4MJ 4X4IA 3FISA 3BR5A 4CYCA 5C44J 1ZQ3P 1FTZA 1PERL 5IP7J 2DMPA 2KPJA 3PO2J 2EQRA 4W97A 2MQKA 1B0NA 2ID3A 4PU8A 2JMWA 1YRNB 4FE4A 1UXCA 4BKXA 2NVYJ 3PXPA 3OSGA 4Z5DA 1WPKA 2IVBA 3BD1A 2W48A 2GBYA 3BTLA 3Q0UA 1MBKA 1F43A 3HEFA 3O9XA 4DYRA 3CMYA 4Z59A 5M3FJ 3HKZN 5IP6A 1DU6A 3TW6A 4IHXA 1B8IB 5FKMA 1ZUGA 1JFSA 1TWCJ 1LFUP 2E2HJ 3CQZJ 3JXDL 3GBGA 4JX6A 2DA2A 1ZKGA 3B6CA 4JCXA 2LTPA 2IUOA 2ECBA 1Z0XA 2WB1N 5DS9A 4I6RA 4YG1A 1RESA 1ADRA 2HDDA 1WIZA 2M34A 4BY1J 3SFIA 3HGGA 3QPLA 1JT0A 1TWGJ 1ZZ8A 2DMNA 2LFBA 1U78A 3S14J 1MSFC 2E1OA 2H8RA 1LE8B 2XCJA 1SANA 3LSJA 1K83J 2DMQA 3NAUA 4IHYA 1IC8A 2LCVA 2WAQN 5E3OA 2L0KA 2O8KA 2IV1A 1JUSA 4IEJA 5BNGA 2LYSA 1FJLA 1Q1VA 5FLVA 3LSPA 1H88C 2LYLA 4Z58A 2PPXA 2KEKA 1S7EA 2CUEA 4C3IJ 2VUMJ 2AXVA 4X4GA 3PO3J 4BBRJ 1B72B 4Y42A 3BTCA 4AC0A 3F6WA 2BJCA 4C3JJ 2CQQA 2E19A 2AUWA 1LMB3 4XIDA 2XPUA 4D5CA 4A3JJ 3GTKJ 2ID6A 1NTCA 1ZPQA 2MEZA 3ZOBA 2LK2A 3S2HJ 3GBFA 1BJZA 2AO9A 5J1YA 1B72A 4LOCA 2PUFA 1HDDC 1PRAA 1BW5A 2HXOA 3B7HA 1IRZA 2NS8A 2OR1L 1APLC 1UMQA 2K9SA 4M3DA 1TWHJ 3OSFA 1FEXA 4NDWA 3F52A 4C2MJ 1ORKA 3B6AA 3BR0A 1JKRC 4A3MJ 1JGGA 2YS9A 3S17J 3OQNA 3DEWA 4A69C 1O4XA 3KJXA 4A93J 1JWLA 3ZQHA 4PU7A 2M9HA 1ZGWA 4JYKA 1ZAYA 3JRBA 5IPAA 2LYPA 4DZPA 3QQ6A 2O4AA 1AHDP 1WGXA 5EGOB 5F0HA 1GV2A 3JREA 1ENHA 2PMZN 1QP4A 5J1UA 4JX5A 2I10A 4HNVA 2VKVA 3RZOJ 2FD5A 4IHVA 1X58A 2VI6A 3ZQCA 3I4NJ 4O8BA 3FYMA 5E3MA 4NDLA 5EGOA 1IJWC 2DJNA 2R5ZB 1BW6A 2BNNA 2PUEA 3TRBA 5EDNA 2DA1A 4GFBA 3GTOJ 1TC3C 3RQIA 1ETQA 4D7MA 2DTZA 1QP0A 1OFCX 3HGYA 2COBA 1ZR2A 3IH2A 2O9LA 1I6HJ 3JXBC 2EZIA 1RZRD 2K9QA 3GTGJ 3LNQA 3S15J 4PU3C 2EZKA 1RETA 1MBEA 2N8GA 5M3MJ 3F0CA 3SCHA 3PM1A 4X4FA 1AKHB 3G1MA 1GUUA 1POGA 3JR9A 4J1XA 4MIMA 1H8AC 1MH3A 2CJJA 2EZLA 3GTLJ 3BDNA 4I6UA 3VPRA 1ZZBA 1H89C 1ETKA 3IH4A 3EUSA 5EG0A 2PIJA 3FIWA 4RDUA 1JKQC 5F27A 3HOVJ 3TW7A 2MG4A 3OIOA 3UFDA 1ETYA 5IP9J 4YBAA 2HOAA 2L7FP 2NOGA 2GRLA 1ZZCA 3GTPJ 1WH5A 3Q0WA 3D1NI 1YRNA 5K7ZA 5FKKA 4RBOA 1LCCA 2HXIA 4EEFG 2CUFA 1ZZ7A 3HB9A 4FCYA 3LISA 2L7MP 2R63A 4A3GJ 5M5XJ 1T33A 2L49A 3OOUA 4S0HB 3KXAA 4XICA 4XRSA 3BQZA 1W0UA 1ITYA 2KZ8A 2DA5A 1ETWA 4X4DA 2E2JJ 3A03A 1UHSA 4FN3A 3FK6A 2LLKA 1AU7A 2DA3A 1B8IA 2E2IJ 1F36A 4X4EA 2XSDC 1LLIA 4A3CJ 2XIUA 2LVSA 4BY7J 5IYCJ 1DU0A 2NVXJ 2CSFA 4X4HA 5E3LA 3TEDA 3QWGA 4X4BA 1Y9QA 3OQOA 3K7AJ 2HYJA 3JRHA 4MLOA 2JA5J 3O8GA 4MO7A 1XWRA 3HOXJ 5EF6A 2HSGA 4XK4A 4Z5HA 2IBDA 3S16J 3MN2A 1I3QJ 2R0QC 3M4OJ 3RZZA 1LE8A 4DYCA 2IAIA 1RKTA 2EF8A 4DZJA 1GV5A 4Y7NJ 2M2EA 1P7IA 1Y7YA 1HCRA 1UXDA 1JFTA 4GHJA 3JRAA 4A3LJ 2WUSR 3DCFA 5FKLA 1MNMC 1X57A 3ZQFA 1IDYA 4V2GA 2P81A 3GTJJ 5C4XJ 5FKNA 1R63A 2PUCA 1MBJA 2OFYA 1U9OA 4GQMA 1JT6A 1ZS4A 2XB0X 1WETA 1XC5A 5DTDA 2FX0A 1RZRA 1ZTRA 4A3IJ 2YU9J 2JA8J 3HDDA 1ZK8A 2LR8A 4JCYA 4M3GA 4B4CA 3S1NJ 1OJLA 3QPSA 4I76A 1GT0C 2LP0A 2LD5A 1WCMJ 1Y1WJ 2HOTA 3SJMA 1MSEC 2CROA 1MBGA 2QCOA 1OCPA 1PUFB 4I6TA 4YG4A 2R1JL 1BDHA 1RPEL 3IH3A 4MFEA 3ZKCA 4V2FA 2XPWA 2XPVA 4MCXA 2GM4A 3CCYA 3TP3A 1RPWA 3F51A 5EZGA 1ETVA 2BNOA 2XB5A 3M3YJ 4FTHA 3KZ3A 2AXUA 4J19A 2IEKA 1NEQA 5M5YJ 1POUA 1UTXA 3E7LA 2LYJA 4D5FA 3G1OA 4A3KJ 4FISA 3LSGA 2Y31A 1G2HA 1IUFA 3Q3SA 4I6ZA 4IVZA 2WV1A 3BQYA 3A01B 1VPWA 4M3EA 4JQDA 3BR6A 3HBLA 5IOYA 2DN0A 5IYBJ 4DYQA 3L1PA 4BXXJ 3HM5A 1TWFJ 2H1KA 3FMYA 9ANTA 1UG2A 2RAEA 2R5ZA 4XRMA 2JA6J 1QQBA 1Z77A 2LYKA 1U9NA 1JUPA 1NERA 3OMTA 3S2DJ 3LOCA 2ELKA 1Y1VJ 3UKGA 2Y30A 1U8BA 3OQMA 4QSHA 1XS9A 4UUTA 1MBFA 3BG3A 5K7FA 2XRLA 3ZHIA 3JRDA 2CQXA 3GN5B 3BR3A 2ICTA 3R1FA 4L5EA 1DWKA 2DA6A 2MSYA 3QF3A 1FIAA 5J3LA 1W0TA 1NK3P 1XG1A 4UUSB 3LSRA 1BL0A 3A02A 4OB4A 1LFBA 1AKHA 3FKIJ 2OF7A 2M0CA 2LYRA 3K2AA 2KEIA 1ZR4A 2TCTA 1TWAJ 2EWTA 2EZHA 3H5TA 5EZHA 4Z5CA 5HODA 1ETXA 1IG7A 4A3EJ 5FJ8J 2Y2ZA 4C3HJ 2IVGA 4IWRA 1DW9A 4UUSA 1HOMA 3OP9A 2DA7A 2G0EA 4CYCB 2PUBA 4PU4C 1OSLA 2Y9YA 5C4JJ 5F04A 2VPRA 3VK0A 3S1RJ 2B63J 1JKPC 1HDPA 1JTXA 3WHBA 3JRGA 1GDTA 4D7NA 1A6IA 2KT0A 2KEJA 2LYQA 2TRTA 3BG5A 5IOZA 2CRGA 1OCTC 1RZSA 1IV6A 3DNVB 3HOUJ 5F0CA 1A5JA 2HI3A 2R7ZJ 1L1MA 4QIWN 1EF4A 4B1RA 3MLFA 4IA8A 4FBIA 2GZUA 4YARA 3BR1A 1JTYA 2B5AA 2JA7J 2L7ZA 1LCDA 1VF9A 1HF0A 2JJ7A 4A3DJ 2JK3A 4XRSG 2PUAA 5EYRA 5F1JA 1WH6A 3JRCA 4Y52J 3LFPA 2DMTA 2BNMA 1BDIA 3ZQLA 4FE7A 2QF7A 2R5YB 2JN6A 2XGCA 2O49A 3U3WA 1HLVA 3BG9A 3QYXA 3O8HA 4QTRA 3CLCA 3G1LA 4IHWA 1MBHA 2R5YA 1PNRA 4BBSJ 1JKOC 2OPTA 2PUDA 3FK7A 2L8NA 3FYAA 2JVLA 3SCGA 1P7JA 2FJ1A 1X2LA 1JUMA 2ECCA 2FJRA 2AXZA 1VI0A 3JRFA 1FIPA 3H0GJ 2PUGA 3CDLA 4M6VA 1CQTA 3SCFA 2XI8A 2JCGA 1ETOA 3RZDJ 2ICPA 3SDGA 3GTQJ 3HZIB 3MKLA 2XGEA 3H3VK 2L9RA 2VKEA 4JX4A 3ZQGA 2EBIA 5F0FA 5C3EJ 3GTMJ 2AW6A 2YUSA 1VFCA 4X6AJ 1IGNA 1JJ8C 2M8GX 5FKOA 2D5VA 4X4CA 4MCTA 4MFDA 5EEAA 1D5YA 2Y9ZA 2EH3A 2HQ5A 2X9DA 3S1QJ 2PE5A 3HOZJ 2O7OA 2MW8A 1WI3A 3CECA 5JLXA 4ABZA 1FTTA 2AWIA 5K7HA 2Y0SN 3QQAA 3BS3A 2NVQJ 2EBYA 1X2NA 3NARA 5FLMJ 1QRYA 1R9TJ 2K40A 2XJ3A 2ME6A 2ZB9A 2R93J 1SQ8A 1JH9A 2HOSA 1PUFA 4M3BA 2X48A 3MVPA 3Q0VA 3G7DA 1QPZA 1LQCA 1PRVA 3HOWJ 2WIUB 5GP9A 1NK2P 3G5GA 2LKXA 2XGDA 4DW6A 2KDZA 3RKQA 1RKWA 3HOYJ 1QVTA 2IU7A 2NS7A 3TP0A 1ZVVA 1ZZ6A 2R92J 1T56A 1E3OC 5IYDJ 2DMUA 1WH8A 3ZQIA 3CROL 4J1WA 3A01A 1JJ6C 2MGQA 2FQ4A 1R69A 5F08A 4YG7B 3BTIA 3BT9A 1SFOJ 1QPIA 2ME0A 2CU7A 3JXCL 2IVQA 1RIOA 2GLOA 1VNDA 1RR7A 4X1EA 4I8TA 2HINA 3JRIA 3S8QA 2O38A 4G12A 5M5WJ 4F8DA 3IV5A 5GPCA 1I50J 1QP7A 1QQAA 3C2BA 1BA5A 3W6VA 3IVPA 2JWTA 5JLWA 2NVTJ 1PRUA 2AHQA 3BR2A 2A6CA 5K98B 1QVUA 4B3AA 4JP0A 3BTJA 3GN5A 5A7LA 1ZZ9A 1CJGA 4AUXA 2X6OA 3S1MJ 5J1RA 4A3BJ 3WHCA 4A3FJ 1IDZA 4M3FA 1YSEA 1WH7A 4W1UA 1EFAA 3ZHMA 1GVDA 2DA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EG0 B;  1X2M A;  2LY9 A;  5E3N A;  2GRM A;  5GPA A;  2K9N A;  4AYB N;  1MH4 A;  1K61 A;  3I4M J;  4X4I A;  3FIS A;  3BR5 A;  4CYC A;  5C44 J;  1ZQ3 P;  1FTZ A;  1PER L;  5IP7 J;  2DMP A;  2KPJ A;  3PO2 J;  2EQR A;  4W97 A;  2MQK A;  1B0N A;  2ID3 A;  4PU8 A;  2JMW A;  1YRN B;  4FE4 A;  1UXC A;  4BKX A;  2NVY J;  3PXP A;  3OSG A;  4Z5D A;  1WPK A;  2IVB A;  3BD1 A;  2W48 A;  2GBY A;  3BTL A;  3Q0U A;  1MBK A;  1F43 A;  3HEF A;  3O9X A;  4DYR A;  3CMY A;  4Z59 A;  5M3F J;  3HKZ N;  5IP6 A;  1DU6 A;  3TW6 A;  4IHX A;  1B8I B;  5FKM A;  1ZUG A;  1JFS A;  1TWC J;  1LFU P;  2E2H J;  3CQZ J;  3JXD L;  3GBG A;  4JX6 A;  2DA2 A;  1ZKG A;  3B6C A;  4JCX A;  2LTP A;  2IUO A;  2ECB A;  1Z0X A;  2WB1 N;  5DS9 A;  4I6R A;  4YG1 A;  1RES A;  1ADR A;  2HDD A;  1WIZ A;  2M34 A;  4BY1 J;  3SFI A;  3HGG A;  3QPL A;  1JT0 A;  1TWG J;  1ZZ8 A;  2DMN A;  2LFB A;  1U78 A;  3S14 J;  1MSF C;  2E1O A;  2H8R A;  1LE8 B;  2XCJ A;  1SAN A;  3LSJ A;  1K83 J;  2DMQ A;  3NAU A;  4IHY A;  1IC8 A;  2LCV A;  2WAQ N;  5E3O A;  2L0K A;  2O8K A;  2IV1 A;  1JUS A;  4IEJ A;  5BNG A;  2LYS A;  1FJL A;  1Q1V A;  5FLV A;  3LSP A;  1H88 C;  2LYL A;  4Z58 A;  2PPX A;  2KEK A;  1S7E A;  2CUE A;  4C3I J;  2VUM J;  2AXV A;  4X4G A;  3PO3 J;  4BBR J;  1B72 B;  4Y42 A;  3BTC A;  4AC0 A;  3F6W A;  2BJC A;  4C3J J;  2CQQ A;  2E19 A;  2AUW A;  1LMB 3;  4XID A;  2XPU A;  4D5C A;  4A3J J;  3GTK J;  2ID6 A;  1NTC A;  1ZPQ A;  2MEZ A;  3ZOB A;  2LK2 A;  3S2H J;  3GBF A;  1BJZ A;  2AO9 A;  5J1Y A;  1B72 A;  4LOC A;  2PUF A;  1HDD C;  1PRA A;  1BW5 A;  2HXO A;  3B7H A;  1IRZ A;  2NS8 A;  2OR1 L;  1APL C;  1UMQ A;  2K9S A;  4M3D A;  1TWH J;  3OSF A;  1FEX A;  4NDW A;  3F52 A;  4C2M J;  1ORK A;  3B6A A;  3BR0 A;  1JKR C;  4A3M J;  1JGG A;  2YS9 A;  3S17 J;  3OQN A;  3DEW A;  4A69 C;  1O4X A;  3KJX A;  4A93 J;  1JWL A;  3ZQH A;  4PU7 A;  2M9H A;  1ZGW A;  4JYK A;  1ZAY A;  3JRB A;  5IPA A;  2LYP A;  4DZP A;  3QQ6 A;  2O4A A;  1AHD P;  1WGX A;  5EGO B;  5F0H A;  1GV2 A;  3JRE A;  1ENH A;  2PMZ N;  1QP4 A;  5J1U A;  4JX5 A;  2I10 A;  4HNV A;  2VKV A;  3RZO J;  2FD5 A;  4IHV A;  1X58 A;  2VI6 A;  3ZQC A;  3I4N J;  4O8B A;  3FYM A;  5E3M A;  4NDL A;  5EGO A;  1IJW C;  2DJN A;  2R5Z B;  1BW6 A;  2BNN A;  2PUE A;  3TRB A;  5EDN A;  2DA1 A;  4GFB A;  3GTO J;  1TC3 C;  3RQI A;  1ETQ A;  4D7M A;  2DTZ A;  1QP0 A;  1OFC X;  3HGY A;  2COB A;  1ZR2 A;  3IH2 A;  2O9L A;  1I6H J;  3JXB C;  2EZI A;  1RZR D;  2K9Q A;  3GTG J;  3LNQ A;  3S15 J;  4PU3 C;  2EZK A;  1RET A;  1MBE A;  2N8G A;  5M3M J;  3F0C A;  3SCH A;  3PM1 A;  4X4F A;  1AKH B;  3G1M A;  1GUU A;  1POG A;  3JR9 A;  4J1X A;  4MIM A;  1H8A C;  1MH3 A;  2CJJ A;  2EZL A;  3GTL J;  3BDN A;  4I6U A;  3VPR A;  1ZZB A;  1H89 C;  1ETK A;  3IH4 A;  3EUS A;  5EG0 A;  2PIJ A;  3FIW A;  4RDU A;  1JKQ C;  5F27 A;  3HOV J;  3TW7 A;  2MG4 A;  3OIO A;  3UFD A;  1ETY A;  5IP9 J;  4YBA A;  2HOA A;  2L7F P;  2NOG A;  2GRL A;  1ZZC A;  3GTP J;  1WH5 A;  3Q0W A;  3D1N I;  1YRN A;  5K7Z A;  5FKK A;  4RBO A;  1LCC A;  2HXI A;  4EEF G;  2CUF A;  1ZZ7 A;  3HB9 A;  4FCY A;  3LIS A;  2L7M P;  2R63 A;  4A3G J;  5M5X J;  1T33 A;  2L49 A;  3OOU A;  4S0H B;  3KXA A;  4XIC A;  4XRS A;  3BQZ A;  1W0U A;  1ITY A;  2KZ8 A;  2DA5 A;  1ETW A;  4X4D A;  2E2J J;  3A03 A;  1UHS A;  4FN3 A;  3FK6 A;  2LLK A;  1AU7 A;  2DA3 A;  1B8I A;  2E2I J;  1F36 A;  4X4E A;  2XSD C;  1LLI A;  4A3C J;  2XIU A;  2LVS A;  4BY7 J;  5IYC J;  1DU0 A;  2NVX J;  2CSF A;  4X4H A;  5E3L A;  3TED A;  3QWG A;  4X4B A;  1Y9Q A;  3OQO A;  3K7A J;  2HYJ A;  3JRH A;  4MLO A;  2JA5 J;  3O8G A;  4MO7 A;  1XWR A;  3HOX J;  5EF6 A;  2HSG A;  4XK4 A;  4Z5H A;  2IBD A;  3S16 J;  3MN2 A;  1I3Q J;  2R0Q C;  3M4O J;  3RZZ A;  1LE8 A;  4DYC A;  2IAI A;  1RKT A;  2EF8 A;  4DZJ A;  1GV5 A;  4Y7N J;  2M2E A;  1P7I A;  1Y7Y A;  1HCR A;  1UXD A;  1JFT A;  4GHJ A;  3JRA A;  4A3L J;  2WUS R;  3DCF A;  5FKL A;  1MNM C;  1X57 A;  3ZQF A;  1IDY A;  4V2G A;  2P81 A;  3GTJ J;  5C4X J;  5FKN A;  1R63 A;  2PUC A;  1MBJ A;  2OFY A;  1U9O A;  4GQM A;  1JT6 A;  1ZS4 A;  2XB0 X;  1WET A;  1XC5 A;  5DTD A;  2FX0 A;  1RZR A;  1ZTR A;  4A3I J;  2YU9 J;  2JA8 J;  3HDD A;  1ZK8 A;  2LR8 A;  4JCY A;  4M3G A;  4B4C A;  3S1N J;  1OJL A;  3QPS A;  4I76 A;  1GT0 C;  2LP0 A;  2LD5 A;  1WCM J;  1Y1W J;  2HOT A;  3SJM A;  1MSE C;  2CRO A;  1MBG A;  2QCO A;  1OCP A;  1PUF B;  4I6T A;  4YG4 A;  2R1J L;  1BDH A;  1RPE L;  3IH3 A;  4MFE A;  3ZKC A;  4V2F A;  2XPW A;  2XPV A;  4MCX A;  2GM4 A;  3CCY A;  3TP3 A;  1RPW A;  3F51 A;  5EZG A;  1ETV A;  2BNO A;  2XB5 A;  3M3Y J;  4FTH A;  3KZ3 A;  2AXU A;  4J19 A;  2IEK A;  1NEQ A;  5M5Y J;  1POU A;  1UTX A;  3E7L A;  2LYJ A;  4D5F A;  3G1O A;  4A3K J;  4FIS A;  3LSG A;  2Y31 A;  1G2H A;  1IUF A;  3Q3S A;  4I6Z A;  4IVZ A;  2WV1 A;  3BQY A;  3A01 B;  1VPW A;  4M3E A;  4JQD A;  3BR6 A;  3HBL A;  5IOY A;  2DN0 A;  5IYB J;  4DYQ A;  3L1P A;  4BXX J;  3HM5 A;  1TWF J;  2H1K A;  3FMY A;  9ANT A;  1UG2 A;  2RAE A;  2R5Z A;  4XRM A;  2JA6 J;  1QQB A;  1Z77 A;  2LYK A;  1U9N A;  1JUP A;  1NER A;  3OMT A;  3S2D J;  3LOC A;  2ELK A;  1Y1V J;  3UKG A;  2Y30 A;  1U8B A;  3OQM A;  4QSH A;  1XS9 A;  4UUT A;  1MBF A;  3BG3 A;  5K7F A;  2XRL A;  3ZHI A;  3JRD A;  2CQX A;  3GN5 B;  3BR3 A;  2ICT A;  3R1F A;  4L5E A;  1DWK A;  2DA6 A;  2MSY A;  3QF3 A;  1FIA A;  5J3L A;  1W0T A;  1NK3 P;  1XG1 A;  4UUS B;  3LSR A;  1BL0 A;  3A02 A;  4OB4 A;  1LFB A;  1AKH A;  3FKI J;  2OF7 A;  2M0C A;  2LYR A;  3K2A A;  2KEI A;  1ZR4 A;  2TCT A;  1TWA J;  2EWT A;  2EZH A;  3H5T A;  5EZH A;  4Z5C A;  5HOD A;  1ETX A;  1IG7 A;  4A3E J;  5FJ8 J;  2Y2Z A;  4C3H J;  2IVG A;  4IWR A;  1DW9 A;  4UUS A;  1HOM A;  3OP9 A;  2DA7 A;  2G0E A;  4CYC B;  2PUB A;  4PU4 C;  1OSL A;  2Y9Y A;  5C4J J;  5F04 A;  2VPR A;  3VK0 A;  3S1R J;  2B63 J;  1JKP C;  1HDP A;  1JTX A;  3WHB A;  3JRG A;  1GDT A;  4D7N A;  1A6I A;  2KT0 A;  2KEJ A;  2LYQ A;  2TRT A;  3BG5 A;  5IOZ A;  2CRG A;  1OCT C;  1RZS A;  1IV6 A;  3DNV B;  3HOU J;  5F0C A;  1A5J A;  2HI3 A;  2R7Z J;  1L1M A;  4QIW N;  1EF4 A;  4B1R A;  3MLF A;  4IA8 A;  4FBI A;  2GZU A;  4YAR A;  3BR1 A;  1JTY A;  2B5A A;  2JA7 J;  2L7Z A;  1LCD A;  1VF9 A;  1HF0 A;  2JJ7 A;  4A3D J;  2JK3 A;  4XRS G;  2PUA A;  5EYR A;  5F1J A;  1WH6 A;  3JRC A;  4Y52 J;  3LFP A;  2DMT A;  2BNM A;  1BDI A;  3ZQL A;  4FE7 A;  2QF7 A;  2R5Y B;  2JN6 A;  2XGC A;  2O49 A;  3U3W A;  1HLV A;  3BG9 A;  3QYX A;  3O8H A;  4QTR A;  3CLC A;  3G1L A;  4IHW A;  1MBH A;  2R5Y A;  1PNR A;  4BBS J;  1JKO C;  2OPT A;  2PUD A;  3FK7 A;  2L8N A;  3FYA A;  2JVL A;  3SCG A;  1P7J A;  2FJ1 A;  1X2L A;  1JUM A;  2ECC A;  2FJR A;  2AXZ A;  1VI0 A;  3JRF A;  1FIP A;  3H0G J;  2PUG A;  3CDL A;  4M6V A;  1CQT A;  3SCF A;  2XI8 A;  2JCG A;  1ETO A;  3RZD J;  2ICP A;  3SDG A;  3GTQ J;  3HZI B;  3MKL A;  2XGE A;  3H3V K;  2L9R A;  2VKE A;  4JX4 A;  3ZQG A;  2EBI A;  5F0F A;  5C3E J;  3GTM J;  2AW6 A;  2YUS A;  1VFC A;  4X6A J;  1IGN A;  1JJ8 C;  2M8G X;  5FKO A;  2D5V A;  4X4C A;  4MCT A;  4MFD A;  5EEA A;  1D5Y A;  2Y9Z A;  2EH3 A;  2HQ5 A;  2X9D A;  3S1Q J;  2PE5 A;  3HOZ J;  2O7O A;  2MW8 A;  1WI3 A;  3CEC A;  5JLX A;  4ABZ A;  1FTT A;  2AWI A;  5K7H A;  2Y0S N;  3QQA A;  3BS3 A;  2NVQ J;  2EBY A;  1X2N A;  3NAR A;  5FLM J;  1QRY A;  1R9T J;  2K40 A;  2XJ3 A;  2ME6 A;  2ZB9 A;  2R93 J;  1SQ8 A;  1JH9 A;  2HOS A;  1PUF A;  4M3B A;  2X48 A;  3MVP A;  3Q0V A;  3G7D A;  1QPZ A;  1LQC A;  1PRV A;  3HOW J;  2WIU B;  5GP9 A;  1NK2 P;  3G5G A;  2LKX A;  2XGD A;  4DW6 A;  2KDZ A;  3RKQ A;  1RKW A;  3HOY J;  1QVT A;  2IU7 A;  2NS7 A;  3TP0 A;  1ZVV A;  1ZZ6 A;  2R92 J;  1T56 A;  1E3O C;  5IYD J;  2DMU A;  1WH8 A;  3ZQI A;  3CRO L;  4J1W A;  3A01 A;  1JJ6 C;  2MGQ A;  2FQ4 A;  1R69 A;  5F08 A;  4YG7 B;  3BTI A;  3BT9 A;  1SFO J;  1QPI A;  2ME0 A;  2CU7 A;  3JXC L;  2IVQ A;  1RIO A;  2GLO A;  1VND A;  1RR7 A;  4X1E A;  4I8T A;  2HIN A;  3JRI A;  3S8Q A;  2O38 A;  4G12 A;  5M5W J;  4F8D A;  3IV5 A;  5GPC A;  1I50 J;  1QP7 A;  1QQA A;  3C2B A;  1BA5 A;  3W6V A;  3IVP A;  2JWT A;  5JLW A;  2NVT J;  1PRU A;  2AHQ A;  3BR2 A;  2A6C A;  5K98 B;  1QVU A;  4B3A A;  4JP0 A;  3BTJ A;  3GN5 A;  5A7L A;  1ZZ9 A;  1CJG A;  4AUX A;  2X6O A;  3S1M J;  5J1R A;  4A3B J;  3WHC A;  4A3F J;  1IDZ A;  4M3F A;  1YSE A;  1WH7 A;  4W1U A;  1EFA A;  3ZHM A;  1GVD A;  2DA4 A; 
#chains in the Genus database with same CATH topology
 4IO9 F;  3C3W A;  5E3N A;  2JQ7 A;  5GPA A;  2PG4 A;  1MH4 A;  2DFE A;  4XKC A;  1O7F A;  4YG2 F;  3OYI A;  1K7A A;  4CA0 A;  3UNG C;  3VEP A;  1ZQ3 P;  1PER L;  4Q4Z F;  2EIJ H;  4PJ0 C;  3QOP A;  1B0N A;  4PU8 A;  2CW7 A;  1S72 I;  1E0E A;  5GTH C;  3L2C A;  3LSM A;  2HDW A;  3OYL A;  2IVB A;  3BD1 A;  4Z5D A;  2E60 A;  2CW0 F;  2X4H A;  3O9X A;  3F8B A;  4Z59 A;  3KLN A;  4F92 B;  4IF4 A;  1T2K A;  3HKZ N;  4YEJ A;  3ZMU A;  4HF0 A;  4EZI A;  1SAU A;  5E1W A;  2LKS A;  1YQA A;  4LB6 B;  5FKM A;  1JFS A;  3JXD L;  4A12 A;  3BJ6 A;  1X4P A;  2Q2E B;  4BJ5 C;  2DA2 A;  1ZKG A;  3FXO A;  1HA8 A;  3H1C A;  2IGM A;  2IUO A;  1SMY F;  1RUN A;  3MZY A;  3U1K A;  4CO8 A;  3H3U A;  4XMY A;  1HC8 A;  2WB1 N;  3IP4 B;  3ESW B;  4YG1 A;  2Y48 A;  3ABT A;  1P92 A;  1ADR A;  4HBL A;  1WIZ A;  2M34 A;  4BY1 J;  2PBI A;  2Z5U A;  3HGG A;  3QPL A;  2V1X A;  1EH8 A;  4O5V A;  3DF8 A;  2HVR A;  2J5O A;  2VOD A;  1R5I D;  5LHI A;  1U78 A;  4PFP A;  2IGN A;  3S14 J;  3TEP A;  2M87 A;  1LE8 B;  3BG7 A;  4BXU A;  3IHU A;  3OYF A;  2DMQ A;  3EYI A;  4IHY A;  4I99 C;  1LJ9 A;  2L0K A;  4I0A A;  4IEJ A;  1RC9 A;  2KPM A;  4LLN A;  4ZZD A;  4XON A;  2Z33 A;  4C3I J;  3S3M A;  2KFD A;  3ERM A;  2E19 A;  4NHJ A;  2AUW A;  2XPU A;  3DWL E;  3GTK J;  1Z1D A;  2ID6 A;  1NTC A;  3ZOB A;  1GVJ A;  2VBX A;  3S2H J;  2ZBK A;  2AO9 A;  2PXU A;  1B72 A;  3KEY A;  4ZDO A;  3ECO A;  1ZAR A;  2K02 A;  4RGU A;  2HXO A;  3K69 A;  4B8X A;  5FLX Z;  1V5F A;  4ESJ A;  4BE0 A;  2OR1 L;  5CPR B;  2VJJ A;  3OSF A;  3OYC A;  2W85 A;  4R1H A;  3HG9 A;  1D8J A;  3ZPL A;  3H5N A;  3ERE D;  3DEW A;  2G7U A;  4G94 A;  4A69 C;  5LLQ A;  1JWL A;  1A35 A;  4JYK A;  4UV9 A;  2JVH A;  5GTI C;  2LYP A;  3QQ6 A;  1TT0 A;  5HNH A;  2LF8 A;  5F0H A;  5EGO B;  1GV2 A;  3EUH A;  2R7V A;  3BWG A;  2HOE A;  5J1U A;  4CGZ A;  4JX5 A;  1R4N B;  5CLS A;  4HNV A;  4ZJZ A;  3VSK A;  1Y0U A;  1X58 A;  2VI6 A;  2WAQ A;  3K2Z A;  1XPX A;  4BNC A;  3FYM A;  5E3M A;  1IJW C;  2ZO4 A;  1ZLK A;  2VL8 A;  4N4N B;  1W1W E;  4FAS D;  5D5W B;  2QSG X;  2R7F A;  4KT6 A;  4DE9 A;  2M4H A;  3RQI A;  1ETQ A;  1SVO A;  2DTZ A;  5DRY A;  1I6H J;  1EV7 A;  3K4N A;  3AG3 H;  3FXL A;  3HSE A;  4IKF A;  3GTG J;  1X1D A;  1J5Y A;  2G7H A;  2B7E A;  3PUF A;  3S15 J;  2EZK A;  2CQ7 A;  2L3D A;  3TO6 A;  3W2W A;  5DTM A;  2MFZ A;  3GX4 X;  3SCH A;  1VQL I;  1AKH B;  2M5W A;  4V19 K;  4HV6 A;  3JR9 A;  4ENN A;  4X0G A;  1D5V A;  1MDM A;  5FFZ A;  1H8A C;  3RIR A;  5TGT A;  3BDN A;  4H4K C;  1D1B A;  2HQN A;  2LMD A;  5DUK A;  1BI1 A;  4LLG F;  3NWT A;  3RKX A;  3IH4 A;  3CDI A;  2PIJ A;  1MMS A;  3PQK A;  3AAF A;  1QQI A;  3TMO A;  5GAG J;  2CQK A;  2PMZ A;  3LMM A;  2Z3Y A;  3KEQ A;  5DUI A;  3U2R A;  3GTP J;  2PXB A;  2F6C A;  3CJR B;  1YRN A;  1Y56 A;  1YW9 A;  3GCM A;  1LNW A;  1Z67 A;  4AWX B;  4EEF G;  2RNG A;  4IOA F;  2MBF A;  1ONV A;  5KCM A;  2LSO A;  4B09 A;  4FCY A;  2R63 A;  4EKG A;  4S0H B;  3KXA A;  2K3P A;  1UZC A;  3CD6 I;  2QBY A;  3I5U A;  4XRS A;  4BDZ A;  3CCU I;  2M7A A;  5AON A;  2KZ8 A;  1ETW A;  3AG4 H;  3EQL F;  1DGW Y;  1V4R A;  3A03 A;  2A6E F;  3FK6 A;  1R58 A;  1LUJ B;  4HV5 A;  5FFX A;  2BW3 B;  2A61 A;  4E6K G;  2R7T A;  3WU1 B;  3TO9 A;  4XOR A;  4ITV A;  2XIU A;  5IYC J;  4BQN A;  2VBW A;  1PP7 U;  4AD9 A;  2CSF A;  3GF2 A;  4U0V A;  5JVT A;  4ENM A;  3TED A;  3QWG A;  4L0Z B;  3K4M A;  3K7A J;  2PXK A;  3KP6 A;  3M8E A;  2JA5 J;  3QP5 A;  5EF6 A;  3H5A A;  4XK4 A;  4XQF A;  4Z5H A;  5D6E A;  3I58 A;  1K78 B;  1R00 A;  1ZG3 A;  2VE8 A;  1XX5 A;  4GYI A;  3RZZ A;  1N25 A;  1S7A A;  1RKT A;  2K5C A;  3MQ0 A;  1X19 A;  2NNN A;  3NRO A;  3ZRG A;  3ZCO A;  4WK8 F;  1Y7Y A;  2Y69 H;  4A3L J;  2WUS R;  1W7P A;  5FKL A;  1MNM C;  4IX7 A;  3ZQF A;  2EIK H;  1V54 H;  2PJP A;  2CYY A;  3KFW X;  1U9O A;  3OYK A;  3U21 A;  1WET A;  1XC5 A;  5DTD A;  5K5O A;  1IRF A;  3MFK A;  4A3I J;  4RAG A;  2LRD A;  2K27 A;  3DPL C;  4LJZ F;  3AKZ A;  4JCY A;  2GA2 A;  3H3Z A;  1MMD A;  3FXJ A;  2LP0 A;  2KLO A;  2LLV A;  2M3A A;  3AFH A;  2DT6 A;  3L7W A;  4PFO A;  4EJV A;  2CRO A;  3CZ6 A;  2FU4 A;  5E8I A;  4I6T A;  1BDH A;  3HJE A;  1J09 A;  1IO2 A;  4MFE A;  2P6T A;  3ZKC A;  4BHB A;  3PUB A;  4ZYG A;  1XB4 A;  3I59 B;  3BY6 A;  3ELK A;  1RPW A;  5EZG A;  3M3Y J;  2VBZ A;  4FTH A;  4XNF A;  1D0X A;  3QYE A;  2AXU A;  5EEG A;  1S8N A;  2MC4 A;  3U1D A;  5M5Y J;  4EGY A;  5E79 C;  3G1O A;  4FIS A;  2BZT A;  2Y31 A;  3A0B C;  5JUW A;  3Q3S A;  4IVZ A;  4RAZ A;  3K4B A;  3KCC A;  4RM3 A;  1FBQ A;  3K6G A;  4HYE A;  1XGS A;  4M3E A;  3D5L A;  4XN3 A;  1LFP A;  3IL2 A;  3HBL A;  5B1B H;  1AA7 A;  3L1P A;  4KJZ A;  2XC7 A;  2F5V A;  2UUZ A;  3FMY A;  2WV0 A;  2F4M B;  2CW8 A;  4M9X A;  4XRM A;  1YIT I;  3O2P E;  1EJ9 A;  5LHH A;  1QQB A;  2KIQ A;  1VQ4 I;  5FB2 A;  3OMT A;  1XTA A;  4OIN F;  3UKG A;  4BJT A;  1JXS A;  1WWX A;  2P5K A;  2Y30 A;  2ZXW H;  4QSH A;  2DI3 A;  2HWV A;  3BG3 A;  1PDN C;  5BMZ A;  2CQX A;  3LA3 A;  2A05 A;  5AIP A;  3R1F A;  4A2U A;  5ILV A;  2BXZ A;  4HEA 2;  2MSY A;  1FIA A;  3CUO A;  3GWZ A;  1W0T A;  1VQ7 I;  4IOC F;  1B4A A;  2HPI A;  4PUS A;  3FMR A;  4M72 A;  5FRO A;  1KU9 A;  1MND A;  3HOT A;  2TCT A;  2ZFU A;  5ILS A;  2IS2 A;  2A6H F;  5EZH A;  2EWT A;  4Z5C A;  2K4B A;  4A3E J;  1FPQ A;  1A6Q A;  2H27 A;  2IVG A;  4Y15 A;  3J80 Z;  3L2Q A;  2HKO A;  3KP5 A;  2M0M A;  1E17 A;  4ZYE A;  4HLY A;  1OSL A;  2Y9Y A;  2BVM A;  3PE5 A;  3ZP5 A;  4CCN A;  2W1O A;  2EA2 A;  3S1R J;  2V79 A;  3JRG A;  5K5R A;  1A6I A;  2KT0 A;  2JPB A;  3C1D A;  4BEH B;  2KEJ A;  1RZS A;  3QOE A;  1IV6 A;  1TQI A;  2FFH A;  1WJB A;  1Z9C A;  3CMA I;  2A6T A;  4E7K A;  2IA1 A;  1R36 A;  3FXU A;  4QIW N;  4B1R A;  3F3X A;  4WCG A;  1PYV A;  3GEZ A;  1JTY A;  2ZJR F;  5D5U B;  1Y8Q B;  3E97 A;  3LSH A;  3CCS I;  3TDZ C;  4FQG A;  2MYS A;  1RR8 C;  3L00 A;  1VF9 A;  3GUD A;  1LCD A;  2JJ7 A;  2QQA A;  4A3D J;  2R7U A;  2JK3 A;  2BHZ A;  4NBQ A;  2RGV A;  1I39 A;  2A07 F;  2XVC A;  2GOX B;  3GW2 A;  5F1J A;  1LEA A;  4I98 B;  3JRC A;  1H9T A;  3MKZ A;  2R7R A;  3CCJ I;  3CES A;  1Z7U A;  1HXD A;  1CGP A;  1W5S A;  3CLQ A;  4CH7 A;  2OU2 A;  4YIR X;  1SVL A;  2QGU A;  4U87 A;  4ZYH A;  4WX9 A;  4EJO A;  1V5G A;  2R5Y A;  1OCO H;  2LKP A;  2PUD A;  3EDP A;  4JBA A;  3G0T A;  1Z6R A;  1P7J A;  2FJ1 A;  2VB6 A;  1X2L A;  5J8F A;  3PNV A;  2FJR A;  1JGS A;  1ZRD A;  2EK5 A;  2XAG A;  1R1T A;  1NHA A;  3TL4 X;  1QHH D;  4M6V A;  3QAH A;  4PJL A;  3RZD J;  1R6R A;  4NC6 A;  3RYR A;  2KHM A;  2LDU A;  4RLF A;  2BHY A;  2H6B A;  2CFO A;  2Y75 A;  2L01 A;  5KNL A;  2OZ6 A;  3IKT A;  3WG9 A;  1XMA A;  3HUG A;  2O6G E;  2QYO A;  4FT8 A;  2HS5 A;  1FYL A;  1BC7 C;  1VFC A;  4X6A J;  4I01 A;  4ASN A;  5LRR A;  5DT2 A;  2M8G X;  3FHZ A;  2IGO A;  5EEA A;  3CP2 A;  2PE5 A;  1V5E A;  1STZ A;  2HQ5 A;  1MJB A;  4GO1 A;  5HS9 A;  5GAD J;  5KVR A;  1OKR A;  2MW8 A;  2NS0 A;  1RRJ A;  1KGS A;  4LIV A;  4ABZ A;  2VJI A;  3JAM Z;  1F4K A;  5K7H A;  4G7H F;  1M1E B;  4KFC A;  1P4W A;  4BHC A;  1X2N A;  3NAR A;  2XJ3 A;  1WVR A;  2ME6 A;  1SQ8 A;  2HOS A;  2XXQ A;  4L0Y B;  3TO7 A;  4L5I A;  3KJX A;  3VOE A;  4CSW A;  3G7D A;  1QPZ A;  2IT0 A;  1LQC A;  3HOW J;  2WIU B;  1IF1 A;  4DBQ A;  3V42 A;  4WWC A;  4E7H A;  2RQP A;  3HRS A;  2XGD A;  4XKB A;  2KRF A;  3RKQ A;  1A31 A;  3IWZ A;  2OQR A;  1FBU A;  2DMU A;  1WH8 A;  2CG4 A;  4HQE A;  4B44 A;  5D5X B;  3WTW C;  1O3Q A;  4DBR A;  3A01 A;  2MGQ A;  1R69 A;  4YG7 B;  1SFO J;  1OMI A;  3DM5 A;  2IVQ A;  4G6Q A;  3IAM 2;  2GLO A;  3PSF A;  2ELJ A;  3SXY A;  2D45 A;  2YU3 A;  2O38 A;  3LFK A;  3WGG A;  5M5W J;  3IV5 A;  1TP4 A;  4C9Y A;  1IXR C;  4D0P A;  2A68 F;  4BAY A;  3W6V A;  3BG6 A;  2XUB A;  4IRI A;  2NVT J;  2HZT A;  2FQ3 A;  1WJ5 A;  2VT3 A;  3LQX A;  3NXH A;  1L0O C;  5K98 B;  1QVU A;  1Z7L A;  3GZC A;  2YPR A;  5A7L A;  4ZC3 A;  4ZDP A;  3ZR8 X;  1YE9 A;  3EUH C;  4KIT B;  1HBX G;  5TJJ A;  4W1U A;  3B73 A;  2FBK A;  3CP8 A;  4NNJ A;  1XMK A;  2K9N A;  1K61 A;  3TEL A;  2X6W A;  4F52 A;  1IXC A;  3FIS A;  4C2T A;  1XSX A;  1FTZ A;  4P9U A;  1J7K A;  5IP7 J;  2EQR A;  4W97 A;  2KJC A;  2L7K A;  2JMW A;  2VC1 A;  4FE4 A;  3WU2 C;  4BKX A;  2E1N A;  2ELH A;  2GBY A;  3BTL A;  1UAA A;  2VKD A;  5IT9 K;  3MMY B;  3CMY A;  3QFI A;  2ZJQ F;  4B3X A;  5M3F J;  4A0X A;  4ER7 A;  2P7V B;  5IP6 A;  2DCE A;  3F72 A;  1IN4 A;  1B8I B;  5DRT A;  3GZ6 A;  2KZV A;  1LDJ A;  3F8N A;  1TWC J;  1ZLJ A;  1LFU P;  3CQZ J;  4JX6 A;  5F6F A;  2LTP A;  1VQO I;  2RC4 A;  3R09 A;  2FNP A;  3E5Q A;  4M6Y A;  1U0J A;  2P7C B;  3VDX A;  3NEU A;  3QU6 A;  3ABK H;  3DTI A;  2VQG A;  4HZF A;  3CUQ C;  2ICW G;  3VFZ A;  1ZZ8 A;  2F2E A;  1N77 A;  2R7S A;  2QKM B;  5A2Q Z;  2A69 F;  2A5Y B;  2KQR A;  5E18 F;  1MSF C;  3ZMV A;  2H8R A;  2PXD A;  1K83 J;  1FX7 A;  3VYS B;  5HDG A;  3JTG A;  2LCV A;  3KYC B;  3W2V A;  4DNC A;  5E3O A;  2E1M B;  3KZY A;  2O8K A;  4DQ2 A;  1JUS A;  2IV1 A;  2LYS A;  1FJL A;  5FLV A;  2LBF A;  3LSP A;  2LYL A;  5H6Q A;  2QWW A;  2CUE A;  2AXV A;  2VUM J;  1BOA A;  3IRR A;  4ZZL A;  4Y42 A;  2O3F A;  1JHF A;  2MD5 A;  4HQM A;  2CFX A;  4HOB A;  3T0Y A;  2XAU A;  5EEH A;  2W25 A;  1KU3 A;  5BS6 A;  1W36 D;  4ER6 A;  3GBF A;  1OR7 A;  3CO6 C;  3EET A;  4XLP F;  3QYF A;  3HKZ A;  1HDD C;  4N0B A;  1MNE A;  4XLC A;  1GLN A;  2D1H A;  4IRH A;  4ZTJ A;  3WTU C;  3PSI A;  3BOQ A;  1APL C;  3J81 K;  2Z99 A;  3F52 A;  2QLZ A;  4EQZ A;  1ORK A;  3B6A A;  1HQC A;  3BR0 A;  1O3S A;  1JGG A;  3KL4 A;  2WY7 Q;  4U7D A;  4XBF A;  3KP3 A;  2WB1 A;  1O4X A;  1X3Z B;  3BZ6 A;  5E1Z B;  2MC3 A;  1U5T C;  3FKJ A;  3ZQH A;  5JVG F;  2EFN A;  2X1C A;  2F5D A;  3WTX C;  1YJW I;  2CGP A;  4PU7 A;  1KYZ A;  1TTY A;  3HHG A;  5IPA A;  2JT1 A;  2M1B A;  2O4A A;  2LY2 A;  4ESB A;  4JOM A;  1FBS A;  3UWP A;  1O7L A;  1QP4 A;  2BY1 A;  4LG0 A;  4G9Y A;  4ZDL A;  3N97 A;  3I4N J;  4OIQ F;  1K6O A;  1QU3 A;  2DQL A;  5EGO A;  4I02 A;  1SFK A;  3CLO A;  1OCC H;  2R5Z B;  3KEO A;  1BW6 A;  1Y39 A;  1LQ1 A;  2D1V A;  2DA1 A;  1BM9 A;  1TC3 C;  1OFC X;  1ZR2 A;  2COB A;  3PQJ A;  2O9L A;  3JXB C;  1LKX A;  2EZI A;  3BLY A;  1SFX A;  1RZR D;  5DD4 A;  1HW1 A;  1TQM A;  4M71 A;  3SYT A;  1X3W B;  1VQ8 I;  2OCC H;  5HDK A;  3CF5 F;  2EV6 A;  2NNY A;  1MBE A;  1UHM A;  1Y6I A;  4NB5 A;  1Z05 A;  2LLW A;  3F0C A;  5DYM A;  3PM1 A;  4X4F A;  1HKQ A;  1G3Y A;  2X1E A;  4BUP A;  1GUU A;  2KDO A;  2YR2 A;  4J1X A;  1IN6 A;  4BYY A;  2WTE A;  1E3P A;  1SD6 A;  2IW5 A;  5D8L B;  4KNY A;  2CJJ A;  2JSC A;  3PIO F;  3BPX A;  3BZK A;  1ETK A;  4CZC A;  5EG0 A;  4OMY A;  4EK9 A;  2QUF A;  4RDU A;  1JKQ C;  2P4W A;  2EFO A;  4XL9 A;  1R5H A;  2MG4 A;  1SD5 A;  3DKW A;  3OIO A;  5IP9 J;  1U2Z A;  3UFD A;  3H9G A;  2HOA A;  2Q1Z B;  2L7F P;  2XRO A;  4O6J A;  1F9N A;  3M8J A;  3OY9 A;  2I5U A;  3Q0W A;  1MFQ C;  3D1N I;  2XKP A;  4RBO A;  1LCC A;  2HXI A;  3ZQ7 A;  2M4G A;  3GVA A;  4RAF A;  5CKT A;  3RJP A;  4DOZ A;  5DTQ A;  1VZ0 A;  3V7C A;  3OOU A;  4YIF A;  3FF5 A;  2HQA A;  1W5C C;  2DQR A;  2M4K A;  3PFI A;  4S05 A;  1ZEL A;  2E2J J;  4X4E A;  2LG4 A;  1KON A;  2L4M A;  1NG7 A;  4I0B A;  2VXZ A;  3S2W A;  4F55 A;  2PEX A;  1AU7 A;  2DFI A;  2E2I J;  2UWM A;  1LLI A;  3VSL A;  1IN7 A;  3A2K A;  4BY7 J;  1IRG A;  2AXT C;  4GDF A;  3F6V A;  4X4H A;  1QHG A;  1QO0 D;  4X4B A;  1Q1H A;  1ZRC A;  3OQO A;  2JSP A;  2BW3 A;  5JI6 A;  4UUV A;  1FP2 A;  4MLO A;  1FC3 A;  5FD6 A;  4MO7 A;  3GFM A;  2EFP A;  1XWR A;  3NDB B;  1UST A;  3REO A;  3S16 J;  3MN2 A;  1DGR M;  2R0Q C;  5DM7 F;  2CH0 A;  5LEK A;  1BC8 C;  2VLA A;  4A5M A;  3N4M A;  4BS9 A;  5J47 A;  1P9Q C;  4DZJ A;  4Y7N J;  2R4G A;  3MD2 A;  1P7I A;  4PJN A;  1JFT A;  2X0L A;  4DIQ A;  3JRA A;  3DCF A;  1K78 A;  2ESN A;  3IAS 2;  2KKO A;  2P81 A;  5FKN A;  1R63 A;  1MBJ A;  2OFY A;  3I64 A;  1H9G A;  5FLX K;  1ZS4 A;  1D0Z A;  2XB0 X;  1FMV A;  2FX0 A;  2KP6 A;  2WC2 A;  2JA8 J;  5L3D A;  2HEO A;  2XAH A;  3OYB A;  3DEU A;  3K4K A;  5H6R A;  2LC2 A;  4B48 A;  2R7W A;  3QPS A;  2LD5 A;  1Y1W J;  1W4M A;  2NOJ B;  3SJM A;  4A5N A;  1XGO A;  1MSE C;  3JW4 A;  1KQ8 A;  2RNJ A;  1PUF B;  4D9J A;  1KA8 A;  2GZW A;  4E7L A;  4G7Z F;  2GM4 A;  3OL4 A;  3M8F A;  4WXC A;  1L3L A;  2ZME C;  1D1C A;  3AL0 C;  5LGU A;  2BNO A;  2BVL A;  4J19 A;  2IEK A;  5DCF A;  1UTX A;  2FBI A;  1O3R A;  1O57 A;  3HTS B;  1MJA A;  1ZG1 A;  3PFY A;  1T08 B;  5GAG i;  4HG2 A;  4I6Z A;  1E2X A;  5J4V A;  2ZJ2 A;  1VPW A;  4JQD A;  5K1Y A;  1SD7 A;  3L2U A;  2GAU A;  3GFJ A;  3RTR A;  2DFH A;  2AXL A;  3O6B B;  4PJM A;  2XRN A;  2LYK A;  2M8E A;  3SZT A;  3T1B A;  2ISZ A;  1NER A;  1I3A A;  2YBD A;  3S2D J;  2ELK A;  4UVB A;  3R6S A;  2E7W A;  5HLT A;  1XS9 A;  1LDD A;  5K7F A;  2XRL A;  3SR4 A;  3OYD A;  4AIK A;  4XLN F;  3GN5 B;  2KL4 A;  3I3L A;  4L5E A;  4E7Z A;  2DA6 A;  4MTE A;  1MIJ A;  3E6B A;  3Q9V A;  2HQR A;  2LYR A;  2KEI A;  3WU0 A;  1LVK A;  1TWA J;  2EZH A;  2O8X A;  2ZXI A;  4NUB A;  5J6X A;  5HOD A;  2Y2Z A;  1B9M A;  3R4K A;  2EIN H;  1Z3Y A;  3CUQ A;  1MD0 A;  4C30 A;  2PUB A;  4PU4 C;  2JRT A;  2VPR A;  4HRI A;  3ME5 A;  1JTX A;  3WHB A;  1J75 A;  4YII A;  4D7N A;  1FLI A;  3CTA A;  1R4M B;  2HFZ A;  5IOZ A;  4MEX F;  4BL0 B;  1YIJ I;  4F91 B;  1SC7 A;  4M74 A;  5F0C A;  2X85 A;  1BI2 A;  5CVU A;  2FBH A;  1L1M A;  1EF4 A;  3T8T A;  3PNT A;  1S7O A;  1T38 A;  5LD2 C;  2ACJ A;  4BEH A;  4U0Y A;  2PJR B;  4PZJ A;  5TRD A;  2DAO A;  1HF0 A;  2E5N A;  1D1A A;  5ICE A;  1AWC A;  4GXO A;  2NXN B;  4IHT A;  1FOY A;  2DOE A;  3LFP A;  2BNM A;  2HCN A;  3ZQL A;  4E4H A;  2QF7 A;  2JN6 A;  2XGC A;  2OTL I;  4DJA A;  4U7B A;  4IPA A;  1FSH A;  4U0W A;  3EPZ A;  3CLC A;  4MHG A;  5D5V B;  4HX4 A;  2AQF A;  3G1L A;  2FE3 A;  2VOO A;  2HTS A;  1MBH A;  3A9Z A;  2OPT A;  1HKT A;  1S6L A;  4XR6 A;  2JVL A;  3SCG A;  1TT5 B;  1VI0 A;  4UVA A;  2MLK A;  1U5T A;  2CWE A;  3JRF A;  1FIP A;  3K70 C;  1I6X A;  1ACI A;  2Z9O A;  1CQT A;  3SCF A;  1JHH A;  3I54 A;  3IKV A;  3ABU A;  3SDG A;  4E70 A;  2XGE A;  1G6N A;  3H3V K;  2L9R A;  2VKE A;  4JX4 A;  4ETS A;  2EBI A;  4KIG A;  2H8W A;  1YFH A;  3P5J A;  5ED4 A;  5F0F A;  5C3E J;  3GTM J;  4QPQ A;  2ZSI B;  3EYY A;  1XDS A;  3GLX A;  1JJ8 C;  1OYY A;  3R0J A;  2XIG A;  2WAD A;  3F6O A;  4MFD A;  2GIV A;  4LLL A;  2H09 A;  3H0D A;  2V6C A;  3KZZ A;  3HOZ J;  4FHT A;  4ENK A;  2CV1 A;  1YHQ I;  1WI3 A;  2DYS H;  5FRM A;  3DKX A;  5D6F A;  1FTT A;  1GXP A;  4ZH4 F;  3SZG A;  3QQA A;  4LB5 A;  3BS3 A;  5FLM J;  1QRY A;  2K40 A;  1YW8 A;  2ZB9 A;  3RKW A;  4P5O A;  2IA0 A;  4M3B A;  3MVP A;  3R0A A;  1OYI A;  3M1C A;  4RB3 C;  3M7G A;  2CO5 A;  1YS6 A;  5GP9 A;  5KAF C;  3G5G A;  2ZXJ A;  3D0S A;  3NQO A;  4ANJ A;  4LIT A;  2PMH A;  2JVG A;  4MGR A;  3CJN A;  2NVU B;  2DYR H;  1RKW A;  4RB0 A;  1QVT A;  5CVV A;  3HOY J;  2IU7 A;  1UG0 A;  1OR7 C;  2DT5 A;  2Z16 A;  1S5L C;  3ZQI A;  3VB2 A;  1YI2 I;  3CRO L;  2H1L A;  3ZMT A;  3K1M A;  4J1W A;  2FQ4 A;  2IXS A;  1WJC A;  1WQ2 A;  3BTI A;  5ICC A;  2PXP A;  2LOO A;  1VND A;  3DEE A;  4KIC A;  1W7P D;  1DPU A;  1U3E M;  3JRI A;  2HVQ A;  4HAM A;  4L9T A;  3KIO A;  4F8D A;  3RPU D;  3OL3 A;  1QB2 A;  4UNO A;  3C2B A;  1BA5 A;  3IVP A;  5JLW A;  2MA3 A;  3QYB A;  3LQQ A;  1PRU A;  2BOL A;  4HA8 A;  2AHQ A;  3BR2 A;  1OIS A;  4B3A A;  1ZG5 A;  3KLO A;  1MDM B;  1CJG A;  3EUK L;  1WI9 A;  3E3V A;  3V8J A;  2X6O A;  3I71 A;  4PGH A;  1B9N A;  3BC8 A;  4M3F A;  3Q5F A;  1EFA A;  1IXS B;  1SMT A;  1BJA A;  3QOX A;  3K0L A;  2J5P A;  2LY9 A;  3KE2 A;  2KZG A;  5L3B A;  4RGR A;  4AYB N;  1T6S A;  5J8C A;  3GZN B;  3BR5 A;  3K4J A;  3DBR B;  4EQQ A;  2UXX A;  4CYC A;  1I1S A;  1TW2 A;  3PO2 J;  1EA3 A;  3OS1 A;  2MQK A;  2E36 A;  1DPR A;  1B6A A;  1YRN B;  3V4G A;  3J7Z I;  4BHP A;  2V9P A;  1BIB A;  2JPC A;  4BU2 A;  3OSG A;  2V6E A;  3VWB A;  4EJT A;  1ZRE A;  1SFU A;  4NQW A;  5E20 A;  1KQ0 A;  3D5S C;  2IVM A;  2UXN A;  3Q0U A;  2KIS A;  3A4C A;  2PMU A;  3HEF A;  3QPT A;  1F43 A;  3M1E A;  1RIO H;  4G8X A;  2F5F A;  2FA5 A;  2VQH A;  2WY8 Q;  2QBY B;  4BXF A;  1BR1 A;  1R23 A;  3ROU A;  2L54 A;  3TW6 A;  1REP C;  4YFK F;  2J7W A;  1ZUG A;  2JA2 A;  1NG6 A;  2ZNY A;  3BP8 A;  5HVQ C;  2E2H J;  3BPV A;  3GBG A;  2PXL A;  1AOY A;  1HKS A;  2ADU A;  2RDP A;  3B6C A;  2HTJ A;  4HLX A;  4ER0 A;  4JCX A;  2KIF A;  1TNT A;  1Z0X A;  5DS9 A;  4I6R A;  1JT0 A;  2QQ8 A;  3F23 A;  1FYM A;  1OYW A;  2XAF A;  1Y8R B;  2DMN A;  2LFB A;  4GYG A;  2PXE A;  5J4Y A;  2K7L A;  2W57 A;  1X4O A;  2COM A;  2E1O A;  2VJ4 A;  2XCJ A;  1SAN A;  3LSJ A;  3RSN A;  3CCV I;  2PXQ A;  2ZME A;  3NAU A;  4HNU A;  3CF2 A;  4EKI A;  5BNG A;  1Q1V A;  1W7P B;  3I4P A;  2L02 A;  2KEK A;  1S7E A;  4X4G A;  1C0W A;  1EH7 A;  3OYN A;  2ZSH B;  3FXQ A;  2BY2 A;  4RAY A;  3CCR I;  4WF2 A;  4AC0 A;  3K4L A;  3QOD A;  1KQ9 A;  4M9Z A;  2NRA C;  1LMB 3;  5F64 A;  4XID A;  4A3J J;  3OYG A;  1J0R A;  2CS3 A;  2MEZ A;  2GXG A;  2LK2 A;  1Y0N A;  5JR3 A;  4HW0 A;  4EGZ A;  3BDD A;  3JAM K;  1FOK A;  1BJZ A;  2X1D A;  5DEQ A;  1F5T A;  4BQA A;  5J1Y A;  3WTY C;  4LOC A;  3DQV C;  1D0Y A;  1BW5 A;  4KN4 X;  2OA4 A;  3A0H C;  3B7H A;  1IRZ A;  2NS8 A;  2QEN A;  1VTN C;  1UMQ A;  4M3D A;  4NDW A;  1HSJ A;  1ZH5 A;  3ASN H;  1JKR C;  4XM3 A;  3FBI B;  5HLH A;  1BR2 A;  2YX7 A;  2VBY A;  1ZGW A;  1HW2 A;  1TNS A;  3JRB A;  1VQ9 I;  1ZGJ A;  1AHD P;  4NC8 A;  2DK5 A;  2XAJ A;  1U2W A;  3WG7 H;  3OR1 C;  3NZL A;  4OIP F;  5J40 A;  5BQT A;  2I10 A;  4UY8 I;  2VKV A;  1TL8 A;  2Y0M A;  3CJT B;  1SEU A;  4IHV A;  5TIS C;  4O8B A;  3FM5 A;  3MWM A;  1YO5 C;  2W4S A;  2V1N A;  2D2W A;  1OCR H;  2BNN A;  2OC6 A;  3G6E I;  4OBM A;  5EDN A;  3GTO J;  2KIU A;  4D7M A;  1QP0 A;  4OAZ A;  3HGY A;  4EJW A;  1IUY A;  2K9Q A;  3LNQ A;  2E71 A;  3IWF A;  4Y13 A;  1R22 A;  1UB9 A;  3E1S A;  4PU3 C;  1RET A;  2IS4 A;  3V8L A;  5M3M J;  2W00 A;  2DPU A;  3G1M A;  1D8K A;  5BPD A;  1RZ4 A;  1CF7 A;  4HPQ A;  2DDB A;  4MIM A;  5DM6 F;  1XSV A;  5AIQ A;  2MLG A;  5L3C A;  3CCM I;  4G6T B;  3P9C A;  1ON2 A;  4XRF A;  3E5X A;  3GTL J;  4P55 A;  1PP8 F;  5GAH i;  2XXA A;  1MGT A;  3TKY A;  3W6K B;  1WJA A;  2JRM A;  4EAT A;  4WVL A;  3FIW A;  5F27 A;  2OV7 A;  3LWF A;  4KA4 A;  4L9J A;  2PI0 A;  1ETY A;  3M07 A;  2JZY A;  2VN2 A;  1LB2 A;  4EMS A;  2GRL A;  4FX4 A;  2F5C A;  5K7Z A;  5FKK A;  1MMN A;  4PJJ A;  1ZZ7 A;  2CUF A;  4RM2 A;  3WTS C;  1P2F A;  3LIS A;  2L7M P;  4A3G J;  3S93 A;  1T33 A;  2L49 A;  3PL8 A;  5LRS A;  2QEX I;  2L9S A;  2V9K A;  4XIC A;  1G3S A;  1W0U A;  1ITY A;  3H35 A;  2PQ8 A;  2Z1D A;  2O5R A;  2A5W A;  3HHH A;  1YX3 A;  3JSO A;  2LLK A;  1F36 A;  3MEX A;  2QSH X;  4HF1 A;  4YFN F;  2Q2E A;  4RMN A;  1X1B A;  5A2Q K;  5GAH J;  1FZP B;  2MH9 A;  2OUM A;  2DXI A;  2NVX J;  4CIC A;  5E3L A;  2ODR D;  2HYJ A;  3OYA A;  3OKZ A;  3OR2 C;  3OS2 A;  3TOB A;  1G59 A;  4Q5S F;  1I3Q J;  5CVR A;  5B5E C;  5DTR A;  4E7J A;  1LE8 A;  4DYC A;  4LGW A;  3J7A O;  1QZX A;  4HST A;  2EF8 A;  3MZ8 A;  1GV5 A;  2BE5 F;  1VQN I;  3ULQ B;  3RDI A;  3HUG B;  4GHJ A;  1FWZ A;  3HSF A;  1V55 H;  2NYX A;  3DU5 A;  4R79 A;  1X57 A;  3CME I;  4UV8 A;  3TQN A;  4XSZ F;  1S9H A;  5E17 F;  5C4X J;  3GTJ J;  5HS8 A;  4BAC A;  1K79 A;  5ICG A;  1JT6 A;  4CZZ A;  4WXD A;  3R60 A;  2WA0 A;  4KDP A;  1RZR A;  1ZTR A;  3I56 I;  3GFI A;  1ZK8 A;  3F9K A;  2IP2 A;  4LMY A;  4M73 A;  2CQN A;  4B4C A;  1OPC A;  3S1N J;  3OYM A;  2OQG A;  4I76 A;  1WCM J;  4ZTF A;  2HOT A;  4KIB A;  4Q2J A;  1YS7 A;  1MBG A;  2VC0 A;  4A6E A;  2OTJ I;  2R1J L;  3BJA A;  1RPE L;  3IH3 A;  3LSK A;  5HLI A;  4V2F A;  2XPV A;  4B43 A;  3CCY A;  3TP3 A;  4H0E A;  3HL2 A;  3F51 A;  4IQ4 A;  4ON0 A;  5EJC A;  2X6Y A;  1T8I A;  2XF5 A;  1XCV A;  1NEQ A;  4FX0 A;  4J00 A;  1N75 A;  1R5G A;  2OZU A;  4L9V A;  3J81 Z;  4A3K J;  2AQE A;  2P5V A;  3LSG A;  1G2H A;  2PN6 A;  3MKW B;  2ZKZ A;  2XF7 A;  3A01 B;  4CDG A;  3HTU A;  4AID A;  3I55 I;  4AM3 A;  3G2B A;  3DPT A;  3BR6 A;  5FD5 A;  4DYQ A;  4BXX J;  3HM5 A;  1I1G A;  3GO5 A;  4BGD A;  1TWF J;  2H1K A;  2V4J C;  3OV8 A;  4EM1 A;  9ANT A;  2LNM A;  1UG2 A;  2RAE A;  2JA6 J;  4PSW A;  1Z77 A;  2W84 A;  3G71 I;  4JK1 X;  3WTV C;  3LOC A;  1Y1V J;  2F4O B;  5GAE J;  2F4I A;  4XLA A;  2DU9 A;  4G6D A;  3LAP A;  3OQM A;  5ICF A;  2R7O A;  1MBF A;  5HNF A;  3ZQQ A;  3JRD A;  1K4S A;  3BR3 A;  3TDU C;  1IZ1 A;  1DWK A;  1X1P A;  5J3L A;  1XG1 A;  4UUS B;  5IT3 A;  1BL0 A;  2K9M A;  2I8D A;  3OYJ A;  3ML6 A;  3CO7 C;  4OB4 A;  1AKH A;  3FKI J;  3K2A A;  1ZR4 A;  2EV0 A;  4EV0 A;  3H5T A;  3KX2 A;  4IWR A;  3CDH A;  1YW7 A;  2PFB A;  2QQB A;  2EIM H;  4PDK A;  2CUJ A;  2MD0 A;  3FBN B;  3OP9 A;  2G0E A;  4HDV A;  1KZH A;  5C4J J;  5JFR A;  5HDN A;  3VK0 A;  3HRT A;  2B63 J;  3LFU A;  4J01 A;  1OCZ H;  2M30 A;  2BXY A;  2STT A;  2TRT A;  2LYQ A;  3HOS A;  3TFL A;  1FY7 A;  1OCT C;  3DNV B;  1XMX A;  4HRA A;  2W7N A;  4RS8 A;  1UJ8 A;  2HI3 A;  2LRE A;  3GYH X;  3LAJ A;  2R7Z J;  3MLF A;  4IA8 A;  1Z91 A;  2XAS A;  5KHD A;  2PX9 A;  4FBI A;  4YAR A;  3BR1 A;  3OWT A;  3MKY B;  2L7Z A;  4U88 A;  3OS0 A;  3DTE A;  1H0M A;  2WAF A;  2PUA A;  5K5Q A;  5F1R A;  4Y52 J;  2FUG 2;  1BDI A;  3F8F A;  4FE7 A;  1F1Z A;  2PJR A;  2O49 A;  3U3W A;  4XKW A;  1TLH B;  1SFE A;  2ZJP F;  3QYX A;  3O8H A;  2NAZ A;  5DCM B;  4IHS A;  4ESF A;  4IHW A;  2B0L A;  2HR3 A;  1VQ5 I;  3OOP A;  4B47 A;  1PNR A;  3S3O A;  2QQ9 A;  5CVI A;  3CMM A;  2RV8 A;  5H2F C;  2EB7 A;  1X1A A;  1X3U A;  3VYU B;  1G8X A;  3K9T A;  3HC7 A;  2ZCW A;  1B1B A;  3C2G A;  2PUG A;  4IXA A;  2R7Q A;  3CDL A;  2LBF B;  2JCG A;  1ETO A;  2ICP A;  2STW A;  4Y4R A;  3SQN A;  4BE1 A;  3GTQ J;  2E34 A;  3J7A Y;  3MKL A;  3S8P A;  2R7D A;  4II3 A;  3VOD A;  1KU2 A;  2VPL A;  1GXQ A;  4Y33 A;  2QA4 I;  3D5R C;  4YRV A;  2CMP A;  5FKO A;  1Z3X A;  2O03 A;  3DBH B;  4CCM A;  2D5V A;  4OWR B;  4E7S A;  3KYL A;  2VQC A;  4KIF A;  1D5Y A;  2YX4 A;  2X9D A;  4KIS A;  3S1Q J;  4OIO F;  1JE8 A;  2O7O A;  3V8K A;  4WXH A;  1FNN A;  3N05 A;  5JLX A;  3UR3 C;  3KP7 A;  2XKO A;  2KRC A;  1Z21 A;  4RB2 C;  1R9T J;  1QPM A;  1EH6 A;  2V9V A;  2VT2 A;  1G4D A;  1OLT A;  3ZMZ A;  2H94 A;  3KPH A;  1JH9 A;  2X48 A;  3BCB A;  2JTV A;  3QPH A;  1J2X A;  1R7J A;  3I59 A;  1BR4 A;  2VKH A;  3S32 A;  2W82 A;  4LG0 B;  4BH9 A;  2LKX A;  2E1M C;  1SAX A;  4M9S A;  1YJ9 I;  4I09 A;  4DW6 A;  3LST A;  5FRN A;  3PIP F;  2EA4 A;  4UB8 C;  1ZZ6 A;  3QOW A;  4UB6 C;  1T56 A;  2R92 J;  5IYD J;  1HQ1 A;  3FDY A;  1MMG A;  2RKH A;  2GWR A;  3SEQ A;  4EM0 B;  5F08 A;  4IVN A;  2HDC A;  3JXC L;  1RIO A;  4CCK A;  4X1E A;  3QP6 A;  4I8T A;  2HIN A;  3S8Q A;  1UEL B;  4G12 A;  4RGS A;  5GPC A;  1I50 J;  2RRE A;  1QQA A;  2WWY A;  3MCZ A;  2L9V A;  4AIJ A;  2ISY A;  1YJN I;  2HCS A;  2V1U A;  1E3H A;  2RVC A;  3A1Y A;  3CC7 I;  3BTJ A;  1MMA A;  1MKM A;  6PAX A;  1ZZ9 A;  2L4A A;  5ILU A;  3CCQ I;  3S1M J;  2KIM A;  3A9X A;  2HYG D;  3ZN0 A;  4A3B J;  3WHC A;  3HRM A;  1IDZ A;  3A9Y A;  2E5Z A;  1MW7 A;  2V3C C;  2HVS A;  5LGN A;  4ER5 A;  1IRX A;  2DA4 A;  4IRG A;  2EIL H;  1FT9 A;  1X2M A;  5EG0 B;  2GRM A;  4Z2Y A;  4I2O A;  3G4S I;  2LNB A;  1JI8 A;  3I4M J;  4X4I A;  2X51 A;  3LA2 A;  2Q8K A;  5CYV A;  3HRU A;  5C44 J;  2LH9 A;  2K85 A;  3BJO A;  2KPJ A;  2DMP A;  4HDU A;  2K86 A;  2ID3 A;  2DFF A;  2V26 A;  1UXC A;  4CHU A;  2NVY J;  1N78 A;  2UV1 A;  5KAI C;  3PXP A;  1D3Y A;  1WPK A;  2W48 A;  3GME A;  1RI7 A;  1MBK A;  4K2E A;  4N4O B;  4Y17 A;  4F7Z A;  1LEB A;  4F93 B;  2M45 A;  4LK0 F;  4DYR A;  1V3F A;  3TGN A;  2G9W A;  2HYF A;  2IS6 A;  2DO7 A;  1DU6 A;  2QVO A;  1QZZ A;  4HSR A;  4JQF A;  4N9I A;  4IHX A;  2H6C A;  5D4S A;  1KU7 A;  3Q9S A;  2HPM A;  1HW5 A;  1IN8 A;  1NH3 A;  4AVP A;  1T0F C;  4EM2 A;  2Q0O A;  5HOO A;  2ESH A;  2PXV A;  2XF6 A;  3JCU C;  3TBI A;  4KUM A;  1G3W A;  2ECB A;  4UVC A;  2GOM A;  1YG2 A;  4P1W A;  1LVA A;  1SD4 A;  2BYV E;  5KK1 A;  4I7H A;  1RES A;  3KP4 A;  1QA6 A;  2HDD A;  4YEL A;  1FOX A;  3SFI A;  3OYH A;  3IRQ A;  1TWG J;  1NW3 A;  3FXK A;  3SEZ A;  3E6C C;  4Q48 A;  1XGN A;  1ZGA A;  2V1D A;  4O3M A;  1LDK B;  2V7F A;  4II2 A;  2JQE A;  5LEJ A;  1IC8 A;  1W36 C;  1WJE A;  2WAQ N;  4AYB A;  3DV8 A;  3I53 A;  3MZH A;  3F21 A;  3OIQ A;  1H88 C;  4Z58 A;  2PPX A;  4QLC U;  3OWQ A;  3TOA A;  4LG3 A;  1XCB A;  3PO3 J;  2IJL A;  2YSR A;  4BBR J;  1ZRF A;  3K1P A;  1B72 B;  3BTC A;  3F6W A;  4DGW B;  4C3J J;  2BJC A;  2CQQ A;  3M9A A;  3B02 A;  4D5C A;  4TV7 A;  1ZPQ A;  2XDV A;  3ZMD A;  2HGC A;  4IL6 C;  1PVE A;  2QM3 A;  1VQP I;  4PSX A;  3RPU A;  4KYW A;  2PUF A;  2FOK A;  2VON A;  2AS5 F;  1PRA A;  4G7O F;  3HIF A;  3OMY A;  3CC2 I;  1YX5 A;  2Z2S B;  1TBX A;  3KP2 A;  2EJR A;  2KJB A;  1XN7 A;  2JUG A;  1WKM A;  1FEX A;  2K9S A;  2VAS A;  1QZY A;  1TWH J;  1TZL A;  1USS A;  2R3S A;  4CYD A;  4S04 A;  4C2M J;  4A3M J;  1ZAO A;  2YS9 A;  1YLF A;  2VJ5 A;  3S17 J;  3OQN A;  3PJR A;  3EUA A;  3ABM H;  4A93 J;  4LFU A;  4D1Q A;  1IN5 A;  1WJF A;  1ZHF A;  2M9H A;  3P9K A;  1ZAY A;  2E35 A;  4MTD A;  4DZP A;  3K4C A;  1QNT A;  1WGX A;  3JRE A;  1ENH A;  2PMZ N;  3I0T A;  2EFQ A;  3VWS A;  2EV5 A;  4HF2 A;  3RZO J;  2EFW A;  3GUU A;  2FD5 A;  1YIO A;  2MH2 A;  2XXP A;  5HLG A;  3GZD C;  3ZQC A;  4RA2 A;  2PXF A;  1HST A;  1LPQ A;  4NDL A;  3ASO H;  2DJN A;  2OCE A;  1ERD A;  4OAY A;  3NWS A;  1UHW A;  1J9I A;  2PUE A;  3F8C A;  3MEJ A;  3TRB A;  4FET A;  4GFB A;  2OJE D;  3IH2 A;  5FO5 A;  3R61 A;  4C2U A;  2FMY A;  3J80 K;  2XSJ C;  2BY0 A;  3CJQ B;  3CCE I;  2N8G A;  3BRO A;  4R8H A;  4CCL A;  1BIA A;  2L2O A;  3BCA A;  2OD5 A;  3RCO A;  3O3K A;  1POG A;  5L3E A;  3LL7 A;  4XOP A;  4BDY A;  3FWE A;  1B59 A;  1MH3 A;  2HNH A;  2EZL A;  2GA1 A;  2M7B A;  3CUQ B;  4I6U A;  3VPR A;  1ZZB A;  1H89 C;  2HKX A;  4QPO A;  3L2W A;  2FEZ A;  2XAQ A;  3EUS A;  3WOD F;  3T5X A;  3J7Y J;  1TW3 A;  3AG2 H;  4CCO A;  3RQ4 A;  5BOX A;  3HOV J;  2R7X A;  3H92 A;  3W3C A;  2VIX A;  1O3T A;  3TW7 A;  4OOI A;  4YBA A;  2NOG A;  2VOP A;  5DD8 A;  3QRF F;  1ZZC A;  3H5R A;  3RYP A;  1BN5 A;  1WH5 A;  4Q47 A;  3FXM A;  1ZYR F;  1FSE A;  3HB9 A;  3JSP A;  4F3Q A;  4HNT A;  5M5X J;  2RN7 A;  4PCQ A;  3FZV A;  2P8T A;  3U9G A;  2L5Q A;  1DUL A;  3BQZ A;  3AG1 H;  2DA5 A;  2FML A;  2X6X A;  4BQQ A;  4X4D A;  1G3T A;  2FXA A;  5LBQ A;  4HX8 A;  1UHS A;  3FXR A;  4FN3 A;  1B8I A;  2DA3 A;  1I27 A;  2K9L A;  2XSD C;  3FHN A;  5B1A H;  4A3C J;  2GQQ A;  2LF7 A;  2LVS A;  4XLF A;  1IAW A;  1DU0 A;  3ZGK A;  1T98 A;  1FP1 D;  4KN7 X;  1Y9Q A;  3WE3 A;  2F5E A;  3DLL F;  2ZXH A;  3DBL B;  3JRH A;  1R1V A;  1WSU A;  3KYD B;  1BI0 A;  3HPH A;  3O8G A;  3HOX J;  3KZI C;  2HSG A;  5JHF A;  3DXJ F;  1U5T B;  3E5U A;  2IBD A;  3G73 A;  1QBJ A;  3SZP A;  2P6S A;  3GLL A;  4MNU A;  3HXL A;  3RKY A;  3M4O J;  4AU7 A;  2IAI A;  3H9J A;  5CQE A;  2DPD A;  2M2E A;  1WFX A;  2WAE A;  5BPI A;  1HCR A;  2GXB A;  1UXD A;  2ETH A;  2IS1 A;  4XLE A;  4MEY F;  1IDY A;  4V2G A;  3HSR A;  5CVJ A;  2PUC A;  5L3F A;  2IPQ X;  5ERI A;  5CJ9 A;  4GQM A;  3HPG A;  3L09 A;  3P7N A;  3L9F A;  5E8G A;  5FGM A;  3SDB A;  1FYK A;  1W5T A;  2YU9 J;  3NRV A;  3HDD A;  5H20 A;  2HFH A;  3OYE A;  2BBY A;  1IW7 F;  2LR8 A;  1R71 A;  2HZD A;  4ZYA A;  4M3G A;  2KMU A;  3WTZ A;  5L3G A;  1OJL A;  2O0Y A;  1GT0 C;  1A36 A;  1P4A A;  2ZFW A;  3WE2 A;  3VYT B;  3F22 A;  3GZ5 A;  2DTR A;  2QCO A;  2FNA A;  1OCP A;  3WGH A;  4YG4 A;  2DJI A;  2TDX A;  3SX0 A;  1X1C A;  2RQQ A;  2XPW A;  4MCX A;  3ZN1 A;  2IRF G;  1ETV A;  3HYI A;  2XB5 A;  4LK1 F;  4UXN A;  5LHG A;  1ON1 A;  3KZ3 A;  1VQK I;  4LIU A;  1WZ2 A;  1POU A;  3E7L A;  3W2A A;  4BJ6 C;  2LYJ A;  4D5F A;  3IUO A;  2PXT A;  2E7X A;  1S29 A;  1IUF A;  2PLY A;  1XGM A;  2WV1 A;  3BQY A;  4P96 A;  2WBM A;  3KET A;  4EJU A;  2XHK A;  2B9S A;  1GHC A;  4XSX F;  4KT5 C;  5IOY A;  5LGT A;  2DN0 A;  5IYB J;  3H36 A;  1ODD A;  2BGC A;  1XDU A;  3C18 A;  2R5Z A;  2BEO A;  2F48 A;  2QKL B;  2DLL A;  1U9N A;  1JUP A;  2CV2 A;  1U8B A;  5E1X A;  4UUT A;  1MZB A;  1R1U A;  3ZHI A;  4PK4 A;  5IY5 H;  2ICT A;  4XN0 A;  3QF3 A;  4CXF A;  2DOD A;  2P0W A;  1NK3 P;  2K3F A;  3LSR A;  1T0F A;  3A02 A;  1S3J A;  2EWN A;  1DUX C;  1LFB A;  2CSO A;  3V7S A;  2OF7 A;  2M0C A;  5HS7 A;  4KMF A;  3MAJ A;  2C6Y A;  1ETX A;  1BBY A;  1IG7 A;  2VXD A;  3H9Q A;  3I9V 2;  3DFG A;  5FJ8 J;  3ONQ A;  5CQG A;  4C3H J;  4IJA A;  1DW9 A;  4UUS A;  2Y0S A;  1R49 A;  4CCJ A;  1HOM A;  1MJ9 A;  2DA7 A;  3RPQ A;  4CYC B;  3ABL H;  1UFM A;  4QWQ A;  3E6D A;  5F04 A;  2W24 A;  3CCL I;  3K1N A;  1JKP C;  1HDP A;  1GDT A;  1VQ6 I;  2KRH A;  3BG5 A;  3P9I A;  2XGX A;  4NQW B;  2CRG A;  4E7I A;  4OU0 A;  3CC4 I;  4IZZ A;  3HOU J;  1A5J A;  4A0Y A;  4EVI A;  4IQJ A;  1PJR A;  5DSX A;  4Y3O A;  1TQP A;  1QGP A;  2GXA A;  2GZU A;  2UZK A;  1Z6T A;  2B5A A;  2K4J A;  2JA7 J;  3E6M A;  1XD7 A;  1U8R A;  2QZ8 A;  4XRS G;  2VEO A;  3C2H A;  5EYR A;  5IT9 Z;  3GXO A;  1WH6 A;  4L9N A;  2DMT A;  2E1C A;  3BZC A;  2L1P A;  4AIH A;  1P6R A;  2DDA A;  4PGG A;  2R5Y B;  3FX3 A;  1QZE A;  4GRI A;  2DW4 A;  5JHU A;  2XV4 S;  4BE2 A;  3T8R A;  2MAB A;  3DP7 A;  3E0J B;  1HLV A;  3GFL A;  2DK8 A;  3BG9 A;  3VYR B;  4QTR A;  2HU9 A;  2P5L C;  3JTH A;  1DP3 A;  3FMS A;  4ER3 A;  3F8M A;  2IGK A;  3SHF A;  2FSW A;  4BBS J;  1JKO C;  3FK7 A;  3IC7 A;  2L8N A;  4ZYD A;  3FYA A;  2ZME B;  2LY1 A;  2EPF A;  2FF4 A;  1T95 A;  1JUM A;  2ZNZ A;  2ECC A;  3AL0 B;  2AXZ A;  3ZMS A;  4XOT A;  5DCM A;  3H0G J;  5LFA A;  3ISP A;  1BOB A;  2O61 A;  3ZPX A;  3DPU A;  2BY3 A;  2A3S A;  2XI8 A;  3V7R A;  2QSF X;  2FOW A;  4P9F A;  3ECH A;  3HZI B;  2JUC A;  3ZQG A;  1DQU A;  1UCR A;  3HZJ A;  5DV5 A;  3GZD A;  4RLQ A;  3COA C;  2AW6 A;  4ENJ A;  2YUS A;  3K70 D;  3QWL A;  1IGN A;  3DKY A;  4OIR F;  2VE9 A;  4L18 B;  4OMZ A;  4X4C A;  3OIP A;  2FRH A;  4MCT A;  1U6G A;  2Y9Z A;  2EH3 A;  5D8K B;  2DBB A;  4LD5 A;  3LQR A;  3FMQ A;  1WHU A;  3WTT C;  2DOF A;  2VQL A;  3CEC A;  3WGI A;  3RI4 A;  4GCV A;  2AWI A;  1YYV A;  1YOV B;  2Y0S N;  3LA7 A;  1DP7 P;  2NVQ J;  2EBY A;  2GIZ A;  3K10 A;  1KYW A;  2MXD A;  2R93 J;  4YFX F;  1RNL A;  1PUF A;  3Q0V A;  1ULY A;  4A0Z A;  4BQO A;  1XSD A;  1YTY A;  4A6D A;  1BI3 A;  1PRV A;  1NK2 P;  4M6X A;  3W6J B;  3L2R A;  3G3Z A;  2KDZ A;  4GGG A;  2NS7 A;  3TP0 A;  2ZC2 A;  1ZVV A;  2IA2 A;  1E3O C;  1K4T A;  2CUZ A;  2OAZ A;  1VQM I;  4DE8 A;  2DOA A;  4MQV A;  3S3N A;  1JJ6 C;  1SVM A;  4N9H A;  4RB1 A;  3QU3 A;  1J59 A;  3BT9 A;  3DU6 A;  1QPI A;  4KMU X;  2ME0 A;  2CU7 A;  3PNY A;  1OQY A;  5B66 C;  1RR7 A;  2BV6 A;  1RUO A;  3LSI A;  5D4R A;  1FOW A;  1PUE E;  4HX7 A;  1IV8 A;  1QP7 A;  1WRJ A;  3C7J A;  4XLH A;  1FMW A;  2L9N A;  3ZXS A;  4UHT A;  1T39 A;  1P4X A;  2JWT A;  3X2Q H;  4NC7 A;  4AVZ A;  4MQ9 F;  3DTK A;  4L5J A;  2CV0 A;  1A04 A;  3M9L A;  4Z6Y A;  1EKE A;  2LYC A;  2A6C A;  2DT7 B;  5DDG A;  1K6Y A;  1WJD A;  3FM3 A;  4JP0 A;  3SFZ A;  1CF7 B;  4RGX A;  4CUG A;  1DDN A;  3GN5 A;  4AUX A;  3DLA A;  4XKV A;  5J1R A;  4A3F J;  3L2V A;  1YSE A;  1WH7 A;  2J7U A;  5B3S H;  3ZHM A;  1ZN2 A;  2OBP A;  1I5Z A;  1GVD A; 
#chains in the Genus database with same CATH homology
 5EG0 B;  1X2M A;  2LY9 A;  5E3N A;  2GRM A;  5GPA A;  2K9N A;  4AYB N;  1MH4 A;  1K61 A;  3I4M J;  4X4I A;  3FIS A;  3BR5 A;  4CYC A;  5C44 J;  1ZQ3 P;  1FTZ A;  1PER L;  5IP7 J;  2DMP A;  2KPJ A;  3PO2 J;  2EQR A;  4W97 A;  2MQK A;  1B0N A;  2ID3 A;  4PU8 A;  2JMW A;  1YRN B;  4FE4 A;  1UXC A;  4BKX A;  2NVY J;  3PXP A;  3OSG A;  4Z5D A;  1WPK A;  2IVB A;  3BD1 A;  2W48 A;  2GBY A;  3BTL A;  3Q0U A;  1MBK A;  1F43 A;  3HEF A;  3O9X A;  4DYR A;  3CMY A;  4Z59 A;  5M3F J;  3HKZ N;  5IP6 A;  1DU6 A;  3TW6 A;  4IHX A;  1B8I B;  5FKM A;  1ZUG A;  1JFS A;  1TWC J;  1LFU P;  2E2H J;  3CQZ J;  3JXD L;  3GBG A;  4JX6 A;  2DA2 A;  1ZKG A;  3B6C A;  4JCX A;  2LTP A;  2IUO A;  2ECB A;  1Z0X A;  2WB1 N;  5DS9 A;  4I6R A;  4YG1 A;  1RES A;  1ADR A;  2HDD A;  1WIZ A;  2M34 A;  4BY1 J;  3SFI A;  3HGG A;  3QPL A;  1JT0 A;  1TWG J;  1ZZ8 A;  2DMN A;  2LFB A;  1U78 A;  3S14 J;  1MSF C;  2E1O A;  2H8R A;  1LE8 B;  2XCJ A;  1SAN A;  3LSJ A;  1K83 J;  2DMQ A;  3NAU A;  4IHY A;  1IC8 A;  2LCV A;  2WAQ N;  5E3O A;  2L0K A;  2O8K A;  2IV1 A;  1JUS A;  4IEJ A;  5BNG A;  2LYS A;  1FJL A;  1Q1V A;  5FLV A;  3LSP A;  1H88 C;  2LYL A;  4Z58 A;  2PPX A;  2KEK A;  1S7E A;  2CUE A;  4C3I J;  2VUM J;  2AXV A;  4X4G A;  3PO3 J;  4BBR J;  1B72 B;  4Y42 A;  3BTC A;  4AC0 A;  3F6W A;  2BJC A;  4C3J J;  2CQQ A;  2E19 A;  2AUW A;  1LMB 3;  4XID A;  2XPU A;  4D5C A;  4A3J J;  3GTK J;  2ID6 A;  1NTC A;  1ZPQ A;  2MEZ A;  3ZOB A;  2LK2 A;  3S2H J;  3GBF A;  1BJZ A;  2AO9 A;  5J1Y A;  1B72 A;  4LOC A;  2PUF A;  1HDD C;  1PRA A;  1BW5 A;  2HXO A;  3B7H A;  1IRZ A;  2NS8 A;  2OR1 L;  1APL C;  1UMQ A;  2K9S A;  4M3D A;  1TWH J;  3OSF A;  1FEX A;  4NDW A;  3F52 A;  4C2M J;  1ORK A;  3B6A A;  3BR0 A;  1JKR C;  4A3M J;  1JGG A;  2YS9 A;  3S17 J;  3OQN A;  3DEW A;  4A69 C;  1O4X A;  3KJX A;  4A93 J;  1JWL A;  3ZQH A;  4PU7 A;  2M9H A;  1ZGW A;  4JYK A;  1ZAY A;  3JRB A;  5IPA A;  2LYP A;  4DZP A;  3QQ6 A;  2O4A A;  1AHD P;  1WGX A;  5EGO B;  5F0H A;  1GV2 A;  3JRE A;  1ENH A;  2PMZ N;  1QP4 A;  5J1U A;  4JX5 A;  2I10 A;  4HNV A;  2VKV A;  3RZO J;  2FD5 A;  4IHV A;  1X58 A;  2VI6 A;  3ZQC A;  3I4N J;  4O8B A;  3FYM A;  5E3M A;  4NDL A;  5EGO A;  1IJW C;  2DJN A;  2R5Z B;  1BW6 A;  2BNN A;  2PUE A;  3TRB A;  5EDN A;  2DA1 A;  4GFB A;  3GTO J;  1TC3 C;  3RQI A;  1ETQ A;  4D7M A;  2DTZ A;  1QP0 A;  1OFC X;  3HGY A;  2COB A;  1ZR2 A;  3IH2 A;  2O9L A;  1I6H J;  3JXB C;  2EZI A;  1RZR D;  2K9Q A;  3GTG J;  3LNQ A;  3S15 J;  4PU3 C;  2EZK A;  1RET A;  1MBE A;  2N8G A;  5M3M J;  3F0C A;  3SCH A;  3PM1 A;  4X4F A;  1AKH B;  3G1M A;  1GUU A;  1POG A;  3JR9 A;  4J1X A;  4MIM A;  1H8A C;  1MH3 A;  2CJJ A;  2EZL A;  3GTL J;  3BDN A;  4I6U A;  3VPR A;  1ZZB A;  1H89 C;  1ETK A;  3IH4 A;  3EUS A;  5EG0 A;  2PIJ A;  3FIW A;  4RDU A;  1JKQ C;  5F27 A;  3HOV J;  3TW7 A;  2MG4 A;  3OIO A;  3UFD A;  1ETY A;  5IP9 J;  4YBA A;  2HOA A;  2L7F P;  2NOG A;  2GRL A;  1ZZC A;  3GTP J;  1WH5 A;  3Q0W A;  3D1N I;  1YRN A;  5K7Z A;  5FKK A;  4RBO A;  1LCC A;  2HXI A;  4EEF G;  2CUF A;  1ZZ7 A;  3HB9 A;  4FCY A;  3LIS A;  2L7M P;  2R63 A;  4A3G J;  5M5X J;  1T33 A;  2L49 A;  3OOU A;  4S0H B;  3KXA A;  4XIC A;  4XRS A;  3BQZ A;  1W0U A;  1ITY A;  2KZ8 A;  2DA5 A;  1ETW A;  4X4D A;  2E2J J;  3A03 A;  1UHS A;  4FN3 A;  3FK6 A;  2LLK A;  1AU7 A;  2DA3 A;  1B8I A;  2E2I J;  1F36 A;  4X4E A;  2XSD C;  1LLI A;  4A3C J;  2XIU A;  2LVS A;  4BY7 J;  5IYC J;  1DU0 A;  2NVX J;  2CSF A;  4X4H A;  5E3L A;  3TED A;  3QWG A;  4X4B A;  1Y9Q A;  3OQO A;  3K7A J;  2HYJ A;  3JRH A;  4MLO A;  2JA5 J;  3O8G A;  4MO7 A;  1XWR A;  3HOX J;  5EF6 A;  2HSG A;  4XK4 A;  4Z5H A;  2IBD A;  3S16 J;  3MN2 A;  1I3Q J;  2R0Q C;  3M4O J;  3RZZ A;  1LE8 A;  4DYC A;  2IAI A;  1RKT A;  2EF8 A;  4DZJ A;  1GV5 A;  4Y7N J;  2M2E A;  1P7I A;  1Y7Y A;  1HCR A;  1UXD A;  1JFT A;  4GHJ A;  3JRA A;  4A3L J;  2WUS R;  3DCF A;  5FKL A;  1MNM C;  1X57 A;  3ZQF A;  1IDY A;  4V2G A;  2P81 A;  3GTJ J;  5C4X J;  5FKN A;  1R63 A;  2PUC A;  1MBJ A;  2OFY A;  1U9O A;  4GQM A;  1JT6 A;  1ZS4 A;  2XB0 X;  1WET A;  1XC5 A;  5DTD A;  2FX0 A;  1RZR A;  1ZTR A;  4A3I J;  2YU9 J;  2JA8 J;  3HDD A;  1ZK8 A;  2LR8 A;  4JCY A;  4M3G A;  4B4C A;  3S1N J;  1OJL A;  3QPS A;  4I76 A;  1GT0 C;  2LP0 A;  2LD5 A;  1WCM J;  1Y1W J;  2HOT A;  3SJM A;  1MSE C;  2CRO A;  1MBG A;  2QCO A;  1OCP A;  1PUF B;  4I6T A;  4YG4 A;  2R1J L;  1BDH A;  1RPE L;  3IH3 A;  4MFE A;  3ZKC A;  4V2F A;  2XPW A;  2XPV A;  4MCX A;  2GM4 A;  3CCY A;  3TP3 A;  1RPW A;  3F51 A;  5EZG A;  1ETV A;  2BNO A;  2XB5 A;  3M3Y J;  4FTH A;  3KZ3 A;  2AXU A;  4J19 A;  2IEK A;  1NEQ A;  5M5Y J;  1POU A;  1UTX A;  3E7L A;  2LYJ A;  4D5F A;  3G1O A;  4A3K J;  4FIS A;  3LSG A;  2Y31 A;  1G2H A;  1IUF A;  3Q3S A;  4I6Z A;  4IVZ A;  2WV1 A;  3BQY A;  3A01 B;  1VPW A;  4M3E A;  4JQD A;  3BR6 A;  3HBL A;  5IOY A;  2DN0 A;  5IYB J;  4DYQ A;  3L1P A;  4BXX J;  3HM5 A;  1TWF J;  2H1K A;  3FMY A;  9ANT A;  1UG2 A;  2RAE A;  2R5Z A;  4XRM A;  2JA6 J;  1QQB A;  1Z77 A;  2LYK A;  1U9N A;  1JUP A;  1NER A;  3OMT A;  3S2D J;  3LOC A;  2ELK A;  1Y1V J;  3UKG A;  2Y30 A;  1U8B A;  3OQM A;  4QSH A;  1XS9 A;  4UUT A;  1MBF A;  3BG3 A;  5K7F A;  2XRL A;  3ZHI A;  3JRD A;  2CQX A;  3GN5 B;  3BR3 A;  2ICT A;  3R1F A;  4L5E A;  1DWK A;  2DA6 A;  2MSY A;  3QF3 A;  1FIA A;  5J3L A;  1W0T A;  1NK3 P;  1XG1 A;  4UUS B;  3LSR A;  1BL0 A;  3A02 A;  4OB4 A;  1LFB A;  1AKH A;  3FKI J;  2OF7 A;  2M0C A;  2LYR A;  3K2A A;  2KEI A;  1ZR4 A;  2TCT A;  1TWA J;  2EWT A;  2EZH A;  3H5T A;  5EZH A;  4Z5C A;  5HOD A;  1ETX A;  1IG7 A;  4A3E J;  5FJ8 J;  2Y2Z A;  4C3H J;  2IVG A;  4IWR A;  1DW9 A;  4UUS A;  1HOM A;  3OP9 A;  2DA7 A;  2G0E A;  4CYC B;  2PUB A;  4PU4 C;  1OSL A;  2Y9Y A;  5C4J J;  5F04 A;  2VPR A;  3VK0 A;  3S1R J;  2B63 J;  1JKP C;  1HDP A;  1JTX A;  3WHB A;  3JRG A;  1GDT A;  4D7N A;  1A6I A;  2KT0 A;  2KEJ A;  2LYQ A;  2TRT A;  3BG5 A;  5IOZ A;  2CRG A;  1OCT C;  1RZS A;  1IV6 A;  3DNV B;  3HOU J;  5F0C A;  1A5J A;  2HI3 A;  2R7Z J;  1L1M A;  4QIW N;  1EF4 A;  4B1R A;  3MLF A;  4IA8 A;  4FBI A;  2GZU A;  4YAR A;  3BR1 A;  1JTY A;  2B5A A;  2JA7 J;  2L7Z A;  1LCD A;  1VF9 A;  1HF0 A;  2JJ7 A;  4A3D J;  2JK3 A;  4XRS G;  2PUA A;  5EYR A;  5F1J A;  1WH6 A;  3JRC A;  4Y52 J;  3LFP A;  2DMT A;  2BNM A;  1BDI A;  3ZQL A;  4FE7 A;  2QF7 A;  2R5Y B;  2JN6 A;  2XGC A;  2O49 A;  3U3W A;  1HLV A;  3BG9 A;  3QYX A;  3O8H A;  4QTR A;  3CLC A;  3G1L A;  4IHW A;  1MBH A;  2R5Y A;  1PNR A;  4BBS J;  1JKO C;  2OPT A;  2PUD A;  3FK7 A;  2L8N A;  3FYA A;  2JVL A;  3SCG A;  1P7J A;  2FJ1 A;  1X2L A;  1JUM A;  2ECC A;  2FJR A;  2AXZ A;  1VI0 A;  3JRF A;  1FIP A;  3H0G J;  2PUG A;  3CDL A;  4M6V A;  1CQT A;  3SCF A;  2XI8 A;  2JCG A;  1ETO A;  3RZD J;  2ICP A;  3SDG A;  3GTQ J;  3HZI B;  3MKL A;  2XGE A;  3H3V K;  2L9R A;  2VKE A;  4JX4 A;  3ZQG A;  2EBI A;  5F0F A;  5C3E J;  3GTM J;  2AW6 A;  2YUS A;  1VFC A;  4X6A J;  1IGN A;  1JJ8 C;  2M8G X;  5FKO A;  2D5V A;  4X4C A;  4MCT A;  4MFD A;  5EEA A;  1D5Y A;  2Y9Z A;  2EH3 A;  2HQ5 A;  2X9D A;  3S1Q J;  2PE5 A;  3HOZ J;  2O7O A;  2MW8 A;  1WI3 A;  3CEC A;  5JLX A;  4ABZ A;  1FTT A;  2AWI A;  5K7H A;  2Y0S N;  3QQA A;  3BS3 A;  2NVQ J;  2EBY A;  1X2N A;  3NAR A;  5FLM J;  1QRY A;  1R9T J;  2K40 A;  2XJ3 A;  2ME6 A;  2ZB9 A;  2R93 J;  1SQ8 A;  1JH9 A;  2HOS A;  1PUF A;  4M3B A;  2X48 A;  3MVP A;  3Q0V A;  3G7D A;  1QPZ A;  1LQC A;  1PRV A;  3HOW J;  2WIU B;  5GP9 A;  1NK2 P;  3G5G A;  2LKX A;  2XGD A;  4DW6 A;  2KDZ A;  3RKQ A;  1RKW A;  3HOY J;  1QVT A;  2IU7 A;  2NS7 A;  3TP0 A;  1ZVV A;  1ZZ6 A;  2R92 J;  1T56 A;  1E3O C;  5IYD J;  2DMU A;  1WH8 A;  3ZQI A;  3CRO L;  4J1W A;  3A01 A;  1JJ6 C;  2MGQ A;  2FQ4 A;  1R69 A;  5F08 A;  4YG7 B;  3BTI A;  3BT9 A;  1SFO J;  1QPI A;  2ME0 A;  2CU7 A;  3JXC L;  2IVQ A;  1RIO A;  2GLO A;  1VND A;  1RR7 A;  4X1E A;  4I8T A;  2HIN A;  3JRI A;  3S8Q A;  2O38 A;  4G12 A;  5M5W J;  4F8D A;  3IV5 A;  5GPC A;  1I50 J;  1QP7 A;  1QQA A;  3C2B A;  1BA5 A;  3W6V A;  3IVP A;  2JWT A;  5JLW A;  2NVT J;  1PRU A;  2AHQ A;  3BR2 A;  2A6C A;  5K98 B;  1QVU A;  4B3A A;  4JP0 A;  3BTJ A;  3GN5 A;  5A7L A;  1ZZ9 A;  1CJG A;  4AUX A;  2X6O A;  3S1M J;  5J1R A;  4A3B J;  3WHC A;  4A3F J;  1IDZ A;  4M3F A;  1YSE A;  1WH7 A;  4W1U A;  1EFA A;  3ZHM A;  1GVD A;  2DA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...