1HFCA

1.56 angstrom structure of mature truncated human fibroblast collagenase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
b'PRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBROBLAST COLLAGENASE
publication title 1.56 A structure of mature truncated human fibroblast collagenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease
total genus 48
structure length 157
sequence length 157
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1994-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1hfcA00
1RM8A 1JKYA 4XM8A 3P1VA 1PWPA 5I4OA 1KUIA 3DL1A 3WV3A 5B5OA 2XS4A 1MNCA 1XFWA 1SLMA 1CGFA 4WKEA 1IACA 2JIHA 2USNA 1FM1A 4A3WA 2W15A 2WO8A 1MMPA 2JT6A 966CA 4GUYA 3HY9A 2Y6DA 1I73A 1CK7A 4H49A 1OS9A 4G9LA 4GR3A 3MA2A 3P24A 2L0RA 1ZTQA 1OM6A 1BUDA 4HX3A 2O3EA 2ERPA 1SATA 1GO8P 3F17A 4H84A 3U1RA 2KRJA 3B8ZA 3F19A 1OM7A 1SLNA 1DTHA 1ROSA 1QJJA 5I2ZA 1Z3JA 4I35A 1G49A 3OHLA 4XM7A 4DPEA 1CGEA 1ZP5A 1FLSA 2OW9A 1AKLA 4FXYP 2W12A 4IJOA 1GE5A 2MZEA 5I12A 1OM8A 3I7GA 2J0TA 2WO9A 4WKIA 5D1SA 2MLRA 3KMEA 1HOVA 1C8TA 1PWWA 1XFUA 1Q3AA 2JT5A 1HTDA 2OVXA 1G4KA 1I76A 1WNIA 1ZXVA 1ASTA 1CIZA 1GE7A 3L0VA 3F15A 1MMBA 2Y6CA 2OVZA 3HBUP 3ZUKA 2DW0A 1ZS0A 4HMAA 1K7QA 1EAKA 1KUKA 1HV5A 1I1IP 1SRPA 2MZIA 3GBOA 3N2UA 1GE6A 1SMPA 3TSKA 1XUDA 2JSDA 2ERQA 1AYKA 4IN9A 1XFZA 2XS3A 1D8MA 2X3CA 4JP4A 4J4MA 2AYKA 1PWVA 4EFSA 3WV1A 1OO9A 1BZSA 2W13A 4GWNA 3KECA 2OI0A 1HFCA 2D1NA 3DWBA 3KWVC 1GKCA 1AF0A 3TS4A 4ILWD 1JIZA 3AIGA 1KBCA 1JJ9A 4FVLA 3CKIA 1DMTA 1R54A 1R1IA 3KRYA 1UMSA 2YIGA 5CZMA 1H71P 3TVCA 1USNA 2K2GA 5I3MA 5BPAA 4WK7A 3LJZA 2J83A 1UEAA 1QIAA 1CAQA 3LKAA 1IAAA 1BKCE 1IAEA 3LGPA 4G0DA 4PKVA 3TT4A 3EHYA 1XFXA 5D3CA 2I47A 1Y8JA 1R1JA 4JA1A 1QJIA 4H30A 2OXWA 4L6TA 3VI1A 1JAPA 3EDZA 3V96B 2YB9A 1YOUA 1KUGA 3DSLA 1J7NA 1BSWA 3LUMA 1HFSA 1B8YA 3LJGA 1FBLA 3NX7A 1ZVXA 3HB2P 3HDBA 1XFVA 1BKCI 1G9KA 2CKIA 4WF6A 2DDYA 2EROA 2N8RA 2OZRA 4GQLA 3KEJA 3RTSA 4AXQA 4CTHA 1ATLA 3ZXHA 1YQYA 4AYKA 456CA 1QICA 4QKZA 2OW2A 5LABA 3AYUA 3G42A 3EDGA 1GKDA 2FV5A 1JH1A 1Y0VA 2HU6A 3LMCA 2X7MA 4FU4A 3LILA 3E8RA 4PKUA 1RMZA 2JNPA 2Z2DA 4GF1A 2OY4A 1B3DA 5BOTA 1G05A 3BA0A 3LQBA 4DD8A 4PKWA 1XFYA 3K7NA 5D1TA 1QUAA 4H82A 4GR0A 1IABA 1BQOA 2OXZA 3Q2GA 3N2VA 1C3IA 1L6JA 2SRTA 3I7IA 5CXAA 3AYKA 1JIWP 1YP1A 2MLSA 2W0DA 3B92A 3G5CA 3DPEA 830CA 1MMRA 4H2EA 1OS2A 3F16A 5BOYA 1UMTA 3Q2HA 1JAQA 2E3XA 4A7BA 4ZR5A 2FV9A 2TCLA 2OW1A 4I03A 1XUCA 3O2XA 3B2ZA 4XBHA 3F1AA 3EDIA 3OHOA 4H76A 2O36A 4L19A 1ND1A 1PWUA 2DDFA 3RTTA 1ZXCA 3VTGA 1BQQM 5JMYA 2X3BA 5H8XA 1XURA 1MMQA 3KMCA 1BM6A 4H3XA 1CQRA 2W14A 2V4BA 1BUVM 1KAPP 5B5PA 3UVCA 2POJA 1CGLA 3LIRA 1G12A 1GO7P 2CLTA 2RJQA 4Q1LA 1GXDA 3DPFA 3L0TA 1Y93A 5D7WA 5I0LA 1D5JA 2WOAA 3ELMA 4DF9A 3EWJA 1SU3A 1K7GA 1BKCA 1EUBA 4GWMA 3HBVP 3LUNA 1HY7A 1R55A 3HDAP 1KUHA 1A85A 3SHIA 1JANA 3HY7A 2DW1A 3USNA 5D1UA 1A86A 4AUOA 3LK8A 5L79A 1D8FA 2PJTA 3LIKA 3LQ0A 3O64A 3WV2A 4JIJA 5I43A 3DNGA 4IUWA 1CXVA 4PKTA 1UTZA 5CUHA 2MZHA 4JPAA 2AIGP 2OY2A 2QPJA 1O0QA 2DW2A 3LEAA 2OXUA 4XM6A 5L7FA 5D2BA 1IAGA 1KUFA 4H1QA 1K7IA 4XCTA 3K7LA 1JK3A 3LE9A 1YCMA 4R3VA 2RJPA 3EDHA 2E2DA 2K9CA 4DV8A 1QIBA 4L63A 3KEKA 3LJTA 3HYGA 3KHIA 3ZVSA 1IADA 1R1HA 1O0TA 4WZVA 1PWQA 3EHXA 1D7XA 4PKRA 2D1OA 4JQGA 4AIGA 1BIWA 1OMJA 4PKQA 4FXQA 3F18A 2X3AA 1EB6A 2A8HA 1JAOA 1UTTA 1C7KA 4GR8A 4PKSA 4ON1A 2OW0A 1S4BP
chains in the Genus database with same CATH superfamily
1RM8A 1JKYA 4XM8A 3P1VA 1PWPA 5I4OA 1KUIA 3DL1A 3WV3A 5B5OA 2XS4A 1MNCA 1XFWA 1SLMA 1CGFA 4WKEA 1IACA 2JIHA 2USNA 1FM1A 4A3WA 2W15A 2WO8A 1MMPA 2JT6A 966CA 4GUYA 3HY9A 2Y6DA 1I73A 1CK7A 3DTKA 4H49A 4L7AA 1OS9A 4G9LA 4GR3A 3MA2A 3P24A 2L0RA 1ZTQA 1OM6A 1BUDA 4HX3A 2O3EA 2ERPA 1SATA 1GO8P 3F17A 4H84A 3U1RA 2KRJA 3B8ZA 3F19A 1OM7A 1SLNA 1DTHA 1ROSA 1QJJA 5I2ZA 1Z3JA 4I35A 1G49A 3OHLA 4XM7A 4DPEA 1CGEA 1ZP5A 3DTEA 1FLSA 2OW9A 1AKLA 4FXYP 2W12A 4IJOA 1GE5A 2MZEA 5I12A 1OM8A 3I7GA 2J0TA 2WO9A 4WKIA 5D1SA 2MLRA 3KMEA 1HOVA 1C8TA 1PWWA 1XFUA 1Q3AA 2JT5A 1HTDA 2OVXA 1G4KA 1I76A 1WNIA 1ZXVA 1ASTA 1CIZA 1GE7A 3L0VA 3F15A 1MMBA 2Y6CA 2OVZA 3HBUP 3ZUKA 2DW0A 1ZS0A 4HMAA 1K7QA 1EAKA 1KUKA 1HV5A 1I1IP 1SRPA 2MZIA 2YUFA 3GBOA 3N2UA 1XM5A 1GE6A 1SMPA 3TSKA 1XUDA 2JSDA 2ERQA 1AYKA 4IN9A 1XFZA 2XS3A 1D8MA 2X3CA 4JP4A 4J4MA 2AYKA 1PWVA 4EFSA 3WV1A 1OO9A 1BZSA 2W13A 4GWNA 3KECA 2OI0A 1HFCA 2D1NA 3DWBA 3KWVC 1GKCA 1AF0A 3TS4A 4ILWD 1JIZA 3AIGA 1KBCA 1JJ9A 4FVLA 3CKIA 1DMTA 1R54A 1R1IA 3KRYA 1UMSA 2YIGA 5CZMA 1H71P 3TVCA 1USNA 2K2GA 5I3MA 5BPAA 4WK7A 3LJZA 2J83A 3DTIA 1UEAA 1QIAA 1CAQA 3LKAA 1IAAA 1BKCE 1IAEA 3LGPA 4G0DA 4PKVA 3TT4A 3EHYA 1XFXA 5D3CA 2I47A 1Y8JA 1R1JA 4JA1A 1QJIA 4H30A 2OXWA 4L6TA 3VI1A 1JAPA 3EDZA 3V96B 2YB9A 1YOUA 1KUGA 3DSLA 1J7NA 1BSWA 3LUMA 1HFSA 1B8YA 3LJGA 1FBLA 3NX7A 1ZVXA 3HB2P 3HDBA 1XFVA 1BKCI 1G9KA 2CKIA 4WF6A 2DDYA 2EROA 2N8RA 2OZRA 4GQLA 3KEJA 3RTSA 4AXQA 4CTHA 1ATLA 3ZXHA 1YQYA 4AYKA 456CA 1QICA 4QKZA 2OW2A 5LABA 3AYUA 3G42A 3EDGA 1GKDA 2FV5A 1JH1A 1Y0VA 2HU6A 3LMCA 2X7MA 4FU4A 3LILA 3E8RA 4PKUA 1RMZA 2JNPA 2Z2DA 4GF1A 2OY4A 1B3DA 5BOTA 1G05A 3BA0A 3LQBA 4DD8A 4PKWA 1XFYA 3K7NA 5D1TA 1QUAA 4H82A 4GR0A 1IABA 1BQOA 2OXZA 3Q2GA 3N2VA 1C3IA 1XAXA 1L6JA 2SRTA 3I7IA 5CXAA 3AYKA 1JIWP 1YP1A 2MLSA 2W0DA 3B92A 3G5CA 3DPEA 830CA 1MMRA 4H2EA 1OS2A 3F16A 5BOYA 1UMTA 3Q2HA 1JAQA 2E3XA 4A7BA 4ZR5A 2FV9A 2TCLA 2OW1A 4I03A 1XUCA 3O2XA 3B2ZA 4XBHA 3F1AA 3EDIA 3OHOA 4H76A 2O36A 4L19A 1ND1A 1PWUA 2DDFA 3RTTA 1ZXCA 3VTGA 1OZ9A 1BQQM 5JMYA 2X3BA 5H8XA 1XURA 1MMQA 3KMCA 1BM6A 4H3XA 1CQRA 2W14A 2V4BA 1BUVM 1KAPP 5B5PA 3UVCA 2POJA 1CGLA 3LIRA 1G12A 1GO7P 2CLTA 2RJQA 4Q1LA 1GXDA 3DPFA 3L0TA 1Y93A 5D7WA 5I0LA 1D5JA 2WOAA 3ELMA 4DF9A 3EWJA 1SU3A 1K7GA 1BKCA 1EUBA 4GWMA 3HBVP 3LUNA 1HY7A 1R55A 3HDAP 1KUHA 1A85A 3SHIA 1JANA 3HY7A 2DW1A 3USNA 5D1UA 1A86A 4AUOA 3LK8A 5L79A 1D8FA 2PJTA 3LIKA 3LQ0A 3O64A 3WV2A 4JIJA 5I43A 3DNGA 4IUWA 1CXVA 4PKTA 1UTZA 5CUHA 2MZHA 4JPAA 2AIGP 2OY2A 1TVIA 2QPJA 1O0QA 2DW2A 3LEAA 2OXUA 4XM6A 5L7FA 5D2BA 1IAGA 1KUFA 4H1QA 1K7IA 4XCTA 3K7LA 1JK3A 3LE9A 1YCMA 4R3VA 2RJPA 3EDHA 2E2DA 2K9CA 4DV8A 1QIBA 4L63A 3KEKA 3LJTA 3HYGA 3KHIA 3ZVSA 1IADA 1R1HA 1O0TA 4WZVA 1PWQA 3EHXA 1D7XA 4PKRA 2D1OA 4JQGA 4AIGA 1BIWA 1OMJA 4PKQA 4FXQA 3F18A 2X3AA 1EB6A 2A8HA 1JAOA 1UTTA 1C7KA 4GR8A 4PKSA 4ON1A 2OW0A 1S4BP
chains in the Genus database with same CATH topology
1RM8A 1JKYA 4XM8A 3P1VA 1PWPA 5I4OA 1KUIA 3DL1A 3WV3A 5B5OA 2XS4A 1MNCA 1XFWA 1SLMA 1CGFA 4WKEA 1IACA 2JIHA 2USNA 1FM1A 4A3WA 2W15A 2WO8A 1MMPA 2JT6A 966CA 4GUYA 3HY9A 2Y6DA 1I73A 1CK7A 3DTKA 4H49A 4L7AA 1OS9A 4G9LA 4GR3A 3MA2A 3P24A 2L0RA 1ZTQA 1OM6A 1BUDA 4HX3A 2O3EA 2ERPA 1SATA 1GO8P 3F17A 4H84A 3U1RA 2KRJA 3B8ZA 3F19A 1OM7A 1SLNA 1DTHA 1ROSA 1QJJA 5I2ZA 1Z3JA 4I35A 1G49A 3OHLA 4XM7A 4DPEA 1CGEA 1ZP5A 3DTEA 1FLSA 2OW9A 1AKLA 4FXYP 2W12A 4IJOA 1GE5A 2MZEA 5I12A 1OM8A 3I7GA 2J0TA 2WO9A 4WKIA 5D1SA 2MLRA 3KMEA 1HOVA 1C8TA 1PWWA 1XFUA 1Q3AA 2JT5A 1HTDA 2OVXA 1G4KA 1I76A 1WNIA 1ZXVA 1ASTA 1CIZA 1GE7A 3L0VA 3F15A 1MMBA 2Y6CA 2OVZA 3HBUP 3ZUKA 2DW0A 1ZS0A 4HMAA 1K7QA 1EAKA 1KUKA 1HV5A 1I1IP 1SRPA 2MZIA 2YUFA 3GBOA 3N2UA 1GE6A 1SMPA 3TSKA 1XUDA 2JSDA 2ERQA 1AYKA 4IN9A 1XFZA 2XS3A 1D8MA 2X3CA 4JP4A 4J4MA 2AYKA 1PWVA 4EFSA 3WV1A 1OO9A 1BZSA 2W13A 4GWNA 3KECA 2OI0A 1HFCA 2D1NA 3DWBA 3KWVC 1GKCA 1AF0A 3TS4A 4ILWD 1JIZA 3AIGA 1KBCA 1JJ9A 4FVLA 3CKIA 1DMTA 1R54A 1R1IA 3KRYA 1UMSA 2YIGA 5CZMA 1H71P 3TVCA 1USNA 2K2GA 5I3MA 5BPAA 4WK7A 3LJZA 2J83A 3DTIA 1UEAA 1QIAA 1CAQA 3LKAA 1IAAA 1BKCE 1IAEA 3LGPA 4G0DA 4PKVA 3TT4A 3EHYA 1XFXA 5D3CA 2I47A 1Y8JA 1R1JA 4JA1A 1QJIA 4H30A 2OXWA 4L6TA 3VI1A 1JAPA 3EDZA 3V96B 2YB9A 1YOUA 1KUGA 3DSLA 1J7NA 1BSWA 3LUMA 1HFSA 1B8YA 3LJGA 1FBLA 3NX7A 1ZVXA 3HB2P 3HDBA 1XFVA 1BKCI 1G9KA 2CKIA 4WF6A 2DDYA 2EROA 2N8RA 2OZRA 4GQLA 3KEJA 3RTSA 4AXQA 4CTHA 1ATLA 3ZXHA 1YQYA 4AYKA 456CA 1QICA 4QKZA 2OW2A 5LABA 3AYUA 3G42A 3EDGA 1GKDA 2FV5A 1JH1A 1Y0VA 2HU6A 3LMCA 2X7MA 4FU4A 3LILA 3E8RA 4PKUA 1RMZA 2JNPA 2Z2DA 4GF1A 2OY4A 1B3DA 5BOTA 1G05A 3BA0A 3LQBA 4DD8A 4PKWA 1XFYA 3K7NA 5D1TA 1QUAA 4H82A 4GR0A 1IABA 1BQOA 2OXZA 3Q2GA 3N2VA 1C3IA 1L6JA 2SRTA 3I7IA 5CXAA 3AYKA 1JIWP 1YP1A 2MLSA 2W0DA 3B92A 3G5CA 3DPEA 830CA 1MMRA 4H2EA 1OS2A 3F16A 5BOYA 1UMTA 3Q2HA 1JAQA 2E3XA 4A7BA 4ZR5A 2FV9A 2TCLA 2OW1A 4I03A 1XUCA 3O2XA 3B2ZA 4XBHA 3F1AA 3EDIA 3OHOA 4H76A 2O36A 4L19A 1ND1A 1PWUA 2DDFA 3RTTA 1ZXCA 3VTGA 1BQQM 5JMYA 2X3BA 5H8XA 1XURA 1MMQA 3KMCA 1BM6A 4H3XA 1CQRA 2W14A 2V4BA 1BUVM 1KAPP 5B5PA 3UVCA 2POJA 1CGLA 3LIRA 1G12A 1GO7P 2CLTA 2RJQA 4Q1LA 1GXDA 3DPFA 3L0TA 1Y93A 5D7WA 5I0LA 1D5JA 2WOAA 3ELMA 4DF9A 3EWJA 1SU3A 1K7GA 1BKCA 1EUBA 4GWMA 3HBVP 3LUNA 1HY7A 1R55A 3HDAP 1KUHA 1A85A 3SHIA 1JANA 3HY7A 2DW1A 3USNA 5D1UA 1A86A 4AUOA 3LK8A 5L79A 1D8FA 2PJTA 3LIKA 3LQ0A 3O64A 3WV2A 4JIJA 5I43A 3DNGA 4IUWA 1CXVA 4PKTA 1UTZA 5CUHA 2MZHA 4JPAA 2AIGP 2OY2A 2QPJA 1O0QA 2DW2A 3LEAA 2OXUA 4XM6A 5L7FA 5D2BA 1IAGA 1KUFA 4H1QA 1K7IA 4XCTA 3K7LA 1JK3A 3LE9A 1YCMA 4R3VA 2RJPA 3EDHA 2E2DA 2K9CA 4DV8A 1QIBA 4L63A 3KEKA 3LJTA 3HYGA 3KHIA 3ZVSA 1IADA 1R1HA 1O0TA 4WZVA 1PWQA 3EHXA 1D7XA 4PKRA 2D1OA 4JQGA 4AIGA 1BIWA 1OMJA 4PKQA 4FXQA 3F18A 2X3AA 1EB6A 2A8HA 1JAOA 1UTTA 1C7KA 4GR8A 4PKSA 4ON1A 2OW0A 1S4BP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RM8 A;  1JKY A;  4XM8 A;  3P1V A;  1PWP A;  5I4O A;  1KUI A;  3DL1 A;  3WV3 A;  5B5O A;  2XS4 A;  1MNC A;  1XFW A;  1SLM A;  1CGF A;  4WKE A;  1IAC A;  2JIH A;  2USN A;  1FM1 A;  4A3W A;  2W15 A;  2WO8 A;  1MMP A;  2JT6 A;  966C A;  4GUY A;  3HY9 A;  2Y6D A;  1I73 A;  1CK7 A;  4H49 A;  1OS9 A;  4G9L A;  4GR3 A;  3MA2 A;  3P24 A;  2L0R A;  1ZTQ A;  1OM6 A;  1BUD A;  4HX3 A;  2O3E A;  2ERP A;  1SAT A;  1GO8 P;  3F17 A;  4H84 A;  3U1R A;  2KRJ A;  3B8Z A;  3F19 A;  1OM7 A;  1SLN A;  1DTH A;  1ROS A;  1QJJ A;  5I2Z A;  1Z3J A;  4I35 A;  1G49 A;  3OHL A;  4XM7 A;  4DPE A;  1CGE A;  1ZP5 A;  1FLS A;  2OW9 A;  1AKL A;  4FXY P;  2W12 A;  4IJO A;  1GE5 A;  2MZE A;  5I12 A;  1OM8 A;  3I7G A;  2J0T A;  2WO9 A;  4WKI A;  5D1S A;  2MLR A;  3KME A;  1HOV A;  1C8T A;  1PWW A;  1XFU A;  1Q3A A;  2JT5 A;  1HTD A;  2OVX A;  1G4K A;  1I76 A;  1WNI A;  1ZXV A;  1AST A;  1CIZ A;  1GE7 A;  3L0V A;  3F15 A;  1MMB A;  2Y6C A;  2OVZ A;  3HBU P;  3ZUK A;  2DW0 A;  1ZS0 A;  4HMA A;  1K7Q A;  1EAK A;  1KUK A;  1HV5 A;  1I1I P;  1SRP A;  2MZI A;  3GBO A;  3N2U A;  1GE6 A;  1SMP A;  3TSK A;  1XUD A;  2JSD A;  2ERQ A;  1AYK A;  4IN9 A;  1XFZ A;  2XS3 A;  1D8M A;  2X3C A;  4JP4 A;  4J4M A;  2AYK A;  1PWV A;  4EFS A;  3WV1 A;  1OO9 A;  1BZS A;  2W13 A;  4GWN A;  3KEC A;  2OI0 A;  1HFC A;  2D1N A;  3DWB A;  3KWV C;  1GKC A;  1AF0 A;  3TS4 A;  4ILW D;  1JIZ A;  3AIG A;  1KBC A;  1JJ9 A;  4FVL A;  3CKI A;  1DMT A;  1R54 A;  1R1I A;  3KRY A;  1UMS A;  2YIG A;  5CZM A;  1H71 P;  3TVC A;  1USN A;  2K2G A;  5I3M A;  5BPA A;  4WK7 A;  3LJZ A;  2J83 A;  1UEA A;  1QIA A;  1CAQ A;  3LKA A;  1IAA A;  1BKC E;  1IAE A;  3LGP A;  4G0D A;  4PKV A;  3TT4 A;  3EHY A;  1XFX A;  5D3C A;  2I47 A;  1Y8J A;  1R1J A;  4JA1 A;  1QJI A;  4H30 A;  2OXW A;  4L6T A;  3VI1 A;  1JAP A;  3EDZ A;  3V96 B;  2YB9 A;  1YOU A;  1KUG A;  3DSL A;  1J7N A;  1BSW A;  3LUM A;  1HFS A;  1B8Y A;  3LJG A;  1FBL A;  3NX7 A;  1ZVX A;  3HB2 P;  3HDB A;  1XFV A;  1BKC I;  1G9K A;  2CKI A;  4WF6 A;  2DDY A;  2ERO A;  2N8R A;  2OZR A;  4GQL A;  3KEJ A;  3RTS A;  4AXQ A;  4CTH A;  1ATL A;  3ZXH A;  1YQY A;  4AYK A;  456C A;  1QIC A;  4QKZ A;  2OW2 A;  5LAB A;  3AYU A;  3G42 A;  3EDG A;  1GKD A;  2FV5 A;  1JH1 A;  1Y0V A;  2HU6 A;  3LMC A;  2X7M A;  4FU4 A;  3LIL A;  3E8R A;  4PKU A;  1RMZ A;  2JNP A;  2Z2D A;  4GF1 A;  2OY4 A;  1B3D A;  5BOT A;  1G05 A;  3BA0 A;  3LQB A;  4DD8 A;  4PKW A;  1XFY A;  3K7N A;  5D1T A;  1QUA A;  4H82 A;  4GR0 A;  1IAB A;  1BQO A;  2OXZ A;  3Q2G A;  3N2V A;  1C3I A;  1L6J A;  2SRT A;  3I7I A;  5CXA A;  3AYK A;  1JIW P;  1YP1 A;  2MLS A;  2W0D A;  3B92 A;  3G5C A;  3DPE A;  830C A;  1MMR A;  4H2E A;  1OS2 A;  3F16 A;  5BOY A;  1UMT A;  3Q2H A;  1JAQ A;  2E3X A;  4A7B A;  4ZR5 A;  2FV9 A;  2TCL A;  2OW1 A;  4I03 A;  1XUC A;  3O2X A;  3B2Z A;  4XBH A;  3F1A A;  3EDI A;  3OHO A;  4H76 A;  2O36 A;  4L19 A;  1ND1 A;  1PWU A;  2DDF A;  3RTT A;  1ZXC A;  3VTG A;  1BQQ M;  5JMY A;  2X3B A;  5H8X A;  1XUR A;  1MMQ A;  3KMC A;  1BM6 A;  4H3X A;  1CQR A;  2W14 A;  2V4B A;  1BUV M;  1KAP P;  5B5P A;  3UVC A;  2POJ A;  1CGL A;  3LIR A;  1G12 A;  1GO7 P;  2CLT A;  2RJQ A;  4Q1L A;  1GXD A;  3DPF A;  3L0T A;  1Y93 A;  5D7W A;  5I0L A;  1D5J A;  2WOA A;  3ELM A;  4DF9 A;  3EWJ A;  1SU3 A;  1K7G A;  1BKC A;  1EUB A;  4GWM A;  3HBV P;  3LUN A;  1HY7 A;  1R55 A;  3HDA P;  1KUH A;  1A85 A;  3SHI A;  1JAN A;  3HY7 A;  2DW1 A;  3USN A;  5D1U A;  1A86 A;  4AUO A;  3LK8 A;  5L79 A;  1D8F A;  2PJT A;  3LIK A;  3LQ0 A;  3O64 A;  3WV2 A;  4JIJ A;  5I43 A;  3DNG A;  4IUW A;  1CXV A;  4PKT A;  1UTZ A;  5CUH A;  2MZH A;  4JPA A;  2AIG P;  2OY2 A;  2QPJ A;  1O0Q A;  2DW2 A;  3LEA A;  2OXU A;  4XM6 A;  5L7F A;  5D2B A;  1IAG A;  1KUF A;  4H1Q A;  1K7I A;  4XCT A;  3K7L A;  1JK3 A;  3LE9 A;  1YCM A;  4R3V A;  2RJP A;  3EDH A;  2E2D A;  2K9C A;  4DV8 A;  1QIB A;  4L63 A;  3KEK A;  3LJT A;  3HYG A;  3KHI A;  3ZVS A;  1IAD A;  1R1H A;  1O0T A;  4WZV A;  1PWQ A;  3EHX A;  1D7X A;  4PKR A;  2D1O A;  4JQG A;  4AIG A;  1BIW A;  1OMJ A;  4PKQ A;  4FXQ A;  3F18 A;  2X3A A;  1EB6 A;  2A8H A;  1JAO A;  1UTT A;  1C7K A;  4GR8 A;  4PKS A;  4ON1 A;  2OW0 A;  1S4B P; 
#chains in the Genus database with same CATH topology
 1RM8 A;  1JKY A;  4XM8 A;  3P1V A;  1PWP A;  5I4O A;  1KUI A;  3DL1 A;  3WV3 A;  5B5O A;  2XS4 A;  1MNC A;  1XFW A;  1SLM A;  1CGF A;  4WKE A;  1IAC A;  2JIH A;  2USN A;  1FM1 A;  4A3W A;  2W15 A;  2WO8 A;  1MMP A;  2JT6 A;  966C A;  4GUY A;  3HY9 A;  2Y6D A;  1I73 A;  1CK7 A;  3DTK A;  4H49 A;  4L7A A;  1OS9 A;  4G9L A;  4GR3 A;  3MA2 A;  3P24 A;  2L0R A;  1ZTQ A;  1OM6 A;  1BUD A;  4HX3 A;  2O3E A;  2ERP A;  1SAT A;  1GO8 P;  3F17 A;  4H84 A;  3U1R A;  2KRJ A;  3B8Z A;  3F19 A;  1OM7 A;  1SLN A;  1DTH A;  1ROS A;  1QJJ A;  5I2Z A;  1Z3J A;  4I35 A;  1G49 A;  3OHL A;  4XM7 A;  4DPE A;  1CGE A;  1ZP5 A;  3DTE A;  1FLS A;  2OW9 A;  1AKL A;  4FXY P;  2W12 A;  4IJO A;  1GE5 A;  2MZE A;  5I12 A;  1OM8 A;  3I7G A;  2J0T A;  2WO9 A;  4WKI A;  5D1S A;  2MLR A;  3KME A;  1HOV A;  1C8T A;  1PWW A;  1XFU A;  1Q3A A;  2JT5 A;  1HTD A;  2OVX A;  1G4K A;  1I76 A;  1WNI A;  1ZXV A;  1AST A;  1CIZ A;  1GE7 A;  3L0V A;  3F15 A;  1MMB A;  2Y6C A;  2OVZ A;  3HBU P;  3ZUK A;  2DW0 A;  1ZS0 A;  4HMA A;  1K7Q A;  1EAK A;  1KUK A;  1HV5 A;  1I1I P;  1SRP A;  2MZI A;  2YUF A;  3GBO A;  3N2U A;  1XM5 A;  1GE6 A;  1SMP A;  3TSK A;  1XUD A;  2JSD A;  2ERQ A;  1AYK A;  4IN9 A;  1XFZ A;  2XS3 A;  1D8M A;  2X3C A;  4JP4 A;  4J4M A;  2AYK A;  1PWV A;  4EFS A;  3WV1 A;  1OO9 A;  1BZS A;  2W13 A;  4GWN A;  3KEC A;  2OI0 A;  1HFC A;  2D1N A;  3DWB A;  3KWV C;  1GKC A;  1AF0 A;  3TS4 A;  4ILW D;  1JIZ A;  3AIG A;  1KBC A;  1JJ9 A;  4FVL A;  3CKI A;  1DMT A;  1R54 A;  1R1I A;  3KRY A;  1UMS A;  2YIG A;  5CZM A;  1H71 P;  3TVC A;  1USN A;  2K2G A;  5I3M A;  5BPA A;  4WK7 A;  3LJZ A;  2J83 A;  3DTI A;  1UEA A;  1QIA A;  1CAQ A;  3LKA A;  1IAA A;  1BKC E;  1IAE A;  3LGP A;  4G0D A;  4PKV A;  3TT4 A;  3EHY A;  1XFX A;  5D3C A;  2I47 A;  1Y8J A;  1R1J A;  4JA1 A;  1QJI A;  4H30 A;  2OXW A;  4L6T A;  3VI1 A;  1JAP A;  3EDZ A;  3V96 B;  2YB9 A;  1YOU A;  1KUG A;  3DSL A;  1J7N A;  1BSW A;  3LUM A;  1HFS A;  1B8Y A;  3LJG A;  1FBL A;  3NX7 A;  1ZVX A;  3HB2 P;  3HDB A;  1XFV A;  1BKC I;  1G9K A;  2CKI A;  4WF6 A;  2DDY A;  2ERO A;  2N8R A;  2OZR A;  4GQL A;  3KEJ A;  3RTS A;  4AXQ A;  4CTH A;  1ATL A;  3ZXH A;  1YQY A;  4AYK A;  456C A;  1QIC A;  4QKZ A;  2OW2 A;  5LAB A;  3AYU A;  3G42 A;  3EDG A;  1GKD A;  2FV5 A;  1JH1 A;  1Y0V A;  2HU6 A;  3LMC A;  2X7M A;  4FU4 A;  3LIL A;  3E8R A;  4PKU A;  1RMZ A;  2JNP A;  2Z2D A;  4GF1 A;  2OY4 A;  1B3D A;  5BOT A;  1G05 A;  3BA0 A;  3LQB A;  4DD8 A;  4PKW A;  1XFY A;  3K7N A;  5D1T A;  1QUA A;  4H82 A;  4GR0 A;  1IAB A;  1BQO A;  2OXZ A;  3Q2G A;  3N2V A;  1C3I A;  1XAX A;  1L6J A;  2SRT A;  3I7I A;  5CXA A;  3AYK A;  1JIW P;  1YP1 A;  2MLS A;  2W0D A;  3B92 A;  3G5C A;  3DPE A;  830C A;  1MMR A;  4H2E A;  1OS2 A;  3F16 A;  5BOY A;  1UMT A;  3Q2H A;  1JAQ A;  2E3X A;  4A7B A;  4ZR5 A;  2FV9 A;  2TCL A;  2OW1 A;  4I03 A;  1XUC A;  3O2X A;  3B2Z A;  4XBH A;  3F1A A;  3EDI A;  3OHO A;  4H76 A;  2O36 A;  4L19 A;  1ND1 A;  1PWU A;  2DDF A;  3RTT A;  1ZXC A;  3VTG A;  1OZ9 A;  1BQQ M;  5JMY A;  2X3B A;  5H8X A;  1XUR A;  1MMQ A;  3KMC A;  1BM6 A;  4H3X A;  1CQR A;  2W14 A;  2V4B A;  1BUV M;  1KAP P;  5B5P A;  3UVC A;  2POJ A;  1CGL A;  3LIR A;  1G12 A;  1GO7 P;  2CLT A;  2RJQ A;  4Q1L A;  1GXD A;  3DPF A;  3L0T A;  1Y93 A;  5D7W A;  5I0L A;  1D5J A;  2WOA A;  3ELM A;  4DF9 A;  3EWJ A;  1SU3 A;  1K7G A;  1BKC A;  1EUB A;  4GWM A;  3HBV P;  3LUN A;  1HY7 A;  1R55 A;  3HDA P;  1KUH A;  1A85 A;  3SHI A;  1JAN A;  3HY7 A;  2DW1 A;  3USN A;  5D1U A;  1A86 A;  4AUO A;  3LK8 A;  5L79 A;  1D8F A;  2PJT A;  3LIK A;  3LQ0 A;  3O64 A;  3WV2 A;  4JIJ A;  5I43 A;  3DNG A;  4IUW A;  1CXV A;  4PKT A;  1UTZ A;  5CUH A;  2MZH A;  4JPA A;  2AIG P;  2OY2 A;  1TVI A;  2QPJ A;  1O0Q A;  2DW2 A;  3LEA A;  2OXU A;  4XM6 A;  5L7F A;  5D2B A;  1IAG A;  1KUF A;  4H1Q A;  1K7I A;  4XCT A;  3K7L A;  1JK3 A;  3LE9 A;  1YCM A;  4R3V A;  2RJP A;  3EDH A;  2E2D A;  2K9C A;  4DV8 A;  1QIB A;  4L63 A;  3KEK A;  3LJT A;  3HYG A;  3KHI A;  3ZVS A;  1IAD A;  1R1H A;  1O0T A;  4WZV A;  1PWQ A;  3EHX A;  1D7X A;  4PKR A;  2D1O A;  4JQG A;  4AIG A;  1BIW A;  1OMJ A;  4PKQ A;  4FXQ A;  3F18 A;  2X3A A;  1EB6 A;  2A8H A;  1JAO A;  1UTT A;  1C7K A;  4GR8 A;  4PKS A;  4ON1 A;  2OW0 A;  1S4B P; 
#chains in the Genus database with same CATH homology
 1RM8 A;  1JKY A;  4XM8 A;  3P1V A;  1PWP A;  5I4O A;  1KUI A;  3DL1 A;  3WV3 A;  5B5O A;  2XS4 A;  1MNC A;  1XFW A;  1SLM A;  1CGF A;  4WKE A;  1IAC A;  2JIH A;  2USN A;  1FM1 A;  4A3W A;  2W15 A;  2WO8 A;  1MMP A;  2JT6 A;  966C A;  4GUY A;  3HY9 A;  2Y6D A;  1I73 A;  1CK7 A;  3DTK A;  4H49 A;  4L7A A;  1OS9 A;  4G9L A;  4GR3 A;  3MA2 A;  3P24 A;  2L0R A;  1ZTQ A;  1OM6 A;  1BUD A;  4HX3 A;  2O3E A;  2ERP A;  1SAT A;  1GO8 P;  3F17 A;  4H84 A;  3U1R A;  2KRJ A;  3B8Z A;  3F19 A;  1OM7 A;  1SLN A;  1DTH A;  1ROS A;  1QJJ A;  5I2Z A;  1Z3J A;  4I35 A;  1G49 A;  3OHL A;  4XM7 A;  4DPE A;  1CGE A;  1ZP5 A;  3DTE A;  1FLS A;  2OW9 A;  1AKL A;  4FXY P;  2W12 A;  4IJO A;  1GE5 A;  2MZE A;  5I12 A;  1OM8 A;  3I7G A;  2J0T A;  2WO9 A;  4WKI A;  5D1S A;  2MLR A;  3KME A;  1HOV A;  1C8T A;  1PWW A;  1XFU A;  1Q3A A;  2JT5 A;  1HTD A;  2OVX A;  1G4K A;  1I76 A;  1WNI A;  1ZXV A;  1AST A;  1CIZ A;  1GE7 A;  3L0V A;  3F15 A;  1MMB A;  2Y6C A;  2OVZ A;  3HBU P;  3ZUK A;  2DW0 A;  1ZS0 A;  4HMA A;  1K7Q A;  1EAK A;  1KUK A;  1HV5 A;  1I1I P;  1SRP A;  2MZI A;  2YUF A;  3GBO A;  3N2U A;  1GE6 A;  1SMP A;  3TSK A;  1XUD A;  2JSD A;  2ERQ A;  1AYK A;  4IN9 A;  1XFZ A;  2XS3 A;  1D8M A;  2X3C A;  4JP4 A;  4J4M A;  2AYK A;  1PWV A;  4EFS A;  3WV1 A;  1OO9 A;  1BZS A;  2W13 A;  4GWN A;  3KEC A;  2OI0 A;  1HFC A;  2D1N A;  3DWB A;  3KWV C;  1GKC A;  1AF0 A;  3TS4 A;  4ILW D;  1JIZ A;  3AIG A;  1KBC A;  1JJ9 A;  4FVL A;  3CKI A;  1DMT A;  1R54 A;  1R1I A;  3KRY A;  1UMS A;  2YIG A;  5CZM A;  1H71 P;  3TVC A;  1USN A;  2K2G A;  5I3M A;  5BPA A;  4WK7 A;  3LJZ A;  2J83 A;  3DTI A;  1UEA A;  1QIA A;  1CAQ A;  3LKA A;  1IAA A;  1BKC E;  1IAE A;  3LGP A;  4G0D A;  4PKV A;  3TT4 A;  3EHY A;  1XFX A;  5D3C A;  2I47 A;  1Y8J A;  1R1J A;  4JA1 A;  1QJI A;  4H30 A;  2OXW A;  4L6T A;  3VI1 A;  1JAP A;  3EDZ A;  3V96 B;  2YB9 A;  1YOU A;  1KUG A;  3DSL A;  1J7N A;  1BSW A;  3LUM A;  1HFS A;  1B8Y A;  3LJG A;  1FBL A;  3NX7 A;  1ZVX A;  3HB2 P;  3HDB A;  1XFV A;  1BKC I;  1G9K A;  2CKI A;  4WF6 A;  2DDY A;  2ERO A;  2N8R A;  2OZR A;  4GQL A;  3KEJ A;  3RTS A;  4AXQ A;  4CTH A;  1ATL A;  3ZXH A;  1YQY A;  4AYK A;  456C A;  1QIC A;  4QKZ A;  2OW2 A;  5LAB A;  3AYU A;  3G42 A;  3EDG A;  1GKD A;  2FV5 A;  1JH1 A;  1Y0V A;  2HU6 A;  3LMC A;  2X7M A;  4FU4 A;  3LIL A;  3E8R A;  4PKU A;  1RMZ A;  2JNP A;  2Z2D A;  4GF1 A;  2OY4 A;  1B3D A;  5BOT A;  1G05 A;  3BA0 A;  3LQB A;  4DD8 A;  4PKW A;  1XFY A;  3K7N A;  5D1T A;  1QUA A;  4H82 A;  4GR0 A;  1IAB A;  1BQO A;  2OXZ A;  3Q2G A;  3N2V A;  1C3I A;  1L6J A;  2SRT A;  3I7I A;  5CXA A;  3AYK A;  1JIW P;  1YP1 A;  2MLS A;  2W0D A;  3B92 A;  3G5C A;  3DPE A;  830C A;  1MMR A;  4H2E A;  1OS2 A;  3F16 A;  5BOY A;  1UMT A;  3Q2H A;  1JAQ A;  2E3X A;  4A7B A;  4ZR5 A;  2FV9 A;  2TCL A;  2OW1 A;  4I03 A;  1XUC A;  3O2X A;  3B2Z A;  4XBH A;  3F1A A;  3EDI A;  3OHO A;  4H76 A;  2O36 A;  4L19 A;  1ND1 A;  1PWU A;  2DDF A;  3RTT A;  1ZXC A;  3VTG A;  1BQQ M;  5JMY A;  2X3B A;  5H8X A;  1XUR A;  1MMQ A;  3KMC A;  1BM6 A;  4H3X A;  1CQR A;  2W14 A;  2V4B A;  1BUV M;  1KAP P;  5B5P A;  3UVC A;  2POJ A;  1CGL A;  3LIR A;  1G12 A;  1GO7 P;  2CLT A;  2RJQ A;  4Q1L A;  1GXD A;  3DPF A;  3L0T A;  1Y93 A;  5D7W A;  5I0L A;  1D5J A;  2WOA A;  3ELM A;  4DF9 A;  3EWJ A;  1SU3 A;  1K7G A;  1BKC A;  1EUB A;  4GWM A;  3HBV P;  3LUN A;  1HY7 A;  1R55 A;  3HDA P;  1KUH A;  1A85 A;  3SHI A;  1JAN A;  3HY7 A;  2DW1 A;  3USN A;  5D1U A;  1A86 A;  4AUO A;  3LK8 A;  5L79 A;  1D8F A;  2PJT A;  3LIK A;  3LQ0 A;  3O64 A;  3WV2 A;  4JIJ A;  5I43 A;  3DNG A;  4IUW A;  1CXV A;  4PKT A;  1UTZ A;  5CUH A;  2MZH A;  4JPA A;  2AIG P;  2OY2 A;  2QPJ A;  1O0Q A;  2DW2 A;  3LEA A;  2OXU A;  4XM6 A;  5L7F A;  5D2B A;  1IAG A;  1KUF A;  4H1Q A;  1K7I A;  4XCT A;  3K7L A;  1JK3 A;  3LE9 A;  1YCM A;  4R3V A;  2RJP A;  3EDH A;  2E2D A;  2K9C A;  4DV8 A;  1QIB A;  4L63 A;  3KEK A;  3LJT A;  3HYG A;  3KHI A;  3ZVS A;  1IAD A;  1R1H A;  1O0T A;  4WZV A;  1PWQ A;  3EHX A;  1D7X A;  4PKR A;  2D1O A;  4JQG A;  4AIG A;  1BIW A;  1OMJ A;  4PKQ A;  4FXQ A;  3F18 A;  2X3A A;  1EB6 A;  2A8H A;  1JAO A;  1UTT A;  1C7K A;  4GR8 A;  4PKS A;  4ON1 A;  2OW0 A;  1S4B P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...