1HG2A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg2A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg2A01
3D9NA 1JWGA 4NACA 2BF0X 2V8SE 3ZYQA 5LP0A 1PY1A 1HG5A 1DVPA 3D9KA 2L0TB 1EDUA 3G2UA 3D9JA 3ZYKA 1X5BA 3G2TA 1UJKA 2DCPA 1HX8A 1ELKA 4HFGA 3ZYMA 1INZA 2DIWA 1VDYA 5CMWA 1EYHA 1SZAA 1JWFA 3D9IA 4Q96A 3D9PA 3ONLA 1UJJA 1XGWA 4Q94A 3RRUA 2MOWA 4JXTA 1LF8A 1HF8A 1MHQA 1HG2A 5CMYA 2L0IA 3ONKA 2QY7A 4GZDA 4FU3A 4AVXA 2LO6A 3G2VA 1JPLA 5J08A 1JUQA 3D9MA 1SZ9A 3D9OA 3ZYLA 3D9LA 3G2SA 4FLBA 3G2WA 5LOZA 1H0AA 1HFAA 3LDZA 2KM4A 3CLJA 4GZCA
chains in the Genus database with same CATH superfamily
3FUJA 5F3JA 2A9UA 4ZI3D 3SOLA 3ZN0B 5E0OA 5EYPF 4X20E 1TJCA 5LX8A 5CFBA 2XCBA 4UWHA 3E37A 3C98B 3FEYA 2IO3C 3V30A 3ZC0A 4WNKA 1XGWA 5JJ7A 2X68A 4B3ST 2A2FX 2VSXE 1O5MA 2R2LA 5L3BB 5FMNA 4PK6A 4FULA 4BT8A 5FTPA 2W00A 2N9DA 4APFA 4F1SA 4HOTA 1J1JA 2PZIA 4GTTA 3N9QA 4IULA 4N78D 4GYWA 1S94A 3PURA 3O1IA 5JA4D 3FUHA 3MYVA 4F6RD 2OA5A 1WG0A 2LSKA 4G8LA 1ZU2A 3OJAA 2P9LG 1ELWA 2ZMAA 2WXHA 3E32A 3OXGA 4DUIA 4KP3C 3SHFA 1E8WA 3FTWA 3DSWA 3KV9A 3J5PA 4ME2A 2EHOC 5FZSA 1T8BA 4KBQA 2X6JA 1KF6A 4DR4T 4U7IA 4WWPA 1ZOYA 2P9KG 5ENOD 4JPSA 2H7OA 4HFDA 5D2MC 2AXUA 3CK7A 3HL6A 1HR0T 2VYIA 3VTXA 4AOFA 2BG9A 2ETBA 1B89A 3UM2A 3JAFA 3D9PA 3KINB 2FBNA 3FXEB 2CCQA 4L5GA 4GMLA 4XZCA 5ABFA 3RO3A 2J4BA 3MZLB 1FIOA 3ZCIA 4I2WA 5A6CA 2Y8DA 2FI7A 4J7WA 3Q15A 3V2XA 2R05A 1J5ET 4AQFA 5M4YA 4DV5T 5L3CB 3CMLA 5AQ7A 3TAXA 2QRXA 3URZA 3Q49B 4IHJE 4A1GA 2H6HA 1E7VA 2A5EA 1DCQA 4UI9C 4AISA 5CMWA 4ATGA 3ML9A 1BPOA 2IOLA 2AWIA 3S2AA 4DIDB 2IONA 4EZ4A 1IQUA 3ZGQA 4IL9A 2D0TA 2PTFA 3S4UA 3JUEA 3FZKB 4JI2T 1WY6A 4FLBA 2CG2A 2E2AA 2VQET 3IHYA 2KXPB 3N9PA 5KDMC 3FB2A 5FXWA 3T1YT 3RLFF 4JEUB 3C3RA 3PUZF 2CHNA 3FZHB 3EDUA 3PUYF 3BUAA 4PS8A 2BS3A 2V0PA 2D0UA 3JXJA 1M62A 4HWHA 3RX6A 1SZAA 3U9WA 4PH4B 2FUPA 2XAHB 2X0YA 2BUGA 3TLTA 2UXNB 2WCAA 3HI2A 1O1SA 4BFRA 2ACXA 4JI4T 3FWVA 3CVPA 3I4GA 2WM9A 3AEDA 5AQGB 3PTRB 3FTZA 4PJNA 4ZHQE 4QH5A 5J2TE 3P4QA 3RI5A 1MNEA 5CRVA 2KZ7B 4N39A 3HXDA 1UN9A 2HPJA 2NC9A 3NAWA 4OFZA 3MKRA 3VHLA 1OWNA 1BR2A 3BQLA 3M65A 4JZYA 2D9DA 4XEIG 4A56A 3ZMVB 3V79K 3EI0A 4H63H 2LOPA 4NIQA 1UCUA 4WBNE 1Z5SC 4D10C 4IDOA 3SO8A 4JI1T 4UIGA 1SVXA 4F53A 3R7RA 2IF4A 3QARA 4WNDA 2DZOA 3R84B 4IE6A 4B3TT 2WMOA 1OWPA 3OPCA 2ACZA 2IUBA 5FJYA 2MPKA 3KEAA 3N2GE 3QB5K 3UU5A 3UUBA 4R7LA 4ACLA 4HRLA 1LTXA 4O2AE 5KMGP 2P9PG 1DU2A 2BKGA 5AQRB 1U4QA 2WPVA 3PZ2A 4BTAA 4DMVA 2D2SA 2OV9A 3V2OA 3LFMA 1K8KG 3EUHA 3JQ0A 4UF0A 3CVYA 3DSTA 1KPSB 3TWWA 4MALA 4HFIA 5ANLA 3HG0D 1HS7A 4IRUA 1Y01A 3VTYA 1IJ6A 3DEOA 2ETCA 2Y4TA 3D9OA 3ETUA 3QB5A 4UWFA 4CCAA 1OXZA 1RW2A 2IEJA 2WQYA 2WWVA 5CECB 3QKYA 2L9BA 4G2AA 5L4HA 5FT9A 2L0TB 1N32T 1EDUA 4A3TA 5TAOA 4WZXA 2BKNA 4ANVA 2I0MA 5EZYE 2DYSE 4ZOLE 3UUNA 3PUSA 4DI3A 2YOEA 4JI3T 3HXFA 3QK0A 2H3RA 2ZGDA 3MX3A 2Y0BG 1AJ3A 2KBXA 2VVNA 2WQ7A 1LRZA 2I1JA 4LF7T 4I1AA 5LHGB 2V7KA 4X64T 4GTSA 4JLEA 4L9PA 2K9AA 3ABKE 1WR0A 1HG5A 3D9JA 3HVEB 3R6NA 4HFEA 1PAQA 4QH1A 1E7PA 3IBPA 4CZZB 2VQFT 2WXOA 3FDHA 5A1LA 3ZNGA 2V7MA 5JDHA 5CA0E 1A17A 4EEDA 1YMPA 4HVBA 5FQ8A 4LMLA 3AG3E 1FT2A 2V5DA 3FU6A 2QA7A 5L47A 1Z8UA 2CE7A 4TV8E 2YQ8A 4N5CA 3KEZA 2V5CA 3WAJA 3LJNA 4G1TA 5LG4A 4X65T 3N5LA 3S7DA 3AXJA 2RFMA 2WQ6A 2BBJA 2M63A 2BG9C 4C0MA 1AP7A 3LS8A 2KNDA 5AQPB 1RZ4A 1D8EA 3IA3A 1TEZA 2CLYC 2Q9QB 4CRWA 1SE7A 2J09A 1N52A 2Q9QA 1QSDA 4B6XA 3ZVVA 3BG0B 2OLTA 2MTQA 4OAUC 3E30A 2W0GA 3DWLG 3K3OA 2IC6A 3LG7A 1Q2ZA 4U72A 4AKLA 3ISMC 4KZCA 3X2QE 4O4LE 3FUEA 2KCLA 4ERRA 4EV6A 4F8HA 3APDA 3ETVA 1WLXA 5JDQA 2XPKA 3FBLA 4UQZA 5AQNB 2LSGA 4K0UA 1UW4B 4Q94A 3CQXC 2HN2A 2I59A 4A63B 2VWAA 4AQYT 4UELA 2A4ZA 3TXMA 5F8PA 4WWNA 4EOZB 1IZNB 2LAHA 2JIWA 3TXNA 4L2LA 1KK7A 4A1SA 5M72A 3P4SA 1X81A 2M6BA 2LXLA 4G8KA 2KCVA 2ILRA 4ATZD 2IDOB 1LVKA 4ILGA 3A5XA 1G3NB 5ANRA 4GKJT 4K5BA 2NOXA 4Z90A 5LGUB 4H9QC 5ABGA 5HRYA 2CWOA 3FHNA 4FU3A 4N2SA 3CK9A 4HFBA 5L3DB 4AKIA 5CRUA 4CT4A 2V6YB 3IEEA 5J0ZA 5D66A 4PFOA 2DL1A 4PFPA 5DQVA 2VASA 2X6KA 3RH3A 1QLBA 5EYLA 4J8EA 2QFCA 3K9IA 4ILHB 4B3MT 2M6IA 3VR9A 5BPPA 2XCCA 3VRAA 4RLYA 5LYJE 5A7DB 4U7EB 3UIPC 3NRYA 3UQ7A 4CXXA 2AXVA 2X38A 2LAIA 3NVOA 1QZ2A 4YFSA 4OVUA 3EU9A 1ELRA 2GRLA 2C2LA 2A72A 2R17C 2WY2A 3GW4A 4QXCB 4YTPA 2W63A 1HCIA 2WWUA 2K24A 4ZZCA 4LSZE 4G26A 3FUNA 4C0EA 4EGWA 5HKPA 3HIZA 2MBGA 3ENEA 3ZMZB 4AQFC 3ANWB 3OTOT 3ASHA 1OXJA 1UN8A 2NSZA 4GYSA 4GB9A 3UM0A 3ZYLA 1FVFA 2V26A 5LBMA 1HE8A 5AQ9A 1H0AA 3P1UA 1E8XA 4EZJA 3UT5E 4YTMA 2JLBA 1OUVA 1BI8B 3EIQC 4QXHB 2W2UA 4ZHBA 4AXPA 5JMND 2HN1A 5AQOB 5G05C 3RPUA 4K5CA 2KC7A 4FJZA 4Z8XA 1GQEA 2W62A 4DX6D 3AVSA 3Q7AA 5ENRD 4DV6T 3AJIA 4GZDA 3Q7FA 1K1BA 3GA8A 3RYIE 3PRZA 5CB4E 3TLVA 3I9YA 3BG1B 1BI7B 3PREA 1IHBA 1HNXT 4BY6A 1VCSA 4TV9E 2UY1A 2J1DG 2H7VC 3UUXA 3UT4A 3D9HA 3SFYA 4NRHB 2C5JA 3L9TA 2UU9T 5L4EA 3DBSA 4I2ZA 2N1GA 2DI4A 4U0UA 1E90A 4UUCA 4A5XA 2XGMA 4P0BA 1TNUA 4DX2A 3CVNA 3DSXA 5D0QD 4CI2B 4YVOA 2BVLA 2JMKA 4GOUA 3O1HA 4UQYA 1H6KA 3UI2A 2OEVA 3CK8A 3ZMSB 4FC8A 4XIFA 3SFEA 4UQXA 2Y48B 4YXDA 4YY3T 4TUMA 1M7KA 3LSVA 4X5TA 5HEJA 4BSXA 4TX5A 2H6IA 2VJ8A 5J1GA 1CUNA 4EB6E 1N94A 5LCWJ 2XGSA 4IDQA 3AA1B 4TXQA 1OEDC 3N9OA 1JWFA 4J8YA 3K1SA 3AEGA 2Y69E 3PEUB 2KLQA 3RRMB 4V3IA 2GROB 3U66A 3E33A 4JHRA 1DC2A 3U3IA 2QYWA 2V4HC 3GZ2A 3MV2B 4M3OA 4LNUD 2FBWA 3QC9A 4MRUA 2BVMA 4OYSA 1T7SA 4EPZA 1FCHA 3RF1A 2FULA 4FJYA 3RQUA 1TNZA 5C1DA 4G63A 4HWIB 2YNQA 5CMYA 5HXSA 2NTXA 3ZYKA 2ZLYA 4EIWA 5G2NA 5LCYA 4GYRA 3WI3A 4IDPA 4DO0A 4P29A 5KCMA 4CT0A 3CSFA 5FKYA 5AENA 3WXXA 3TLUA 3FU5A 5HEOA 2XAGB 4HFVA 5FQ7A 5G04J 3R7QA 3DXMG 2YEVC 3HKEE 3P50A 3RKVA 2CXLA 2CRBA 3CKCA 2JQKA 2XUEA 3LVRE 2LJLA 1OWMA 3T5XA 2NW9A 3DP7A 2HYZA 2WB2A 4U3CA 2Y6XA 5EIBE 3UXGA 4YDWA 4GK0E 3L82A 5EX3A 1UJKA 1IBLT 2X6IA 3D9IA 1X9BA 1L0VA 2YDRA 3DJBA 3FUKA 2IQCA 4P1NA 4TZ4C 2Y1LE 1XWMA 2QY7A 4QQIA 3AE6A 4U8VD 4UXNB 5HXCA 5CERB 2EHOA 4X1YE 2B76A 1MX6A 5C2TA 4PJJA 3AEAA 2VK9A 2WXKA 4Y6CA 3CVWA 1TN8A 4JEHB 1NEKA 1Y64B 3B7SA 5FQ4A 4JYAT 5BXOA 1UJJA 4BA9A 2VSNA 2IFUA 3CR3A 3MKQB 3DEPA 3MK7C 5JR9B 4MLPA 4X62T 2WBLA 1OCZE 1NENA 5KJKA 3H37A 1IKND 2ZIRA 4RG9A 3MXZA 2IAKA 3PU3A 5T4YA 1BU9A 2I6HA 1YQ3A 2LHRA 4F6RC 4HKAA 5IHYA 5FP3A 1QQEA 1Y8MA 3EVYA 3EJNA 3HVEA 5D0OD 4ANJA 1TYQG 4JI6T 2F8XK 4PK5A 3HXEA 3RK6A 5HI7A 2X9WA 1LD8A 3ZJ1A 5AQHB 2XPIA 1YXRA 2KINB 4MS6A 1HF8A 5AIJA 2XS8A 3L8RA 3HRAA 5KXJA 1IAPA 3PS6A 3T8KA 3APFA 4GTMA 4UVCB 4O1PA 3S7FA 5CBNA 3UM1A 1ZHCA 3TJPA 3PV0F 4Q25A 3FUIA 5FXZA 4OYKA 4UEMA 4BX9A 4DV0T 3AE9A 5E76A 4C90A 1V54E 2B6CA 4HXIA 3ASGA 4TUUA 1XDPA 3PUWF 3MGBA 2ZM6T 5H6RB 3TWSA 1E1HB 5EDSA 3T9KA 5FZQA 2WP9A 3NZPA 5JJTA 3DPYA 3FEXA 2L8KA 3SRZA 2VURA 4PK4A 4KXKB 4JHJA 1JCRA 2XEHA 3LDZA 3W9FA 5IWAT 5EN5D 4FLHA 3AG4E 2PL2A 2XM1A 3ZYQA 1JCSA 3J9X1 2LM2A 1NAFA 2ZM8A 1ZKEA 1OEDB 2E8IA 3GWHA 3Q75A 5LG3A 3MACA 4DV7T 4GYOA 3B57A 3QWVA 3KVBA 5ABHA 3HYMB 1KLXA 3AU5A 1KEYA 1S64A 4JV5T 3OXLA 3ZJ2A 3FHEA 2QYJA 1YCSB 1IQRA 1D1AA 5DABA 3BEEA 4LFCT 5C3JA 1T98A 2HR2A 3CVQA 5ENTD 4NUVA 3I4RB 1NFIE 1AWCB 3NZQA 2DHRA 3FXDB 2ZU6B 4N3AA 3SY2A 3VRBA 4DI4A 3TLWA 4JEHA 4JC8A 5HEUA 3NZUA 3ASDA 4E7ZA 3B5MA 1I6ZA 2WZIA 4CI3B 4ZI2C 3KBTA 2DBAA 5FL1A 4QHOA 2RA1A 3JQ1A 4U8HA 3UT8A 2ETAA 4CXWA 2LSYA 2KSRA 4IE4A 5AQAA 3JC6D 2WZHA 4U2ZA 3SBSA 4Z91A 4HRNA 4GA2A 4RQIA 4PAGA 4J0UA 3B7UX 2LUHA 5LMUT 1YYHA 3AE1A 1XMQT 3N2KE 3LEWA 3FH5A 4A3VA 3CVUA 1MMAA 4GZ3A 3UU6A 4I55E 5FXXA 2GGFA 2EHOB 4GZ5A 2WU2A 4O60A 5FYMA 3AE5A 2VKOA 3OYXA 3M3ZB 1DNPA 2RD0A 3PUJA 4HLLA 1BR1A 3SNXA 1N34T 2FF4A 3IKOB 1Z3YA 5FVKA 3AG2E 3CHOA 1US7B 2BKOA 1L5JA 2PJQA 2X9YA 2V7IA 4YJ2E 2X66A 3KS2A 2FEZA 4FI5A 4I0UA 2XQ9A 4B8CB 2BTDA 5LFAA 5ADXL 3AE3A 3L17A 2LSVA 4X1IE 3PU8A 2E2EA 4JW1A 4U96D 4GYYA 3CHRA 1PY1A 4L0RA 4ASKA 4YHJA 2Q7FA 2FJEA 1INZA 1YD8G 1VOMA 5JJ6A 5JDLA 3TLSA 3RIUA 5FWQA 3ZMTB 3ONKA 5AQBA 3IHRA 5HCJA 3O1JA 2MHKA 1HS6A 4U63A 4TV3A 4ISTA 2LEHA 2LLYA 2GRPB 4GIWA 2P9SG 5AQUB 2LT3A 4DJAA 4L1BA 4UF0B 2XRZA 5IY5E 2JMHA 4TXRA 2J9QA 1YKHB 1DVPA 2WDVA 5FXVA 2AXZA 2UY1B 3T8OA 3EHRA 1HX8A 4GMJA 3FTSA 2L6BA 2MRIA 2ZISA 1SA0E 1W09A 1WAO1 3AAAC 5DIZA 3J5QB 5B3SE 2XY8B 3JCFA 2H6FA 4M1PA 2P9NG 3SGHA 2F4VT 2A3DA 2PM7A 4UWKA 4KHPT 4BTBA 2IW5B 1SA5A 4TNVA 3PDNA 3TWUA 2JPFA 1KT1A 4GZCA 2BZBA 3FULA 3FUDA 4MBQA 4DX7D 4O4IE 3LCAA 4HWCA 2Q9QC 3QOFA 5AYWD 1MMNA 2OEWA 3Q9NC 4BEPA 2WVIA 4ILAA 3PZ3A 4G11A 2PQNA 4ZI7E 2H89A 3ZN3A 3L3PA 2YU1A 2QVAA 1S0PA 2R03A 4ANXA 4P0AA 5BV0A 2Y3AA 3MA9A 4UVAB 5BW8C 5HYAA 2JABA 3O4ZA 4HTEA 5T8IA 5IUXA 3ZSSA 4WWOA 3EHNA 3ZUVB 2P2CP 4I9CA 2FO1E 5AAOA 3QWWA 3UINC 1LVFA 4U2YA 3VLDA 3LK2B 4LF8T 3DSUA 3ZEFA 4KMCA 5B1AE 2XPZA 4UI9K 4O2BE 4IL4A 3CWZB 4XI9A 4O1OA 4DBRA 4KVMA 4FP7A 3NWIA 5LP6E 2XENA 5JDFA 3GZ1A 5LP0A 3SQVA 3B13A 3ONXA 3K8PC 4Q96A 4YT0A 4H63V 4XZ4A 1KNRA 1CHUA 4HOQA 1UX4A 3C3QA 4O8SA 4HB5A 5L3EB 4NQ0A 4ILIA 2IHR1 3ZKRA 2KZTB 3GYZA 5BT1A 4H9SE 3QOUA 5AFUL 4JB8P 2CA5A 4I43A 5EILA 3W15B 2WXIA 3ASFA 4FADA 1MMGA 4WYVA 1FT1A 4LF5T 4U8YD 3PUVF 2BKPA 2RPAA 4DR3T 4YHHT 3ZYMA 5GONE 1N9AA 2HE0A 4BWRA 1E8ZA 1BR4A 2C5KT 5FZRA 2V6XA 3ZSTA 2FJAA 3AECA 2W67A 3AA7B 3Q2MA 3ZLIA 3V5SA 4CXYA 5KNHD 3F57A 4AVXA 3TGOA 4C91A 4TUYE 1H7CA 2UWJG 4ABNA 4IREA 3FU3A 5ENSD 3KFWX 3P4WA 4H7XA 3ZIMA 4K0KT 3TL5A 2F0YA 3PE3A 3U78A 2NTYA 2DNXA 3PUKA 2LKGA 4G25A 3ZXSA 3DXKG 4AKHA 3FH8A 3HXBA 1JNRA 2W4XA 3LDQB 1N0QA 2LNIA 5EK4A 3MKQA 5LBQB 4ZXLA 5FNVE 1QNFA 4HEAA 3HKBE 3N9NA 4I6JA 3N9MA 3DTOA 4HORA 5LGNB 3Q79A 3Q5WA 4JI5T 4X1KE 2MYOA 3ML8A 4Q69A 4L23A 4GK5E 4WNFA 2L3LA 5AJDA 4NXMT 4F3VA 3L39A 4B94A 3C4WA 2WU5A 4URKA 3ZHEA 4W9RA 1TR4A 2IC9A 3IV0A 4HS2A 3FZFB 5ETWA 1K1AA 4B8AA 3IXEA 2CG3A 1KNPA 4AJWA 5JRCB 1NP7A 2VVSA 2C0LA 3PE4A 3RRWA 3NQPA 3AAEB 2XQ3A 5F5WA 4LCTA 4KVOA 3G2WA 1VRBA 2KATA 2XQ6A 3LJCA 3C98A 4ZFHA 2FO7A 1E2AA 3RAUA 2NP9A 4LRZA 4YDOA 4JL0A 3H3MA 1Z0PA 2E5VA 1K3ZD 3OKQA 4GTPA 5LCWC 2ZGGA 4MBGA 5T3RA 3I5PA 4TN7B 3MV3B 4EZLA 4TRQA 4LMKA 4ZI3C 3CVRA 5AQSB 4AIFA 4HQDA 2VGXB 3AEFA 3CLJA 4YVQC 4NACA 3SBTB 2XEVA 2ODUA 2CXDA 3CQCB 2N2NA 1O3XA 2IY0C 1N4SA 3PUXF 5DJQC 3DSSA 5KJLA 4U0SA 2XZTG 4ANUA 2R6GF 3GMIA 2PBIA 1YA0A 3EABA 3LY8A 2EIKE 3ONJA 3ABLE 4JI8T 4GTRA 2PNNA 4YNDA 2J49A 4MFRA 3C5RA 4YDYA 4DBQA 1MYOA 3HR0A 3TWRA 3D9NA 1SUMB 3KV4A 4H9RC 5FIOA 4GA0A 3B7TA 2HM8A 2IIUA 1HX1B 3RQWA 2LOSA 2WB5A 2YDSA 3ESKA 4ILUA 3WG7E 2ONDA 3ONLA 1D8DA 4B93B 4E85A 4GMRA 2P58C 3UQ3A 4I9EA 3E34A 4WAFA 3CSTA 3AE2A 1D9SA 4GCNA 3JCKC 4HFHA 2CPTA 2KM4A 1A5EA 5FY0A 4P09A 4PJLA 4JVSA 5HWXA 1OT8A 5CHEE 4G24A 1WCRA 4XAXB 3JUIA 2VL8A 3EDVA 2WXRA 4HGAA 4TWDA 1O1RA 1MIVA 4O6FA 3UT7A 4EZKA 2YDQA 3VKGA 4CDNA 2L9QA 3PUAA 1NL4A 2UXBT 4GZ6A 3HKDE 1UG3A 4DUZT 3SFXA 3MCXA 3VLFA 5G05J 2RP4A 4H7YA 2ZM2A 3MKDA 3T5VA 4U74A 3N71A 1H19A 2XHEB 3C4XA 3TWVA 1D1CA 2WXJA 3NB2A 2VSOE 3Q73A 5HXRA 2WSSV 3ZT5A 5JR9C 4OX9T 3ULEG 1FMWA 4BX8A 4OHFA 3AEEA 4U33A 2LE8A 4O4JE 3BU8A 1IBKT 2VB6A 3E0ZA 4Y6WA 1XDOA 1XNQT 2J08A 3KAEA 3D9MA 4J8SA 3UMVA 3OBVE 2W61A 4CYMD 3A8YC 2UXDT 3B7RL 3CEQA 4J6IA 4AXHA 3V31A 2K48A 5EK3A 2QZAA 4IGUA 4APOA 3CX6B 5AQVB 5JTGA 4E7SA 5BMVE 1UK5A 4BJNA 4LF4T 2WXFA 3C72A 3RKOA 1EPUA 3CHSA 1N95A 2KWIB 2WXLA 3L6AA 4XBFB 3O9XA 3ESLA 3T1HT 5AQQB 4J8DA 2H88A 3NZSA 2IO2C 2L0IA 4JA9A 2I9CA 3ZN1B 1XNFA 3E08A 3Q5DA 4DV2T 3LXUX 4EQFA 3ZW3A 1N54A 2PQRA 3D0TA 2CFUA 2PFVA 3UUMA 2X67A 3UQ4A 4CN6A 3NOCD 4DNDA 3L22A 3Q4AB 3FZMB 5JR9A 4OAVB 4DR2T 2DWGA 1SQMA 3ZT6A 3RRUA 2AXDS 3QJZA 3Q5XA 4ISSA 4JD2G 1FJGT 3CHQA 4DUYT 4BETA 4HOSA 2R02A 1MMDA 4KI0F 4IE0A 5HXHA 1JCQA 2CXFA 2X9HA 2E9XB 4LUNU 4AV7A 4TNWA 3ZMUB 3Q5EA 1U5PA 4QX8B 5L3GB 1WRDA 4UV9B 3C51A 4K03A 4YSYA 3RC8A 4WNGA 1G8XA 4NUUA 2OCCE 2L6JA 2HPLA 3FBZA 3KSLA 3LVQE 5ARFA 2ZM0A 3I9WA 4UI9J 3HA4A 3KV6A 4FHKA 3QDNA 1FPPA 3C64A 4MLKA 2AJAA 2XZDG 4GAAA 2W66A 1JUQA 2G0UA 4I6EA 1ZEEA 2CM0A 4DV4T 5J2UE 2XPYA 1W0BA 5JREA 2J4DA 3S7BA 5ABEA 2XHEA 4AEZC 4JI0T 5FQ6A 3TG5A 4LMJA 3NF1A 1W3BA 1UUSA 1YQ4A 3FP3A 3IEGA 1HNZT 2YHEA 3ZT7A 3JC6C 2XQ0A 5HAXA 5CJ5A 2B1EA 2CHZA 1HZ4A 1N33T 2X9XA 1NI1A 4G23A 4ILCA 3HXCA 1YKEB 5LMNT 2NXPA 4HOUA 1H2TC 2J4GA 2LSUA 3VR8A 3UFEA 3SF4A 3Q9DA 1SZ9A 3KBUA 2H6GA 4JHKA 3G06A 3AE8A 2WAUA 5AQTB 3TKLB 1WDYA 2XQYA 1B7TA 2PG8A 1ZB1A 3LPZA 3ULYA 2V8SV 4IIJE 3CGHA 3CX8B 3OXFA 3D9KA 3G2TA 5A23A 1IXVA 4HFGA 1D0XA 4DR6T 2OVBA 3U3WA 4CGWA 4BT9A 1H2VC 1LF8A 1N11A 2J62A 4LEUA 4KBMB 4KHZF 5JVDE 5C8YE 4U95D 4EHMA 4TXPA 4Z68A 3ANWA 4NIKA 3B95A 3FZLB 4QXBB 3CVVA 2I1KA 4PJMA 2V1DB 3EAMA 2IMLA 2J47A 3LJ3A 2KWHA 2IOSA 2VKHA 2NYJA 3GN5B 3Q9UC 2SPCA 4YSXA 2JEKA 1H6PA 3EU5A 4F1PA 4DMWA 4CQIA 4HE8A 5FVLA 2V6YA 3H3AA 2WS3A 4F7AA 4GA1A 3AS4A 2XQ8A 3L16A 4WW0A 5HXEA 1N0RA 2OOEA 5J90A 4NXNT 5LHIB 5C2YA 4I6GA 1Y6IA 3MZKB 4G2VA 4GCOA 1ZV4X 3VLEA 3LK3B 1TNBA 3SZ7A 2AVPA 2DWKA 3DPDA 3QWPA 2MOZA 1GW6A 4CI1B 4PS7A 4EBAG 2LRLA 3RC3A 1WYBA 1KZPA 3N9LA 3AEBA 1XZYA 2NR4A 3APCA 4DR1T 2LSJA 3LBXB 4KT6B 2OVFA 1V55E 2ES0A 3RIFA 4UR9A 3EHMA 4AY5A 3ZEFB 2VTBB 4L9IA 4DVDA 5AJLA 2VGYA 3RIUC 4DPRA 2F8YA 4C48B 2DCFA 2RG8A 2X6HA 1NZNA 3O4XE 2P9IG 1MX4A 4GU5A 4ZI2D 2DZNA 1D1BA 1TNYA 4IT4A 4J8FA 1KT0A 2X51A 3I1AA 4BAYB 3LKUA 1D0ZA 1KZOA 1EZ3A 1FMVA 3PH0C 4QWNB 4L2YA 2KCKA 2EHOD 3PZ4A 3PZ1A 3OYZA 3AS8A 2LXMA 3RYHE 3AS5A 5FINA 4TWHA 2HO1A 2XQ4A 1NWMX 3GN5A 1H2UA 4HRMB 4GPKA 1BLXB 3OVUA 1QYMA 1TN6A 5H6QB 4CDRA 4U07A 2CHXA 4E6HA 2XS1A 3CHPA 2J8SD 3BK9A 4I4TE 4EECA 1S35A 3I3NA 2R5SA 1HO8A 1IJ5A 2GRRB 2E0IA 3Q47B 3ZU7B 5CEAA 1X79A 3A7MA 2WQHA 3CQGB 5BUZA 3D9LA 2Z6EA 5FY1A 2V7JA 1OCOE 2BG9E 3P2BA 5EK2A 1E8YA 2YKSA 3L13A 2CWYA 1BR0A 5BV1A 4AQGA 2BG9B 3L08A 4DV1T 1VCTA 5DQWA 3J7Yq 3UX4A 3FFLA 2CLYB 1WFDA 1WYCA 2GRMA 1FEWA 3CHMA 3FTUA 1HH8A 3RJVA 2XQ7A 4IE5A 3MJXA 1DCEA 1MHQA 5KJMA 4YLHA 2DLRA 3RKGA 5BNWA 4JI7T 2JJ9A 4U04A 2LO6A 2KXPC 2P9BA 5JDMA 4K0RA 3QAQA 4LFBT 3SS1A 5LJMA 4B89A 5JRCA 3FTVA 5KX5E 3RSEG 1HFAA 2I2OA 5LHHB 2WDRA 5L3FB 2UXCT 1MX2A 1HXIA 1TNOA 2NWBA 4U31A 3EIJA 2NW8A 1OCRE 3L09A 3U4TA 3QNUA 1T72A 4DX5D 3LY7A 5LA6E 2WXMA 1TN7A 5HCMA 5HWYA 2CBIA 5AQMB 3ZCJA 4C9BB 5HQ8A 4OYJA 3DRAA 4PUCA 4XKCA 2BS4A 3VU7H 5CCLA 2RFAA 3O48A 5IYZE 3C3OA 4HNAD 2BBHA 5CA1E 3PZDA 3UFGA 2JQHA 3QK6A 4WUYA 4AY6A 2GRNB 2CMRA 3VKHA 1S70B 1OWLA 3QUJA 5LOVE 4FHJA 3R9MA 3ONLC 3NBXX 3RIBA 3KDSE 4I50E 4ADZA 2ZXWE 3RO2A 3KVAA 2XSAA 2HHHT 2BKKB 3SFDA 2OV8A 3NOGD 4EXTA 3QC1A 2YINA 5KNGA 3CKDA 4EAHA 2VTBA 4CEMA 4ZS3A 4CZ2D 3BQOA 2WXQA 1JWGA 3AU4A 2P9UG 3ZPJA 3ABVA 4WNEA 2VKDA 4V1Av 1TJFA 1LKXA 2BS2A 3V5UA 3SD5A 5G55A 5CGMA 2WXPA 4WBOA 5AQLB 1N4QA 4HBDA 5KJNA 4OVVA 4KX6A 3RU0A 3EHZA 4TWFA 5CCMA 2XTLA 2JQ9A 3EUVA 3ZHEB 2AE9A 1N36T 1J5WA 4EEBA 3ZC1A 4I17A 3K3NA 4IYPA 2WXNA 1MIWA 3PJAA 2M67A 4BERA 5JH7E 4LG6A 3BQIA 3ZFWA 1OCCE 2CHWA 3DSVA 2DCPA 2CBJA 4EYUA 3FUMA 3P4PA 1KNZA 3UKRG 5HS0A 4DR5T 4QFVA 5CBOA 4U0ZA 2V5QC 4CDMA 2XZEA 4N3CA 4XE0A 3UPVA 3U64A 1JPLA 4ANWA 4PDXA 4XKBA 5L2LA 2BDEA 2C5IT 4H9NC 2B0OE 3I0QA 2WDQA 4U7YA 5JDNA 2X3MA 5EX0A 3ZKJA 3HDXA 1UURA 3K3QC 2RKKA 2LKHA 3PDYA 2V5FA 4GKKT 4BJMA 1UX5A 1XNRT 3MEKA 4HLEA 3P4RA 4PS3A 5KWDA 2C0MA 3IHVA 2DWZA 3UU8A 3AA6B 4RVBA 4I1MA 3AAIA 4CN4A 5AQKB 3CPZA 3UTMA 4DLQA 1BD8A 4QKNA 5ABFB 3FTXA 1N4PA 3F2EA 3SFZA 3CIAA 1SHZC 4DR7T 2IU1A 3JAEA 3EDTB 4DK5A 1U2VG 2XASB 1OEDE 1I94T 3PUGA 3UUXB 2DIWA 3IF8B 3EHQA 4UWLA 3BQKA 5FL0A 2EQXA 3WAKA 2MOWA 2EILE 4YDEA 2KMFA 2CHOA 3B7BA 2LHNA 3D3MA 2LM9A 4UWGA 4KZ0A 3X1DA 3HKCE 4DX1A 1EF1C 4H9OC 4OK0A 3RGLA 4ZZBA 5LJNA 1IBMT 3CIRA 2XAFB 1U3DA 4HI9A 4B0ZA 3R9AB 4X66T 3N2OA 5AQIB 3AE7A 2A5UA 2YHCA 3QB2A 2WMNA 5KBAA 4HN9A 4QH4A 2XSBA 2CFZA 5J08A 4CN1A 2DVWA 2XGOA 4LERA 3ULQA 4BESA 1OWOA 4BSZB 3PEVB 4XX5A 2E5LT 4J2CA 5AQFB 4HWDA 3FUFA 1ZBPA 2GW1A 2MYSA 3KSQA 3QNKA 2UUAT 2X0HA 3E4BA 1ZP0A 1NA3A 4JBWF 2R59A 3ASOE 4LF9T 3MJWA 4IDZA 1KFYA 5AQJB 4L7TA 4N2QA 3NKZA 4AM9A 4IE7A 2DYRE 4JXTA 5CEDB 3NBNB 3AA0B 2VQ2A 3LK42 5AN8A 2XAQB 4GPMA 3AAAB 3E22E 4N3BA 1NA0A 3FTYA 1R8IA 1XMOT 4XI0A 4YTNA 2NW7A 5JDGA 5H7PA 3P8CD 1QUUA 2X0LB 2QYUA 4LNGA 4JA7A 4EYYR 3F6QA 3TWQA 3RRCA 3PJAJ 1MIYA 3L54A 3TWXA 2E9XC 1IHGA 4GTVA 2HH7A 1SA4A 1EYHA 4A98A 4H9PC 4FJOA 3PVLA 3TG4A 4EBAA 5LB7B 2LRKA 2VSYA 4UV8B 3JYSA 3FU0A 4AKGA 1QBQA 1U3CA 4B3RT 4ACKA 2V7LA 4ILBA 3I0OA 3LYAA 4I1OB 1MQSA 1O1TA 2IJGX 1LD7A 1ELKA 2GRQB 2XRYA 1UGOA 3CK6A 3ZXPA 2K5BB 1UOHA 4DLOA 3SI5A 4RG6A 2CEAA 1H6OA 5BR8T 3MA5A 2K3WA 2GK9A 2VKJA 2YK0A 3ZPOA 4N5QA 2YU2A 3KD7A 3UIOC 2LSIA 5B1BE 2Y4UA 3UULA 3OAWA 4LFAT 3RYFE 2V8SE 5LNKA 4GTQA 3NRXA 3AB3B 1MNDA 1V9DA 5ENPD 2E9XA 3HHMA 3P7IA 1WR6A 3AVRA 1OY3D 4DRXE 3PNTB 3ABME 5ARGA 5JQGE 2AW6A 1IYGA 4QX7B 4PW8A 2FJDA 3FH7A 1G73A 2E9XD 3AG1E 3JADA 5LGTB 2XEEA 5JHBA 2D5UA 3PUQA 1OEDA 1MJ0A 4AIUA 4HI8A 4A55A 4UVBB 4KYOB 5E75A 2C0SA 4M7CA 1E96B 3ASNE 3IBEA 2VGEA 5ENQD 1X5BA 2FJBA 1YW0A 2Q9QD 1W0AA 4K5AB 3CV0A 3Q5MA 1HG2A 2YN6A 1S63A 2BEDA 2JQQA 3UU3A 3PNLB 1Z6TA 4ZS2A 3RHWA 4LNBA 2XQ5A 2UUBT 3CVXA 2F37A 4NPPA 5ITZF 2XM2A 1OWAA 4PNIA 2XQAA 1N4RA 2UXXB 4AI6A 1JNZA 4JUYA 1PC2A 4FA6A 2QC9A 3F31A 5EKQD 3C50A 1P5QA 3CVLA 3G2VA 4O4HE 3LBXA 3JXIA 3T8MA 1HU3A 5LOZA 5JHAA 3S7JA 2EIJE 4MKTA 3RIAA 3KV5A 3UTKA 1Z3XA 2VGXA 2JRKA 3LY9A 3AE4A 1HNWT 4IN3B 3SWHA 5FY7A 2J07A 4KMOA 3UM3A 2EIME 3UKUG 1SW6A 5DBKA 4CGVA 4NURA 4KUMB 3W9GA 2V4LA 1MZCA 4GTOA 5EIDA 4YJ3E 5HEGA 4LF6T 3Q78A 1D0YA 3OTNA 4JEUA 3AXJB 4COFA 5LXTE 5G04C 2XAJB 3G2SA 2WXGA 1FVHA 2BF0X 4HWFA 2PM6A 4MHCA 3FY4A 2EINE 3CX7B 5HEHA 3G2UA 2ODVA 2XJ7A 3C4ZA 3RYCE 3PE0A 5AARA 1VDYA 4I43B 4IDNA 5ENNA 4RSYA 3UU4A 1HTJF 1W9RA 3CKBA 3ZRHA 3TWTA 4A97A 2KZTA 2MAWA 4AP2A 4EZHA 2X6FA 1WM5A 2UUCT 3GZSA 5BXUA 4YSZA 4DV3T 1E7UA 4X8QA 4AKRB 4ZEYA 3RRNB 4HFCA 2QGSA 2KT9A 2VL0A
chains in the Genus database with same CATH topology
3FUJA 5F3JA 4ZI3D 3SOLA 3ZN0B 5E0OA 4X20E 1TJCA 5LX8A 2XCBA 4UWHA 3C98B 3FEYA 3ZC0A 4WNKA 1XGWA 5JJ7A 2X68A 2A2FX 2VSXE 5L3BB 5FMNA 4PK6A 4FULA 4BT8A 5FTPA 2W00A 2N9DA 4APFA 4F1SA 4HOTA 2PZIA 3N9QA 4IULA 4N78D 4GYWA 1S94A 3PURA 3O1IA 3FUHA 3MYVA 2OA5A 2LSKA 1ZU2A 3OJAA 1ELWA 2ZMAA 2WXHA 3OXGA 4KP3C 3SHFA 1E8WA 3FTWA 3KV9A 4ME2A 2EHOC 5FZSA 4KBQA 2X6JA 4WWPA 4JPSA 2H7OA 2AXUA 3CK7A 3HL6A 2VYIA 3VTXA 4AOFA 1B89A 3D9PA 3KINB 2FBNA 3FXEB 2CCQA 4L5GA 4GMLA 4XZCA 3RO3A 2J4BA 3MZLB 1FIOA 3ZCIA 4I2WA 5A6CA 2Y8DA 2FI7A 3Q15A 4AQFA 5M4YA 5L3CB 3CMLA 3TAXA 3URZA 3Q49B 4IHJE 4A1GA 1E7VA 4UI9C 5CMWA 4ATGA 3ML9A 1BPOA 2IOLA 2AWIA 3S2AA 2IONA 4EZ4A 1IQUA 3ZGQA 2D0TA 3S4UA 1WY6A 4FLBA 2CG2A 3IHYA 2KXPB 3N9PA 5KDMC 3FB2A 5FXWA 4JEUB 3EDUA 4PS8A 2V0PA 2D0UA 1SZAA 3RX6A 3U9WA 4PH4B 2XAHB 2BUGA 2UXNB 3HI2A 4BFRA 2ACXA 3FWVA 3CVPA 3I4GA 2WM9A 3FTZA 3PTRB 4PJNA 4ZHQE 5J2TE 1MNEA 2KZ7B 4N39A 1UN9A 2HPJA 2NC9A 4OFZA 3MKRA 3VHLA 1OWNA 1BR2A 3BQLA 3M65A 4JZYA 4A56A 3ZMVB 4H63H 2LOPA 1UCUA 4WBNE 4D10C 4UIGA 4F53A 3R7RA 2IF4A 3QARA 4WNDA 3R84B 4IE6A 2WMOA 1OWPA 5FJYA 3N2GE 4R7LA 4ACLA 4O2AE 5KMGP 1U4QA 2WPVA 4BTAA 4DMVA 2D2SA 3LFMA 3EUHA 3JQ0A 4UF0A 3CVYA 4MALA 5ANLA 1HS7A 4IRUA 3VTYA 1IJ6A 2Y4TA 3D9OA 3ETUA 4UWFA 4CCAA 1OXZA 3QKYA 2L9BA 4G2AA 5FT9A 2L0TB 1EDUA 4A3TA 5TAOA 4ANVA 5EZYE 4ZOLE 3UUNA 3PUSA 4DI3A 3QK0A 2H3RA 3MX3A 1AJ3A 2WQ7A 1LRZA 2I1JA 4I1AA 5LHGB 2V7KA 4JLEA 2K9AA 1HG5A 3D9JA 3HVEB 3R6NA 1PAQA 3IBPA 4CZZB 2WXOA 3FDHA 5A1LA 2V7MA 5JDHA 5CA0E 1A17A 4HVBA 5FQ8A 3FU6A 2QA7A 2CE7A 4TV8E 2YQ8A 4N5CA 3KEZA 3WAJA 4G1TA 5LG4A 3N5LA 3S7DA 2WQ6A 2M63A 4C0MA 3LS8A 2KNDA 1TEZA 2CLYC 2Q9QB 4CRWA 2J09A 1N52A 2Q9QA 1QSDA 4B6XA 3ZVVA 3BG0B 2MTQA 2W0GA 3K3OA 2IC6A 3LG7A 4U72A 4AKLA 4KZCA 4O4LE 3FUEA 2KCLA 4ERRA 3APDA 3ETVA 1WLXA 5JDQA 3FBLA 4UQZA 1UW4B 2LSGA 4K0UA 4Q94A 3CQXC 2I59A 2VWAA 4UELA 2A4ZA 3TXMA 5F8PA 4WWNA 4EOZB 1IZNB 2LAHA 3TXNA 4L2LA 1KK7A 4A1SA 5M72A 2KCVA 2ILRA 1LVKA 4ILGA 3A5XA 5ANRA 2NOXA 5LGUB 4H9QC 2CWOA 3FHNA 4FU3A 4N2SA 3CK9A 5L3DB 4AKIA 4CT4A 3IEEA 4PFOA 4PFPA 5DQVA 2VASA 2X6KA 3RH3A 4J8EA 2QFCA 3K9IA 4ILHB 5BPPA 2XCCA 5LYJE 5A7DB 3NRYA 4CXXA 2AXVA 2X38A 2LAIA 1QZ2A 4YFSA 4OVUA 1ELRA 2GRLA 2C2LA 2A72A 2R17C 3GW4A 4QXCB 2W63A 1HCIA 2WWUA 2K24A 4G26A 3FUNA 4C0EA 3HIZA 2MBGA 3ENEA 3ZMZB 4AQFC 3ANWB 3ASHA 1UN8A 2NSZA 4GYSA 4GB9A 3ZYLA 1FVFA 2V26A 5LBMA 1HE8A 1H0AA 3P1UA 1E8XA 4EZJA 3UT5E 2JLBA 1OUVA 3EIQC 4QXHB 4AXPA 5G05C 3RPUA 2KC7A 4FJZA 4Z8XA 2W62A 3AVSA 4GZDA 3GA8A 3RYIE 3PRZA 5CB4E 3I9YA 3BG1B 3PREA 4BY6A 2UY1A 4TV9E 2J1DG 2H7VC 3UUXA 3UT4A 4NRHB 2C5JA 3DBSA 4I2ZA 2DI4A 2N1GA 4U0UA 1E90A 2XGMA 4P0BA 3CVNA 5D0QD 4CI2B 4YVOA 2BVLA 2JMKA 4GOUA 3O1HA 4UQYA 1H6KA 3CK8A 4XIFA 3ZMSB 4FC8A 4UQXA 2Y48B 4BSXA 4TX5A 2VJ8A 5J1GA 1CUNA 4EB6E 5LCWJ 2XGSA 3AA1B 3N9OA 1JWFA 3PEUB 3RRMB 2KLQA 4V3IA 3U66A 4JHRA 3U3IA 3GZ2A 3MV2B 4M3OA 3QC9A 4MRUA 2BVMA 4OYSA 4EPZA 1FCHA 2FULA 4FJYA 5C1DA 4G63A 2YNQA 5CMYA 5HXSA 2NTXA 3ZYKA 2ZLYA 4EIWA 5G2NA 5LCYA 4GYRA 3WI3A 4DO0A 4P29A 5KCMA 4CT0A 3CSFA 5AENA 3WXXA 3FU5A 2XAGB 4HFVA 5FQ7A 5G04J 3R7QA 2YEVC 3HKEE 3RKVA 2CXLA 3T5XA 3CKCA 2XUEA 3LVRE 2LJLA 1OWMA 2NW9A 3DP7A 2HYZA 2WB2A 2Y6XA 4GK0E 5EX3A 1UJKA 2X6IA 3D9IA 3DJBA 3FUKA 2IQCA 4TZ4C 2QY7A 4UXNB 5HXCA 2EHOA 4X1YE 4PJJA 2VK9A 2WXKA 4Y6CA 3CVWA 4JEHB 1Y64B 3B7SA 5FQ4A 1UJJA 4BA9A 2VSNA 2IFUA 3CR3A 3MKQB 3MK7C 5JR9B 4MLPA 2WBLA 5KJKA 3H37A 4RG9A 3MXZA 2IAKA 3PU3A 5T4YA 2I6HA 2LHRA 4F6RC 4HKAA 5IHYA 5FP3A 1QQEA 1Y8MA 3EVYA 3EJNA 3HVEA 5D0OD 4ANJA 4PK5A 3RK6A 5HI7A 2X9WA 3ZJ1A 2XPIA 5AIJA 2KINB 4MS6A 1HF8A 1IAPA 3PS6A 3APFA 4UVCB 3S7FA 1ZHCA 3TJPA 3FUIA 5FXZA 4OYKA 4UEMA 4BX9A 5E76A 4C90A 4HXIA 3ASGA 4TUUA 3MGBA 5H6RB 1E1HB 5EDSA 5FZQA 3NZPA 5JJTA 3FEXA 2L8KA 3SRZA 4PK4A 4KXKB 4JHJA 3LDZA 4FLHA 2PL2A 3ZYQA 3J9X1 1NAFA 2ZM8A 1ZKEA 2E8IA 3GWHA 3MACA 4GYOA 3B57A 3QWVA 3KVBA 3HYMB 1KLXA 3AU5A 3OXLA 3ZJ2A 3FHEA 1IQRA 1D1AA 5DABA 3BEEA 2HR2A 1T98A 3CVQA 4NUVA 3I4RB 3NZQA 2DHRA 3FXDB 2ZU6B 4N3AA 4DI4A 4JEHA 4JC8A 3NZUA 3ASDA 4E7ZA 4CI3B 3KBTA 4ZI2C 2DBAA 4QHOA 2RA1A 3JQ1A 4U8HA 3UT8A 4CXWA 2LSYA 4IE4A 3JC6D 3SBSA 4GA2A 4PAGA 4J0UA 3B7UX 3N2KE 3LEWA 3FH5A 4A3VA 3CVUA 1MMAA 4GZ3A 4I55E 5FXXA 2GGFA 2EHOB 4GZ5A 5FYMA 3OYXA 2VKOA 1DNPA 2RD0A 3PUJA 1BR1A 3SNXA 2FF4A 3IKOB 1Z3YA 3CHOA 1US7B 1L5JA 2PJQA 2X9YA 2V7IA 4YJ2E 2X66A 3KS2A 2FEZA 4FI5A 4B8CB 2BTDA 5LFAA 5ADXL 3L17A 2LSVA 4X1IE 3PU8A 2E2EA 4JW1A 4GYYA 3CHRA 1PY1A 4L0RA 4ASKA 4YHJA 2Q7FA 1INZA 1YD8G 1VOMA 5JJ6A 5JDLA 5FWQA 3ZMTB 3ONKA 3IHRA 3O1JA 2MHKA 1HS6A 4U63A 4TV3A 4ISTA 2LEHA 4GIWA 2LT3A 4DJAA 4L1BA 4UF0B 2XRZA 2JMHA 2J9QA 1YKHB 5FXVA 1DVPA 2AXZA 2UY1B 3T8OA 4GMJA 1HX8A 3FTSA 2MRIA 1SA0E 1WAO1 5DIZA 4M1PA 3SGHA 2A3DA 2PM7A 4UWKA 4BTBA 2IW5B 3PDNA 2JPFA 1KT1A 4GZCA 2BZBA 3FULA 3FUDA 4MBQA 4O4IE 3LCAA 2Q9QC 5AYWD 1MMNA 2WVIA 4G11A 2PQNA 4ZI7E 3ZN3A 3L3PA 2YU1A 1S0PA 4ANXA 4P0AA 5BV0A 2Y3AA 3MA9A 4UVAB 5BW8C 5HYAA 3O4ZA 4HTEA 5T8IA 4WWOA 3EHNA 4I9CA 3QWWA 1LVFA 3VLDA 3LK2B 3ZEFA 4KMCA 2XPZA 4UI9K 4O2BE 3CWZB 4XI9A 4DBRA 4KVMA 4FP7A 5LP6E 5JDFA 3GZ1A 5LP0A 3B13A 3ONXA 3K8PC 4Q96A 4H63V 4XZ4A 4HOQA 1UX4A 4O8SA 5L3EB 4NQ0A 4ILIA 2KZTB 3GYZA 5BT1A 4H9SE 3QOUA 5AFUL 2CA5A 4I43A 3W15B 2WXIA 3ASFA 4FADA 1MMGA 3ZYMA 5GONE 4BWRA 1E8ZA 1BR4A 2C5KT 5FZRA 3AA7B 3Q2MA 3ZLIA 3V5SA 4CXYA 3F57A 4AVXA 3TGOA 4C91A 4TUYE 1H7CA 2UWJG 4ABNA 3FU3A 3KFWX 4H7XA 3ZIMA 3TL5A 3PE3A 3U78A 2NTYA 2DNXA 3PUKA 4G25A 3ZXSA 4AKHA 3FH8A 2LNIA 5EK4A 3MKQA 5LBQB 5FNVE 1QNFA 4HEAA 3HKBE 3N9NA 4I6JA 3N9MA 3DTOA 4HORA 5LGNB 3Q5WA 4X1KE 3ML8A 4Q69A 4L23A 4GK5E 4WNFA 2L3LA 5AJDA 4F3VA 4B94A 3C4WA 4URKA 3ZHEA 4W9RA 2IC9A 3IV0A 4HS2A 5ETWA 4B8AA 2CG3A 4AJWA 5JRCB 1NP7A 2C0LA 3PE4A 3RRWA 3NQPA 3AAEB 4LCTA 4KVOA 3G2WA 1VRBA 2KATA 3LJCA 3C98A 2FO7A 2NP9A 4LRZA 4JL0A 1Z0PA 3OKQA 5LCWC 5T3RA 3I5PA 4TN7B 3MV3B 4EZLA 4TRQA 4ZI3C 3CVRA 4AIFA 2VGXB 3CLJA 4YVQC 4NACA 3SBTB 2XEVA 2ODUA 2CXDA 3CQCB 2N2NA 1O3XA 5DJQC 5KJLA 4U0SA 4ANUA 3GMIA 2PBIA 1YA0A 3LY8A 4YNDA 2J49A 4MFRA 4DBQA 3HR0A 3D9NA 3KV4A 4H9RC 4GA0A 3B7TA 2HM8A 2LOSA 3ESKA 4ILUA 2ONDA 3ONLA 4E85A 2P58C 3UQ3A 4I9EA 4WAFA 3CSTA 4GCNA 3JCKC 2KM4A 5FY0A 4P09A 4PJLA 4JVSA 5HWXA 5CHEE 4G24A 4XAXB 3JUIA 2VL8A 3EDVA 2WXRA 4HGAA 1MIVA 4O6FA 3UT7A 4EZKA 3VKGA 4CDNA 2L9QA 3PUAA 4GZ6A 3HKDE 1UG3A 3MCXA 3VLFA 5G05J 2RP4A 4H7YA 2ZM2A 3MKDA 3T5VA 4U74A 3N71A 1H19A 2XHEB 3C4XA 1D1CA 2WXJA 2VSOE 5HXRA 2WSSV 5JR9C 1FMWA 4BX8A 4OHFA 2LE8A 4O4JE 2VB6A 3E0ZA 4Y6WA 2J08A 3KAEA 3D9MA 4J8SA 3UMVA 3OBVE 2W61A 3B7RL 3CEQA 4J6IA 4AXHA 2K48A 5EK3A 4IGUA 4APOA 3CX6B 4E7SA 5BMVE 4BJNA 2WXFA 3RKOA 1EPUA 3CHSA 2KWIB 2WXLA 3L6AA 4XBFB 3O9XA 3ESLA 4J8DA 3NZSA 2L0IA 4JA9A 2I9CA 3ZN1B 1XNFA 3E08A 3LXUX 4EQFA 3ZW3A 1N54A 2PQRA 3D0TA 2CFUA 2PFVA 3UUMA 2X67A 4DNDA 3L22A 3Q4AB 5JR9A 2DWGA 1SQMA 3RRUA 3QJZA 3Q5XA 4ISSA 3CHQA 4HOSA 1MMDA 4IE0A 5HXHA 2CXFA 2X9HA 2E9XB 4LUNU 4AV7A 3ZMUB 4QX8B 1U5PA 5L3GB 1WRDA 4UV9B 3C51A 4K03A 3RC8A 4WNGA 1G8XA 4NUUA 2L6JA 2HPLA 3FBZA 3LVQE 5ARFA 2ZM0A 3I9WA 4UI9J 3HA4A 3KV6A 4FHKA 3QDNA 3C64A 4MLKA 4GAAA 1JUQA 2G0UA 4I6EA 1ZEEA 2CM0A 5J2UE 2XPYA 5JREA 3S7BA 2J4DA 2XHEA 4AEZC 5FQ6A 3TG5A 3NF1A 1W3BA 3FP3A 3IEGA 2YHEA 3JC6C 2XQ0A 5HAXA 2B1EA 2CHZA 1HZ4A 2X9XA 4G23A 1YKEB 2NXPA 4HOUA 1H2TC 2LSUA 3UFEA 3SF4A 3Q9DA 1SZ9A 3KBUA 4JHKA 2WAUA 3TKLB 2XQYA 1B7TA 2PG8A 3LPZA 4IIJE 3CGHA 3CX8B 3OXFA 3D9KA 3G2TA 5A23A 4HFGA 1D0XA 2OVBA 3U3WA 4CGWA 4BT9A 1H2VC 1LF8A 4LEUA 4KBMB 5JVDE 5C8YE 3ANWA 4QXBB 3CVVA 2I1KA 4PJMA 2V1DB 3LJ3A 2KWHA 2IOSA 2VKHA 3GN5B 2SPCA 2JEKA 4DMWA 4CQIA 4HE8A 3H3AA 4F7AA 4GA1A 3AS4A 3L16A 4WW0A 5HXEA 2OOEA 5J90A 5LHIB 5C2YA 4I6GA 1Y6IA 3MZKB 4G2VA 4GCOA 1ZV4X 3VLEA 3LK3B 3SZ7A 2AVPA 2DWKA 3DPDA 3QWPA 2MOZA 1GW6A 4CI1B 4PS7A 4EBAG 3RC3A 1WYBA 3N9LA 3APCA 2LSJA 3LBXB 4KT6B 2OVFA 2ES0A 3EHMA 4AY5A 3ZEFB 2VTBB 4L9IA 4DVDA 5AJLA 2VGYA 4DPRA 2DCFA 2RG8A 2X6HA 1NZNA 3O4XE 4GU5A 4ZI2D 1D1BA 4J8FA 1KT0A 2X51A 3I1AA 4BAYB 3LKUA 1D0ZA 1EZ3A 1FMVA 3PH0C 4QWNB 4L2YA 2KCKA 2EHOD 3OYZA 3AS8A 3RYHE 3AS5A 2HO1A 1NWMX 3GN5A 1H2UA 4GPKA 5H6QB 4CDRA 4U07A 2CHXA 4E6HA 3CHPA 3BK9A 4I4TE 4EECA 1S35A 3I3NA 2R5SA 1HO8A 1IJ5A 2E0IA 3Q47B 1X79A 2WQHA 3CQGB 5BUZA 3D9LA 2Z6EA 5FY1A 2V7JA 3P2BA 5EK2A 1E8YA 3L13A 2CWYA 1BR0A 5BV1A 4AQGA 3L08A 5DQWA 3J7Yq 3UX4A 3FFLA 2CLYB 1WYCA 2GRMA 1FEWA 3CHMA 3FTUA 1HH8A 3RJVA 4IE5A 3MJXA 1MHQA 5KJMA 4YLHA 2DLRA 5BNWA 2JJ9A 4U04A 2LO6A 2P9BA 5JDMA 4K0RA 3QAQA 4B89A 3SS1A 5LJMA 5JRCA 3FTVA 5KX5E 1HFAA 2I2OA 5LHHB 5L3FB 1HXIA 2NWBA 3EIJA 2NW8A 3L09A 3U4TA 3LY7A 5LA6E 2WXMA 5HWYA 3ZCJA 4C9BB 5HQ8A 4OYJA 4PUCA 4XKCA 3VU7H 5CCLA 3O48A 5IYZE 5CA1E 3PZDA 3QK6A 4WUYA 4AY6A 2CMRA 3VKHA 1OWLA 4FHJA 3QUJA 5LOVE 3RIBA 3RO2A 3NBXX 3KDSE 4I50E 4ADZA 3KVAA 2OV8A 4EXTA 3QC1A 2YINA 3CKDA 4EAHA 2VTBA 4CEMA 4ZS3A 2WXQA 1JWGA 3AU4A 3ZPJA 4WNEA 2VKDA 4V1Av 1TJFA 1LKXA 3SD5A 3V5UA 5G55A 2WXPA 4WBOA 5KJNA 4OVVA 3RU0A 5CCMA 2XTLA 3ZHEB 3ZC1A 4I17A 3K3NA 4IYPA 2WXNA 1MIWA 2M67A 5JH7E 3BQIA 3ZFWA 2CHWA 2DCPA 4EYUA 3FUMA 1KNZA 4QFVA 4U0ZA 4CDMA 4N3CA 4XE0A 3UPVA 3U64A 1JPLA 4ANWA 4PDXA 4XKBA 5L2LA 2BDEA 2C5IT 4H9NC 3I0QA 5JDNA 2X3MA 5EX0A 3HDXA 3K3QC 3PDYA 2V5FA 4BJMA 1UX5A 3MEKA 4HLEA 4PS3A 2C0MA 3IHVA 3AA6B 4RVBA 4I1MA 3AAIA 3CPZA 4DLQA 4QKNA 3FTXA 3F2EA 3SFZA 3CIAA 1SHZC 2IU1A 3EDTB 4DK5A 2XASB 3PUGA 3UUXB 2DIWA 3IF8B 4UWLA 3BQKA 2EQXA 3WAKA 2MOWA 2KMFA 2LHNA 3D3MA 2LM9A 4UWGA 4KZ0A 3HKCE 1EF1C 4H9OC 4OK0A 5LJNA 2XAFB 1U3DA 4B0ZA 3R9AB 3N2OA 2A5UA 2YHCA 3QB2A 2WMNA 4HN9A 2CFZA 5J08A 2XGOA 3ULQA 4LERA 1OWOA 3PEVB 4XX5A 4J2CA 3FUFA 1ZBPA 2GW1A 2MYSA 3QNKA 3E4BA 1NA3A 2R59A 3MJWA 4IDZA 4L7TA 4N2QA 4AM9A 4IE7A 4JXTA 3AA0B 2VQ2A 3LK42 2XAQB 3AAAB 3E22E 4N3BA 1NA0A 3FTYA 4XI0A 2NW7A 5JDGA 3P8CD 1QUUA 2X0LB 4JA7A 4EYYR 3RRCA 1MIYA 3L54A 2E9XC 1IHGA 2HH7A 1EYHA 4H9PC 4FJOA 3PVLA 3TG4A 4EBAA 2VSYA 4UV8B 3JYSA 3FU0A 4AKGA 1U3CA 4ACKA 2V7LA 3LYAA 3I0OA 4I1OB 1MQSA 2IJGX 1ELKA 2XRYA 4DLOA 2K5BB 3SI5A 4RG6A 2CEAA 3MA5A 2GK9A 2VKJA 2YK0A 3ZPOA 2YU2A 3KD7A 2LSIA 2Y4UA 3UULA 3OAWA 3RYFE 2V8SE 5LNKA 3NRXA 3AB3B 1MNDA 1V9DA 2E9XA 3HHMA 3P7IA 1WR6A 3AVRA 3PNTB 5ARGA 5JQGE 2AW6A 1IYGA 4QX7B 4PW8A 3FH7A 1G73A 2E9XD 5LGTB 5JHBA 2D5UA 3PUQA 4A55A 4UVBB 4KYOB 5E75A 2C0SA 1E96B 3IBEA 1X5BA 1YW0A 2Q9QD 3CV0A 3Q5MA 1HG2A 2JQQA 3PNLB 1Z6TA 4ZS2A 3CVXA 1OWAA 4PNIA 2UXXB 4AI6A 4JUYA 1PC2A 4FA6A 3F31A 5EKQD 3C50A 1P5QA 3CVLA 3G2VA 4O4HE 3LBXA 3T8MA 1HU3A 5LOZA 5JHAA 3S7JA 4MKTA 3KV5A 3UTKA 1Z3XA 2VGXA 2JRKA 3LY9A 4IN3B 3SWHA 5FY7A 2J07A 4KMOA 5DBKA 4CGVA 4NURA 4KUMB 2V4LA 4YJ3E 1D0YA 4JEUA 3OTNA 5LXTE 5G04C 2XAJB 3G2SA 2WXGA 1FVHA 2BF0X 2PM6A 4MHCA 3FY4A 3CX7B 3G2UA 2ODVA 3C4ZA 3RYCE 3PE0A 1VDYA 4I43B 5ENNA 4RSYA 1HTJF 3CKBA 3ZRHA 2KZTA 4AP2A 4EZHA 2X6FA 1WM5A 3GZSA 1E7UA 4AKRB 3RRNB 2QGSA 2KT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9N A;  1JWG A;  4NAC A;  2BF0 X;  2V8S E;  3ZYQ A;  5LP0 A;  1PY1 A;  1HG5 A;  1DVP A;  3D9K A;  2L0T B;  1EDU A;  3G2U A;  3D9J A;  3ZYK A;  1X5B A;  3G2T A;  1UJK A;  2DCP A;  1HX8 A;  1ELK A;  4HFG A;  3ZYM A;  1INZ A;  2DIW A;  1VDY A;  5CMW A;  1EYH A;  1SZA A;  1JWF A;  3D9I A;  4Q96 A;  3D9P A;  3ONL A;  1UJJ A;  1XGW A;  4Q94 A;  3RRU A;  2MOW A;  4JXT A;  1LF8 A;  1HF8 A;  1MHQ A;  1HG2 A;  5CMY A;  2L0I A;  3ONK A;  2QY7 A;  4GZD A;  4FU3 A;  4AVX A;  2LO6 A;  3G2V A;  1JPL A;  5J08 A;  1JUQ A;  3D9M A;  1SZ9 A;  3D9O A;  3ZYL A;  3D9L A;  3G2S A;  4FLB A;  3G2W A;  5LOZ A;  1H0A A;  1HFA A;  3LDZ A;  2KM4 A;  3CLJ A;  4GZC A; 
#chains in the Genus database with same CATH topology
 3FUJ A;  5F3J A;  2A9U A;  4ZI3 D;  3SOL A;  3ZN0 B;  5E0O A;  5EYP F;  4X20 E;  1TJC A;  5LX8 A;  5CFB A;  2XCB A;  4UWH A;  3E37 A;  3C98 B;  3FEY A;  2IO3 C;  3V30 A;  3ZC0 A;  4WNK A;  1XGW A;  5JJ7 A;  2X68 A;  4B3S T;  2A2F X;  2VSX E;  1O5M A;  2R2L A;  5L3B B;  5FMN A;  4PK6 A;  4FUL A;  4BT8 A;  5FTP A;  2W00 A;  2N9D A;  4APF A;  4F1S A;  4HOT A;  1J1J A;  2PZI A;  4GTT A;  3N9Q A;  4IUL A;  4N78 D;  4GYW A;  1S94 A;  3PUR A;  3O1I A;  5JA4 D;  3FUH A;  3MYV A;  4F6R D;  2OA5 A;  1WG0 A;  2LSK A;  4G8L A;  1ZU2 A;  3OJA A;  2P9L G;  1ELW A;  2ZMA A;  2WXH A;  3E32 A;  3OXG A;  4DUI A;  4KP3 C;  3SHF A;  1E8W A;  3FTW A;  3DSW A;  3KV9 A;  3J5P A;  4ME2 A;  2EHO C;  5FZS A;  1T8B A;  4KBQ A;  2X6J A;  1KF6 A;  4DR4 T;  4U7I A;  4WWP A;  1ZOY A;  2P9K G;  5ENO D;  4JPS A;  2H7O A;  4HFD A;  5D2M C;  2AXU A;  3CK7 A;  3HL6 A;  1HR0 T;  2VYI A;  3VTX A;  4AOF A;  2BG9 A;  2ETB A;  1B89 A;  3UM2 A;  3JAF A;  3D9P A;  3KIN B;  2FBN A;  3FXE B;  2CCQ A;  4L5G A;  4GML A;  4XZC A;  5ABF A;  3RO3 A;  2J4B A;  3MZL B;  1FIO A;  3ZCI A;  4I2W A;  5A6C A;  2Y8D A;  2FI7 A;  4J7W A;  3Q15 A;  3V2X A;  2R05 A;  1J5E T;  4AQF A;  5M4Y A;  4DV5 T;  5L3C B;  3CML A;  5AQ7 A;  3TAX A;  2QRX A;  3URZ A;  3Q49 B;  4IHJ E;  4A1G A;  2H6H A;  1E7V A;  2A5E A;  1DCQ A;  4UI9 C;  4AIS A;  5CMW A;  4ATG A;  3ML9 A;  1BPO A;  2IOL A;  2AWI A;  3S2A A;  4DID B;  2ION A;  4EZ4 A;  1IQU A;  3ZGQ A;  4IL9 A;  2D0T A;  2PTF A;  3S4U A;  3JUE A;  3FZK B;  4JI2 T;  1WY6 A;  4FLB A;  2CG2 A;  2E2A A;  2VQE T;  3IHY A;  2KXP B;  3N9P A;  5KDM C;  3FB2 A;  5FXW A;  3T1Y T;  3RLF F;  4JEU B;  3C3R A;  3PUZ F;  2CHN A;  3FZH B;  3EDU A;  3PUY F;  3BUA A;  4PS8 A;  2BS3 A;  2V0P A;  2D0U A;  3JXJ A;  1M62 A;  4HWH A;  3RX6 A;  1SZA A;  3U9W A;  4PH4 B;  2FUP A;  2XAH B;  2X0Y A;  2BUG A;  3TLT A;  2UXN B;  2WCA A;  3HI2 A;  1O1S A;  4BFR A;  2ACX A;  4JI4 T;  3FWV A;  3CVP A;  3I4G A;  2WM9 A;  3AED A;  5AQG B;  3PTR B;  3FTZ A;  4PJN A;  4ZHQ E;  4QH5 A;  5J2T E;  3P4Q A;  3RI5 A;  1MNE A;  5CRV A;  2KZ7 B;  4N39 A;  3HXD A;  1UN9 A;  2HPJ A;  2NC9 A;  3NAW A;  4OFZ A;  3MKR A;  3VHL A;  1OWN A;  1BR2 A;  3BQL A;  3M65 A;  4JZY A;  2D9D A;  4XEI G;  4A56 A;  3ZMV B;  3V79 K;  3EI0 A;  4H63 H;  2LOP A;  4NIQ A;  1UCU A;  4WBN E;  1Z5S C;  4D10 C;  4IDO A;  3SO8 A;  4JI1 T;  4UIG A;  1SVX A;  4F53 A;  3R7R A;  2IF4 A;  3QAR A;  4WND A;  2DZO A;  3R84 B;  4IE6 A;  4B3T T;  2WMO A;  1OWP A;  3OPC A;  2ACZ A;  2IUB A;  5FJY A;  2MPK A;  3KEA A;  3N2G E;  3QB5 K;  3UU5 A;  3UUB A;  4R7L A;  4ACL A;  4HRL A;  1LTX A;  4O2A E;  5KMG P;  2P9P G;  1DU2 A;  2BKG A;  5AQR B;  1U4Q A;  2WPV A;  3PZ2 A;  4BTA A;  4DMV A;  2D2S A;  2OV9 A;  3V2O A;  3LFM A;  1K8K G;  3EUH A;  3JQ0 A;  4UF0 A;  3CVY A;  3DST A;  1KPS B;  3TWW A;  4MAL A;  4HFI A;  5ANL A;  3HG0 D;  1HS7 A;  4IRU A;  1Y01 A;  3VTY A;  1IJ6 A;  3DEO A;  2ETC A;  2Y4T A;  3D9O A;  3ETU A;  3QB5 A;  4UWF A;  4CCA A;  1OXZ A;  1RW2 A;  2IEJ A;  2WQY A;  2WWV A;  5CEC B;  3QKY A;  2L9B A;  4G2A A;  5L4H A;  5FT9 A;  2L0T B;  1N32 T;  1EDU A;  4A3T A;  5TAO A;  4WZX A;  2BKN A;  4ANV A;  2I0M A;  5EZY E;  2DYS E;  4ZOL E;  3UUN A;  3PUS A;  4DI3 A;  2YOE A;  4JI3 T;  3HXF A;  3QK0 A;  2H3R A;  2ZGD A;  3MX3 A;  2Y0B G;  1AJ3 A;  2KBX A;  2VVN A;  2WQ7 A;  1LRZ A;  2I1J A;  4LF7 T;  4I1A A;  5LHG B;  2V7K A;  4X64 T;  4GTS A;  4JLE A;  4L9P A;  2K9A A;  3ABK E;  1WR0 A;  1HG5 A;  3D9J A;  3HVE B;  3R6N A;  4HFE A;  1PAQ A;  4QH1 A;  1E7P A;  3IBP A;  4CZZ B;  2VQF T;  2WXO A;  3FDH A;  5A1L A;  3ZNG A;  2V7M A;  5JDH A;  5CA0 E;  1A17 A;  4EED A;  1YMP A;  4HVB A;  5FQ8 A;  4LML A;  3AG3 E;  1FT2 A;  2V5D A;  3FU6 A;  2QA7 A;  5L47 A;  1Z8U A;  2CE7 A;  4TV8 E;  2YQ8 A;  4N5C A;  3KEZ A;  2V5C A;  3WAJ A;  3LJN A;  4G1T A;  5LG4 A;  4X65 T;  3N5L A;  3S7D A;  3AXJ A;  2RFM A;  2WQ6 A;  2BBJ A;  2M63 A;  2BG9 C;  4C0M A;  1AP7 A;  3LS8 A;  2KND A;  5AQP B;  1RZ4 A;  1D8E A;  3IA3 A;  1TEZ A;  2CLY C;  2Q9Q B;  4CRW A;  1SE7 A;  2J09 A;  1N52 A;  2Q9Q A;  1QSD A;  4B6X A;  3ZVV A;  3BG0 B;  2OLT A;  2MTQ A;  4OAU C;  3E30 A;  2W0G A;  3DWL G;  3K3O A;  2IC6 A;  3LG7 A;  1Q2Z A;  4U72 A;  4AKL A;  3ISM C;  4KZC A;  3X2Q E;  4O4L E;  3FUE A;  2KCL A;  4ERR A;  4EV6 A;  4F8H A;  3APD A;  3ETV A;  1WLX A;  5JDQ A;  2XPK A;  3FBL A;  4UQZ A;  5AQN B;  2LSG A;  4K0U A;  1UW4 B;  4Q94 A;  3CQX C;  2HN2 A;  2I59 A;  4A63 B;  2VWA A;  4AQY T;  4UEL A;  2A4Z A;  3TXM A;  5F8P A;  4WWN A;  4EOZ B;  1IZN B;  2LAH A;  2JIW A;  3TXN A;  4L2L A;  1KK7 A;  4A1S A;  5M72 A;  3P4S A;  1X81 A;  2M6B A;  2LXL A;  4G8K A;  2KCV A;  2ILR A;  4ATZ D;  2IDO B;  1LVK A;  4ILG A;  3A5X A;  1G3N B;  5ANR A;  4GKJ T;  4K5B A;  2NOX A;  4Z90 A;  5LGU B;  4H9Q C;  5ABG A;  5HRY A;  2CWO A;  3FHN A;  4FU3 A;  4N2S A;  3CK9 A;  4HFB A;  5L3D B;  4AKI A;  5CRU A;  4CT4 A;  2V6Y B;  3IEE A;  5J0Z A;  5D66 A;  4PFO A;  2DL1 A;  4PFP A;  5DQV A;  2VAS A;  2X6K A;  3RH3 A;  1QLB A;  5EYL A;  4J8E A;  2QFC A;  3K9I A;  4ILH B;  4B3M T;  2M6I A;  3VR9 A;  5BPP A;  2XCC A;  3VRA A;  4RLY A;  5LYJ E;  5A7D B;  4U7E B;  3UIP C;  3NRY A;  3UQ7 A;  4CXX A;  2AXV A;  2X38 A;  2LAI A;  3NVO A;  1QZ2 A;  4YFS A;  4OVU A;  3EU9 A;  1ELR A;  2GRL A;  2C2L A;  2A72 A;  2R17 C;  2WY2 A;  3GW4 A;  4QXC B;  4YTP A;  2W63 A;  1HCI A;  2WWU A;  2K24 A;  4ZZC A;  4LSZ E;  4G26 A;  3FUN A;  4C0E A;  4EGW A;  5HKP A;  3HIZ A;  2MBG A;  3ENE A;  3ZMZ B;  4AQF C;  3ANW B;  3OTO T;  3ASH A;  1OXJ A;  1UN8 A;  2NSZ A;  4GYS A;  4GB9 A;  3UM0 A;  3ZYL A;  1FVF A;  2V26 A;  5LBM A;  1HE8 A;  5AQ9 A;  1H0A A;  3P1U A;  1E8X A;  4EZJ A;  3UT5 E;  4YTM A;  2JLB A;  1OUV A;  1BI8 B;  3EIQ C;  4QXH B;  2W2U A;  4ZHB A;  4AXP A;  5JMN D;  2HN1 A;  5AQO B;  5G05 C;  3RPU A;  4K5C A;  2KC7 A;  4FJZ A;  4Z8X A;  1GQE A;  2W62 A;  4DX6 D;  3AVS A;  3Q7A A;  5ENR D;  4DV6 T;  3AJI A;  4GZD A;  3Q7F A;  1K1B A;  3GA8 A;  3RYI E;  3PRZ A;  5CB4 E;  3TLV A;  3I9Y A;  3BG1 B;  1BI7 B;  3PRE A;  1IHB A;  1HNX T;  4BY6 A;  1VCS A;  4TV9 E;  2UY1 A;  2J1D G;  2H7V C;  3UUX A;  3UT4 A;  3D9H A;  3SFY A;  4NRH B;  2C5J A;  3L9T A;  2UU9 T;  5L4E A;  3DBS A;  4I2Z A;  2N1G A;  2DI4 A;  4U0U A;  1E90 A;  4UUC A;  4A5X A;  2XGM A;  4P0B A;  1TNU A;  4DX2 A;  3CVN A;  3DSX A;  5D0Q D;  4CI2 B;  4YVO A;  2BVL A;  2JMK A;  4GOU A;  3O1H A;  4UQY A;  1H6K A;  3UI2 A;  2OEV A;  3CK8 A;  3ZMS B;  4FC8 A;  4XIF A;  3SFE A;  4UQX A;  2Y48 B;  4YXD A;  4YY3 T;  4TUM A;  1M7K A;  3LSV A;  4X5T A;  5HEJ A;  4BSX A;  4TX5 A;  2H6I A;  2VJ8 A;  5J1G A;  1CUN A;  4EB6 E;  1N94 A;  5LCW J;  2XGS A;  4IDQ A;  3AA1 B;  4TXQ A;  1OED C;  3N9O A;  1JWF A;  4J8Y A;  3K1S A;  3AEG A;  2Y69 E;  3PEU B;  2KLQ A;  3RRM B;  4V3I A;  2GRO B;  3U66 A;  3E33 A;  4JHR A;  1DC2 A;  3U3I A;  2QYW A;  2V4H C;  3GZ2 A;  3MV2 B;  4M3O A;  4LNU D;  2FBW A;  3QC9 A;  4MRU A;  2BVM A;  4OYS A;  1T7S A;  4EPZ A;  1FCH A;  3RF1 A;  2FUL A;  4FJY A;  3RQU A;  1TNZ A;  5C1D A;  4G63 A;  4HWI B;  2YNQ A;  5CMY A;  5HXS A;  2NTX A;  3ZYK A;  2ZLY A;  4EIW A;  5G2N A;  5LCY A;  4GYR A;  3WI3 A;  4IDP A;  4DO0 A;  4P29 A;  5KCM A;  4CT0 A;  3CSF A;  5FKY A;  5AEN A;  3WXX A;  3TLU A;  3FU5 A;  5HEO A;  2XAG B;  4HFV A;  5FQ7 A;  5G04 J;  3R7Q A;  3DXM G;  2YEV C;  3HKE E;  3P50 A;  3RKV A;  2CXL A;  2CRB A;  3CKC A;  2JQK A;  2XUE A;  3LVR E;  2LJL A;  1OWM A;  3T5X A;  2NW9 A;  3DP7 A;  2HYZ A;  2WB2 A;  4U3C A;  2Y6X A;  5EIB E;  3UXG A;  4YDW A;  4GK0 E;  3L82 A;  5EX3 A;  1UJK A;  1IBL T;  2X6I A;  3D9I A;  1X9B A;  1L0V A;  2YDR A;  3DJB A;  3FUK A;  2IQC A;  4P1N A;  4TZ4 C;  2Y1L E;  1XWM A;  2QY7 A;  4QQI A;  3AE6 A;  4U8V D;  4UXN B;  5HXC A;  5CER B;  2EHO A;  4X1Y E;  2B76 A;  1MX6 A;  5C2T A;  4PJJ A;  3AEA A;  2VK9 A;  2WXK A;  4Y6C A;  3CVW A;  1TN8 A;  4JEH B;  1NEK A;  1Y64 B;  3B7S A;  5FQ4 A;  4JYA T;  5BXO A;  1UJJ A;  4BA9 A;  2VSN A;  2IFU A;  3CR3 A;  3MKQ B;  3DEP A;  3MK7 C;  5JR9 B;  4MLP A;  4X62 T;  2WBL A;  1OCZ E;  1NEN A;  5KJK A;  3H37 A;  1IKN D;  2ZIR A;  4RG9 A;  3MXZ A;  2IAK A;  3PU3 A;  5T4Y A;  1BU9 A;  2I6H A;  1YQ3 A;  2LHR A;  4F6R C;  4HKA A;  5IHY A;  5FP3 A;  1QQE A;  1Y8M A;  3EVY A;  3EJN A;  3HVE A;  5D0O D;  4ANJ A;  1TYQ G;  4JI6 T;  2F8X K;  4PK5 A;  3HXE A;  3RK6 A;  5HI7 A;  2X9W A;  1LD8 A;  3ZJ1 A;  5AQH B;  2XPI A;  1YXR A;  2KIN B;  4MS6 A;  1HF8 A;  5AIJ A;  2XS8 A;  3L8R A;  3HRA A;  5KXJ A;  1IAP A;  3PS6 A;  3T8K A;  3APF A;  4GTM A;  4UVC B;  4O1P A;  3S7F A;  5CBN A;  3UM1 A;  1ZHC A;  3TJP A;  3PV0 F;  4Q25 A;  3FUI A;  5FXZ A;  4OYK A;  4UEM A;  4BX9 A;  4DV0 T;  3AE9 A;  5E76 A;  4C90 A;  1V54 E;  2B6C A;  4HXI A;  3ASG A;  4TUU A;  1XDP A;  3PUW F;  3MGB A;  2ZM6 T;  5H6R B;  3TWS A;  1E1H B;  5EDS A;  3T9K A;  5FZQ A;  2WP9 A;  3NZP A;  5JJT A;  3DPY A;  3FEX A;  2L8K A;  3SRZ A;  2VUR A;  4PK4 A;  4KXK B;  4JHJ A;  1JCR A;  2XEH A;  3LDZ A;  3W9F A;  5IWA T;  5EN5 D;  4FLH A;  3AG4 E;  2PL2 A;  2XM1 A;  3ZYQ A;  1JCS A;  3J9X 1;  2LM2 A;  1NAF A;  2ZM8 A;  1ZKE A;  1OED B;  2E8I A;  3GWH A;  3Q75 A;  5LG3 A;  3MAC A;  4DV7 T;  4GYO A;  3B57 A;  3QWV A;  3KVB A;  5ABH A;  3HYM B;  1KLX A;  3AU5 A;  1KEY A;  1S64 A;  4JV5 T;  3OXL A;  3ZJ2 A;  3FHE A;  2QYJ A;  1YCS B;  1IQR A;  1D1A A;  5DAB A;  3BEE A;  4LFC T;  5C3J A;  1T98 A;  2HR2 A;  3CVQ A;  5ENT D;  4NUV A;  3I4R B;  1NFI E;  1AWC B;  3NZQ A;  2DHR A;  3FXD B;  2ZU6 B;  4N3A A;  3SY2 A;  3VRB A;  4DI4 A;  3TLW A;  4JEH A;  4JC8 A;  5HEU A;  3NZU A;  3ASD A;  4E7Z A;  3B5M A;  1I6Z A;  2WZI A;  4CI3 B;  4ZI2 C;  3KBT A;  2DBA A;  5FL1 A;  4QHO A;  2RA1 A;  3JQ1 A;  4U8H A;  3UT8 A;  2ETA A;  4CXW A;  2LSY A;  2KSR A;  4IE4 A;  5AQA A;  3JC6 D;  2WZH A;  4U2Z A;  3SBS A;  4Z91 A;  4HRN A;  4GA2 A;  4RQI A;  4PAG A;  4J0U A;  3B7U X;  2LUH A;  5LMU T;  1YYH A;  3AE1 A;  1XMQ T;  3N2K E;  3LEW A;  3FH5 A;  4A3V A;  3CVU A;  1MMA A;  4GZ3 A;  3UU6 A;  4I55 E;  5FXX A;  2GGF A;  2EHO B;  4GZ5 A;  2WU2 A;  4O60 A;  5FYM A;  3AE5 A;  2VKO A;  3OYX A;  3M3Z B;  1DNP A;  2RD0 A;  3PUJ A;  4HLL A;  1BR1 A;  3SNX A;  1N34 T;  2FF4 A;  3IKO B;  1Z3Y A;  5FVK A;  3AG2 E;  3CHO A;  1US7 B;  2BKO A;  1L5J A;  2PJQ A;  2X9Y A;  2V7I A;  4YJ2 E;  2X66 A;  3KS2 A;  2FEZ A;  4FI5 A;  4I0U A;  2XQ9 A;  4B8C B;  2BTD A;  5LFA A;  5ADX L;  3AE3 A;  3L17 A;  2LSV A;  4X1I E;  3PU8 A;  2E2E A;  4JW1 A;  4U96 D;  4GYY A;  3CHR A;  1PY1 A;  4L0R A;  4ASK A;  4YHJ A;  2Q7F A;  2FJE A;  1INZ A;  1YD8 G;  1VOM A;  5JJ6 A;  5JDL A;  3TLS A;  3RIU A;  5FWQ A;  3ZMT B;  3ONK A;  5AQB A;  3IHR A;  5HCJ A;  3O1J A;  2MHK A;  1HS6 A;  4U63 A;  4TV3 A;  4IST A;  2LEH A;  2LLY A;  2GRP B;  4GIW A;  2P9S G;  5AQU B;  2LT3 A;  4DJA A;  4L1B A;  4UF0 B;  2XRZ A;  5IY5 E;  2JMH A;  4TXR A;  2J9Q A;  1YKH B;  1DVP A;  2WDV A;  5FXV A;  2AXZ A;  2UY1 B;  3T8O A;  3EHR A;  1HX8 A;  4GMJ A;  3FTS A;  2L6B A;  2MRI A;  2ZIS A;  1SA0 E;  1W09 A;  1WAO 1;  3AAA C;  5DIZ A;  3J5Q B;  5B3S E;  2XY8 B;  3JCF A;  2H6F A;  4M1P A;  2P9N G;  3SGH A;  2F4V T;  2A3D A;  2PM7 A;  4UWK A;  4KHP T;  4BTB A;  2IW5 B;  1SA5 A;  4TNV A;  3PDN A;  3TWU A;  2JPF A;  1KT1 A;  4GZC A;  2BZB A;  3FUL A;  3FUD A;  4MBQ A;  4DX7 D;  4O4I E;  3LCA A;  4HWC A;  2Q9Q C;  3QOF A;  5AYW D;  1MMN A;  2OEW A;  3Q9N C;  4BEP A;  2WVI A;  4ILA A;  3PZ3 A;  4G11 A;  2PQN A;  4ZI7 E;  2H89 A;  3ZN3 A;  3L3P A;  2YU1 A;  2QVA A;  1S0P A;  2R03 A;  4ANX A;  4P0A A;  5BV0 A;  2Y3A A;  3MA9 A;  4UVA B;  5BW8 C;  5HYA A;  2JAB A;  3O4Z A;  4HTE A;  5T8I A;  5IUX A;  3ZSS A;  4WWO A;  3EHN A;  3ZUV B;  2P2C P;  4I9C A;  2FO1 E;  5AAO A;  3QWW A;  3UIN C;  1LVF A;  4U2Y A;  3VLD A;  3LK2 B;  4LF8 T;  3DSU A;  3ZEF A;  4KMC A;  5B1A E;  2XPZ A;  4UI9 K;  4O2B E;  4IL4 A;  3CWZ B;  4XI9 A;  4O1O A;  4DBR A;  4KVM A;  4FP7 A;  3NWI A;  5LP6 E;  2XEN A;  5JDF A;  3GZ1 A;  5LP0 A;  3SQV A;  3B13 A;  3ONX A;  3K8P C;  4Q96 A;  4YT0 A;  4H63 V;  4XZ4 A;  1KNR A;  1CHU A;  4HOQ A;  1UX4 A;  3C3Q A;  4O8S A;  4HB5 A;  5L3E B;  4NQ0 A;  4ILI A;  2IHR 1;  3ZKR A;  2KZT B;  3GYZ A;  5BT1 A;  4H9S E;  3QOU A;  5AFU L;  4JB8 P;  2CA5 A;  4I43 A;  5EIL A;  3W15 B;  2WXI A;  3ASF A;  4FAD A;  1MMG A;  4WYV A;  1FT1 A;  4LF5 T;  4U8Y D;  3PUV F;  2BKP A;  2RPA A;  4DR3 T;  4YHH T;  3ZYM A;  5GON E;  1N9A A;  2HE0 A;  4BWR A;  1E8Z A;  1BR4 A;  2C5K T;  5FZR A;  2V6X A;  3ZST A;  2FJA A;  3AEC A;  2W67 A;  3AA7 B;  3Q2M A;  3ZLI A;  3V5S A;  4CXY A;  5KNH D;  3F57 A;  4AVX A;  3TGO A;  4C91 A;  4TUY E;  1H7C A;  2UWJ G;  4ABN A;  4IRE A;  3FU3 A;  5ENS D;  3KFW X;  3P4W A;  4H7X A;  3ZIM A;  4K0K T;  3TL5 A;  2F0Y A;  3PE3 A;  3U78 A;  2NTY A;  2DNX A;  3PUK A;  2LKG A;  4G25 A;  3ZXS A;  3DXK G;  4AKH A;  3FH8 A;  3HXB A;  1JNR A;  2W4X A;  3LDQ B;  1N0Q A;  2LNI A;  5EK4 A;  3MKQ A;  5LBQ B;  4ZXL A;  5FNV E;  1QNF A;  4HEA A;  3HKB E;  3N9N A;  4I6J A;  3N9M A;  3DTO A;  4HOR A;  5LGN B;  3Q79 A;  3Q5W A;  4JI5 T;  4X1K E;  2MYO A;  3ML8 A;  4Q69 A;  4L23 A;  4GK5 E;  4WNF A;  2L3L A;  5AJD A;  4NXM T;  4F3V A;  3L39 A;  4B94 A;  3C4W A;  2WU5 A;  4URK A;  3ZHE A;  4W9R A;  1TR4 A;  2IC9 A;  3IV0 A;  4HS2 A;  3FZF B;  5ETW A;  1K1A A;  4B8A A;  3IXE A;  2CG3 A;  1KNP A;  4AJW A;  5JRC B;  1NP7 A;  2VVS A;  2C0L A;  3PE4 A;  3RRW A;  3NQP A;  3AAE B;  2XQ3 A;  5F5W A;  4LCT A;  4KVO A;  3G2W A;  1VRB A;  2KAT A;  2XQ6 A;  3LJC A;  3C98 A;  4ZFH A;  2FO7 A;  1E2A A;  3RAU A;  2NP9 A;  4LRZ A;  4YDO A;  4JL0 A;  3H3M A;  1Z0P A;  2E5V A;  1K3Z D;  3OKQ A;  4GTP A;  5LCW C;  2ZGG A;  4MBG A;  5T3R A;  3I5P A;  4TN7 B;  3MV3 B;  4EZL A;  4TRQ A;  4LMK A;  4ZI3 C;  3CVR A;  5AQS B;  4AIF A;  4HQD A;  2VGX B;  3AEF A;  3CLJ A;  4YVQ C;  4NAC A;  3SBT B;  2XEV A;  2ODU A;  2CXD A;  3CQC B;  2N2N A;  1O3X A;  2IY0 C;  1N4S A;  3PUX F;  5DJQ C;  3DSS A;  5KJL A;  4U0S A;  2XZT G;  4ANU A;  2R6G F;  3GMI A;  2PBI A;  1YA0 A;  3EAB A;  3LY8 A;  2EIK E;  3ONJ A;  3ABL E;  4JI8 T;  4GTR A;  2PNN A;  4YND A;  2J49 A;  4MFR A;  3C5R A;  4YDY A;  4DBQ A;  1MYO A;  3HR0 A;  3TWR A;  3D9N A;  1SUM B;  3KV4 A;  4H9R C;  5FIO A;  4GA0 A;  3B7T A;  2HM8 A;  2IIU A;  1HX1 B;  3RQW A;  2LOS A;  2WB5 A;  2YDS A;  3ESK A;  4ILU A;  3WG7 E;  2OND A;  3ONL A;  1D8D A;  4B93 B;  4E85 A;  4GMR A;  2P58 C;  3UQ3 A;  4I9E A;  3E34 A;  4WAF A;  3CST A;  3AE2 A;  1D9S A;  4GCN A;  3JCK C;  4HFH A;  2CPT A;  2KM4 A;  1A5E A;  5FY0 A;  4P09 A;  4PJL A;  4JVS A;  5HWX A;  1OT8 A;  5CHE E;  4G24 A;  1WCR A;  4XAX B;  3JUI A;  2VL8 A;  3EDV A;  2WXR A;  4HGA A;  4TWD A;  1O1R A;  1MIV A;  4O6F A;  3UT7 A;  4EZK A;  2YDQ A;  3VKG A;  4CDN A;  2L9Q A;  3PUA A;  1NL4 A;  2UXB T;  4GZ6 A;  3HKD E;  1UG3 A;  4DUZ T;  3SFX A;  3MCX A;  3VLF A;  5G05 J;  2RP4 A;  4H7Y A;  2ZM2 A;  3MKD A;  3T5V A;  4U74 A;  3N71 A;  1H19 A;  2XHE B;  3C4X A;  3TWV A;  1D1C A;  2WXJ A;  3NB2 A;  2VSO E;  3Q73 A;  5HXR A;  2WSS V;  3ZT5 A;  5JR9 C;  4OX9 T;  3ULE G;  1FMW A;  4BX8 A;  4OHF A;  3AEE A;  4U33 A;  2LE8 A;  4O4J E;  3BU8 A;  1IBK T;  2VB6 A;  3E0Z A;  4Y6W A;  1XDO A;  1XNQ T;  2J08 A;  3KAE A;  3D9M A;  4J8S A;  3UMV A;  3OBV E;  2W61 A;  4CYM D;  3A8Y C;  2UXD T;  3B7R L;  3CEQ A;  4J6I A;  4AXH A;  3V31 A;  2K48 A;  5EK3 A;  2QZA A;  4IGU A;  4APO A;  3CX6 B;  5AQV B;  5JTG A;  4E7S A;  5BMV E;  1UK5 A;  4BJN A;  4LF4 T;  2WXF A;  3C72 A;  3RKO A;  1EPU A;  3CHS A;  1N95 A;  2KWI B;  2WXL A;  3L6A A;  4XBF B;  3O9X A;  3ESL A;  3T1H T;  5AQQ B;  4J8D A;  2H88 A;  3NZS A;  2IO2 C;  2L0I A;  4JA9 A;  2I9C A;  3ZN1 B;  1XNF A;  3E08 A;  3Q5D A;  4DV2 T;  3LXU X;  4EQF A;  3ZW3 A;  1N54 A;  2PQR A;  3D0T A;  2CFU A;  2PFV A;  3UUM A;  2X67 A;  3UQ4 A;  4CN6 A;  3NOC D;  4DND A;  3L22 A;  3Q4A B;  3FZM B;  5JR9 A;  4OAV B;  4DR2 T;  2DWG A;  1SQM A;  3ZT6 A;  3RRU A;  2AXD S;  3QJZ A;  3Q5X A;  4ISS A;  4JD2 G;  1FJG T;  3CHQ A;  4DUY T;  4BET A;  4HOS A;  2R02 A;  1MMD A;  4KI0 F;  4IE0 A;  5HXH A;  1JCQ A;  2CXF A;  2X9H A;  2E9X B;  4LUN U;  4AV7 A;  4TNW A;  3ZMU B;  3Q5E A;  1U5P A;  4QX8 B;  5L3G B;  1WRD A;  4UV9 B;  3C51 A;  4K03 A;  4YSY A;  3RC8 A;  4WNG A;  1G8X A;  4NUU A;  2OCC E;  2L6J A;  2HPL A;  3FBZ A;  3KSL A;  3LVQ E;  5ARF A;  2ZM0 A;  3I9W A;  4UI9 J;  3HA4 A;  3KV6 A;  4FHK A;  3QDN A;  1FPP A;  3C64 A;  4MLK A;  2AJA A;  2XZD G;  4GAA A;  2W66 A;  1JUQ A;  2G0U A;  4I6E A;  1ZEE A;  2CM0 A;  4DV4 T;  5J2U E;  2XPY A;  1W0B A;  5JRE A;  2J4D A;  3S7B A;  5ABE A;  2XHE A;  4AEZ C;  4JI0 T;  5FQ6 A;  3TG5 A;  4LMJ A;  3NF1 A;  1W3B A;  1UUS A;  1YQ4 A;  3FP3 A;  3IEG A;  1HNZ T;  2YHE A;  3ZT7 A;  3JC6 C;  2XQ0 A;  5HAX A;  5CJ5 A;  2B1E A;  2CHZ A;  1HZ4 A;  1N33 T;  2X9X A;  1NI1 A;  4G23 A;  4ILC A;  3HXC A;  1YKE B;  5LMN T;  2NXP A;  4HOU A;  1H2T C;  2J4G A;  2LSU A;  3VR8 A;  3UFE A;  3SF4 A;  3Q9D A;  1SZ9 A;  3KBU A;  2H6G A;  4JHK A;  3G06 A;  3AE8 A;  2WAU A;  5AQT B;  3TKL B;  1WDY A;  2XQY A;  1B7T A;  2PG8 A;  1ZB1 A;  3LPZ A;  3ULY A;  2V8S V;  4IIJ E;  3CGH A;  3CX8 B;  3OXF A;  3D9K A;  3G2T A;  5A23 A;  1IXV A;  4HFG A;  1D0X A;  4DR6 T;  2OVB A;  3U3W A;  4CGW A;  4BT9 A;  1H2V C;  1LF8 A;  1N11 A;  2J62 A;  4LEU A;  4KBM B;  4KHZ F;  5JVD E;  5C8Y E;  4U95 D;  4EHM A;  4TXP A;  4Z68 A;  3ANW A;  4NIK A;  3B95 A;  3FZL B;  4QXB B;  3CVV A;  2I1K A;  4PJM A;  2V1D B;  3EAM A;  2IML A;  2J47 A;  3LJ3 A;  2KWH A;  2IOS A;  2VKH A;  2NYJ A;  3GN5 B;  3Q9U C;  2SPC A;  4YSX A;  2JEK A;  1H6P A;  3EU5 A;  4F1P A;  4DMW A;  4CQI A;  4HE8 A;  5FVL A;  2V6Y A;  3H3A A;  2WS3 A;  4F7A A;  4GA1 A;  3AS4 A;  2XQ8 A;  3L16 A;  4WW0 A;  5HXE A;  1N0R A;  2OOE A;  5J90 A;  4NXN T;  5LHI B;  5C2Y A;  4I6G A;  1Y6I A;  3MZK B;  4G2V A;  4GCO A;  1ZV4 X;  3VLE A;  3LK3 B;  1TNB A;  3SZ7 A;  2AVP A;  2DWK A;  3DPD A;  3QWP A;  2MOZ A;  1GW6 A;  4CI1 B;  4PS7 A;  4EBA G;  2LRL A;  3RC3 A;  1WYB A;  1KZP A;  3N9L A;  3AEB A;  1XZY A;  2NR4 A;  3APC A;  4DR1 T;  2LSJ A;  3LBX B;  4KT6 B;  2OVF A;  1V55 E;  2ES0 A;  3RIF A;  4UR9 A;  3EHM A;  4AY5 A;  3ZEF B;  2VTB B;  4L9I A;  4DVD A;  5AJL A;  2VGY A;  3RIU C;  4DPR A;  2F8Y A;  4C48 B;  2DCF A;  2RG8 A;  2X6H A;  1NZN A;  3O4X E;  2P9I G;  1MX4 A;  4GU5 A;  4ZI2 D;  2DZN A;  1D1B A;  1TNY A;  4IT4 A;  4J8F A;  1KT0 A;  2X51 A;  3I1A A;  4BAY B;  3LKU A;  1D0Z A;  1KZO A;  1EZ3 A;  1FMV A;  3PH0 C;  4QWN B;  4L2Y A;  2KCK A;  2EHO D;  3PZ4 A;  3PZ1 A;  3OYZ A;  3AS8 A;  2LXM A;  3RYH E;  3AS5 A;  5FIN A;  4TWH A;  2HO1 A;  2XQ4 A;  1NWM X;  3GN5 A;  1H2U A;  4HRM B;  4GPK A;  1BLX B;  3OVU A;  1QYM A;  1TN6 A;  5H6Q B;  4CDR A;  4U07 A;  2CHX A;  4E6H A;  2XS1 A;  3CHP A;  2J8S D;  3BK9 A;  4I4T E;  4EEC A;  1S35 A;  3I3N A;  2R5S A;  1HO8 A;  1IJ5 A;  2GRR B;  2E0I A;  3Q47 B;  3ZU7 B;  5CEA A;  1X79 A;  3A7M A;  2WQH A;  3CQG B;  5BUZ A;  3D9L A;  2Z6E A;  5FY1 A;  2V7J A;  1OCO E;  2BG9 E;  3P2B A;  5EK2 A;  1E8Y A;  2YKS A;  3L13 A;  2CWY A;  1BR0 A;  5BV1 A;  4AQG A;  2BG9 B;  3L08 A;  4DV1 T;  1VCT A;  5DQW A;  3J7Y q;  3UX4 A;  3FFL A;  2CLY B;  1WFD A;  1WYC A;  2GRM A;  1FEW A;  3CHM A;  3FTU A;  1HH8 A;  3RJV A;  2XQ7 A;  4IE5 A;  3MJX A;  1DCE A;  1MHQ A;  5KJM A;  4YLH A;  2DLR A;  3RKG A;  5BNW A;  4JI7 T;  2JJ9 A;  4U04 A;  2LO6 A;  2KXP C;  2P9B A;  5JDM A;  4K0R A;  3QAQ A;  4LFB T;  3SS1 A;  5LJM A;  4B89 A;  5JRC A;  3FTV A;  5KX5 E;  3RSE G;  1HFA A;  2I2O A;  5LHH B;  2WDR A;  5L3F B;  2UXC T;  1MX2 A;  1HXI A;  1TNO A;  2NWB A;  4U31 A;  3EIJ A;  2NW8 A;  1OCR E;  3L09 A;  3U4T A;  3QNU A;  1T72 A;  4DX5 D;  3LY7 A;  5LA6 E;  2WXM A;  1TN7 A;  5HCM A;  5HWY A;  2CBI A;  5AQM B;  3ZCJ A;  4C9B B;  5HQ8 A;  4OYJ A;  3DRA A;  4PUC A;  4XKC A;  2BS4 A;  3VU7 H;  5CCL A;  2RFA A;  3O48 A;  5IYZ E;  3C3O A;  4HNA D;  2BBH A;  5CA1 E;  3PZD A;  3UFG A;  2JQH A;  3QK6 A;  4WUY A;  4AY6 A;  2GRN B;  2CMR A;  3VKH A;  1S70 B;  1OWL A;  3QUJ A;  5LOV E;  4FHJ A;  3R9M A;  3ONL C;  3NBX X;  3RIB A;  3KDS E;  4I50 E;  4ADZ A;  2ZXW E;  3RO2 A;  3KVA A;  2XSA A;  2HHH T;  2BKK B;  3SFD A;  2OV8 A;  3NOG D;  4EXT A;  3QC1 A;  2YIN A;  5KNG A;  3CKD A;  4EAH A;  2VTB A;  4CEM A;  4ZS3 A;  4CZ2 D;  3BQO A;  2WXQ A;  1JWG A;  3AU4 A;  2P9U G;  3ZPJ A;  3ABV A;  4WNE A;  2VKD A;  4V1A v;  1TJF A;  1LKX A;  2BS2 A;  3V5U A;  3SD5 A;  5G55 A;  5CGM A;  2WXP A;  4WBO A;  5AQL B;  1N4Q A;  4HBD A;  5KJN A;  4OVV A;  4KX6 A;  3RU0 A;  3EHZ A;  4TWF A;  5CCM A;  2XTL A;  2JQ9 A;  3EUV A;  3ZHE B;  2AE9 A;  1N36 T;  1J5W A;  4EEB A;  3ZC1 A;  4I17 A;  3K3N A;  4IYP A;  2WXN A;  1MIW A;  3PJA A;  2M67 A;  4BER A;  5JH7 E;  4LG6 A;  3BQI A;  3ZFW A;  1OCC E;  2CHW A;  3DSV A;  2DCP A;  2CBJ A;  4EYU A;  3FUM A;  3P4P A;  1KNZ A;  3UKR G;  5HS0 A;  4DR5 T;  4QFV A;  5CBO A;  4U0Z A;  2V5Q C;  4CDM A;  2XZE A;  4N3C A;  4XE0 A;  3UPV A;  3U64 A;  1JPL A;  4ANW A;  4PDX A;  4XKB A;  5L2L A;  2BDE A;  2C5I T;  4H9N C;  2B0O E;  3I0Q A;  2WDQ A;  4U7Y A;  5JDN A;  2X3M A;  5EX0 A;  3ZKJ A;  3HDX A;  1UUR A;  3K3Q C;  2RKK A;  2LKH A;  3PDY A;  2V5F A;  4GKK T;  4BJM A;  1UX5 A;  1XNR T;  3MEK A;  4HLE A;  3P4R A;  4PS3 A;  5KWD A;  2C0M A;  3IHV A;  2DWZ A;  3UU8 A;  3AA6 B;  4RVB A;  4I1M A;  3AAI A;  4CN4 A;  5AQK B;  3CPZ A;  3UTM A;  4DLQ A;  1BD8 A;  4QKN A;  5ABF B;  3FTX A;  1N4P A;  3F2E A;  3SFZ A;  3CIA A;  1SHZ C;  4DR7 T;  2IU1 A;  3JAE A;  3EDT B;  4DK5 A;  1U2V G;  2XAS B;  1OED E;  1I94 T;  3PUG A;  3UUX B;  2DIW A;  3IF8 B;  3EHQ A;  4UWL A;  3BQK A;  5FL0 A;  2EQX A;  3WAK A;  2MOW A;  2EIL E;  4YDE A;  2KMF A;  2CHO A;  3B7B A;  2LHN A;  3D3M A;  2LM9 A;  4UWG A;  4KZ0 A;  3X1D A;  3HKC E;  4DX1 A;  1EF1 C;  4H9O C;  4OK0 A;  3RGL A;  4ZZB A;  5LJN A;  1IBM T;  3CIR A;  2XAF B;  1U3D A;  4HI9 A;  4B0Z A;  3R9A B;  4X66 T;  3N2O A;  5AQI B;  3AE7 A;  2A5U A;  2YHC A;  3QB2 A;  2WMN A;  5KBA A;  4HN9 A;  4QH4 A;  2XSB A;  2CFZ A;  5J08 A;  4CN1 A;  2DVW A;  2XGO A;  4LER A;  3ULQ A;  4BES A;  1OWO A;  4BSZ B;  3PEV B;  4XX5 A;  2E5L T;  4J2C A;  5AQF B;  4HWD A;  3FUF A;  1ZBP A;  2GW1 A;  2MYS A;  3KSQ A;  3QNK A;  2UUA T;  2X0H A;  3E4B A;  1ZP0 A;  1NA3 A;  4JBW F;  2R59 A;  3ASO E;  4LF9 T;  3MJW A;  4IDZ A;  1KFY A;  5AQJ B;  4L7T A;  4N2Q A;  3NKZ A;  4AM9 A;  4IE7 A;  2DYR E;  4JXT A;  5CED B;  3NBN B;  3AA0 B;  2VQ2 A;  3LK4 2;  5AN8 A;  2XAQ B;  4GPM A;  3AAA B;  3E22 E;  4N3B A;  1NA0 A;  3FTY A;  1R8I A;  1XMO T;  4XI0 A;  4YTN A;  2NW7 A;  5JDG A;  5H7P A;  3P8C D;  1QUU A;  2X0L B;  2QYU A;  4LNG A;  4JA7 A;  4EYY R;  3F6Q A;  3TWQ A;  3RRC A;  3PJA J;  1MIY A;  3L54 A;  3TWX A;  2E9X C;  1IHG A;  4GTV A;  2HH7 A;  1SA4 A;  1EYH A;  4A98 A;  4H9P C;  4FJO A;  3PVL A;  3TG4 A;  4EBA A;  5LB7 B;  2LRK A;  2VSY A;  4UV8 B;  3JYS A;  3FU0 A;  4AKG A;  1QBQ A;  1U3C A;  4B3R T;  4ACK A;  2V7L A;  4ILB A;  3I0O A;  3LYA A;  4I1O B;  1MQS A;  1O1T A;  2IJG X;  1LD7 A;  1ELK A;  2GRQ B;  2XRY A;  1UGO A;  3CK6 A;  3ZXP A;  2K5B B;  1UOH A;  4DLO A;  3SI5 A;  4RG6 A;  2CEA A;  1H6O A;  5BR8 T;  3MA5 A;  2K3W A;  2GK9 A;  2VKJ A;  2YK0 A;  3ZPO A;  4N5Q A;  2YU2 A;  3KD7 A;  3UIO C;  2LSI A;  5B1B E;  2Y4U A;  3UUL A;  3OAW A;  4LFA T;  3RYF E;  2V8S E;  5LNK A;  4GTQ A;  3NRX A;  3AB3 B;  1MND A;  1V9D A;  5ENP D;  2E9X A;  3HHM A;  3P7I A;  1WR6 A;  3AVR A;  1OY3 D;  4DRX E;  3PNT B;  3ABM E;  5ARG A;  5JQG E;  2AW6 A;  1IYG A;  4QX7 B;  4PW8 A;  2FJD A;  3FH7 A;  1G73 A;  2E9X D;  3AG1 E;  3JAD A;  5LGT B;  2XEE A;  5JHB A;  2D5U A;  3PUQ A;  1OED A;  1MJ0 A;  4AIU A;  4HI8 A;  4A55 A;  4UVB B;  4KYO B;  5E75 A;  2C0S A;  4M7C A;  1E96 B;  3ASN E;  3IBE A;  2VGE A;  5ENQ D;  1X5B A;  2FJB A;  1YW0 A;  2Q9Q D;  1W0A A;  4K5A B;  3CV0 A;  3Q5M A;  1HG2 A;  2YN6 A;  1S63 A;  2BED A;  2JQQ A;  3UU3 A;  3PNL B;  1Z6T A;  4ZS2 A;  3RHW A;  4LNB A;  2XQ5 A;  2UUB T;  3CVX A;  2F37 A;  4NPP A;  5ITZ F;  2XM2 A;  1OWA A;  4PNI A;  2XQA A;  1N4R A;  2UXX B;  4AI6 A;  1JNZ A;  4JUY A;  1PC2 A;  4FA6 A;  2QC9 A;  3F31 A;  5EKQ D;  3C50 A;  1P5Q A;  3CVL A;  3G2V A;  4O4H E;  3LBX A;  3JXI A;  3T8M A;  1HU3 A;  5LOZ A;  5JHA A;  3S7J A;  2EIJ E;  4MKT A;  3RIA A;  3KV5 A;  3UTK A;  1Z3X A;  2VGX A;  2JRK A;  3LY9 A;  3AE4 A;  1HNW T;  4IN3 B;  3SWH A;  5FY7 A;  2J07 A;  4KMO A;  3UM3 A;  2EIM E;  3UKU G;  1SW6 A;  5DBK A;  4CGV A;  4NUR A;  4KUM B;  3W9G A;  2V4L A;  1MZC A;  4GTO A;  5EID A;  4YJ3 E;  5HEG A;  4LF6 T;  3Q78 A;  1D0Y A;  3OTN A;  4JEU A;  3AXJ B;  4COF A;  5LXT E;  5G04 C;  2XAJ B;  3G2S A;  2WXG A;  1FVH A;  2BF0 X;  4HWF A;  2PM6 A;  4MHC A;  3FY4 A;  2EIN E;  3CX7 B;  5HEH A;  3G2U A;  2ODV A;  2XJ7 A;  3C4Z A;  3RYC E;  3PE0 A;  5AAR A;  1VDY A;  4I43 B;  4IDN A;  5ENN A;  4RSY A;  3UU4 A;  1HTJ F;  1W9R A;  3CKB A;  3ZRH A;  3TWT A;  4A97 A;  2KZT A;  2MAW A;  4AP2 A;  4EZH A;  2X6F A;  1WM5 A;  2UUC T;  3GZS A;  5BXU A;  4YSZ A;  4DV3 T;  1E7U A;  4X8Q A;  4AKR B;  4ZEY A;  3RRN B;  4HFC A;  2QGS A;  2KT9 A;  2VL0 A; 
#chains in the Genus database with same CATH homology
 3FUJ A;  5F3J A;  4ZI3 D;  3SOL A;  3ZN0 B;  5E0O A;  4X20 E;  1TJC A;  5LX8 A;  2XCB A;  4UWH A;  3C98 B;  3FEY A;  3ZC0 A;  4WNK A;  1XGW A;  5JJ7 A;  2X68 A;  2A2F X;  2VSX E;  5L3B B;  5FMN A;  4PK6 A;  4FUL A;  4BT8 A;  5FTP A;  2W00 A;  2N9D A;  4APF A;  4F1S A;  4HOT A;  2PZI A;  3N9Q A;  4IUL A;  4N78 D;  4GYW A;  1S94 A;  3PUR A;  3O1I A;  3FUH A;  3MYV A;  2OA5 A;  2LSK A;  1ZU2 A;  3OJA A;  1ELW A;  2ZMA A;  2WXH A;  3OXG A;  4KP3 C;  3SHF A;  1E8W A;  3FTW A;  3KV9 A;  4ME2 A;  2EHO C;  5FZS A;  4KBQ A;  2X6J A;  4WWP A;  4JPS A;  2H7O A;  2AXU A;  3CK7 A;  3HL6 A;  2VYI A;  3VTX A;  4AOF A;  1B89 A;  3D9P A;  3KIN B;  2FBN A;  3FXE B;  2CCQ A;  4L5G A;  4GML A;  4XZC A;  3RO3 A;  2J4B A;  3MZL B;  1FIO A;  3ZCI A;  4I2W A;  5A6C A;  2Y8D A;  2FI7 A;  3Q15 A;  4AQF A;  5M4Y A;  5L3C B;  3CML A;  3TAX A;  3URZ A;  3Q49 B;  4IHJ E;  4A1G A;  1E7V A;  4UI9 C;  5CMW A;  4ATG A;  3ML9 A;  1BPO A;  2IOL A;  2AWI A;  3S2A A;  2ION A;  4EZ4 A;  1IQU A;  3ZGQ A;  2D0T A;  3S4U A;  1WY6 A;  4FLB A;  2CG2 A;  3IHY A;  2KXP B;  3N9P A;  5KDM C;  3FB2 A;  5FXW A;  4JEU B;  3EDU A;  4PS8 A;  2V0P A;  2D0U A;  1SZA A;  3RX6 A;  3U9W A;  4PH4 B;  2XAH B;  2BUG A;  2UXN B;  3HI2 A;  4BFR A;  2ACX A;  3FWV A;  3CVP A;  3I4G A;  2WM9 A;  3FTZ A;  3PTR B;  4PJN A;  4ZHQ E;  5J2T E;  1MNE A;  2KZ7 B;  4N39 A;  1UN9 A;  2HPJ A;  2NC9 A;  4OFZ A;  3MKR A;  3VHL A;  1OWN A;  1BR2 A;  3BQL A;  3M65 A;  4JZY A;  4A56 A;  3ZMV B;  4H63 H;  2LOP A;  1UCU A;  4WBN E;  4D10 C;  4UIG A;  4F53 A;  3R7R A;  2IF4 A;  3QAR A;  4WND A;  3R84 B;  4IE6 A;  2WMO A;  1OWP A;  5FJY A;  3N2G E;  4R7L A;  4ACL A;  4O2A E;  5KMG P;  1U4Q A;  2WPV A;  4BTA A;  4DMV A;  2D2S A;  3LFM A;  3EUH A;  3JQ0 A;  4UF0 A;  3CVY A;  4MAL A;  5ANL A;  1HS7 A;  4IRU A;  3VTY A;  1IJ6 A;  2Y4T A;  3D9O A;  3ETU A;  4UWF A;  4CCA A;  1OXZ A;  3QKY A;  2L9B A;  4G2A A;  5FT9 A;  2L0T B;  1EDU A;  4A3T A;  5TAO A;  4ANV A;  5EZY E;  4ZOL E;  3UUN A;  3PUS A;  4DI3 A;  3QK0 A;  2H3R A;  3MX3 A;  1AJ3 A;  2WQ7 A;  1LRZ A;  2I1J A;  4I1A A;  5LHG B;  2V7K A;  4JLE A;  2K9A A;  1HG5 A;  3D9J A;  3HVE B;  3R6N A;  1PAQ A;  3IBP A;  4CZZ B;  2WXO A;  3FDH A;  5A1L A;  2V7M A;  5JDH A;  5CA0 E;  1A17 A;  4HVB A;  5FQ8 A;  3FU6 A;  2QA7 A;  2CE7 A;  4TV8 E;  2YQ8 A;  4N5C A;  3KEZ A;  3WAJ A;  4G1T A;  5LG4 A;  3N5L A;  3S7D A;  2WQ6 A;  2M63 A;  4C0M A;  3LS8 A;  2KND A;  1TEZ A;  2CLY C;  2Q9Q B;  4CRW A;  2J09 A;  1N52 A;  2Q9Q A;  1QSD A;  4B6X A;  3ZVV A;  3BG0 B;  2MTQ A;  2W0G A;  3K3O A;  2IC6 A;  3LG7 A;  4U72 A;  4AKL A;  4KZC A;  4O4L E;  3FUE A;  2KCL A;  4ERR A;  3APD A;  3ETV A;  1WLX A;  5JDQ A;  3FBL A;  4UQZ A;  1UW4 B;  2LSG A;  4K0U A;  4Q94 A;  3CQX C;  2I59 A;  2VWA A;  4UEL A;  2A4Z A;  3TXM A;  5F8P A;  4WWN A;  4EOZ B;  1IZN B;  2LAH A;  3TXN A;  4L2L A;  1KK7 A;  4A1S A;  5M72 A;  2KCV A;  2ILR A;  1LVK A;  4ILG A;  3A5X A;  5ANR A;  2NOX A;  5LGU B;  4H9Q C;  2CWO A;  3FHN A;  4FU3 A;  4N2S A;  3CK9 A;  5L3D B;  4AKI A;  4CT4 A;  3IEE A;  4PFO A;  4PFP A;  5DQV A;  2VAS A;  2X6K A;  3RH3 A;  4J8E A;  2QFC A;  3K9I A;  4ILH B;  5BPP A;  2XCC A;  5LYJ E;  5A7D B;  3NRY A;  4CXX A;  2AXV A;  2X38 A;  2LAI A;  1QZ2 A;  4YFS A;  4OVU A;  1ELR A;  2GRL A;  2C2L A;  2A72 A;  2R17 C;  3GW4 A;  4QXC B;  2W63 A;  1HCI A;  2WWU A;  2K24 A;  4G26 A;  3FUN A;  4C0E A;  3HIZ A;  2MBG A;  3ENE A;  3ZMZ B;  4AQF C;  3ANW B;  3ASH A;  1UN8 A;  2NSZ A;  4GYS A;  4GB9 A;  3ZYL A;  1FVF A;  2V26 A;  5LBM A;  1HE8 A;  1H0A A;  3P1U A;  1E8X A;  4EZJ A;  3UT5 E;  2JLB A;  1OUV A;  3EIQ C;  4QXH B;  4AXP A;  5G05 C;  3RPU A;  2KC7 A;  4FJZ A;  4Z8X A;  2W62 A;  3AVS A;  4GZD A;  3GA8 A;  3RYI E;  3PRZ A;  5CB4 E;  3I9Y A;  3BG1 B;  3PRE A;  4BY6 A;  2UY1 A;  4TV9 E;  2J1D G;  2H7V C;  3UUX A;  3UT4 A;  4NRH B;  2C5J A;  3DBS A;  4I2Z A;  2DI4 A;  2N1G A;  4U0U A;  1E90 A;  2XGM A;  4P0B A;  3CVN A;  5D0Q D;  4CI2 B;  4YVO A;  2BVL A;  2JMK A;  4GOU A;  3O1H A;  4UQY A;  1H6K A;  3CK8 A;  4XIF A;  3ZMS B;  4FC8 A;  4UQX A;  2Y48 B;  4BSX A;  4TX5 A;  2VJ8 A;  5J1G A;  1CUN A;  4EB6 E;  5LCW J;  2XGS A;  3AA1 B;  3N9O A;  1JWF A;  3PEU B;  3RRM B;  2KLQ A;  4V3I A;  3U66 A;  4JHR A;  3U3I A;  3GZ2 A;  3MV2 B;  4M3O A;  3QC9 A;  4MRU A;  2BVM A;  4OYS A;  4EPZ A;  1FCH A;  2FUL A;  4FJY A;  5C1D A;  4G63 A;  2YNQ A;  5CMY A;  5HXS A;  2NTX A;  3ZYK A;  2ZLY A;  4EIW A;  5G2N A;  5LCY A;  4GYR A;  3WI3 A;  4DO0 A;  4P29 A;  5KCM A;  4CT0 A;  3CSF A;  5AEN A;  3WXX A;  3FU5 A;  2XAG B;  4HFV A;  5FQ7 A;  5G04 J;  3R7Q A;  2YEV C;  3HKE E;  3RKV A;  2CXL A;  3T5X A;  3CKC A;  2XUE A;  3LVR E;  2LJL A;  1OWM A;  2NW9 A;  3DP7 A;  2HYZ A;  2WB2 A;  2Y6X A;  4GK0 E;  5EX3 A;  1UJK A;  2X6I A;  3D9I A;  3DJB A;  3FUK A;  2IQC A;  4TZ4 C;  2QY7 A;  4UXN B;  5HXC A;  2EHO A;  4X1Y E;  4PJJ A;  2VK9 A;  2WXK A;  4Y6C A;  3CVW A;  4JEH B;  1Y64 B;  3B7S A;  5FQ4 A;  1UJJ A;  4BA9 A;  2VSN A;  2IFU A;  3CR3 A;  3MKQ B;  3MK7 C;  5JR9 B;  4MLP A;  2WBL A;  5KJK A;  3H37 A;  4RG9 A;  3MXZ A;  2IAK A;  3PU3 A;  5T4Y A;  2I6H A;  2LHR A;  4F6R C;  4HKA A;  5IHY A;  5FP3 A;  1QQE A;  1Y8M A;  3EVY A;  3EJN A;  3HVE A;  5D0O D;  4ANJ A;  4PK5 A;  3RK6 A;  5HI7 A;  2X9W A;  3ZJ1 A;  2XPI A;  5AIJ A;  2KIN B;  4MS6 A;  1HF8 A;  1IAP A;  3PS6 A;  3APF A;  4UVC B;  3S7F A;  1ZHC A;  3TJP A;  3FUI A;  5FXZ A;  4OYK A;  4UEM A;  4BX9 A;  5E76 A;  4C90 A;  4HXI A;  3ASG A;  4TUU A;  3MGB A;  5H6R B;  1E1H B;  5EDS A;  5FZQ A;  3NZP A;  5JJT A;  3FEX A;  2L8K A;  3SRZ A;  4PK4 A;  4KXK B;  4JHJ A;  3LDZ A;  4FLH A;  2PL2 A;  3ZYQ A;  3J9X 1;  1NAF A;  2ZM8 A;  1ZKE A;  2E8I A;  3GWH A;  3MAC A;  4GYO A;  3B57 A;  3QWV A;  3KVB A;  3HYM B;  1KLX A;  3AU5 A;  3OXL A;  3ZJ2 A;  3FHE A;  1IQR A;  1D1A A;  5DAB A;  3BEE A;  2HR2 A;  1T98 A;  3CVQ A;  4NUV A;  3I4R B;  3NZQ A;  2DHR A;  3FXD B;  2ZU6 B;  4N3A A;  4DI4 A;  4JEH A;  4JC8 A;  3NZU A;  3ASD A;  4E7Z A;  4CI3 B;  3KBT A;  4ZI2 C;  2DBA A;  4QHO A;  2RA1 A;  3JQ1 A;  4U8H A;  3UT8 A;  4CXW A;  2LSY A;  4IE4 A;  3JC6 D;  3SBS A;  4GA2 A;  4PAG A;  4J0U A;  3B7U X;  3N2K E;  3LEW A;  3FH5 A;  4A3V A;  3CVU A;  1MMA A;  4GZ3 A;  4I55 E;  5FXX A;  2GGF A;  2EHO B;  4GZ5 A;  5FYM A;  3OYX A;  2VKO A;  1DNP A;  2RD0 A;  3PUJ A;  1BR1 A;  3SNX A;  2FF4 A;  3IKO B;  1Z3Y A;  3CHO A;  1US7 B;  1L5J A;  2PJQ A;  2X9Y A;  2V7I A;  4YJ2 E;  2X66 A;  3KS2 A;  2FEZ A;  4FI5 A;  4B8C B;  2BTD A;  5LFA A;  5ADX L;  3L17 A;  2LSV A;  4X1I E;  3PU8 A;  2E2E A;  4JW1 A;  4GYY A;  3CHR A;  1PY1 A;  4L0R A;  4ASK A;  4YHJ A;  2Q7F A;  1INZ A;  1YD8 G;  1VOM A;  5JJ6 A;  5JDL A;  5FWQ A;  3ZMT B;  3ONK A;  3IHR A;  3O1J A;  2MHK A;  1HS6 A;  4U63 A;  4TV3 A;  4IST A;  2LEH A;  4GIW A;  2LT3 A;  4DJA A;  4L1B A;  4UF0 B;  2XRZ A;  2JMH A;  2J9Q A;  1YKH B;  5FXV A;  1DVP A;  2AXZ A;  2UY1 B;  3T8O A;  4GMJ A;  1HX8 A;  3FTS A;  2MRI A;  1SA0 E;  1WAO 1;  5DIZ A;  4M1P A;  3SGH A;  2A3D A;  2PM7 A;  4UWK A;  4BTB A;  2IW5 B;  3PDN A;  2JPF A;  1KT1 A;  4GZC A;  2BZB A;  3FUL A;  3FUD A;  4MBQ A;  4O4I E;  3LCA A;  2Q9Q C;  5AYW D;  1MMN A;  2WVI A;  4G11 A;  2PQN A;  4ZI7 E;  3ZN3 A;  3L3P A;  2YU1 A;  1S0P A;  4ANX A;  4P0A A;  5BV0 A;  2Y3A A;  3MA9 A;  4UVA B;  5BW8 C;  5HYA A;  3O4Z A;  4HTE A;  5T8I A;  4WWO A;  3EHN A;  4I9C A;  3QWW A;  1LVF A;  3VLD A;  3LK2 B;  3ZEF A;  4KMC A;  2XPZ A;  4UI9 K;  4O2B E;  3CWZ B;  4XI9 A;  4DBR A;  4KVM A;  4FP7 A;  5LP6 E;  5JDF A;  3GZ1 A;  5LP0 A;  3B13 A;  3ONX A;  3K8P C;  4Q96 A;  4H63 V;  4XZ4 A;  4HOQ A;  1UX4 A;  4O8S A;  5L3E B;  4NQ0 A;  4ILI A;  2KZT B;  3GYZ A;  5BT1 A;  4H9S E;  3QOU A;  5AFU L;  2CA5 A;  4I43 A;  3W15 B;  2WXI A;  3ASF A;  4FAD A;  1MMG A;  3ZYM A;  5GON E;  4BWR A;  1E8Z A;  1BR4 A;  2C5K T;  5FZR A;  3AA7 B;  3Q2M A;  3ZLI A;  3V5S A;  4CXY A;  3F57 A;  4AVX A;  3TGO A;  4C91 A;  4TUY E;  1H7C A;  2UWJ G;  4ABN A;  3FU3 A;  3KFW X;  4H7X A;  3ZIM A;  3TL5 A;  3PE3 A;  3U78 A;  2NTY A;  2DNX A;  3PUK A;  4G25 A;  3ZXS A;  4AKH A;  3FH8 A;  2LNI A;  5EK4 A;  3MKQ A;  5LBQ B;  5FNV E;  1QNF A;  4HEA A;  3HKB E;  3N9N A;  4I6J A;  3N9M A;  3DTO A;  4HOR A;  5LGN B;  3Q5W A;  4X1K E;  3ML8 A;  4Q69 A;  4L23 A;  4GK5 E;  4WNF A;  2L3L A;  5AJD A;  4F3V A;  4B94 A;  3C4W A;  4URK A;  3ZHE A;  4W9R A;  2IC9 A;  3IV0 A;  4HS2 A;  5ETW A;  4B8A A;  2CG3 A;  4AJW A;  5JRC B;  1NP7 A;  2C0L A;  3PE4 A;  3RRW A;  3NQP A;  3AAE B;  4LCT A;  4KVO A;  3G2W A;  1VRB A;  2KAT A;  3LJC A;  3C98 A;  2FO7 A;  2NP9 A;  4LRZ A;  4JL0 A;  1Z0P A;  3OKQ A;  5LCW C;  5T3R A;  3I5P A;  4TN7 B;  3MV3 B;  4EZL A;  4TRQ A;  4ZI3 C;  3CVR A;  4AIF A;  2VGX B;  3CLJ A;  4YVQ C;  4NAC A;  3SBT B;  2XEV A;  2ODU A;  2CXD A;  3CQC B;  2N2N A;  1O3X A;  5DJQ C;  5KJL A;  4U0S A;  4ANU A;  3GMI A;  2PBI A;  1YA0 A;  3LY8 A;  4YND A;  2J49 A;  4MFR A;  4DBQ A;  3HR0 A;  3D9N A;  3KV4 A;  4H9R C;  4GA0 A;  3B7T A;  2HM8 A;  2LOS A;  3ESK A;  4ILU A;  2OND A;  3ONL A;  4E85 A;  2P58 C;  3UQ3 A;  4I9E A;  4WAF A;  3CST A;  4GCN A;  3JCK C;  2KM4 A;  5FY0 A;  4P09 A;  4PJL A;  4JVS A;  5HWX A;  5CHE E;  4G24 A;  4XAX B;  3JUI A;  2VL8 A;  3EDV A;  2WXR A;  4HGA A;  1MIV A;  4O6F A;  3UT7 A;  4EZK A;  3VKG A;  4CDN A;  2L9Q A;  3PUA A;  4GZ6 A;  3HKD E;  1UG3 A;  3MCX A;  3VLF A;  5G05 J;  2RP4 A;  4H7Y A;  2ZM2 A;  3MKD A;  3T5V A;  4U74 A;  3N71 A;  1H19 A;  2XHE B;  3C4X A;  1D1C A;  2WXJ A;  2VSO E;  5HXR A;  2WSS V;  5JR9 C;  1FMW A;  4BX8 A;  4OHF A;  2LE8 A;  4O4J E;  2VB6 A;  3E0Z A;  4Y6W A;  2J08 A;  3KAE A;  3D9M A;  4J8S A;  3UMV A;  3OBV E;  2W61 A;  3B7R L;  3CEQ A;  4J6I A;  4AXH A;  2K48 A;  5EK3 A;  4IGU A;  4APO A;  3CX6 B;  4E7S A;  5BMV E;  4BJN A;  2WXF A;  3RKO A;  1EPU A;  3CHS A;  2KWI B;  2WXL A;  3L6A A;  4XBF B;  3O9X A;  3ESL A;  4J8D A;  3NZS A;  2L0I A;  4JA9 A;  2I9C A;  3ZN1 B;  1XNF A;  3E08 A;  3LXU X;  4EQF A;  3ZW3 A;  1N54 A;  2PQR A;  3D0T A;  2CFU A;  2PFV A;  3UUM A;  2X67 A;  4DND A;  3L22 A;  3Q4A B;  5JR9 A;  2DWG A;  1SQM A;  3RRU A;  3QJZ A;  3Q5X A;  4ISS A;  3CHQ A;  4HOS A;  1MMD A;  4IE0 A;  5HXH A;  2CXF A;  2X9H A;  2E9X B;  4LUN U;  4AV7 A;  3ZMU B;  4QX8 B;  1U5P A;  5L3G B;  1WRD A;  4UV9 B;  3C51 A;  4K03 A;  3RC8 A;  4WNG A;  1G8X A;  4NUU A;  2L6J A;  2HPL A;  3FBZ A;  3LVQ E;  5ARF A;  2ZM0 A;  3I9W A;  4UI9 J;  3HA4 A;  3KV6 A;  4FHK A;  3QDN A;  3C64 A;  4MLK A;  4GAA A;  1JUQ A;  2G0U A;  4I6E A;  1ZEE A;  2CM0 A;  5J2U E;  2XPY A;  5JRE A;  3S7B A;  2J4D A;  2XHE A;  4AEZ C;  5FQ6 A;  3TG5 A;  3NF1 A;  1W3B A;  3FP3 A;  3IEG A;  2YHE A;  3JC6 C;  2XQ0 A;  5HAX A;  2B1E A;  2CHZ A;  1HZ4 A;  2X9X A;  4G23 A;  1YKE B;  2NXP A;  4HOU A;  1H2T C;  2LSU A;  3UFE A;  3SF4 A;  3Q9D A;  1SZ9 A;  3KBU A;  4JHK A;  2WAU A;  3TKL B;  2XQY A;  1B7T A;  2PG8 A;  3LPZ A;  4IIJ E;  3CGH A;  3CX8 B;  3OXF A;  3D9K A;  3G2T A;  5A23 A;  4HFG A;  1D0X A;  2OVB A;  3U3W A;  4CGW A;  4BT9 A;  1H2V C;  1LF8 A;  4LEU A;  4KBM B;  5JVD E;  5C8Y E;  3ANW A;  4QXB B;  3CVV A;  2I1K A;  4PJM A;  2V1D B;  3LJ3 A;  2KWH A;  2IOS A;  2VKH A;  3GN5 B;  2SPC A;  2JEK A;  4DMW A;  4CQI A;  4HE8 A;  3H3A A;  4F7A A;  4GA1 A;  3AS4 A;  3L16 A;  4WW0 A;  5HXE A;  2OOE A;  5J90 A;  5LHI B;  5C2Y A;  4I6G A;  1Y6I A;  3MZK B;  4G2V A;  4GCO A;  1ZV4 X;  3VLE A;  3LK3 B;  3SZ7 A;  2AVP A;  2DWK A;  3DPD A;  3QWP A;  2MOZ A;  1GW6 A;  4CI1 B;  4PS7 A;  4EBA G;  3RC3 A;  1WYB A;  3N9L A;  3APC A;  2LSJ A;  3LBX B;  4KT6 B;  2OVF A;  2ES0 A;  3EHM A;  4AY5 A;  3ZEF B;  2VTB B;  4L9I A;  4DVD A;  5AJL A;  2VGY A;  4DPR A;  2DCF A;  2RG8 A;  2X6H A;  1NZN A;  3O4X E;  4GU5 A;  4ZI2 D;  1D1B A;  4J8F A;  1KT0 A;  2X51 A;  3I1A A;  4BAY B;  3LKU A;  1D0Z A;  1EZ3 A;  1FMV A;  3PH0 C;  4QWN B;  4L2Y A;  2KCK A;  2EHO D;  3OYZ A;  3AS8 A;  3RYH E;  3AS5 A;  2HO1 A;  1NWM X;  3GN5 A;  1H2U A;  4GPK A;  5H6Q B;  4CDR A;  4U07 A;  2CHX A;  4E6H A;  3CHP A;  3BK9 A;  4I4T E;  4EEC A;  1S35 A;  3I3N A;  2R5S A;  1HO8 A;  1IJ5 A;  2E0I A;  3Q47 B;  1X79 A;  2WQH A;  3CQG B;  5BUZ A;  3D9L A;  2Z6E A;  5FY1 A;  2V7J A;  3P2B A;  5EK2 A;  1E8Y A;  3L13 A;  2CWY A;  1BR0 A;  5BV1 A;  4AQG A;  3L08 A;  5DQW A;  3J7Y q;  3UX4 A;  3FFL A;  2CLY B;  1WYC A;  2GRM A;  1FEW A;  3CHM A;  3FTU A;  1HH8 A;  3RJV A;  4IE5 A;  3MJX A;  1MHQ A;  5KJM A;  4YLH A;  2DLR A;  5BNW A;  2JJ9 A;  4U04 A;  2LO6 A;  2P9B A;  5JDM A;  4K0R A;  3QAQ A;  4B89 A;  3SS1 A;  5LJM A;  5JRC A;  3FTV A;  5KX5 E;  1HFA A;  2I2O A;  5LHH B;  5L3F B;  1HXI A;  2NWB A;  3EIJ A;  2NW8 A;  3L09 A;  3U4T A;  3LY7 A;  5LA6 E;  2WXM A;  5HWY A;  3ZCJ A;  4C9B B;  5HQ8 A;  4OYJ A;  4PUC A;  4XKC A;  3VU7 H;  5CCL A;  3O48 A;  5IYZ E;  5CA1 E;  3PZD A;  3QK6 A;  4WUY A;  4AY6 A;  2CMR A;  3VKH A;  1OWL A;  4FHJ A;  3QUJ A;  5LOV E;  3RIB A;  3RO2 A;  3NBX X;  3KDS E;  4I50 E;  4ADZ A;  3KVA A;  2OV8 A;  4EXT A;  3QC1 A;  2YIN A;  3CKD A;  4EAH A;  2VTB A;  4CEM A;  4ZS3 A;  2WXQ A;  1JWG A;  3AU4 A;  3ZPJ A;  4WNE A;  2VKD A;  4V1A v;  1TJF A;  1LKX A;  3SD5 A;  3V5U A;  5G55 A;  2WXP A;  4WBO A;  5KJN A;  4OVV A;  3RU0 A;  5CCM A;  2XTL A;  3ZHE B;  3ZC1 A;  4I17 A;  3K3N A;  4IYP A;  2WXN A;  1MIW A;  2M67 A;  5JH7 E;  3BQI A;  3ZFW A;  2CHW A;  2DCP A;  4EYU A;  3FUM A;  1KNZ A;  4QFV A;  4U0Z A;  4CDM A;  4N3C A;  4XE0 A;  3UPV A;  3U64 A;  1JPL A;  4ANW A;  4PDX A;  4XKB A;  5L2L A;  2BDE A;  2C5I T;  4H9N C;  3I0Q A;  5JDN A;  2X3M A;  5EX0 A;  3HDX A;  3K3Q C;  3PDY A;  2V5F A;  4BJM A;  1UX5 A;  3MEK A;  4HLE A;  4PS3 A;  2C0M A;  3IHV A;  3AA6 B;  4RVB A;  4I1M A;  3AAI A;  3CPZ A;  4DLQ A;  4QKN A;  3FTX A;  3F2E A;  3SFZ A;  3CIA A;  1SHZ C;  2IU1 A;  3EDT B;  4DK5 A;  2XAS B;  3PUG A;  3UUX B;  2DIW A;  3IF8 B;  4UWL A;  3BQK A;  2EQX A;  3WAK A;  2MOW A;  2KMF A;  2LHN A;  3D3M A;  2LM9 A;  4UWG A;  4KZ0 A;  3HKC E;  1EF1 C;  4H9O C;  4OK0 A;  5LJN A;  2XAF B;  1U3D A;  4B0Z A;  3R9A B;  3N2O A;  2A5U A;  2YHC A;  3QB2 A;  2WMN A;  4HN9 A;  2CFZ A;  5J08 A;  2XGO A;  3ULQ A;  4LER A;  1OWO A;  3PEV B;  4XX5 A;  4J2C A;  3FUF A;  1ZBP A;  2GW1 A;  2MYS A;  3QNK A;  3E4B A;  1NA3 A;  2R59 A;  3MJW A;  4IDZ A;  4L7T A;  4N2Q A;  4AM9 A;  4IE7 A;  4JXT A;  3AA0 B;  2VQ2 A;  3LK4 2;  2XAQ B;  3AAA B;  3E22 E;  4N3B A;  1NA0 A;  3FTY A;  4XI0 A;  2NW7 A;  5JDG A;  3P8C D;  1QUU A;  2X0L B;  4JA7 A;  4EYY R;  3RRC A;  1MIY A;  3L54 A;  2E9X C;  1IHG A;  2HH7 A;  1EYH A;  4H9P C;  4FJO A;  3PVL A;  3TG4 A;  4EBA A;  2VSY A;  4UV8 B;  3JYS A;  3FU0 A;  4AKG A;  1U3C A;  4ACK A;  2V7L A;  3LYA A;  3I0O A;  4I1O B;  1MQS A;  2IJG X;  1ELK A;  2XRY A;  4DLO A;  2K5B B;  3SI5 A;  4RG6 A;  2CEA A;  3MA5 A;  2GK9 A;  2VKJ A;  2YK0 A;  3ZPO A;  2YU2 A;  3KD7 A;  2LSI A;  2Y4U A;  3UUL A;  3OAW A;  3RYF E;  2V8S E;  5LNK A;  3NRX A;  3AB3 B;  1MND A;  1V9D A;  2E9X A;  3HHM A;  3P7I A;  1WR6 A;  3AVR A;  3PNT B;  5ARG A;  5JQG E;  2AW6 A;  1IYG A;  4QX7 B;  4PW8 A;  3FH7 A;  1G73 A;  2E9X D;  5LGT B;  5JHB A;  2D5U A;  3PUQ A;  4A55 A;  4UVB B;  4KYO B;  5E75 A;  2C0S A;  1E96 B;  3IBE A;  1X5B A;  1YW0 A;  2Q9Q D;  3CV0 A;  3Q5M A;  1HG2 A;  2JQQ A;  3PNL B;  1Z6T A;  4ZS2 A;  3CVX A;  1OWA A;  4PNI A;  2UXX B;  4AI6 A;  4JUY A;  1PC2 A;  4FA6 A;  3F31 A;  5EKQ D;  3C50 A;  1P5Q A;  3CVL A;  3G2V A;  4O4H E;  3LBX A;  3T8M A;  1HU3 A;  5LOZ A;  5JHA A;  3S7J A;  4MKT A;  3KV5 A;  3UTK A;  1Z3X A;  2VGX A;  2JRK A;  3LY9 A;  4IN3 B;  3SWH A;  5FY7 A;  2J07 A;  4KMO A;  5DBK A;  4CGV A;  4NUR A;  4KUM B;  2V4L A;  4YJ3 E;  1D0Y A;  4JEU A;  3OTN A;  5LXT E;  5G04 C;  2XAJ B;  3G2S A;  2WXG A;  1FVH A;  2BF0 X;  2PM6 A;  4MHC A;  3FY4 A;  3CX7 B;  3G2U A;  2ODV A;  3C4Z A;  3RYC E;  3PE0 A;  1VDY A;  4I43 B;  5ENN A;  4RSY A;  1HTJ F;  3CKB A;  3ZRH A;  2KZT A;  4AP2 A;  4EZH A;  2X6F A;  1WM5 A;  3GZS A;  1E7U A;  4AKR B;  3RRN B;  2QGS A;  2KT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...