1HFCA

1.56 angstrom structure of mature truncated human fibroblast collagenase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
157
structure length
157
Chain Sequence
PRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBROBLAST COLLAGENASE
publication title 1.56 A structure of mature truncated human fibroblast collagenase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metalloprotease
total genus 48
structure length 157
sequence length 157
ec nomenclature ec 3.4.24.7: Interstitial collagenase.
pdb deposition date 1994-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1hfcA00
1L6JA 1JH1A 830CA 1UMSA 1JKYA 1QIBA 3LEAA 1CGFA 1KUIA 3P24A 3LGPA 2JIHA 1XUCA 1R1HA 4XCTA 2SRTA 4GR3A 4JQGA 1QUAA 2TCLA 4AYKA 4JIJA 3HDBA 2HU6A 1JK3A 3LILA 456CA 3HY9A 2MZEA 1YOUA 1Y8JA 1AF0A 1CQRA 4ILWD 3DPFA 3ELMA 4GR8A 4IN9A 5D3CA 1OS9A 1UTTA 4FVLA 3WV2A 1ZS0A 1KUKA 4G9LA 4A7BA 1KUGA 4FXYP 3OHOA 1ZVXA 3G5CA 2JT5A 4AUOA 2ERPA 3K7LA 3L0TA 1JIWP 4ZR5A 3AYKA 5CZMA 3N2UA 4PKVA 2YIGA 4PKUA 3KECA 5I3MA 3EDGA 4GWNA 1R1JA 3L0VA 1OS2A 3K7NA 1SRPA 1BSWA 4IUWA 3O64A 5H8XA 3VI1A 966CA 2MLRA 2J0TA 1IADA 2WO8A 1Y93A 1ROSA 1QJJA 1CAQA 3LK8A 4JP4A 3V96B 3LMCA 3EDHA 4L63A 1QJIA 1KUFA 3TSKA 4R3VA 5D1UA 2O36A 2YB9A 1G05A 3E8RA 1KUHA 5CUHA 2K2GA 1JANA 1B3DA 1K7GA 4Q1LA 4J4MA 1PWVA 3F16A 5B5OA 1K7QA 2FV5A 4EFSA 3Q2HA 1HTDA 3EHYA 1HOVA 2XS4A 4I35A 3UVCA 4A3WA 3LUNA 3KWVC 3VTGA 2CLTA 1D7XA 1OO9A 3CKIA 2I47A 3B2ZA 4I03A 3KEJA 1YCMA 1JJ9A 1HV5A 1BKCI 4AXQA 2OW2A 4DF9A 3KRYA 1KAPP 2POJA 2J83A 3NX7A 1JAPA 2AIGP 2QPJA 1K7IA 1DTHA 2OI0A 1ATLA 4GR0A 1SLNA 1I1IP 2DDFA 3USNA 2OZRA 1ZTQA 1AYKA 3I7GA 1XFWA 2X3BA 2KRJA 1PWPA 3HB2P 4PKQA 1FLSA 3HYGA 3ZUKA 2OY2A 3AIGA 4H76A 1XFZA 2OW0A 1OM8A 1AKLA 1OMJA 2K9CA 3DWBA 1ZP5A 4DD8A 2JNPA 2OVZA 1XFYA 1MMBA 5BOTA 4CTHA 4IJOA 2XS3A 1GXDA 3EDZA 5BOYA 1C8TA 2RJQA 3F17A 1O0QA 4H82A 2O3EA 2W12A 2L0RA 1UMTA 2RJPA 1ASTA 1B8YA 1D5JA 2OXUA 1ZXVA 3KEKA 1BQOA 4H1QA 4H84A 3WV3A 2DW2A 1J7NA 1PWUA 1XURA 2JSDA 5I0LA 1HFSA 4GF1A 1MNCA 3LJZA 2D1NA 3RTTA 2AYKA 2MZHA 4G0DA 3ZVSA 1A85A 2W15A 4WKIA 1G9KA 3F19A 1WNIA 1YQYA 3MA2A 4HMAA 3F1AA 1ZXCA 1MMPA 5B5PA 5JMYA 1EUBA 3DPEA 2DW1A 3LJGA 1HFCA 1CGEA 1IAAA 2MLSA 3EDIA 1GE6A 1I76A 5BPAA 4FXQA 1R55A 3KMEA 1GE7A 5LABA 2WOAA 1Q3AA 5I2ZA 3KMCA 2OW1A 2FV9A 1XFXA 1JAOA 1IACA 4H30A 2N8RA 1FM1A 4XM7A 3RTSA 1SLMA 3TT4A 1XFUA 1DMTA 3LQ0A 3TS4A 3GBOA 4WZVA 1KBCA 3O2XA 1R1IA 1IAGA 4XM8A 1C7KA 3LQBA 3HDAP 2X3AA 3OHLA 4DPEA 5D1SA 5L7FA 4GWMA 3EHXA 4L6TA 3F18A 1Y0VA 3KHIA 1S4BP 1FBLA 3HY7A 3HBVP 1BQQM 1O0TA 2X7MA 1CGLA 1EB6A 1UTZA 1D8MA 4QKZA 1BM6A 4ON1A 1YP1A 1BZSA 3DL1A 1GE5A 1BUDA 1RM8A 5I4OA 1SU3A 5I12A 3WV1A 2A8HA 4AIGA 4H49A 1CXVA 3LJTA 2Y6DA 2OVXA 4L19A 2E2DA 1PWWA 4XBHA 2X3CA 1USNA 1QICA 1GO8P 4WKEA 1OM6A 4DV8A 2MZIA 2W13A 4HX3A 5I43A 3LUMA 1ND1A 2OXZA 1GKDA 1MMRA 1CIZA 1G4KA 4H2EA 4JPAA 3EWJA 1QIAA 1I73A 1BKCA 3Q2GA 1GO7P 3U1RA 2W14A 4FU4A 5CXAA 1IABA 5D7WA 1GKCA 2CKIA 4GQLA 3DNGA 3DSLA 1R54A 1XFVA 2W0DA 1A86A 2Y6CA 5D2BA 2DW0A 3F15A 2Z2DA 4PKTA 1SMPA 1MMQA 1JIZA 4PKWA 3P1VA 4XM6A 1Z3JA 3I7IA 1H71P 2ERQA 1D8FA 1SATA 3B8ZA 3G42A 5L79A 5D1TA 2D1OA 1BIWA 3SHIA 3HBUP 3LKAA 2USNA 1UEAA 1IAEA 1JAQA 1XUDA 2DDYA 3LIKA 1G12A 1C3IA 4WK7A 4WF6A 3BA0A 2E3XA 4JA1A 2EROA 4H3XA 2OXWA 2V4BA 1RMZA 3N2VA 1HY7A 2OW9A 2OY4A 4GUYA 2PJTA 1G49A 4PKRA 1BKCE 3ZXHA 1PWQA 3B92A 4PKSA 3AYUA 2WO9A 3LIRA 1EAKA 1CK7A 1BUVM 1OM7A 3LE9A 2JT6A 3TVCA
chains in the Genus database with same CATH superfamily
1L6JA 1JH1A 830CA 1UMSA 1JKYA 1QIBA 3LEAA 1CGFA 1KUIA 3P24A 3LGPA 2JIHA 1XUCA 1R1HA 4XCTA 2SRTA 4GR3A 4JQGA 1QUAA 2TCLA 4AYKA 4JIJA 3HDBA 2HU6A 1JK3A 3LILA 456CA 3HY9A 2MZEA 1YOUA 1Y8JA 1AF0A 1CQRA 4ILWD 3DPFA 3ELMA 4GR8A 4IN9A 5D3CA 1OS9A 1UTTA 4FVLA 3WV2A 1ZS0A 1KUKA 4G9LA 4A7BA 1KUGA 4FXYP 3OHOA 1ZVXA 3G5CA 2JT5A 4AUOA 2ERPA 3K7LA 3L0TA 1JIWP 4L7AA 4ZR5A 3AYKA 5CZMA 3N2UA 4PKVA 2YIGA 4PKUA 3KECA 5I3MA 3EDGA 4GWNA 1R1JA 3L0VA 1OS2A 3K7NA 1SRPA 1BSWA 4IUWA 3O64A 5H8XA 3VI1A 966CA 2MLRA 2J0TA 1IADA 2WO8A 1Y93A 1ROSA 1QJJA 1CAQA 3LK8A 4JP4A 3V96B 3LMCA 3EDHA 4L63A 1QJIA 1KUFA 3TSKA 4R3VA 5D1UA 2O36A 2YB9A 1G05A 3E8RA 1KUHA 5CUHA 2K2GA 1JANA 1B3DA 1K7GA 4Q1LA 4J4MA 1PWVA 3F16A 5B5OA 1K7QA 2FV5A 4EFSA 3Q2HA 1HTDA 3EHYA 1HOVA 2XS4A 4I35A 3UVCA 4A3WA 3LUNA 3KWVC 3VTGA 2CLTA 1D7XA 1OO9A 3CKIA 2I47A 3B2ZA 4I03A 3KEJA 1YCMA 1JJ9A 1HV5A 1BKCI 4AXQA 2OW2A 4DF9A 3KRYA 1KAPP 2POJA 2J83A 3NX7A 1JAPA 2AIGP 2QPJA 1K7IA 1DTHA 2OI0A 1ATLA 4GR0A 1SLNA 1I1IP 2DDFA 3USNA 2OZRA 1ZTQA 1AYKA 3I7GA 1XFWA 2X3BA 1XM5A 2KRJA 1PWPA 3HB2P 4PKQA 1FLSA 3HYGA 3ZUKA 2OY2A 3AIGA 4H76A 1XFZA 2OW0A 1OM8A 1AKLA 1OMJA 2K9CA 3DWBA 1ZP5A 4DD8A 2JNPA 2OVZA 1XFYA 1MMBA 1TVIA 5BOTA 4CTHA 4IJOA 2XS3A 1GXDA 3EDZA 5BOYA 1C8TA 2RJQA 3F17A 1O0QA 4H82A 2O3EA 2W12A 2L0RA 1UMTA 2RJPA 1ASTA 1B8YA 1D5JA 2OXUA 1ZXVA 3KEKA 1BQOA 4H1QA 4H84A 3WV3A 2DW2A 1J7NA 1PWUA 1XURA 2JSDA 5I0LA 1HFSA 4GF1A 1MNCA 3LJZA 2D1NA 3RTTA 2AYKA 2MZHA 4G0DA 3ZVSA 1A85A 2W15A 4WKIA 1G9KA 3F19A 1WNIA 1YQYA 3MA2A 4HMAA 3F1AA 1ZXCA 1MMPA 5B5PA 5JMYA 1EUBA 3DPEA 2DW1A 3LJGA 1HFCA 1CGEA 1IAAA 2MLSA 3EDIA 1GE6A 1I76A 5BPAA 4FXQA 1R55A 3KMEA 1GE7A 5LABA 2WOAA 1Q3AA 5I2ZA 3KMCA 2OW1A 2FV9A 1XFXA 1JAOA 1IACA 4H30A 2N8RA 1FM1A 4XM7A 3RTSA 1SLMA 3TT4A 1XFUA 1DMTA 3LQ0A 3TS4A 3GBOA 4WZVA 1KBCA 3O2XA 1R1IA 1IAGA 4XM8A 1C7KA 3LQBA 3HDAP 2X3AA 3OHLA 4DPEA 5D1SA 5L7FA 4GWMA 3EHXA 4L6TA 3F18A 1Y0VA 3KHIA 1S4BP 1FBLA 3DTKA 3HY7A 3HBVP 1BQQM 1O0TA 2X7MA 1CGLA 1EB6A 1UTZA 1D8MA 4QKZA 1BM6A 4ON1A 1YP1A 1BZSA 3DL1A 1GE5A 1BUDA 1RM8A 5I4OA 1SU3A 5I12A 3WV1A 2A8HA 4AIGA 4H49A 1CXVA 3LJTA 2Y6DA 2OVXA 4L19A 2E2DA 1PWWA 4XBHA 2X3CA 1USNA 1XAXA 1QICA 1GO8P 4WKEA 1OM6A 4DV8A 2MZIA 2W13A 4HX3A 5I43A 3LUMA 1ND1A 2OXZA 1GKDA 1MMRA 1CIZA 1G4KA 4H2EA 4JPAA 3EWJA 1QIAA 1I73A 1BKCA 3Q2GA 1GO7P 3U1RA 2W14A 4FU4A 5CXAA 1IABA 5D7WA 1GKCA 2CKIA 2YUFA 4GQLA 3DNGA 3DSLA 1R54A 1XFVA 2W0DA 1A86A 2Y6CA 5D2BA 2DW0A 3F15A 2Z2DA 4PKTA 1SMPA 1MMQA 1JIZA 4PKWA 3P1VA 4XM6A 1Z3JA 3DTIA 3I7IA 1H71P 2ERQA 1D8FA 1SATA 3B8ZA 3G42A 5L79A 5D1TA 2D1OA 1BIWA 3DTEA 3SHIA 3HBUP 3LKAA 2USNA 1UEAA 1IAEA 1JAQA 1XUDA 2DDYA 3LIKA 1G12A 1C3IA 4WK7A 4WF6A 3BA0A 2E3XA 4JA1A 2EROA 4H3XA 2OXWA 2V4BA 1RMZA 1OZ9A 3N2VA 1HY7A 2OW9A 2OY4A 4GUYA 2PJTA 1G49A 4PKRA 1BKCE 3ZXHA 1PWQA 3B92A 4PKSA 3AYUA 2WO9A 3LIRA 1EAKA 1CK7A 1BUVM 1OM7A 3LE9A 2JT6A 3TVCA
chains in the Genus database with same CATH topology
1L6JA 1JH1A 830CA 1UMSA 1JKYA 1QIBA 3LEAA 1CGFA 1KUIA 3P24A 3LGPA 2JIHA 1XUCA 1R1HA 4XCTA 2SRTA 4GR3A 4JQGA 1QUAA 2TCLA 4AYKA 4JIJA 3HDBA 2HU6A 1JK3A 3LILA 456CA 3HY9A 2MZEA 1YOUA 1Y8JA 1AF0A 1CQRA 4ILWD 3DPFA 3ELMA 4GR8A 4IN9A 5D3CA 1OS9A 1UTTA 4FVLA 3WV2A 1ZS0A 1KUKA 4G9LA 4A7BA 1KUGA 4FXYP 3OHOA 1ZVXA 3G5CA 2JT5A 4AUOA 2ERPA 3K7LA 3L0TA 1JIWP 4L7AA 4ZR5A 3AYKA 5CZMA 3N2UA 4PKVA 2YIGA 4PKUA 3KECA 5I3MA 3EDGA 4GWNA 1R1JA 3L0VA 1OS2A 3K7NA 1SRPA 1BSWA 4IUWA 3O64A 5H8XA 3VI1A 966CA 2MLRA 2J0TA 1IADA 2WO8A 1Y93A 1ROSA 1QJJA 1CAQA 3LK8A 4JP4A 3V96B 3LMCA 3EDHA 4L63A 1QJIA 1KUFA 3TSKA 4R3VA 5D1UA 2O36A 2YB9A 1G05A 3E8RA 1KUHA 5CUHA 2K2GA 1JANA 1B3DA 1K7GA 4Q1LA 4J4MA 1PWVA 3F16A 5B5OA 1K7QA 2FV5A 4EFSA 3Q2HA 1HTDA 3EHYA 1HOVA 2XS4A 4I35A 3UVCA 4A3WA 3LUNA 3KWVC 3VTGA 2CLTA 1D7XA 1OO9A 3CKIA 2I47A 3B2ZA 4I03A 3KEJA 1YCMA 1JJ9A 1HV5A 1BKCI 4AXQA 2OW2A 4DF9A 3KRYA 1KAPP 2POJA 2J83A 3NX7A 1JAPA 2AIGP 2QPJA 1K7IA 1DTHA 2OI0A 1ATLA 4GR0A 1SLNA 1I1IP 2DDFA 3USNA 2OZRA 1ZTQA 1AYKA 3I7GA 1XFWA 2X3BA 2KRJA 1PWPA 3HB2P 4PKQA 1FLSA 3HYGA 3ZUKA 2OY2A 3AIGA 4H76A 1XFZA 2OW0A 1OM8A 1AKLA 1OMJA 2K9CA 3DWBA 1ZP5A 4DD8A 2JNPA 2OVZA 1XFYA 1MMBA 5BOTA 4CTHA 4IJOA 2XS3A 1GXDA 3EDZA 5BOYA 1C8TA 2RJQA 3F17A 1O0QA 4H82A 2O3EA 2W12A 2L0RA 1UMTA 2RJPA 1ASTA 1B8YA 1D5JA 2OXUA 1ZXVA 3KEKA 1BQOA 4H1QA 4H84A 3WV3A 2DW2A 1J7NA 1PWUA 1XURA 2JSDA 5I0LA 1HFSA 4GF1A 1MNCA 3LJZA 2D1NA 3RTTA 2AYKA 2MZHA 4G0DA 3ZVSA 1A85A 2W15A 4WKIA 1G9KA 3F19A 1WNIA 1YQYA 3MA2A 4HMAA 3F1AA 1ZXCA 1MMPA 5B5PA 5JMYA 1EUBA 3DPEA 2DW1A 3LJGA 1HFCA 1CGEA 1IAAA 2MLSA 3EDIA 1GE6A 1I76A 5BPAA 4FXQA 1R55A 3KMEA 1GE7A 5LABA 2WOAA 1Q3AA 5I2ZA 3KMCA 2OW1A 2FV9A 1XFXA 1JAOA 1IACA 4H30A 2N8RA 1FM1A 4XM7A 3RTSA 1SLMA 3TT4A 1XFUA 1DMTA 3LQ0A 3TS4A 3GBOA 4WZVA 1KBCA 3O2XA 1R1IA 1IAGA 4XM8A 1C7KA 3LQBA 3HDAP 2X3AA 3OHLA 4DPEA 5D1SA 5L7FA 4GWMA 3EHXA 4L6TA 3F18A 1Y0VA 3KHIA 1S4BP 1FBLA 3DTKA 3HY7A 3HBVP 1BQQM 1O0TA 2X7MA 1CGLA 1EB6A 1UTZA 1D8MA 4QKZA 1BM6A 4ON1A 1YP1A 1BZSA 3DL1A 1GE5A 1BUDA 1RM8A 5I4OA 1SU3A 5I12A 3WV1A 2A8HA 4AIGA 4H49A 1CXVA 3LJTA 2Y6DA 2OVXA 4L19A 2E2DA 1PWWA 4XBHA 2X3CA 1USNA 1QICA 1GO8P 4WKEA 1OM6A 4DV8A 2MZIA 2W13A 4HX3A 5I43A 3LUMA 1ND1A 2OXZA 1GKDA 1MMRA 1CIZA 1G4KA 4H2EA 4JPAA 3EWJA 1QIAA 1I73A 1BKCA 3Q2GA 1GO7P 3U1RA 2W14A 4FU4A 5CXAA 1IABA 5D7WA 1GKCA 2CKIA 2YUFA 4GQLA 3DNGA 3DSLA 1R54A 1XFVA 2W0DA 1A86A 2Y6CA 5D2BA 2DW0A 3F15A 2Z2DA 4PKTA 1SMPA 1MMQA 1JIZA 4PKWA 3P1VA 4XM6A 1Z3JA 3DTIA 3I7IA 1H71P 2ERQA 1D8FA 1SATA 3B8ZA 3G42A 5L79A 5D1TA 2D1OA 1BIWA 3DTEA 3SHIA 3HBUP 3LKAA 2USNA 1UEAA 1IAEA 1JAQA 1XUDA 2DDYA 3LIKA 1G12A 1C3IA 4WK7A 4WF6A 3BA0A 2E3XA 4JA1A 2EROA 4H3XA 2OXWA 2V4BA 1RMZA 3N2VA 1HY7A 2OW9A 2OY4A 4GUYA 2PJTA 1G49A 4PKRA 1BKCE 3ZXHA 1PWQA 3B92A 4PKSA 3AYUA 2WO9A 3LIRA 1EAKA 1CK7A 1BUVM 1OM7A 3LE9A 2JT6A 3TVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6J A;  1JH1 A;  830C A;  1UMS A;  1JKY A;  1QIB A;  3LEA A;  1CGF A;  1KUI A;  3P24 A;  3LGP A;  2JIH A;  1XUC A;  1R1H A;  4XCT A;  2SRT A;  4GR3 A;  4JQG A;  1QUA A;  2TCL A;  4AYK A;  4JIJ A;  3HDB A;  2HU6 A;  1JK3 A;  3LIL A;  456C A;  3HY9 A;  2MZE A;  1YOU A;  1Y8J A;  1AF0 A;  1CQR A;  4ILW D;  3DPF A;  3ELM A;  4GR8 A;  4IN9 A;  5D3C A;  1OS9 A;  1UTT A;  4FVL A;  3WV2 A;  1ZS0 A;  1KUK A;  4G9L A;  4A7B A;  1KUG A;  4FXY P;  3OHO A;  1ZVX A;  3G5C A;  2JT5 A;  4AUO A;  2ERP A;  3K7L A;  3L0T A;  1JIW P;  4ZR5 A;  3AYK A;  5CZM A;  3N2U A;  4PKV A;  2YIG A;  4PKU A;  3KEC A;  5I3M A;  3EDG A;  4GWN A;  1R1J A;  3L0V A;  1OS2 A;  3K7N A;  1SRP A;  1BSW A;  4IUW A;  3O64 A;  5H8X A;  3VI1 A;  966C A;  2MLR A;  2J0T A;  1IAD A;  2WO8 A;  1Y93 A;  1ROS A;  1QJJ A;  1CAQ A;  3LK8 A;  4JP4 A;  3V96 B;  3LMC A;  3EDH A;  4L63 A;  1QJI A;  1KUF A;  3TSK A;  4R3V A;  5D1U A;  2O36 A;  2YB9 A;  1G05 A;  3E8R A;  1KUH A;  5CUH A;  2K2G A;  1JAN A;  1B3D A;  1K7G A;  4Q1L A;  4J4M A;  1PWV A;  3F16 A;  5B5O A;  1K7Q A;  2FV5 A;  4EFS A;  3Q2H A;  1HTD A;  3EHY A;  1HOV A;  2XS4 A;  4I35 A;  3UVC A;  4A3W A;  3LUN A;  3KWV C;  3VTG A;  2CLT A;  1D7X A;  1OO9 A;  3CKI A;  2I47 A;  3B2Z A;  4I03 A;  3KEJ A;  1YCM A;  1JJ9 A;  1HV5 A;  1BKC I;  4AXQ A;  2OW2 A;  4DF9 A;  3KRY A;  1KAP P;  2POJ A;  2J83 A;  3NX7 A;  1JAP A;  2AIG P;  2QPJ A;  1K7I A;  1DTH A;  2OI0 A;  1ATL A;  4GR0 A;  1SLN A;  1I1I P;  2DDF A;  3USN A;  2OZR A;  1ZTQ A;  1AYK A;  3I7G A;  1XFW A;  2X3B A;  2KRJ A;  1PWP A;  3HB2 P;  4PKQ A;  1FLS A;  3HYG A;  3ZUK A;  2OY2 A;  3AIG A;  4H76 A;  1XFZ A;  2OW0 A;  1OM8 A;  1AKL A;  1OMJ A;  2K9C A;  3DWB A;  1ZP5 A;  4DD8 A;  2JNP A;  2OVZ A;  1XFY A;  1MMB A;  5BOT A;  4CTH A;  4IJO A;  2XS3 A;  1GXD A;  3EDZ A;  5BOY A;  1C8T A;  2RJQ A;  3F17 A;  1O0Q A;  4H82 A;  2O3E A;  2W12 A;  2L0R A;  1UMT A;  2RJP A;  1AST A;  1B8Y A;  1D5J A;  2OXU A;  1ZXV A;  3KEK A;  1BQO A;  4H1Q A;  4H84 A;  3WV3 A;  2DW2 A;  1J7N A;  1PWU A;  1XUR A;  2JSD A;  5I0L A;  1HFS A;  4GF1 A;  1MNC A;  3LJZ A;  2D1N A;  3RTT A;  2AYK A;  2MZH A;  4G0D A;  3ZVS A;  1A85 A;  2W15 A;  4WKI A;  1G9K A;  3F19 A;  1WNI A;  1YQY A;  3MA2 A;  4HMA A;  3F1A A;  1ZXC A;  1MMP A;  5B5P A;  5JMY A;  1EUB A;  3DPE A;  2DW1 A;  3LJG A;  1HFC A;  1CGE A;  1IAA A;  2MLS A;  3EDI A;  1GE6 A;  1I76 A;  5BPA A;  4FXQ A;  1R55 A;  3KME A;  1GE7 A;  5LAB A;  2WOA A;  1Q3A A;  5I2Z A;  3KMC A;  2OW1 A;  2FV9 A;  1XFX A;  1JAO A;  1IAC A;  4H30 A;  2N8R A;  1FM1 A;  4XM7 A;  3RTS A;  1SLM A;  3TT4 A;  1XFU A;  1DMT A;  3LQ0 A;  3TS4 A;  3GBO A;  4WZV A;  1KBC A;  3O2X A;  1R1I A;  1IAG A;  4XM8 A;  1C7K A;  3LQB A;  3HDA P;  2X3A A;  3OHL A;  4DPE A;  5D1S A;  5L7F A;  4GWM A;  3EHX A;  4L6T A;  3F18 A;  1Y0V A;  3KHI A;  1S4B P;  1FBL A;  3HY7 A;  3HBV P;  1BQQ M;  1O0T A;  2X7M A;  1CGL A;  1EB6 A;  1UTZ A;  1D8M A;  4QKZ A;  1BM6 A;  4ON1 A;  1YP1 A;  1BZS A;  3DL1 A;  1GE5 A;  1BUD A;  1RM8 A;  5I4O A;  1SU3 A;  5I12 A;  3WV1 A;  2A8H A;  4AIG A;  4H49 A;  1CXV A;  3LJT A;  2Y6D A;  2OVX A;  4L19 A;  2E2D A;  1PWW A;  4XBH A;  2X3C A;  1USN A;  1QIC A;  1GO8 P;  4WKE A;  1OM6 A;  4DV8 A;  2MZI A;  2W13 A;  4HX3 A;  5I43 A;  3LUM A;  1ND1 A;  2OXZ A;  1GKD A;  1MMR A;  1CIZ A;  1G4K A;  4H2E A;  4JPA A;  3EWJ A;  1QIA A;  1I73 A;  1BKC A;  3Q2G A;  1GO7 P;  3U1R A;  2W14 A;  4FU4 A;  5CXA A;  1IAB A;  5D7W A;  1GKC A;  2CKI A;  4GQL A;  3DNG A;  3DSL A;  1R54 A;  1XFV A;  2W0D A;  1A86 A;  2Y6C A;  5D2B A;  2DW0 A;  3F15 A;  2Z2D A;  4PKT A;  1SMP A;  1MMQ A;  1JIZ A;  4PKW A;  3P1V A;  4XM6 A;  1Z3J A;  3I7I A;  1H71 P;  2ERQ A;  1D8F A;  1SAT A;  3B8Z A;  3G42 A;  5L79 A;  5D1T A;  2D1O A;  1BIW A;  3SHI A;  3HBU P;  3LKA A;  2USN A;  1UEA A;  1IAE A;  1JAQ A;  1XUD A;  2DDY A;  3LIK A;  1G12 A;  1C3I A;  4WK7 A;  4WF6 A;  3BA0 A;  2E3X A;  4JA1 A;  2ERO A;  4H3X A;  2OXW A;  2V4B A;  1RMZ A;  3N2V A;  1HY7 A;  2OW9 A;  2OY4 A;  4GUY A;  2PJT A;  1G49 A;  4PKR A;  1BKC E;  3ZXH A;  1PWQ A;  3B92 A;  4PKS A;  3AYU A;  2WO9 A;  3LIR A;  1EAK A;  1CK7 A;  1BUV M;  1OM7 A;  3LE9 A;  2JT6 A;  3TVC A; 
#chains in the Genus database with same CATH topology
 1L6J A;  1JH1 A;  830C A;  1UMS A;  1JKY A;  1QIB A;  3LEA A;  1CGF A;  1KUI A;  3P24 A;  3LGP A;  2JIH A;  1XUC A;  1R1H A;  4XCT A;  2SRT A;  4GR3 A;  4JQG A;  1QUA A;  2TCL A;  4AYK A;  4JIJ A;  3HDB A;  2HU6 A;  1JK3 A;  3LIL A;  456C A;  3HY9 A;  2MZE A;  1YOU A;  1Y8J A;  1AF0 A;  1CQR A;  4ILW D;  3DPF A;  3ELM A;  4GR8 A;  4IN9 A;  5D3C A;  1OS9 A;  1UTT A;  4FVL A;  3WV2 A;  1ZS0 A;  1KUK A;  4G9L A;  4A7B A;  1KUG A;  4FXY P;  3OHO A;  1ZVX A;  3G5C A;  2JT5 A;  4AUO A;  2ERP A;  3K7L A;  3L0T A;  1JIW P;  4L7A A;  4ZR5 A;  3AYK A;  5CZM A;  3N2U A;  4PKV A;  2YIG A;  4PKU A;  3KEC A;  5I3M A;  3EDG A;  4GWN A;  1R1J A;  3L0V A;  1OS2 A;  3K7N A;  1SRP A;  1BSW A;  4IUW A;  3O64 A;  5H8X A;  3VI1 A;  966C A;  2MLR A;  2J0T A;  1IAD A;  2WO8 A;  1Y93 A;  1ROS A;  1QJJ A;  1CAQ A;  3LK8 A;  4JP4 A;  3V96 B;  3LMC A;  3EDH A;  4L63 A;  1QJI A;  1KUF A;  3TSK A;  4R3V A;  5D1U A;  2O36 A;  2YB9 A;  1G05 A;  3E8R A;  1KUH A;  5CUH A;  2K2G A;  1JAN A;  1B3D A;  1K7G A;  4Q1L A;  4J4M A;  1PWV A;  3F16 A;  5B5O A;  1K7Q A;  2FV5 A;  4EFS A;  3Q2H A;  1HTD A;  3EHY A;  1HOV A;  2XS4 A;  4I35 A;  3UVC A;  4A3W A;  3LUN A;  3KWV C;  3VTG A;  2CLT A;  1D7X A;  1OO9 A;  3CKI A;  2I47 A;  3B2Z A;  4I03 A;  3KEJ A;  1YCM A;  1JJ9 A;  1HV5 A;  1BKC I;  4AXQ A;  2OW2 A;  4DF9 A;  3KRY A;  1KAP P;  2POJ A;  2J83 A;  3NX7 A;  1JAP A;  2AIG P;  2QPJ A;  1K7I A;  1DTH A;  2OI0 A;  1ATL A;  4GR0 A;  1SLN A;  1I1I P;  2DDF A;  3USN A;  2OZR A;  1ZTQ A;  1AYK A;  3I7G A;  1XFW A;  2X3B A;  1XM5 A;  2KRJ A;  1PWP A;  3HB2 P;  4PKQ A;  1FLS A;  3HYG A;  3ZUK A;  2OY2 A;  3AIG A;  4H76 A;  1XFZ A;  2OW0 A;  1OM8 A;  1AKL A;  1OMJ A;  2K9C A;  3DWB A;  1ZP5 A;  4DD8 A;  2JNP A;  2OVZ A;  1XFY A;  1MMB A;  1TVI A;  5BOT A;  4CTH A;  4IJO A;  2XS3 A;  1GXD A;  3EDZ A;  5BOY A;  1C8T A;  2RJQ A;  3F17 A;  1O0Q A;  4H82 A;  2O3E A;  2W12 A;  2L0R A;  1UMT A;  2RJP A;  1AST A;  1B8Y A;  1D5J A;  2OXU A;  1ZXV A;  3KEK A;  1BQO A;  4H1Q A;  4H84 A;  3WV3 A;  2DW2 A;  1J7N A;  1PWU A;  1XUR A;  2JSD A;  5I0L A;  1HFS A;  4GF1 A;  1MNC A;  3LJZ A;  2D1N A;  3RTT A;  2AYK A;  2MZH A;  4G0D A;  3ZVS A;  1A85 A;  2W15 A;  4WKI A;  1G9K A;  3F19 A;  1WNI A;  1YQY A;  3MA2 A;  4HMA A;  3F1A A;  1ZXC A;  1MMP A;  5B5P A;  5JMY A;  1EUB A;  3DPE A;  2DW1 A;  3LJG A;  1HFC A;  1CGE A;  1IAA A;  2MLS A;  3EDI A;  1GE6 A;  1I76 A;  5BPA A;  4FXQ A;  1R55 A;  3KME A;  1GE7 A;  5LAB A;  2WOA A;  1Q3A A;  5I2Z A;  3KMC A;  2OW1 A;  2FV9 A;  1XFX A;  1JAO A;  1IAC A;  4H30 A;  2N8R A;  1FM1 A;  4XM7 A;  3RTS A;  1SLM A;  3TT4 A;  1XFU A;  1DMT A;  3LQ0 A;  3TS4 A;  3GBO A;  4WZV A;  1KBC A;  3O2X A;  1R1I A;  1IAG A;  4XM8 A;  1C7K A;  3LQB A;  3HDA P;  2X3A A;  3OHL A;  4DPE A;  5D1S A;  5L7F A;  4GWM A;  3EHX A;  4L6T A;  3F18 A;  1Y0V A;  3KHI A;  1S4B P;  1FBL A;  3DTK A;  3HY7 A;  3HBV P;  1BQQ M;  1O0T A;  2X7M A;  1CGL A;  1EB6 A;  1UTZ A;  1D8M A;  4QKZ A;  1BM6 A;  4ON1 A;  1YP1 A;  1BZS A;  3DL1 A;  1GE5 A;  1BUD A;  1RM8 A;  5I4O A;  1SU3 A;  5I12 A;  3WV1 A;  2A8H A;  4AIG A;  4H49 A;  1CXV A;  3LJT A;  2Y6D A;  2OVX A;  4L19 A;  2E2D A;  1PWW A;  4XBH A;  2X3C A;  1USN A;  1XAX A;  1QIC A;  1GO8 P;  4WKE A;  1OM6 A;  4DV8 A;  2MZI A;  2W13 A;  4HX3 A;  5I43 A;  3LUM A;  1ND1 A;  2OXZ A;  1GKD A;  1MMR A;  1CIZ A;  1G4K A;  4H2E A;  4JPA A;  3EWJ A;  1QIA A;  1I73 A;  1BKC A;  3Q2G A;  1GO7 P;  3U1R A;  2W14 A;  4FU4 A;  5CXA A;  1IAB A;  5D7W A;  1GKC A;  2CKI A;  2YUF A;  4GQL A;  3DNG A;  3DSL A;  1R54 A;  1XFV A;  2W0D A;  1A86 A;  2Y6C A;  5D2B A;  2DW0 A;  3F15 A;  2Z2D A;  4PKT A;  1SMP A;  1MMQ A;  1JIZ A;  4PKW A;  3P1V A;  4XM6 A;  1Z3J A;  3DTI A;  3I7I A;  1H71 P;  2ERQ A;  1D8F A;  1SAT A;  3B8Z A;  3G42 A;  5L79 A;  5D1T A;  2D1O A;  1BIW A;  3DTE A;  3SHI A;  3HBU P;  3LKA A;  2USN A;  1UEA A;  1IAE A;  1JAQ A;  1XUD A;  2DDY A;  3LIK A;  1G12 A;  1C3I A;  4WK7 A;  4WF6 A;  3BA0 A;  2E3X A;  4JA1 A;  2ERO A;  4H3X A;  2OXW A;  2V4B A;  1RMZ A;  1OZ9 A;  3N2V A;  1HY7 A;  2OW9 A;  2OY4 A;  4GUY A;  2PJT A;  1G49 A;  4PKR A;  1BKC E;  3ZXH A;  1PWQ A;  3B92 A;  4PKS A;  3AYU A;  2WO9 A;  3LIR A;  1EAK A;  1CK7 A;  1BUV M;  1OM7 A;  3LE9 A;  2JT6 A;  3TVC A; 
#chains in the Genus database with same CATH homology
 1L6J A;  1JH1 A;  830C A;  1UMS A;  1JKY A;  1QIB A;  3LEA A;  1CGF A;  1KUI A;  3P24 A;  3LGP A;  2JIH A;  1XUC A;  1R1H A;  4XCT A;  2SRT A;  4GR3 A;  4JQG A;  1QUA A;  2TCL A;  4AYK A;  4JIJ A;  3HDB A;  2HU6 A;  1JK3 A;  3LIL A;  456C A;  3HY9 A;  2MZE A;  1YOU A;  1Y8J A;  1AF0 A;  1CQR A;  4ILW D;  3DPF A;  3ELM A;  4GR8 A;  4IN9 A;  5D3C A;  1OS9 A;  1UTT A;  4FVL A;  3WV2 A;  1ZS0 A;  1KUK A;  4G9L A;  4A7B A;  1KUG A;  4FXY P;  3OHO A;  1ZVX A;  3G5C A;  2JT5 A;  4AUO A;  2ERP A;  3K7L A;  3L0T A;  1JIW P;  4L7A A;  4ZR5 A;  3AYK A;  5CZM A;  3N2U A;  4PKV A;  2YIG A;  4PKU A;  3KEC A;  5I3M A;  3EDG A;  4GWN A;  1R1J A;  3L0V A;  1OS2 A;  3K7N A;  1SRP A;  1BSW A;  4IUW A;  3O64 A;  5H8X A;  3VI1 A;  966C A;  2MLR A;  2J0T A;  1IAD A;  2WO8 A;  1Y93 A;  1ROS A;  1QJJ A;  1CAQ A;  3LK8 A;  4JP4 A;  3V96 B;  3LMC A;  3EDH A;  4L63 A;  1QJI A;  1KUF A;  3TSK A;  4R3V A;  5D1U A;  2O36 A;  2YB9 A;  1G05 A;  3E8R A;  1KUH A;  5CUH A;  2K2G A;  1JAN A;  1B3D A;  1K7G A;  4Q1L A;  4J4M A;  1PWV A;  3F16 A;  5B5O A;  1K7Q A;  2FV5 A;  4EFS A;  3Q2H A;  1HTD A;  3EHY A;  1HOV A;  2XS4 A;  4I35 A;  3UVC A;  4A3W A;  3LUN A;  3KWV C;  3VTG A;  2CLT A;  1D7X A;  1OO9 A;  3CKI A;  2I47 A;  3B2Z A;  4I03 A;  3KEJ A;  1YCM A;  1JJ9 A;  1HV5 A;  1BKC I;  4AXQ A;  2OW2 A;  4DF9 A;  3KRY A;  1KAP P;  2POJ A;  2J83 A;  3NX7 A;  1JAP A;  2AIG P;  2QPJ A;  1K7I A;  1DTH A;  2OI0 A;  1ATL A;  4GR0 A;  1SLN A;  1I1I P;  2DDF A;  3USN A;  2OZR A;  1ZTQ A;  1AYK A;  3I7G A;  1XFW A;  2X3B A;  2KRJ A;  1PWP A;  3HB2 P;  4PKQ A;  1FLS A;  3HYG A;  3ZUK A;  2OY2 A;  3AIG A;  4H76 A;  1XFZ A;  2OW0 A;  1OM8 A;  1AKL A;  1OMJ A;  2K9C A;  3DWB A;  1ZP5 A;  4DD8 A;  2JNP A;  2OVZ A;  1XFY A;  1MMB A;  5BOT A;  4CTH A;  4IJO A;  2XS3 A;  1GXD A;  3EDZ A;  5BOY A;  1C8T A;  2RJQ A;  3F17 A;  1O0Q A;  4H82 A;  2O3E A;  2W12 A;  2L0R A;  1UMT A;  2RJP A;  1AST A;  1B8Y A;  1D5J A;  2OXU A;  1ZXV A;  3KEK A;  1BQO A;  4H1Q A;  4H84 A;  3WV3 A;  2DW2 A;  1J7N A;  1PWU A;  1XUR A;  2JSD A;  5I0L A;  1HFS A;  4GF1 A;  1MNC A;  3LJZ A;  2D1N A;  3RTT A;  2AYK A;  2MZH A;  4G0D A;  3ZVS A;  1A85 A;  2W15 A;  4WKI A;  1G9K A;  3F19 A;  1WNI A;  1YQY A;  3MA2 A;  4HMA A;  3F1A A;  1ZXC A;  1MMP A;  5B5P A;  5JMY A;  1EUB A;  3DPE A;  2DW1 A;  3LJG A;  1HFC A;  1CGE A;  1IAA A;  2MLS A;  3EDI A;  1GE6 A;  1I76 A;  5BPA A;  4FXQ A;  1R55 A;  3KME A;  1GE7 A;  5LAB A;  2WOA A;  1Q3A A;  5I2Z A;  3KMC A;  2OW1 A;  2FV9 A;  1XFX A;  1JAO A;  1IAC A;  4H30 A;  2N8R A;  1FM1 A;  4XM7 A;  3RTS A;  1SLM A;  3TT4 A;  1XFU A;  1DMT A;  3LQ0 A;  3TS4 A;  3GBO A;  4WZV A;  1KBC A;  3O2X A;  1R1I A;  1IAG A;  4XM8 A;  1C7K A;  3LQB A;  3HDA P;  2X3A A;  3OHL A;  4DPE A;  5D1S A;  5L7F A;  4GWM A;  3EHX A;  4L6T A;  3F18 A;  1Y0V A;  3KHI A;  1S4B P;  1FBL A;  3DTK A;  3HY7 A;  3HBV P;  1BQQ M;  1O0T A;  2X7M A;  1CGL A;  1EB6 A;  1UTZ A;  1D8M A;  4QKZ A;  1BM6 A;  4ON1 A;  1YP1 A;  1BZS A;  3DL1 A;  1GE5 A;  1BUD A;  1RM8 A;  5I4O A;  1SU3 A;  5I12 A;  3WV1 A;  2A8H A;  4AIG A;  4H49 A;  1CXV A;  3LJT A;  2Y6D A;  2OVX A;  4L19 A;  2E2D A;  1PWW A;  4XBH A;  2X3C A;  1USN A;  1QIC A;  1GO8 P;  4WKE A;  1OM6 A;  4DV8 A;  2MZI A;  2W13 A;  4HX3 A;  5I43 A;  3LUM A;  1ND1 A;  2OXZ A;  1GKD A;  1MMR A;  1CIZ A;  1G4K A;  4H2E A;  4JPA A;  3EWJ A;  1QIA A;  1I73 A;  1BKC A;  3Q2G A;  1GO7 P;  3U1R A;  2W14 A;  4FU4 A;  5CXA A;  1IAB A;  5D7W A;  1GKC A;  2CKI A;  2YUF A;  4GQL A;  3DNG A;  3DSL A;  1R54 A;  1XFV A;  2W0D A;  1A86 A;  2Y6C A;  5D2B A;  2DW0 A;  3F15 A;  2Z2D A;  4PKT A;  1SMP A;  1MMQ A;  1JIZ A;  4PKW A;  3P1V A;  4XM6 A;  1Z3J A;  3DTI A;  3I7I A;  1H71 P;  2ERQ A;  1D8F A;  1SAT A;  3B8Z A;  3G42 A;  5L79 A;  5D1T A;  2D1O A;  1BIW A;  3DTE A;  3SHI A;  3HBU P;  3LKA A;  2USN A;  1UEA A;  1IAE A;  1JAQ A;  1XUD A;  2DDY A;  3LIK A;  1G12 A;  1C3I A;  4WK7 A;  4WF6 A;  3BA0 A;  2E3X A;  4JA1 A;  2ERO A;  4H3X A;  2OXW A;  2V4B A;  1RMZ A;  3N2V A;  1HY7 A;  2OW9 A;  2OY4 A;  4GUY A;  2PJT A;  1G49 A;  4PKR A;  1BKC E;  3ZXH A;  1PWQ A;  3B92 A;  4PKS A;  3AYU A;  2WO9 A;  3LIR A;  1EAK A;  1CK7 A;  1BUV M;  1OM7 A;  3LE9 A;  2JT6 A;  3TVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...