1HFIA

Solution structure of a pair of complement modules by nuclear magnetic resonance
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
EKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR H, 15TH C-MODULE PAIR
publication title Solution structure of a pair of complement modules by nuclear magnetic resonance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycoprotein
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1993-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1hfiA00
3KZJA 4YNXA 1TPMA 1H03P 3TVJA 2JRAA 3GOVA 2IZ3A 3IX0A 1OK9A 4ONTD 5I0QB 2LOJA 2XWJI 1H2PP 1HCCA 2RLPA 3T5OA 5HYPA 2W81A 1OK3A 3IU3I 1O9AA 3O8EB 3OP8A 3M7PA 1VVDA 3GXEA 1PPQA 2YBYA 3NFPI 1E8BA 1OJVA 4B2RA 4JHSA 2RKZA 4AYDA 1QUBA 2RL0A 4CSYA 1Z92B 3INBC 1SS2A 2ERJA 3RJ3D 2A55A 2IZ4A 4MUCA 3ZRZA 1VVCA 1ELVA 2XRDA 2EHFA 2V8EA 5HYUB 2CG7A 2XWBF 2BZMA 3CALA 1QO6A 1E88A 3ZD1A 1FBRA 4LOSA 4ZH1D 3OXUD 3EJHA 5FO8C 2W80A 1GPZA 1C1ZA 1QGBA 4PZ5A 1SRZA 2RLQA 1CKLA 1TPNA 3ZD2A 4AYMA 2JGXA 1OJWA 4DJZA 1TPGA 1GHQB 2KMSA 3R62A 3ERBA 1E5GA 1ZJKA 2KRIA 2O39C 1H2QP 1U5MA 3SW0X 4LOTA 1OK2A 4J38B 4A5WB 4B2SA 5HZPB 1MD8A 3L89M 4K12A 2WIIC 2CKUA 3MQLA 2JGWA 2XQWC 5HYTB 1G4FA 2RKYA 3KXVA 4C16A 4AYEA 2B5ID 1LY2A 1NWVA 2QY0A 5JPMG 4F4OC 1GKNA 1H04P 1OJYA 4IGDA 4KKDA 3OEDC 1Q3XA 1OK1A 2UWNA 2YRAA 4WJG2 2MCYA 1UOTP 2XRBA 4FXGG 1GKGA 1HFHA 2CG6A 2MCZA 1G4GA 1MD7A 2EC3A 1HFIA 4AYIA 2G7IA
chains in the Genus database with same CATH superfamily
3KZJA 4YNXA 1TPMA 1H03P 3TVJA 2JRAA 3GOVA 3WSXA 2IZ3A 3IX0A 1OK9A 4ONTD 5I0QB 2LOJA 2XWJI 1H2PP 1HCCA 4YIZA 2RLPA 3T5OA 5HYPA 2W81A 4N7EA 1OK3A 3IU3I 1O9AA 3O8EB 3OP8A 3M7PA 1VVDA 3GXEA 1PPQA 2YBYA 3NFPI 1E8BA 1OJVA 4B2RA 4JHSA 2RKZA 4AYDA 1QUBA 2RL0A 4CSYA 1Z92B 3VWOA 3INBC 1SS2A 2ERJA 3RJ3D 2A55A 2IZ4A 4MUCA 3ZRZA 5DN4A 1VVCA 1ELVA 2XRDA 2EHFA 2V8EA 5HYUB 2CG7A 2XWBF 2I2LA 2BZMA 3CALA 3F6KA 1QO6A 1E88A 3ZD1A 1FBRA 4APLA 4LOSA 4ZH1D 3OXUD 3EJHA 3K3TA 5FO8C 2W80A 1GPZA 1C1ZA 1QGBA 4PZ5A 1SRZA 2RLQA 1CKLA 1TPNA 3ZD2A 4AYMA 2JGXA 1OJWA 4DJZA 1TPGA 1GHQB 2KMSA 3R62A 3ERBA 1E5GA 1ZJKA 2KRIA 2O39C 1H2QP 1U5MA 3SW0X 4BWCA 4LOTA 1OK2A 2Y8SA 4J38B 4A5WB 4B2SA 5HZPB 1MD8A 3L89M 4K12A 3CI0J 1RLHA 2WIIC 2CKUA 3MQLA 2X2ZA 2JGWA 2XQWC 5HYTB 2Y8TA 1G4FA 2RKYA 2Y8RA 3NJAA 3KXVA 4C16A 4MSLA 4AYEA 2B5ID 1LY2A 1NWVA 2QY0A 5JPMG 5DN5A 2ZYCA 4F4OC 1GKNA 1H04P 3FGRA 1OJYA 4IGDA 4KKDA 3ZLDA 3OEDC 3WSYA 1Q3XA 3FGTA 1OK1A 2UWNA 2YRAA 4WJG2 2MCYA 1UOTP 2XRBA 4FXGG 1GKGA 1HFHA 2CG6A 3ZLEA 4PO7A 2MCZA 1G4GA 1MD7A 2EC3A 1HFIA 4AYIA 2G7IA
chains in the Genus database with same CATH topology
3KZJA 4YNXA 1TPMA 1H03P 3TVJA 2JRAA 3GOVA 2IZ3A 3IX0A 1OK9A 4ONTD 5I0QB 2LOJA 2XWJI 1H2PP 1HCCA 2RLPA 3T5OA 5HYPA 2W81A 1OK3A 3IU3I 1O9AA 3O8EB 3OP8A 3M7PA 1VVDA 3GXEA 1PPQA 2YBYA 3NFPI 1E8BA 1OJVA 4B2RA 4JHSA 2RKZA 4AYDA 1QUBA 2RL0A 4CSYA 1Z92B 3INBC 1SS2A 2ERJA 3RJ3D 2A55A 2IZ4A 4MUCA 3ZRZA 1VVCA 1ELVA 2XRDA 2EHFA 2V8EA 5HYUB 2CG7A 2XWBF 2BZMA 3CALA 1QO6A 1E88A 3ZD1A 1FBRA 4LOSA 4ZH1D 3OXUD 3EJHA 5FO8C 2W80A 1GPZA 1C1ZA 1QGBA 4PZ5A 1SRZA 2RLQA 1CKLA 1TPNA 3ZD2A 4AYMA 2JGXA 1OJWA 4DJZA 1TPGA 1GHQB 2KMSA 3R62A 3ERBA 1E5GA 1ZJKA 2KRIA 2O39C 1H2QP 1U5MA 3SW0X 4LOTA 1OK2A 4J38B 4A5WB 4B2SA 5HZPB 1MD8A 3L89M 4K12A 2WIIC 2CKUA 3MQLA 2JGWA 2XQWC 5HYTB 1G4FA 2RKYA 3KXVA 4C16A 4AYEA 2B5ID 1LY2A 1NWVA 2QY0A 5JPMG 4F4OC 1GKNA 1H04P 1OJYA 4IGDA 4KKDA 3OEDC 1Q3XA 1OK1A 2UWNA 2YRAA 4WJG2 2MCYA 1UOTP 2XRBA 4FXGG 1GKGA 1HFHA 2CG6A 2MCZA 1G4GA 1MD7A 2EC3A 1HFIA 4AYIA 2G7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZJ A;  4YNX A;  1TPM A;  1H03 P;  3TVJ A;  2JRA A;  3GOV A;  2IZ3 A;  3IX0 A;  1OK9 A;  4ONT D;  5I0Q B;  2LOJ A;  2XWJ I;  1H2P P;  1HCC A;  2RLP A;  3T5O A;  5HYP A;  2W81 A;  1OK3 A;  3IU3 I;  1O9A A;  3O8E B;  3OP8 A;  3M7P A;  1VVD A;  3GXE A;  1PPQ A;  2YBY A;  3NFP I;  1E8B A;  1OJV A;  4B2R A;  4JHS A;  2RKZ A;  4AYD A;  1QUB A;  2RL0 A;  4CSY A;  1Z92 B;  3INB C;  1SS2 A;  2ERJ A;  3RJ3 D;  2A55 A;  2IZ4 A;  4MUC A;  3ZRZ A;  1VVC A;  1ELV A;  2XRD A;  2EHF A;  2V8E A;  5HYU B;  2CG7 A;  2XWB F;  2BZM A;  3CAL A;  1QO6 A;  1E88 A;  3ZD1 A;  1FBR A;  4LOS A;  4ZH1 D;  3OXU D;  3EJH A;  5FO8 C;  2W80 A;  1GPZ A;  1C1Z A;  1QGB A;  4PZ5 A;  1SRZ A;  2RLQ A;  1CKL A;  1TPN A;  3ZD2 A;  4AYM A;  2JGX A;  1OJW A;  4DJZ A;  1TPG A;  1GHQ B;  2KMS A;  3R62 A;  3ERB A;  1E5G A;  1ZJK A;  2KRI A;  2O39 C;  1H2Q P;  1U5M A;  3SW0 X;  4LOT A;  1OK2 A;  4J38 B;  4A5W B;  4B2S A;  5HZP B;  1MD8 A;  3L89 M;  4K12 A;  2WII C;  2CKU A;  3MQL A;  2JGW A;  2XQW C;  5HYT B;  1G4F A;  2RKY A;  3KXV A;  4C16 A;  4AYE A;  2B5I D;  1LY2 A;  1NWV A;  2QY0 A;  5JPM G;  4F4O C;  1GKN A;  1H04 P;  1OJY A;  4IGD A;  4KKD A;  3OED C;  1Q3X A;  1OK1 A;  2UWN A;  2YRA A;  4WJG 2;  2MCY A;  1UOT P;  2XRB A;  4FXG G;  1GKG A;  1HFH A;  2CG6 A;  2MCZ A;  1G4G A;  1MD7 A;  2EC3 A;  1HFI A;  4AYI A;  2G7I A; 
#chains in the Genus database with same CATH topology
 3KZJ A;  4YNX A;  1TPM A;  1H03 P;  3TVJ A;  2JRA A;  3GOV A;  3WSX A;  2IZ3 A;  3IX0 A;  1OK9 A;  4ONT D;  5I0Q B;  2LOJ A;  2XWJ I;  1H2P P;  1HCC A;  4YIZ A;  2RLP A;  3T5O A;  5HYP A;  2W81 A;  4N7E A;  1OK3 A;  3IU3 I;  1O9A A;  3O8E B;  3OP8 A;  3M7P A;  1VVD A;  3GXE A;  1PPQ A;  2YBY A;  3NFP I;  1E8B A;  1OJV A;  4B2R A;  4JHS A;  2RKZ A;  4AYD A;  1QUB A;  2RL0 A;  4CSY A;  1Z92 B;  3VWO A;  3INB C;  1SS2 A;  2ERJ A;  3RJ3 D;  2A55 A;  2IZ4 A;  4MUC A;  3ZRZ A;  5DN4 A;  1VVC A;  1ELV A;  2XRD A;  2EHF A;  2V8E A;  5HYU B;  2CG7 A;  2XWB F;  2I2L A;  2BZM A;  3CAL A;  3F6K A;  1QO6 A;  1E88 A;  3ZD1 A;  1FBR A;  4APL A;  4LOS A;  4ZH1 D;  3OXU D;  3EJH A;  3K3T A;  5FO8 C;  2W80 A;  1GPZ A;  1C1Z A;  1QGB A;  4PZ5 A;  1SRZ A;  2RLQ A;  1CKL A;  1TPN A;  3ZD2 A;  4AYM A;  2JGX A;  1OJW A;  4DJZ A;  1TPG A;  1GHQ B;  2KMS A;  3R62 A;  3ERB A;  1E5G A;  1ZJK A;  2KRI A;  2O39 C;  1H2Q P;  1U5M A;  3SW0 X;  4BWC A;  4LOT A;  1OK2 A;  2Y8S A;  4J38 B;  4A5W B;  4B2S A;  5HZP B;  1MD8 A;  3L89 M;  4K12 A;  3CI0 J;  1RLH A;  2WII C;  2CKU A;  3MQL A;  2X2Z A;  2JGW A;  2XQW C;  5HYT B;  2Y8T A;  1G4F A;  2RKY A;  2Y8R A;  3NJA A;  3KXV A;  4C16 A;  4MSL A;  4AYE A;  2B5I D;  1LY2 A;  1NWV A;  2QY0 A;  5JPM G;  5DN5 A;  2ZYC A;  4F4O C;  1GKN A;  1H04 P;  3FGR A;  1OJY A;  4IGD A;  4KKD A;  3ZLD A;  3OED C;  3WSY A;  1Q3X A;  3FGT A;  1OK1 A;  2UWN A;  2YRA A;  4WJG 2;  2MCY A;  1UOT P;  2XRB A;  4FXG G;  1GKG A;  1HFH A;  2CG6 A;  3ZLE A;  4PO7 A;  2MCZ A;  1G4G A;  1MD7 A;  2EC3 A;  1HFI A;  4AYI A;  2G7I A; 
#chains in the Genus database with same CATH homology
 3KZJ A;  4YNX A;  1TPM A;  1H03 P;  3TVJ A;  2JRA A;  3GOV A;  2IZ3 A;  3IX0 A;  1OK9 A;  4ONT D;  5I0Q B;  2LOJ A;  2XWJ I;  1H2P P;  1HCC A;  2RLP A;  3T5O A;  5HYP A;  2W81 A;  1OK3 A;  3IU3 I;  1O9A A;  3O8E B;  3OP8 A;  3M7P A;  1VVD A;  3GXE A;  1PPQ A;  2YBY A;  3NFP I;  1E8B A;  1OJV A;  4B2R A;  4JHS A;  2RKZ A;  4AYD A;  1QUB A;  2RL0 A;  4CSY A;  1Z92 B;  3INB C;  1SS2 A;  2ERJ A;  3RJ3 D;  2A55 A;  2IZ4 A;  4MUC A;  3ZRZ A;  1VVC A;  1ELV A;  2XRD A;  2EHF A;  2V8E A;  5HYU B;  2CG7 A;  2XWB F;  2BZM A;  3CAL A;  1QO6 A;  1E88 A;  3ZD1 A;  1FBR A;  4LOS A;  4ZH1 D;  3OXU D;  3EJH A;  5FO8 C;  2W80 A;  1GPZ A;  1C1Z A;  1QGB A;  4PZ5 A;  1SRZ A;  2RLQ A;  1CKL A;  1TPN A;  3ZD2 A;  4AYM A;  2JGX A;  1OJW A;  4DJZ A;  1TPG A;  1GHQ B;  2KMS A;  3R62 A;  3ERB A;  1E5G A;  1ZJK A;  2KRI A;  2O39 C;  1H2Q P;  1U5M A;  3SW0 X;  4LOT A;  1OK2 A;  4J38 B;  4A5W B;  4B2S A;  5HZP B;  1MD8 A;  3L89 M;  4K12 A;  2WII C;  2CKU A;  3MQL A;  2JGW A;  2XQW C;  5HYT B;  1G4F A;  2RKY A;  3KXV A;  4C16 A;  4AYE A;  2B5I D;  1LY2 A;  1NWV A;  2QY0 A;  5JPM G;  4F4O C;  1GKN A;  1H04 P;  1OJY A;  4IGD A;  4KKD A;  3OED C;  1Q3X A;  1OK1 A;  2UWN A;  2YRA A;  4WJG 2;  2MCY A;  1UOT P;  2XRB A;  4FXG G;  1GKG A;  1HFH A;  2CG6 A;  2MCZ A;  1G4G A;  1MD7 A;  2EC3 A;  1HFI A;  4AYI A;  2G7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...