1HFSA

Crystal structure of the catalytic domain of human fibroblast stromelysin-1 inhibited with the n-carboxy-alkyl inhibitor l-764,004
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
160
structure length
160
Chain Sequence
GIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STROMELYSIN-1
publication title Inhibition of stromelysin-1 (MMP-3) by P1'-biphenylylethyl carboxyalkyl dipeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 160
sequence length 160
ec nomenclature ec 3.4.24.17: Stromelysin 1.
pdb deposition date 1997-02-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1hfsA00
3O64A 3TSKA 1CQRA 4H3XA 1GE7A 4H2EA 1KUKA 3LJZA 1A85A 4IJOA 1PWVA 1BZSA 4DV8A 3EHXA 1QICA 3LJGA 3TS4A 1G05A 1YP1A 3LKAA 4QKZA 1ZXVA 4XCTA 1GE5A 5I0LA 2OXWA 2OXUA 2OI0A 1GE6A 2MLSA 3Q2GA 3SHIA 2MZHA 1XFXA 3N2VA 1O0QA 3P24A 3OHOA 4FU4A 2K9CA 5CZMA 1S4BP 2JIHA 3RTSA 2X3AA 2N8RA 4JIJA 1HTDA 3K7NA 3F15A 1XFUA 3F1AA 2TCLA 2MZEA 1BIWA 5LABA 3F18A 3KECA 1CIZA 4FVLA 1FBLA 4H82A 1R1HA 1BKCI 2Z2DA 4AXQA 2V4BA 2OW0A 1CGEA 1GKCA 3LIKA 3LUNA 1PWPA 2FV5A 4G9LA 3I7GA 5CXAA 3WV1A 3EWJA 2X3CA 3HBUP 3B92A 1BKCA 1HY7A 3ELMA 1FLSA 1G12A 1Y8JA 3N2UA 3ZVSA 2CLTA 1MMRA 4I03A 4PKWA 4PKQA 1L6JA 1UTZA 3LIRA 5I4OA 3DSLA 1HFCA 3MA2A 3TT4A 1I73A 2OVZA 1Y0VA 1KBCA 1MMQA 3KMCA 3HYGA 1ATLA 3HDAP 1IAGA 1UTTA 1OS9A 2OXZA 4AYKA 3HY7A 1Q3AA 5L79A 1SMPA 2O3EA 3LILA 2JT6A 2X7MA 4H76A 1KAPP 1XFVA 2E3XA 4PKSA 4WZVA 2JSDA 1UEAA 4PKTA 5JMYA 2W12A 1XUCA 5BOYA 2DDFA 2USNA 1UMSA 1MMPA 3WV2A 1AKLA 1C3IA 1GO7P 3F19A 2AIGP 1D7XA 4ZR5A 5I12A 1ND1A 1I76A 2X3BA 3NX7A 5B5OA 4A3WA 1ASTA 3KEKA 4DD8A 1EUBA 5BPAA 3KWVC 3EDHA 1JIWP 1R1IA 1GKDA 3CKIA 4GQLA 5BOTA 3F16A 3DPEA 1OM7A 1JAQA 3AIGA 4DF9A 1IACA 1Y93A 1JK3A 3ZXHA 1CXVA 1QJIA 3B2ZA 5D3CA 5D2BA 2HU6A 2ERPA 456CA 3E8RA 1O0TA 3Q2HA 4GWMA 4IN9A 3UVCA 1BQOA 1PWUA 1ZTQA 3HY9A 1IAAA 4JQGA 1JAPA 4ON1A 830CA 3VI1A 3TVCA 1SATA 1R54A 1Z3JA 2WOAA 1D8FA 1XUDA 4XM6A 3EHYA 3LMCA 4EFSA 4XM8A 1A86A 4A7BA 1G4KA 4HX3A 3K7LA 1BM6A 2W15A 2WO9A 1R55A 2YIGA 4IUWA 2W14A 5D1TA 3EDZA 2E2DA 1BUVM 3DNGA 3HDBA 1K7QA 1JKYA 5D1SA 1IADA 1RM8A 4PKRA 2I47A 2FV9A 4Q1LA 1B8YA 4PKVA 2KRJA 4L19A 1D5JA 1QJJA 2O36A 4CTHA 1XFWA 5H8XA 1B3DA 1CGFA 1FM1A 3HB2P 2D1OA 1YQYA 2POJA 3U1RA 4AIGA 1I1IP 1OM6A 2QPJA 4PKUA 3L0VA 1ZP5A 2K2GA 3LK8A 1SRPA 1KUFA 3B8ZA 1OO9A 2J83A 4WKEA 1C7KA 1D8MA 1JH1A 1BKCE 1MMBA 3WV3A 2CKIA 4H84A 2DW0A 3G42A 2MLRA 2DW2A 3LUMA 4DPEA 1C8TA 1H71P 3KEJA 4L6TA 1OM8A 1G9KA 1IAEA 2YB9A 4G0DA 4L63A 2OY4A 4AUOA 1QUAA 1PWQA 1ZVXA 1R1JA 1ZXCA 3EDGA 3LJTA 1KUHA 3ZUKA 1AYKA 3VTGA 4HMAA 2D1NA 1SLNA 1OS2A 1SLMA 2W0DA 3L0TA 1JIZA 3RTTA 4WKIA 1GXDA 1JANA 3AYKA 5I3MA 4JPAA 2JNPA 4R3VA 3DL1A 2W13A 1KUGA 3LQ0A 1HOVA 5I2ZA 1MNCA 4H49A 1KUIA 4ILWD 4J4MA 3LE9A 4H1QA 3KHIA 3DPFA 2A8HA 3LGPA 4JA1A 1YCMA 1G49A 1K7IA 2OW2A 3KRYA 1DTHA 2MZIA 4WF6A 1USNA 2DW1A 1EB6A 1HFSA 2WO8A 3LEAA 1BUDA 3DWBA 3USNA 1SU3A 1YOUA 1GO8P 1RMZA 1K7GA 4H30A 2XS4A 1HV5A 1CAQA 4GF1A 2OVXA 4GR0A 4JP4A 2RJQA 4GR3A 1BQQM 5L7FA 2PJTA 3V96B 2DDYA 1XFYA 3HBVP 2AYKA 2XS3A 1XFZA 3GBOA 3OHLA 3F17A 2Y6CA 2J0TA 4FXQA 5CUHA 1UMTA 1OMJA 2OZRA 2SRTA 1BSWA 2OW9A 4FXYP 1CK7A 1QIBA 1AF0A 1CGLA 1IABA 1DMTA 2OY2A 1QIAA 3G5CA 4GR8A 4I35A 3AYUA 1J7NA 3BA0A 3EDIA 4XBHA 4GUYA 3O2XA 3P1VA 4XM7A 2ERQA 5B5PA 2EROA 1PWWA 4GWNA 3KMEA 5D1UA 2JT5A 2Y6DA 2OW1A 4WK7A 5I43A 1JAOA 1JJ9A 1ZS0A 2L0RA 966CA 2RJPA 5D7WA 3LQBA 1WNIA 3I7IA 1XURA 1ROSA 1EAKA
chains in the Genus database with same CATH superfamily
3O64A 3TSKA 1CQRA 4H3XA 1GE7A 4H2EA 1KUKA 3LJZA 1A85A 4IJOA 1PWVA 1BZSA 4DV8A 3EHXA 1QICA 3LJGA 3TS4A 1G05A 1YP1A 3LKAA 4QKZA 1ZXVA 4XCTA 1GE5A 5I0LA 2OXWA 2OXUA 2OI0A 1GE6A 2MLSA 3Q2GA 3SHIA 2MZHA 1XFXA 3N2VA 1O0QA 3P24A 3OHOA 4FU4A 2K9CA 5CZMA 1S4BP 2JIHA 3RTSA 2X3AA 2N8RA 4JIJA 1HTDA 3K7NA 3F15A 1XFUA 3F1AA 2TCLA 2MZEA 1BIWA 5LABA 3F18A 3KECA 1CIZA 4FVLA 1FBLA 4H82A 1R1HA 1BKCI 2Z2DA 4AXQA 2V4BA 2OW0A 1CGEA 1GKCA 3LIKA 3LUNA 1XM5A 1PWPA 3DTIA 2FV5A 4G9LA 3I7GA 5CXAA 3WV1A 3EWJA 2X3CA 3HBUP 3B92A 1BKCA 1HY7A 3ELMA 1FLSA 1G12A 2YUFA 1Y8JA 3N2UA 3ZVSA 2CLTA 1MMRA 4I03A 4PKWA 4PKQA 1L6JA 1UTZA 3LIRA 5I4OA 3DSLA 1HFCA 3MA2A 3TT4A 1I73A 2OVZA 1Y0VA 1KBCA 1MMQA 3KMCA 3HYGA 1ATLA 3HDAP 1IAGA 1UTTA 1OS9A 2OXZA 4AYKA 3HY7A 1Q3AA 5L79A 1SMPA 2O3EA 3LILA 2JT6A 2X7MA 4H76A 1KAPP 1XFVA 2E3XA 4PKSA 4WZVA 2JSDA 1UEAA 4PKTA 5JMYA 2W12A 1XUCA 5BOYA 2DDFA 2USNA 1UMSA 1MMPA 3WV2A 1AKLA 1C3IA 1GO7P 3F19A 2AIGP 1D7XA 4ZR5A 5I12A 1ND1A 1I76A 2X3BA 3NX7A 5B5OA 4A3WA 1ASTA 3KEKA 4DD8A 1EUBA 5BPAA 3KWVC 3EDHA 1JIWP 1R1IA 1GKDA 3CKIA 4GQLA 5BOTA 3F16A 3DPEA 1OM7A 1JAQA 3AIGA 4DF9A 1IACA 1Y93A 1JK3A 3ZXHA 1CXVA 1QJIA 3B2ZA 5D3CA 5D2BA 2HU6A 2ERPA 456CA 3E8RA 1O0TA 3Q2HA 4GWMA 4IN9A 3UVCA 1BQOA 1PWUA 1ZTQA 3HY9A 1IAAA 4JQGA 1JAPA 4ON1A 830CA 3VI1A 3TVCA 1SATA 1R54A 1Z3JA 2WOAA 1D8FA 1XUDA 4XM6A 3EHYA 3LMCA 4EFSA 4XM8A 1A86A 4A7BA 1G4KA 4HX3A 3K7LA 1BM6A 2W15A 2WO9A 1R55A 2YIGA 4IUWA 2W14A 5D1TA 3EDZA 2E2DA 1BUVM 3DNGA 3HDBA 1K7QA 1JKYA 5D1SA 1IADA 1RM8A 4PKRA 1TVIA 2I47A 2FV9A 4Q1LA 1B8YA 4PKVA 2KRJA 4L19A 1D5JA 1QJJA 2O36A 4CTHA 1XFWA 5H8XA 1B3DA 1CGFA 1FM1A 3HB2P 2D1OA 1YQYA 2POJA 3U1RA 4AIGA 1I1IP 1OM6A 2QPJA 4PKUA 3L0VA 1ZP5A 2K2GA 3LK8A 1SRPA 1KUFA 3B8ZA 1OO9A 2J83A 4WKEA 3DTKA 1C7KA 1D8MA 1JH1A 1BKCE 1MMBA 3WV3A 2CKIA 4H84A 2DW0A 3G42A 2MLRA 2DW2A 3LUMA 4DPEA 1C8TA 1H71P 3KEJA 4L6TA 1OM8A 1G9KA 1IAEA 2YB9A 4G0DA 4L63A 2OY4A 4AUOA 1QUAA 1PWQA 1ZVXA 1R1JA 1ZXCA 3EDGA 3LJTA 1KUHA 3ZUKA 1AYKA 1OZ9A 3VTGA 4HMAA 2D1NA 1SLNA 1OS2A 1SLMA 2W0DA 3L0TA 1JIZA 3RTTA 4WKIA 1GXDA 1JANA 3AYKA 5I3MA 4JPAA 2JNPA 4R3VA 3DL1A 2W13A 1KUGA 3LQ0A 1HOVA 5I2ZA 4L7AA 1MNCA 4H49A 1KUIA 4ILWD 4J4MA 3LE9A 4H1QA 3KHIA 3DPFA 2A8HA 3LGPA 4JA1A 1YCMA 1G49A 1K7IA 2OW2A 3KRYA 1DTHA 2MZIA 4WF6A 1USNA 2DW1A 1EB6A 1HFSA 2WO8A 3LEAA 1BUDA 3DWBA 3USNA 1SU3A 1YOUA 1GO8P 1RMZA 1K7GA 4H30A 2XS4A 1HV5A 1CAQA 4GF1A 2OVXA 4GR0A 4JP4A 2RJQA 4GR3A 1BQQM 5L7FA 2PJTA 3V96B 2DDYA 1XFYA 3HBVP 2AYKA 2XS3A 1XFZA 3GBOA 3OHLA 3F17A 2Y6CA 2J0TA 4FXQA 5CUHA 1UMTA 1OMJA 2OZRA 2SRTA 1BSWA 2OW9A 4FXYP 3DTEA 1CK7A 1QIBA 1AF0A 1CGLA 1XAXA 1IABA 1DMTA 2OY2A 1QIAA 3G5CA 4GR8A 4I35A 3AYUA 1J7NA 3BA0A 3EDIA 4XBHA 4GUYA 3O2XA 3P1VA 4XM7A 2ERQA 5B5PA 2EROA 1PWWA 4GWNA 3KMEA 5D1UA 2JT5A 2Y6DA 2OW1A 4WK7A 5I43A 1JAOA 1JJ9A 1ZS0A 2L0RA 966CA 2RJPA 5D7WA 3LQBA 1WNIA 3I7IA 1XURA 1ROSA 1EAKA
chains in the Genus database with same CATH topology
3O64A 3TSKA 1CQRA 4H3XA 1GE7A 4H2EA 1KUKA 3LJZA 1A85A 4IJOA 1PWVA 1BZSA 4DV8A 3EHXA 1QICA 3LJGA 3TS4A 1G05A 1YP1A 3LKAA 4QKZA 1ZXVA 4XCTA 1GE5A 5I0LA 2OXWA 2OXUA 2OI0A 1GE6A 2MLSA 3Q2GA 3SHIA 2MZHA 1XFXA 3N2VA 1O0QA 3P24A 3OHOA 4FU4A 2K9CA 5CZMA 1S4BP 2JIHA 3RTSA 2X3AA 2N8RA 4JIJA 1HTDA 3K7NA 3F15A 1XFUA 3F1AA 2TCLA 2MZEA 1BIWA 5LABA 3F18A 3KECA 1CIZA 4FVLA 1FBLA 4H82A 1R1HA 1BKCI 2Z2DA 4AXQA 2V4BA 2OW0A 1CGEA 1GKCA 3LIKA 3LUNA 1PWPA 3DTIA 2FV5A 4G9LA 3I7GA 5CXAA 3WV1A 3EWJA 2X3CA 3HBUP 3B92A 1BKCA 1HY7A 3ELMA 1FLSA 1G12A 2YUFA 1Y8JA 3N2UA 3ZVSA 2CLTA 1MMRA 4I03A 4PKWA 4PKQA 1L6JA 1UTZA 3LIRA 5I4OA 3DSLA 1HFCA 3MA2A 3TT4A 1I73A 2OVZA 1Y0VA 1KBCA 1MMQA 3KMCA 3HYGA 1ATLA 3HDAP 1IAGA 1UTTA 1OS9A 2OXZA 4AYKA 3HY7A 1Q3AA 5L79A 1SMPA 2O3EA 3LILA 2JT6A 2X7MA 4H76A 1KAPP 1XFVA 2E3XA 4PKSA 4WZVA 2JSDA 1UEAA 4PKTA 5JMYA 2W12A 1XUCA 5BOYA 2DDFA 2USNA 1UMSA 1MMPA 3WV2A 1AKLA 1C3IA 1GO7P 3F19A 2AIGP 1D7XA 4ZR5A 5I12A 1ND1A 1I76A 2X3BA 3NX7A 5B5OA 4A3WA 1ASTA 3KEKA 4DD8A 1EUBA 5BPAA 3KWVC 3EDHA 1JIWP 1R1IA 1GKDA 3CKIA 4GQLA 5BOTA 3F16A 3DPEA 1OM7A 1JAQA 3AIGA 4DF9A 1IACA 1Y93A 1JK3A 3ZXHA 1CXVA 1QJIA 3B2ZA 5D3CA 5D2BA 2HU6A 2ERPA 456CA 3E8RA 1O0TA 3Q2HA 4GWMA 4IN9A 3UVCA 1BQOA 1PWUA 1ZTQA 3HY9A 1IAAA 4JQGA 1JAPA 4ON1A 830CA 3VI1A 3TVCA 1SATA 1R54A 1Z3JA 2WOAA 1D8FA 1XUDA 4XM6A 3EHYA 3LMCA 4EFSA 4XM8A 1A86A 4A7BA 1G4KA 4HX3A 3K7LA 1BM6A 2W15A 2WO9A 1R55A 2YIGA 4IUWA 2W14A 5D1TA 3EDZA 2E2DA 1BUVM 3DNGA 3HDBA 1K7QA 1JKYA 5D1SA 1IADA 1RM8A 4PKRA 2I47A 2FV9A 4Q1LA 1B8YA 4PKVA 2KRJA 4L19A 1D5JA 1QJJA 2O36A 4CTHA 1XFWA 5H8XA 1B3DA 1CGFA 1FM1A 3HB2P 2D1OA 1YQYA 2POJA 3U1RA 4AIGA 1I1IP 1OM6A 2QPJA 4PKUA 3L0VA 1ZP5A 2K2GA 3LK8A 1SRPA 1KUFA 3B8ZA 1OO9A 2J83A 4WKEA 3DTKA 1C7KA 1D8MA 1JH1A 1BKCE 1MMBA 3WV3A 2CKIA 4H84A 2DW0A 3G42A 2MLRA 2DW2A 3LUMA 4DPEA 1C8TA 1H71P 3KEJA 4L6TA 1OM8A 1G9KA 1IAEA 2YB9A 4G0DA 4L63A 2OY4A 4AUOA 1QUAA 1PWQA 1ZVXA 1R1JA 1ZXCA 3EDGA 3LJTA 1KUHA 3ZUKA 1AYKA 3VTGA 4HMAA 2D1NA 1SLNA 1OS2A 1SLMA 2W0DA 3L0TA 1JIZA 3RTTA 4WKIA 1GXDA 1JANA 3AYKA 5I3MA 4JPAA 2JNPA 4R3VA 3DL1A 2W13A 1KUGA 3LQ0A 1HOVA 5I2ZA 4L7AA 1MNCA 4H49A 1KUIA 4ILWD 4J4MA 3LE9A 4H1QA 3KHIA 3DPFA 2A8HA 3LGPA 4JA1A 1YCMA 1G49A 1K7IA 2OW2A 3KRYA 1DTHA 2MZIA 4WF6A 1USNA 2DW1A 1EB6A 1HFSA 2WO8A 3LEAA 1BUDA 3DWBA 3USNA 1SU3A 1YOUA 1GO8P 1RMZA 1K7GA 4H30A 2XS4A 1HV5A 1CAQA 4GF1A 2OVXA 4GR0A 4JP4A 2RJQA 4GR3A 1BQQM 5L7FA 2PJTA 3V96B 2DDYA 1XFYA 3HBVP 2AYKA 2XS3A 1XFZA 3GBOA 3OHLA 3F17A 2Y6CA 2J0TA 4FXQA 5CUHA 1UMTA 1OMJA 2OZRA 2SRTA 1BSWA 2OW9A 4FXYP 3DTEA 1CK7A 1QIBA 1AF0A 1CGLA 1IABA 1DMTA 2OY2A 1QIAA 3G5CA 4GR8A 4I35A 3AYUA 1J7NA 3BA0A 3EDIA 4XBHA 4GUYA 3O2XA 3P1VA 4XM7A 2ERQA 5B5PA 2EROA 1PWWA 4GWNA 3KMEA 5D1UA 2JT5A 2Y6DA 2OW1A 4WK7A 5I43A 1JAOA 1JJ9A 1ZS0A 2L0RA 966CA 2RJPA 5D7WA 3LQBA 1WNIA 3I7IA 1XURA 1ROSA 1EAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O64 A;  3TSK A;  1CQR A;  4H3X A;  1GE7 A;  4H2E A;  1KUK A;  3LJZ A;  1A85 A;  4IJO A;  1PWV A;  1BZS A;  4DV8 A;  3EHX A;  1QIC A;  3LJG A;  3TS4 A;  1G05 A;  1YP1 A;  3LKA A;  4QKZ A;  1ZXV A;  4XCT A;  1GE5 A;  5I0L A;  2OXW A;  2OXU A;  2OI0 A;  1GE6 A;  2MLS A;  3Q2G A;  3SHI A;  2MZH A;  1XFX A;  3N2V A;  1O0Q A;  3P24 A;  3OHO A;  4FU4 A;  2K9C A;  5CZM A;  1S4B P;  2JIH A;  3RTS A;  2X3A A;  2N8R A;  4JIJ A;  1HTD A;  3K7N A;  3F15 A;  1XFU A;  3F1A A;  2TCL A;  2MZE A;  1BIW A;  5LAB A;  3F18 A;  3KEC A;  1CIZ A;  4FVL A;  1FBL A;  4H82 A;  1R1H A;  1BKC I;  2Z2D A;  4AXQ A;  2V4B A;  2OW0 A;  1CGE A;  1GKC A;  3LIK A;  3LUN A;  1PWP A;  2FV5 A;  4G9L A;  3I7G A;  5CXA A;  3WV1 A;  3EWJ A;  2X3C A;  3HBU P;  3B92 A;  1BKC A;  1HY7 A;  3ELM A;  1FLS A;  1G12 A;  1Y8J A;  3N2U A;  3ZVS A;  2CLT A;  1MMR A;  4I03 A;  4PKW A;  4PKQ A;  1L6J A;  1UTZ A;  3LIR A;  5I4O A;  3DSL A;  1HFC A;  3MA2 A;  3TT4 A;  1I73 A;  2OVZ A;  1Y0V A;  1KBC A;  1MMQ A;  3KMC A;  3HYG A;  1ATL A;  3HDA P;  1IAG A;  1UTT A;  1OS9 A;  2OXZ A;  4AYK A;  3HY7 A;  1Q3A A;  5L79 A;  1SMP A;  2O3E A;  3LIL A;  2JT6 A;  2X7M A;  4H76 A;  1KAP P;  1XFV A;  2E3X A;  4PKS A;  4WZV A;  2JSD A;  1UEA A;  4PKT A;  5JMY A;  2W12 A;  1XUC A;  5BOY A;  2DDF A;  2USN A;  1UMS A;  1MMP A;  3WV2 A;  1AKL A;  1C3I A;  1GO7 P;  3F19 A;  2AIG P;  1D7X A;  4ZR5 A;  5I12 A;  1ND1 A;  1I76 A;  2X3B A;  3NX7 A;  5B5O A;  4A3W A;  1AST A;  3KEK A;  4DD8 A;  1EUB A;  5BPA A;  3KWV C;  3EDH A;  1JIW P;  1R1I A;  1GKD A;  3CKI A;  4GQL A;  5BOT A;  3F16 A;  3DPE A;  1OM7 A;  1JAQ A;  3AIG A;  4DF9 A;  1IAC A;  1Y93 A;  1JK3 A;  3ZXH A;  1CXV A;  1QJI A;  3B2Z A;  5D3C A;  5D2B A;  2HU6 A;  2ERP A;  456C A;  3E8R A;  1O0T A;  3Q2H A;  4GWM A;  4IN9 A;  3UVC A;  1BQO A;  1PWU A;  1ZTQ A;  3HY9 A;  1IAA A;  4JQG A;  1JAP A;  4ON1 A;  830C A;  3VI1 A;  3TVC A;  1SAT A;  1R54 A;  1Z3J A;  2WOA A;  1D8F A;  1XUD A;  4XM6 A;  3EHY A;  3LMC A;  4EFS A;  4XM8 A;  1A86 A;  4A7B A;  1G4K A;  4HX3 A;  3K7L A;  1BM6 A;  2W15 A;  2WO9 A;  1R55 A;  2YIG A;  4IUW A;  2W14 A;  5D1T A;  3EDZ A;  2E2D A;  1BUV M;  3DNG A;  3HDB A;  1K7Q A;  1JKY A;  5D1S A;  1IAD A;  1RM8 A;  4PKR A;  2I47 A;  2FV9 A;  4Q1L A;  1B8Y A;  4PKV A;  2KRJ A;  4L19 A;  1D5J A;  1QJJ A;  2O36 A;  4CTH A;  1XFW A;  5H8X A;  1B3D A;  1CGF A;  1FM1 A;  3HB2 P;  2D1O A;  1YQY A;  2POJ A;  3U1R A;  4AIG A;  1I1I P;  1OM6 A;  2QPJ A;  4PKU A;  3L0V A;  1ZP5 A;  2K2G A;  3LK8 A;  1SRP A;  1KUF A;  3B8Z A;  1OO9 A;  2J83 A;  4WKE A;  1C7K A;  1D8M A;  1JH1 A;  1BKC E;  1MMB A;  3WV3 A;  2CKI A;  4H84 A;  2DW0 A;  3G42 A;  2MLR A;  2DW2 A;  3LUM A;  4DPE A;  1C8T A;  1H71 P;  3KEJ A;  4L6T A;  1OM8 A;  1G9K A;  1IAE A;  2YB9 A;  4G0D A;  4L63 A;  2OY4 A;  4AUO A;  1QUA A;  1PWQ A;  1ZVX A;  1R1J A;  1ZXC A;  3EDG A;  3LJT A;  1KUH A;  3ZUK A;  1AYK A;  3VTG A;  4HMA A;  2D1N A;  1SLN A;  1OS2 A;  1SLM A;  2W0D A;  3L0T A;  1JIZ A;  3RTT A;  4WKI A;  1GXD A;  1JAN A;  3AYK A;  5I3M A;  4JPA A;  2JNP A;  4R3V A;  3DL1 A;  2W13 A;  1KUG A;  3LQ0 A;  1HOV A;  5I2Z A;  1MNC A;  4H49 A;  1KUI A;  4ILW D;  4J4M A;  3LE9 A;  4H1Q A;  3KHI A;  3DPF A;  2A8H A;  3LGP A;  4JA1 A;  1YCM A;  1G49 A;  1K7I A;  2OW2 A;  3KRY A;  1DTH A;  2MZI A;  4WF6 A;  1USN A;  2DW1 A;  1EB6 A;  1HFS A;  2WO8 A;  3LEA A;  1BUD A;  3DWB A;  3USN A;  1SU3 A;  1YOU A;  1GO8 P;  1RMZ A;  1K7G A;  4H30 A;  2XS4 A;  1HV5 A;  1CAQ A;  4GF1 A;  2OVX A;  4GR0 A;  4JP4 A;  2RJQ A;  4GR3 A;  1BQQ M;  5L7F A;  2PJT A;  3V96 B;  2DDY A;  1XFY A;  3HBV P;  2AYK A;  2XS3 A;  1XFZ A;  3GBO A;  3OHL A;  3F17 A;  2Y6C A;  2J0T A;  4FXQ A;  5CUH A;  1UMT A;  1OMJ A;  2OZR A;  2SRT A;  1BSW A;  2OW9 A;  4FXY P;  1CK7 A;  1QIB A;  1AF0 A;  1CGL A;  1IAB A;  1DMT A;  2OY2 A;  1QIA A;  3G5C A;  4GR8 A;  4I35 A;  3AYU A;  1J7N A;  3BA0 A;  3EDI A;  4XBH A;  4GUY A;  3O2X A;  3P1V A;  4XM7 A;  2ERQ A;  5B5P A;  2ERO A;  1PWW A;  4GWN A;  3KME A;  5D1U A;  2JT5 A;  2Y6D A;  2OW1 A;  4WK7 A;  5I43 A;  1JAO A;  1JJ9 A;  1ZS0 A;  2L0R A;  966C A;  2RJP A;  5D7W A;  3LQB A;  1WNI A;  3I7I A;  1XUR A;  1ROS A;  1EAK A; 
#chains in the Genus database with same CATH topology
 3O64 A;  3TSK A;  1CQR A;  4H3X A;  1GE7 A;  4H2E A;  1KUK A;  3LJZ A;  1A85 A;  4IJO A;  1PWV A;  1BZS A;  4DV8 A;  3EHX A;  1QIC A;  3LJG A;  3TS4 A;  1G05 A;  1YP1 A;  3LKA A;  4QKZ A;  1ZXV A;  4XCT A;  1GE5 A;  5I0L A;  2OXW A;  2OXU A;  2OI0 A;  1GE6 A;  2MLS A;  3Q2G A;  3SHI A;  2MZH A;  1XFX A;  3N2V A;  1O0Q A;  3P24 A;  3OHO A;  4FU4 A;  2K9C A;  5CZM A;  1S4B P;  2JIH A;  3RTS A;  2X3A A;  2N8R A;  4JIJ A;  1HTD A;  3K7N A;  3F15 A;  1XFU A;  3F1A A;  2TCL A;  2MZE A;  1BIW A;  5LAB A;  3F18 A;  3KEC A;  1CIZ A;  4FVL A;  1FBL A;  4H82 A;  1R1H A;  1BKC I;  2Z2D A;  4AXQ A;  2V4B A;  2OW0 A;  1CGE A;  1GKC A;  3LIK A;  3LUN A;  1XM5 A;  1PWP A;  3DTI A;  2FV5 A;  4G9L A;  3I7G A;  5CXA A;  3WV1 A;  3EWJ A;  2X3C A;  3HBU P;  3B92 A;  1BKC A;  1HY7 A;  3ELM A;  1FLS A;  1G12 A;  2YUF A;  1Y8J A;  3N2U A;  3ZVS A;  2CLT A;  1MMR A;  4I03 A;  4PKW A;  4PKQ A;  1L6J A;  1UTZ A;  3LIR A;  5I4O A;  3DSL A;  1HFC A;  3MA2 A;  3TT4 A;  1I73 A;  2OVZ A;  1Y0V A;  1KBC A;  1MMQ A;  3KMC A;  3HYG A;  1ATL A;  3HDA P;  1IAG A;  1UTT A;  1OS9 A;  2OXZ A;  4AYK A;  3HY7 A;  1Q3A A;  5L79 A;  1SMP A;  2O3E A;  3LIL A;  2JT6 A;  2X7M A;  4H76 A;  1KAP P;  1XFV A;  2E3X A;  4PKS A;  4WZV A;  2JSD A;  1UEA A;  4PKT A;  5JMY A;  2W12 A;  1XUC A;  5BOY A;  2DDF A;  2USN A;  1UMS A;  1MMP A;  3WV2 A;  1AKL A;  1C3I A;  1GO7 P;  3F19 A;  2AIG P;  1D7X A;  4ZR5 A;  5I12 A;  1ND1 A;  1I76 A;  2X3B A;  3NX7 A;  5B5O A;  4A3W A;  1AST A;  3KEK A;  4DD8 A;  1EUB A;  5BPA A;  3KWV C;  3EDH A;  1JIW P;  1R1I A;  1GKD A;  3CKI A;  4GQL A;  5BOT A;  3F16 A;  3DPE A;  1OM7 A;  1JAQ A;  3AIG A;  4DF9 A;  1IAC A;  1Y93 A;  1JK3 A;  3ZXH A;  1CXV A;  1QJI A;  3B2Z A;  5D3C A;  5D2B A;  2HU6 A;  2ERP A;  456C A;  3E8R A;  1O0T A;  3Q2H A;  4GWM A;  4IN9 A;  3UVC A;  1BQO A;  1PWU A;  1ZTQ A;  3HY9 A;  1IAA A;  4JQG A;  1JAP A;  4ON1 A;  830C A;  3VI1 A;  3TVC A;  1SAT A;  1R54 A;  1Z3J A;  2WOA A;  1D8F A;  1XUD A;  4XM6 A;  3EHY A;  3LMC A;  4EFS A;  4XM8 A;  1A86 A;  4A7B A;  1G4K A;  4HX3 A;  3K7L A;  1BM6 A;  2W15 A;  2WO9 A;  1R55 A;  2YIG A;  4IUW A;  2W14 A;  5D1T A;  3EDZ A;  2E2D A;  1BUV M;  3DNG A;  3HDB A;  1K7Q A;  1JKY A;  5D1S A;  1IAD A;  1RM8 A;  4PKR A;  1TVI A;  2I47 A;  2FV9 A;  4Q1L A;  1B8Y A;  4PKV A;  2KRJ A;  4L19 A;  1D5J A;  1QJJ A;  2O36 A;  4CTH A;  1XFW A;  5H8X A;  1B3D A;  1CGF A;  1FM1 A;  3HB2 P;  2D1O A;  1YQY A;  2POJ A;  3U1R A;  4AIG A;  1I1I P;  1OM6 A;  2QPJ A;  4PKU A;  3L0V A;  1ZP5 A;  2K2G A;  3LK8 A;  1SRP A;  1KUF A;  3B8Z A;  1OO9 A;  2J83 A;  4WKE A;  3DTK A;  1C7K A;  1D8M A;  1JH1 A;  1BKC E;  1MMB A;  3WV3 A;  2CKI A;  4H84 A;  2DW0 A;  3G42 A;  2MLR A;  2DW2 A;  3LUM A;  4DPE A;  1C8T A;  1H71 P;  3KEJ A;  4L6T A;  1OM8 A;  1G9K A;  1IAE A;  2YB9 A;  4G0D A;  4L63 A;  2OY4 A;  4AUO A;  1QUA A;  1PWQ A;  1ZVX A;  1R1J A;  1ZXC A;  3EDG A;  3LJT A;  1KUH A;  3ZUK A;  1AYK A;  1OZ9 A;  3VTG A;  4HMA A;  2D1N A;  1SLN A;  1OS2 A;  1SLM A;  2W0D A;  3L0T A;  1JIZ A;  3RTT A;  4WKI A;  1GXD A;  1JAN A;  3AYK A;  5I3M A;  4JPA A;  2JNP A;  4R3V A;  3DL1 A;  2W13 A;  1KUG A;  3LQ0 A;  1HOV A;  5I2Z A;  4L7A A;  1MNC A;  4H49 A;  1KUI A;  4ILW D;  4J4M A;  3LE9 A;  4H1Q A;  3KHI A;  3DPF A;  2A8H A;  3LGP A;  4JA1 A;  1YCM A;  1G49 A;  1K7I A;  2OW2 A;  3KRY A;  1DTH A;  2MZI A;  4WF6 A;  1USN A;  2DW1 A;  1EB6 A;  1HFS A;  2WO8 A;  3LEA A;  1BUD A;  3DWB A;  3USN A;  1SU3 A;  1YOU A;  1GO8 P;  1RMZ A;  1K7G A;  4H30 A;  2XS4 A;  1HV5 A;  1CAQ A;  4GF1 A;  2OVX A;  4GR0 A;  4JP4 A;  2RJQ A;  4GR3 A;  1BQQ M;  5L7F A;  2PJT A;  3V96 B;  2DDY A;  1XFY A;  3HBV P;  2AYK A;  2XS3 A;  1XFZ A;  3GBO A;  3OHL A;  3F17 A;  2Y6C A;  2J0T A;  4FXQ A;  5CUH A;  1UMT A;  1OMJ A;  2OZR A;  2SRT A;  1BSW A;  2OW9 A;  4FXY P;  3DTE A;  1CK7 A;  1QIB A;  1AF0 A;  1CGL A;  1XAX A;  1IAB A;  1DMT A;  2OY2 A;  1QIA A;  3G5C A;  4GR8 A;  4I35 A;  3AYU A;  1J7N A;  3BA0 A;  3EDI A;  4XBH A;  4GUY A;  3O2X A;  3P1V A;  4XM7 A;  2ERQ A;  5B5P A;  2ERO A;  1PWW A;  4GWN A;  3KME A;  5D1U A;  2JT5 A;  2Y6D A;  2OW1 A;  4WK7 A;  5I43 A;  1JAO A;  1JJ9 A;  1ZS0 A;  2L0R A;  966C A;  2RJP A;  5D7W A;  3LQB A;  1WNI A;  3I7I A;  1XUR A;  1ROS A;  1EAK A; 
#chains in the Genus database with same CATH homology
 3O64 A;  3TSK A;  1CQR A;  4H3X A;  1GE7 A;  4H2E A;  1KUK A;  3LJZ A;  1A85 A;  4IJO A;  1PWV A;  1BZS A;  4DV8 A;  3EHX A;  1QIC A;  3LJG A;  3TS4 A;  1G05 A;  1YP1 A;  3LKA A;  4QKZ A;  1ZXV A;  4XCT A;  1GE5 A;  5I0L A;  2OXW A;  2OXU A;  2OI0 A;  1GE6 A;  2MLS A;  3Q2G A;  3SHI A;  2MZH A;  1XFX A;  3N2V A;  1O0Q A;  3P24 A;  3OHO A;  4FU4 A;  2K9C A;  5CZM A;  1S4B P;  2JIH A;  3RTS A;  2X3A A;  2N8R A;  4JIJ A;  1HTD A;  3K7N A;  3F15 A;  1XFU A;  3F1A A;  2TCL A;  2MZE A;  1BIW A;  5LAB A;  3F18 A;  3KEC A;  1CIZ A;  4FVL A;  1FBL A;  4H82 A;  1R1H A;  1BKC I;  2Z2D A;  4AXQ A;  2V4B A;  2OW0 A;  1CGE A;  1GKC A;  3LIK A;  3LUN A;  1PWP A;  3DTI A;  2FV5 A;  4G9L A;  3I7G A;  5CXA A;  3WV1 A;  3EWJ A;  2X3C A;  3HBU P;  3B92 A;  1BKC A;  1HY7 A;  3ELM A;  1FLS A;  1G12 A;  2YUF A;  1Y8J A;  3N2U A;  3ZVS A;  2CLT A;  1MMR A;  4I03 A;  4PKW A;  4PKQ A;  1L6J A;  1UTZ A;  3LIR A;  5I4O A;  3DSL A;  1HFC A;  3MA2 A;  3TT4 A;  1I73 A;  2OVZ A;  1Y0V A;  1KBC A;  1MMQ A;  3KMC A;  3HYG A;  1ATL A;  3HDA P;  1IAG A;  1UTT A;  1OS9 A;  2OXZ A;  4AYK A;  3HY7 A;  1Q3A A;  5L79 A;  1SMP A;  2O3E A;  3LIL A;  2JT6 A;  2X7M A;  4H76 A;  1KAP P;  1XFV A;  2E3X A;  4PKS A;  4WZV A;  2JSD A;  1UEA A;  4PKT A;  5JMY A;  2W12 A;  1XUC A;  5BOY A;  2DDF A;  2USN A;  1UMS A;  1MMP A;  3WV2 A;  1AKL A;  1C3I A;  1GO7 P;  3F19 A;  2AIG P;  1D7X A;  4ZR5 A;  5I12 A;  1ND1 A;  1I76 A;  2X3B A;  3NX7 A;  5B5O A;  4A3W A;  1AST A;  3KEK A;  4DD8 A;  1EUB A;  5BPA A;  3KWV C;  3EDH A;  1JIW P;  1R1I A;  1GKD A;  3CKI A;  4GQL A;  5BOT A;  3F16 A;  3DPE A;  1OM7 A;  1JAQ A;  3AIG A;  4DF9 A;  1IAC A;  1Y93 A;  1JK3 A;  3ZXH A;  1CXV A;  1QJI A;  3B2Z A;  5D3C A;  5D2B A;  2HU6 A;  2ERP A;  456C A;  3E8R A;  1O0T A;  3Q2H A;  4GWM A;  4IN9 A;  3UVC A;  1BQO A;  1PWU A;  1ZTQ A;  3HY9 A;  1IAA A;  4JQG A;  1JAP A;  4ON1 A;  830C A;  3VI1 A;  3TVC A;  1SAT A;  1R54 A;  1Z3J A;  2WOA A;  1D8F A;  1XUD A;  4XM6 A;  3EHY A;  3LMC A;  4EFS A;  4XM8 A;  1A86 A;  4A7B A;  1G4K A;  4HX3 A;  3K7L A;  1BM6 A;  2W15 A;  2WO9 A;  1R55 A;  2YIG A;  4IUW A;  2W14 A;  5D1T A;  3EDZ A;  2E2D A;  1BUV M;  3DNG A;  3HDB A;  1K7Q A;  1JKY A;  5D1S A;  1IAD A;  1RM8 A;  4PKR A;  2I47 A;  2FV9 A;  4Q1L A;  1B8Y A;  4PKV A;  2KRJ A;  4L19 A;  1D5J A;  1QJJ A;  2O36 A;  4CTH A;  1XFW A;  5H8X A;  1B3D A;  1CGF A;  1FM1 A;  3HB2 P;  2D1O A;  1YQY A;  2POJ A;  3U1R A;  4AIG A;  1I1I P;  1OM6 A;  2QPJ A;  4PKU A;  3L0V A;  1ZP5 A;  2K2G A;  3LK8 A;  1SRP A;  1KUF A;  3B8Z A;  1OO9 A;  2J83 A;  4WKE A;  3DTK A;  1C7K A;  1D8M A;  1JH1 A;  1BKC E;  1MMB A;  3WV3 A;  2CKI A;  4H84 A;  2DW0 A;  3G42 A;  2MLR A;  2DW2 A;  3LUM A;  4DPE A;  1C8T A;  1H71 P;  3KEJ A;  4L6T A;  1OM8 A;  1G9K A;  1IAE A;  2YB9 A;  4G0D A;  4L63 A;  2OY4 A;  4AUO A;  1QUA A;  1PWQ A;  1ZVX A;  1R1J A;  1ZXC A;  3EDG A;  3LJT A;  1KUH A;  3ZUK A;  1AYK A;  3VTG A;  4HMA A;  2D1N A;  1SLN A;  1OS2 A;  1SLM A;  2W0D A;  3L0T A;  1JIZ A;  3RTT A;  4WKI A;  1GXD A;  1JAN A;  3AYK A;  5I3M A;  4JPA A;  2JNP A;  4R3V A;  3DL1 A;  2W13 A;  1KUG A;  3LQ0 A;  1HOV A;  5I2Z A;  4L7A A;  1MNC A;  4H49 A;  1KUI A;  4ILW D;  4J4M A;  3LE9 A;  4H1Q A;  3KHI A;  3DPF A;  2A8H A;  3LGP A;  4JA1 A;  1YCM A;  1G49 A;  1K7I A;  2OW2 A;  3KRY A;  1DTH A;  2MZI A;  4WF6 A;  1USN A;  2DW1 A;  1EB6 A;  1HFS A;  2WO8 A;  3LEA A;  1BUD A;  3DWB A;  3USN A;  1SU3 A;  1YOU A;  1GO8 P;  1RMZ A;  1K7G A;  4H30 A;  2XS4 A;  1HV5 A;  1CAQ A;  4GF1 A;  2OVX A;  4GR0 A;  4JP4 A;  2RJQ A;  4GR3 A;  1BQQ M;  5L7F A;  2PJT A;  3V96 B;  2DDY A;  1XFY A;  3HBV P;  2AYK A;  2XS3 A;  1XFZ A;  3GBO A;  3OHL A;  3F17 A;  2Y6C A;  2J0T A;  4FXQ A;  5CUH A;  1UMT A;  1OMJ A;  2OZR A;  2SRT A;  1BSW A;  2OW9 A;  4FXY P;  3DTE A;  1CK7 A;  1QIB A;  1AF0 A;  1CGL A;  1IAB A;  1DMT A;  2OY2 A;  1QIA A;  3G5C A;  4GR8 A;  4I35 A;  3AYU A;  1J7N A;  3BA0 A;  3EDI A;  4XBH A;  4GUY A;  3O2X A;  3P1V A;  4XM7 A;  2ERQ A;  5B5P A;  2ERO A;  1PWW A;  4GWN A;  3KME A;  5D1U A;  2JT5 A;  2Y6D A;  2OW1 A;  4WK7 A;  5I43 A;  1JAO A;  1JJ9 A;  1ZS0 A;  2L0R A;  966C A;  2RJP A;  5D7W A;  3LQB A;  1WNI A;  3I7I A;  1XUR A;  1ROS A;  1EAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...