1HFIA

Solution structure of a pair of complement modules by nuclear magnetic resonance
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
62
structure length
62
Chain Sequence
EKIPCSQPPQIEHGTINSSRSSQESYAHGTKLSYTCEGGFRISEENETTCYMGKWSSPPQCE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FACTOR H, 15TH C-MODULE PAIR
publication title Solution structure of a pair of complement modules by nuclear magnetic resonance.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Glycoprotein
total genus 7
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1993-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 1hfiA00
1LY2A 1H04P 1OK2A 1QO6A 4AYEA 5JPMG 2XWBF 4LOTA 1GPZA 2ERJA 4K12A 2JGXA 2XRBA 1SS2A 4JHSA 4F4OC 2KMSA 2XWJI 1VVDA 2XQWC 5HYTB 1E5GA 3M7PA 3ZD1A 1GKNA 2YBYA 3T5OA 2V8EA 2MCZA 1HFHA 4ZH1D 3GOVA 1TPGA 3CALA 1QUBA 2B5ID 3MQLA 1E8BA 2UWNA 4J38B 1O9AA 2W81A 1GKGA 1Q3XA 3OEDC 4DJZA 2O39C 2IZ3A 1QGBA 3ZRZA 1TPNA 3GXEA 1H03P 1OK1A 3RJ3D 2CG6A 1OJVA 1ZJKA 2CKUA 2JGWA 1C1ZA 2IZ4A 1H2PP 4AYMA 2CG7A 2A55A 1HCCA 1Z92B 2JRAA 1OJYA 4ONTD 2EHFA 2WIIC 4B2RA 1G4GA 4C16A 3ZD2A 2LOJA 3ERBA 4KKDA 3L89M 5I0QB 1UOTP 1OK3A 1CKLA 3KXVA 4IGDA 1PPQA 3IX0A 3R62A 4B2SA 2EC3A 2W80A 1E88A 1NWVA 1OK9A 5HYPA 1G4FA 1FBRA 2RKYA 5HZPB 2RL0A 1MD8A 3NFPI 3OP8A 3OXUD 3IU3I 5FO8C 4A5WB 4FXGG 2RLQA 3O8EB 3KZJA 2KRIA 1U5MA 1GHQB 4MUCA 2MCYA 3TVJA 2QY0A 1OJWA 3INBC 4YNXA 2XRDA 4AYDA 2RLPA 4CSYA 4LOSA 1HFIA 2BZMA 2G7IA 1VVCA 2RKZA 4PZ5A 5HYUB 2YRAA 4WJG2 3EJHA 1MD7A 3SW0X 1ELVA 1TPMA 4AYIA 1H2QP 1SRZA
chains in the Genus database with same CATH superfamily
1LY2A 4MSLA 1H04P 1OK2A 1QO6A 4AYEA 5JPMG 2XWBF 4LOTA 1GPZA 2ERJA 4K12A 2JGXA 2XRBA 1RLHA 1SS2A 4JHSA 4F4OC 2KMSA 2XWJI 1VVDA 2XQWC 3FGRA 5HYTB 1E5GA 3M7PA 3ZD1A 1GKNA 2YBYA 3NJAA 3T5OA 2V8EA 2MCZA 1HFHA 4ZH1D 4N7EA 3GOVA 1TPGA 3CALA 1QUBA 2B5ID 3MQLA 1E8BA 2UWNA 4J38B 1O9AA 2W81A 1GKGA 1Q3XA 3OEDC 4DJZA 2O39C 2IZ3A 1QGBA 2I2LA 3ZRZA 3FGTA 1TPNA 3GXEA 1H03P 1OK1A 3K3TA 3RJ3D 2CG6A 1OJVA 1ZJKA 2CKUA 2JGWA 1C1ZA 2ZYCA 2IZ4A 1H2PP 4AYMA 2CG7A 2A55A 1HCCA 4PO7A 3ZLDA 1Z92B 2JRAA 1OJYA 4ONTD 2EHFA 2WIIC 4B2RA 1G4GA 4C16A 3ZD2A 2LOJA 3ERBA 4APLA 4KKDA 3L89M 5I0QB 1UOTP 1OK3A 1CKLA 3KXVA 4IGDA 2Y8RA 1PPQA 3WSXA 3IX0A 3R62A 2Y8SA 4B2SA 2EC3A 2W80A 1E88A 1NWVA 1OK9A 5HYPA 1G4FA 1FBRA 2RKYA 2Y8TA 5HZPB 3F6KA 2RL0A 3VWOA 1MD8A 3NFPI 3OP8A 3OXUD 3IU3I 5FO8C 4A5WB 4FXGG 2RLQA 3O8EB 3CI0J 3KZJA 2KRIA 1U5MA 1GHQB 4MUCA 2MCYA 4YIZA 3TVJA 2QY0A 2X2ZA 1OJWA 3INBC 4YNXA 5DN4A 2XRDA 4AYDA 2RLPA 5DN5A 4CSYA 4LOSA 1HFIA 2BZMA 2G7IA 3WSYA 1VVCA 2RKZA 4PZ5A 5HYUB 2YRAA 4WJG2 4BWCA 3EJHA 1MD7A 3ZLEA 3SW0X 1ELVA 1TPMA 4AYIA 1H2QP 1SRZA
chains in the Genus database with same CATH topology
1LY2A 1H04P 1OK2A 1QO6A 4AYEA 5JPMG 2XWBF 4LOTA 1GPZA 2ERJA 4K12A 2JGXA 2XRBA 1SS2A 4JHSA 4F4OC 2KMSA 2XWJI 1VVDA 2XQWC 5HYTB 1E5GA 3M7PA 3ZD1A 1GKNA 2YBYA 3T5OA 2V8EA 2MCZA 1HFHA 4ZH1D 3GOVA 1TPGA 3CALA 1QUBA 2B5ID 3MQLA 1E8BA 2UWNA 4J38B 1O9AA 2W81A 1GKGA 1Q3XA 3OEDC 4DJZA 2O39C 2IZ3A 1QGBA 3ZRZA 1TPNA 3GXEA 1H03P 1OK1A 3RJ3D 2CG6A 1OJVA 1ZJKA 2CKUA 2JGWA 1C1ZA 2IZ4A 1H2PP 4AYMA 2CG7A 2A55A 1HCCA 1Z92B 2JRAA 1OJYA 4ONTD 2EHFA 2WIIC 4B2RA 1G4GA 4C16A 3ZD2A 2LOJA 3ERBA 4KKDA 3L89M 5I0QB 1UOTP 1OK3A 1CKLA 3KXVA 4IGDA 1PPQA 3IX0A 3R62A 4B2SA 2EC3A 2W80A 1E88A 1NWVA 1OK9A 5HYPA 1G4FA 1FBRA 2RKYA 5HZPB 2RL0A 1MD8A 3NFPI 3OP8A 3OXUD 3IU3I 5FO8C 4A5WB 4FXGG 2RLQA 3O8EB 3KZJA 2KRIA 1U5MA 1GHQB 4MUCA 2MCYA 3TVJA 2QY0A 1OJWA 3INBC 4YNXA 2XRDA 4AYDA 2RLPA 4CSYA 4LOSA 1HFIA 2BZMA 2G7IA 1VVCA 2RKZA 4PZ5A 5HYUB 2YRAA 4WJG2 3EJHA 1MD7A 3SW0X 1ELVA 1TPMA 4AYIA 1H2QP 1SRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LY2 A;  1H04 P;  1OK2 A;  1QO6 A;  4AYE A;  5JPM G;  2XWB F;  4LOT A;  1GPZ A;  2ERJ A;  4K12 A;  2JGX A;  2XRB A;  1SS2 A;  4JHS A;  4F4O C;  2KMS A;  2XWJ I;  1VVD A;  2XQW C;  5HYT B;  1E5G A;  3M7P A;  3ZD1 A;  1GKN A;  2YBY A;  3T5O A;  2V8E A;  2MCZ A;  1HFH A;  4ZH1 D;  3GOV A;  1TPG A;  3CAL A;  1QUB A;  2B5I D;  3MQL A;  1E8B A;  2UWN A;  4J38 B;  1O9A A;  2W81 A;  1GKG A;  1Q3X A;  3OED C;  4DJZ A;  2O39 C;  2IZ3 A;  1QGB A;  3ZRZ A;  1TPN A;  3GXE A;  1H03 P;  1OK1 A;  3RJ3 D;  2CG6 A;  1OJV A;  1ZJK A;  2CKU A;  2JGW A;  1C1Z A;  2IZ4 A;  1H2P P;  4AYM A;  2CG7 A;  2A55 A;  1HCC A;  1Z92 B;  2JRA A;  1OJY A;  4ONT D;  2EHF A;  2WII C;  4B2R A;  1G4G A;  4C16 A;  3ZD2 A;  2LOJ A;  3ERB A;  4KKD A;  3L89 M;  5I0Q B;  1UOT P;  1OK3 A;  1CKL A;  3KXV A;  4IGD A;  1PPQ A;  3IX0 A;  3R62 A;  4B2S A;  2EC3 A;  2W80 A;  1E88 A;  1NWV A;  1OK9 A;  5HYP A;  1G4F A;  1FBR A;  2RKY A;  5HZP B;  2RL0 A;  1MD8 A;  3NFP I;  3OP8 A;  3OXU D;  3IU3 I;  5FO8 C;  4A5W B;  4FXG G;  2RLQ A;  3O8E B;  3KZJ A;  2KRI A;  1U5M A;  1GHQ B;  4MUC A;  2MCY A;  3TVJ A;  2QY0 A;  1OJW A;  3INB C;  4YNX A;  2XRD A;  4AYD A;  2RLP A;  4CSY A;  4LOS A;  1HFI A;  2BZM A;  2G7I A;  1VVC A;  2RKZ A;  4PZ5 A;  5HYU B;  2YRA A;  4WJG 2;  3EJH A;  1MD7 A;  3SW0 X;  1ELV A;  1TPM A;  4AYI A;  1H2Q P;  1SRZ A; 
#chains in the Genus database with same CATH topology
 1LY2 A;  4MSL A;  1H04 P;  1OK2 A;  1QO6 A;  4AYE A;  5JPM G;  2XWB F;  4LOT A;  1GPZ A;  2ERJ A;  4K12 A;  2JGX A;  2XRB A;  1RLH A;  1SS2 A;  4JHS A;  4F4O C;  2KMS A;  2XWJ I;  1VVD A;  2XQW C;  3FGR A;  5HYT B;  1E5G A;  3M7P A;  3ZD1 A;  1GKN A;  2YBY A;  3NJA A;  3T5O A;  2V8E A;  2MCZ A;  1HFH A;  4ZH1 D;  4N7E A;  3GOV A;  1TPG A;  3CAL A;  1QUB A;  2B5I D;  3MQL A;  1E8B A;  2UWN A;  4J38 B;  1O9A A;  2W81 A;  1GKG A;  1Q3X A;  3OED C;  4DJZ A;  2O39 C;  2IZ3 A;  1QGB A;  2I2L A;  3ZRZ A;  3FGT A;  1TPN A;  3GXE A;  1H03 P;  1OK1 A;  3K3T A;  3RJ3 D;  2CG6 A;  1OJV A;  1ZJK A;  2CKU A;  2JGW A;  1C1Z A;  2ZYC A;  2IZ4 A;  1H2P P;  4AYM A;  2CG7 A;  2A55 A;  1HCC A;  4PO7 A;  3ZLD A;  1Z92 B;  2JRA A;  1OJY A;  4ONT D;  2EHF A;  2WII C;  4B2R A;  1G4G A;  4C16 A;  3ZD2 A;  2LOJ A;  3ERB A;  4APL A;  4KKD A;  3L89 M;  5I0Q B;  1UOT P;  1OK3 A;  1CKL A;  3KXV A;  4IGD A;  2Y8R A;  1PPQ A;  3WSX A;  3IX0 A;  3R62 A;  2Y8S A;  4B2S A;  2EC3 A;  2W80 A;  1E88 A;  1NWV A;  1OK9 A;  5HYP A;  1G4F A;  1FBR A;  2RKY A;  2Y8T A;  5HZP B;  3F6K A;  2RL0 A;  3VWO A;  1MD8 A;  3NFP I;  3OP8 A;  3OXU D;  3IU3 I;  5FO8 C;  4A5W B;  4FXG G;  2RLQ A;  3O8E B;  3CI0 J;  3KZJ A;  2KRI A;  1U5M A;  1GHQ B;  4MUC A;  2MCY A;  4YIZ A;  3TVJ A;  2QY0 A;  2X2Z A;  1OJW A;  3INB C;  4YNX A;  5DN4 A;  2XRD A;  4AYD A;  2RLP A;  5DN5 A;  4CSY A;  4LOS A;  1HFI A;  2BZM A;  2G7I A;  3WSY A;  1VVC A;  2RKZ A;  4PZ5 A;  5HYU B;  2YRA A;  4WJG 2;  4BWC A;  3EJH A;  1MD7 A;  3ZLE A;  3SW0 X;  1ELV A;  1TPM A;  4AYI A;  1H2Q P;  1SRZ A; 
#chains in the Genus database with same CATH homology
 1LY2 A;  1H04 P;  1OK2 A;  1QO6 A;  4AYE A;  5JPM G;  2XWB F;  4LOT A;  1GPZ A;  2ERJ A;  4K12 A;  2JGX A;  2XRB A;  1SS2 A;  4JHS A;  4F4O C;  2KMS A;  2XWJ I;  1VVD A;  2XQW C;  5HYT B;  1E5G A;  3M7P A;  3ZD1 A;  1GKN A;  2YBY A;  3T5O A;  2V8E A;  2MCZ A;  1HFH A;  4ZH1 D;  3GOV A;  1TPG A;  3CAL A;  1QUB A;  2B5I D;  3MQL A;  1E8B A;  2UWN A;  4J38 B;  1O9A A;  2W81 A;  1GKG A;  1Q3X A;  3OED C;  4DJZ A;  2O39 C;  2IZ3 A;  1QGB A;  3ZRZ A;  1TPN A;  3GXE A;  1H03 P;  1OK1 A;  3RJ3 D;  2CG6 A;  1OJV A;  1ZJK A;  2CKU A;  2JGW A;  1C1Z A;  2IZ4 A;  1H2P P;  4AYM A;  2CG7 A;  2A55 A;  1HCC A;  1Z92 B;  2JRA A;  1OJY A;  4ONT D;  2EHF A;  2WII C;  4B2R A;  1G4G A;  4C16 A;  3ZD2 A;  2LOJ A;  3ERB A;  4KKD A;  3L89 M;  5I0Q B;  1UOT P;  1OK3 A;  1CKL A;  3KXV A;  4IGD A;  1PPQ A;  3IX0 A;  3R62 A;  4B2S A;  2EC3 A;  2W80 A;  1E88 A;  1NWV A;  1OK9 A;  5HYP A;  1G4F A;  1FBR A;  2RKY A;  5HZP B;  2RL0 A;  1MD8 A;  3NFP I;  3OP8 A;  3OXU D;  3IU3 I;  5FO8 C;  4A5W B;  4FXG G;  2RLQ A;  3O8E B;  3KZJ A;  2KRI A;  1U5M A;  1GHQ B;  4MUC A;  2MCY A;  3TVJ A;  2QY0 A;  1OJW A;  3INB C;  4YNX A;  2XRD A;  4AYD A;  2RLP A;  4CSY A;  4LOS A;  1HFI A;  2BZM A;  2G7I A;  1VVC A;  2RKZ A;  4PZ5 A;  5HYU B;  2YRA A;  4WJG 2;  3EJH A;  1MD7 A;  3SW0 X;  1ELV A;  1TPM A;  4AYI A;  1H2Q P;  1SRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...