1HG2A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg2A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg2A01
1X5BA 1PY1A 4GZCA 1SZAA 3ZYMA 2V8SE 4Q96A 3D9IA 5J08A 1JWFA 3G2SA 1EYHA 1JUQA 1JPLA 3D9JA 1ELKA 3ONLA 3D9OA 3ZYQA 4FLBA 2LO6A 3RRUA 1SZ9A 3ZYKA 4AVXA 4JXTA 2L0IA 2DIWA 1HG5A 3D9MA 2L0TB 5LP0A 2DCPA 4GZDA 1UJKA 3LDZA 1VDYA 1H0AA 4FU3A 3D9PA 1DVPA 1HG2A 5CMYA 5LOZA 2QY7A 1LF8A 1HX8A 1HFAA 3ZYLA 1UJJA 3CLJA 3D9KA 3D9LA 3D9NA 4HFGA 3G2WA 1INZA 1HF8A 3ONKA 2MOWA 4NACA 1XGWA 2KM4A 3G2TA 1MHQA 1EDUA 2BF0X 1JWGA 3G2UA 5CMWA 3G2VA 4Q94A
chains in the Genus database with same CATH superfamily
1NI1A 1W0BA 3J5PA 3F57A 2XQ9A 3ZRHA 3LVQE 5LGUB 5T4YA 4J7WA 4P1NA 3A5XA 2KXPB 2FEZA 2DIWA 1EF1C 3PZ4A 1YA0A 3AA7B 4MLPA 4O60A 2QYWA 4YSXA 5KNHD 2XTLA 1S35A 2AWIA 3D9KA 3RIBA 4G2AA 3L3PA 4CT0A 3GMIA 1WAO1 4GU5A 1J1JA 2XHEB 3V2XA 2YHCA 2CFZA 5EKQD 2MRIA 4YTPA 5BNWA 2EHOA 3ZT5A 2UXNB 3N9MA 1YD8G 2OEVA 5LG3A 3UT5E 3EJNA 5AQVB 4GPKA 5LHIB 3UM0A 4D10C 1FVFA 4WNGA 5C3JA 3UQ7A 4H7XA 1XMOT 4UWKA 5CHEE 4ABNA 1DU2A 2ODVA 5DIZA 2EIJE 1WM5A 2J4GA 1TN7A 4DVDA 2L6BA 3CK6A 3AEGA 1IBLT 3QARA 1JWGA 4ZZCA 2OEWA 1V54E 4KT6B 1Z3XA 3B57A 3QKYA 3SGHA 4YDWA 4CZZB 5HEGA 2IQCA 3R7RA 3C4WA 3JQ1A 3AEEA 5G2NA 3DXMG 4ZI7E 5FINA 3UPVA 4N2SA 4AY5A 1NZNA 2CM0A 2VSYA 4CI2B 4TUUA 2XQ0A 3MKQA 3B7SA 4KMCA 1OY3D 3NZQA 4R7LA 4PK5A 1IXVA 3AAEB 2AE9A 5IWAT 3D3MA 4PS7A 3EIJA 4PK6A 1BPOA 4AQGA 4UWLA 2V8SE 5J2TE 3FHEA 1JUQA 3ZFWA 4O4LE 4OK0A 3ZC1A 3EVYA 5KNGA 4GTRA 3NRYA 3MEKA 5CERB 2HPJA 3CVUA 5J1GA 4GPMA 3UIPC 2IO2C 5ENNA 4O1OA 2WDRA 3TWXA 1LF8A 1OCRE 2AXUA 1YCSB 1MMAA 4UUCA 3UM2A 2EINE 3CX8B 1P5QA 1IZNB 4U3CA 1TJCA 4HFIA 4IYPA 2SPCA 2GROB 2JEKA 3IV0A 2YDQA 4QQIA 2PG8A 1JNRA 2V5DA 4PK4A 4ILCA 3T8MA 3VR8A 4B8AA 2CBIA 3EABA 5HWXA 5AQQB 1HCIA 2D5UA 2YN6A 4HS2A 2WWVA 5EYLA 3U78A 5AQIB 1N34T 3DJBA 3ML9A 5JVDE 3G2UA 2W61A 2XY8B 3PDYA 3UTKA 1W3BA 3SOLA 4QXCB 5AQKB 3IBEA 4AKLA 2BEDA 2W67A 3LY7A 4TRQA 3PEUB 4QFVA 1G73A 1UGOA 3UFGA 3VU7H 4UI9J 4YNDA 1OWAA 1A5EA 3CPZA 3R6NA 4DV4T 3ZHEB 3HL6A 3I4GA 5KMGP 4TUYE 5FIOA 1EZ3A 2MYSA 2J4BA 2V1DB 4P29A 3CVQA 4QX7B 3NQPA 1YKEB 2YDRA 2W00A 5L3CB 1XGWA 2XGMA 4HI9A 2N1GA 1MMGA 4ERRA 1E8ZA 3PVLA 5BV0A 1SZAA 4XKBA 3WAKA 3AS5A 3LG7A 4XZ4A 3OKQA 3CEQA 3IHYA 2WXQA 4CXXA 2L9BA 4X5TA 2AXDS 2YU2A 2XS1A 1FT2A 3B7UX 3SHFA 3UMVA 1VCSA 1KFYA 3PS6A 5HS0A 4F6RC 3RRCA 2JIWA 3KSLA 5EK2A 4CDMA 5JHBA 3ZYLA 4A97A 2GW1A 1A17A 4FC8A 3C98B 2CBJA 2PBIA 3HR0A 4OHFA 1YQ3A 3LFMA 3OJAA 2QA7A 3Q47B 1OCZE 2FF4A 3IEEA 2C0SA 4MKTA 1U5PA 1YYHA 2XGSA 3LYAA 3JYSA 5L3FB 2VKOA 4JEUA 4TV3A 1T8BA 4JZYA 4EHMA 4IHJE 3RF1A 2LSGA 3QB5A 3U64A 5JDGA 4FULA 3A7MA 5HXHA 4PJMA 1U3CA 1Z8UA 2B1EA 3U3IA 4E6HA 1JCQA 4PH4B 2LSYA 4DR6T 1EPUA 2LAIA 4Q96A 3L08A 4X65T 5DJQC 3K9IA 3QOUA 1E8YA 5HRYA 4MBQA 3OTNA 2CE7A 4LFCT 2I2OA 5H6RB 2NYJA 4YDYA 5AQFB 2DWKA 2WCAA 2ZISA 3E0ZA 3ZMZB 2W66A 3PUQA 3R9MA 3E08A 4AIUA 4UEMA 4HE8A 3MXZA 3SZ7A 2PQNA 2X0YA 2LM2A 1BI7B 1RW2A 1N4SA 3GN5A 3E30A 4X1KE 5AQ7A 3GZ1A 3L54A 5E75A 4YY3T 1OEDC 4YVOA 4DJAA 5AIJA 2WQ7A 2X51A 2BG9A 4FJZA 2NW7A 4TN7B 4H7YA 4GCNA 3B5MA 3OXGA 4EAHA 3OTOT 4LNBA 4DV6T 3NBXX 2KZ7B 2R17C 3LS8A 5CEDB 3H3MA 3O9XA 5KDMC 3VTXA 3A8YC 2MBGA 1H2UA 2M67A 5ITZF 5IUXA 4FLHA 4EEDA 1D1AA 1SA0E 3ONLA 3TXNA 4CN4A 3ZMVB 4ZI3D 2LUHA 3TLUA 4BTAA 2KSRA 4GA0A 3TWRA 1HE8A 5HCMA 3L82A 2PNNA 1WY6A 4ZI3C 3RQUA 2E9XD 3O1JA 1LKXA 2B6CA 3U9WA 3JC6D 4EZJA 3K3OA 1HF8A 5LXTE 4XI9A 5ANRA 4ATZD 3FUIA 4AISA 4PFPA 4JLEA 4CQIA 4X66T 2KATA 5D2MC 1J5WA 2FO7A 2K9AA 3OVUA 1YMPA 4I9EA 4ANXA 3P2BA 3V5SA 3AU5A 3LY9A 4X20E 1US7B 3Q5WA 2DCPA 4U7EB 2NW9A 4XAXB 2LSIA 5L3DB 4FJYA 1O5MA 1ZHCA 4KX6A 4UV9B 4J8YA 1HX8A 5CGMA 5ENTD 4NIKA 2LRLA 5LFAA 2D0UA 4EEBA 5T8IA 4ACKA 4C91A 3VRBA 3PUXF 5JRCB 4I1OB 2X67A 4IDPA 3APDA 4MRUA 5BW8C 4H9SE 4IRUA 1N4QA 4AM9A 3QWWA 3KAEA 1WG0A 2C5KT 3BQOA 1X79A 2YINA 3SF4A 5BUZA 1NA3A 3MV2B 4F6RD 5J2UE 3ZPOA 3ZCJA 4YTMA 3FUJA 4LF8T 5HXSA 3U4TA 3WI3A 2XQYA 3ABME 2Y3AA 3IF8B 3P4SA 3KV6A 1CUNA 5C2TA 1QSDA 1S63A 2F8YA 1OEDA 3Q79A 3QWPA 2A72A 1T72A 3P7IA 2H89A 5AQUB 3HXFA 4M1PA 3ONXA 1MIWA 3RQWA 4QX8B 4KXKB 3L8RA 3Q7AA 4DV1T 4IDZA 3ZIMA 2PQRA 3FHNA 2CRBA 3LPZA 2L6JA 4OX9T 1KLXA 3NBNB 2HH7A 4K5CA 5A6CA 2CCQA 1BR2A 2JLBA 3HXDA 2X0HA 5EZYE 4BEPA 4G2VA 2XQ7A 5EX0A 4GZ5A 2UUAT 5E0OA 2VQET 3LJCA 2CHZA 4U7YA 1YKHB 4UWFA 1HG5A 1E1HB 5LP6E 2DCFA 4QKNA 3ZT6A 4IE6A 3FULA 1E8WA 3JUEA 4XKCA 2B76A 3J5QB 2LXMA 2W2UA 5FY7A 5AJDA 3PUSA 2J4DA 3FH8A 1MZCA 3L13A 1ZP0A 4Y6WA 2WM9A 3HDXA 2UY1B 1MMNA 3ZT7A 4U04A 1KF6A 3ZXSA 4YDOA 2WQHA 1XNFA 2WXNA 3T1HT 5LB7B 4M7CA 2CXLA 2KCKA 3MV3B 2FJBA 2IU1A 3B7BA 2VASA 3AG4E 5AFUL 3ASNE 2V6XA 4TXQA 4ZZBA 4AEZC 4WZXA 5CBOA 3RYFE 3KBUA 3AEAA 3CHOA 5KJNA 5FKYA 4ZXLA 3FUEA 2QVAA 2DWGA 4QXHB 1HTJF 2IUBA 2PM6A 3T8KA 1IBKT 4HOSA 3AECA 1S70B 2VKDA 3APCA 3OAWA 2XM2A 4M3OA 5AQTB 3CV0A 2VWAA 4BX9A 5IY5E 2LAHA 1VOMA 3M3ZB 2GRMA 4TXPA 4ZHBA 5LYJE 2P9LG 3PH0C 3EHQA 2L9QA 5AQNB 3AE5A 3PRZA 4BESA 4EB6E 3JC6C 3EI0A 1FMVA 3C51A 2UY1A 3Q15A 2BKKB 1S0PA 2BKNA 4CDNA 4B0ZA 3P1UA 3UKRG 4ADZA 4KVOA 4JA9A 3ONJA 2Z6EA 3AJIA 4ME2A 4JI0T 2BBHA 1DC2A 2AXVA 1PC2A 1E7PA 4CXWA 3ZXPA 1UX5A 1KEYA 4ANJA 3TAXA 1X9BA 2FULA 3PEVB 2XENA 4HFEA 3Q5DA 2CHWA 3CR3A 5ADXL 1HS7A 5CCMA 1QLBA 2ZGGA 1DCQA 3RHWA 4ZI2C 3P4PA 1D0YA 4N5CA 1N9AA 3NKZA 3JXJA 4UVBB 4UR9A 4GA2A 2KBXA 3S7DA 1SVXA 3AE4A 4U72A 2WXOA 1N32T 4OYJA 3FXDB 2VL8A 2YHEA 3HKCE 4CGWA 4AKGA 3KSQA 2ZXWE 3EHZA 3X1DA 3ML8A 4U7IA 1LD7A 1V9DA 5H7PA 1QZ2A 1Z3YA 4O2BE 2IAKA 3ZYMA 3DSTA 4YHHT 1ELKA 3B7TA 3FTZA 3EDTB 3O1IA 2DZNA 2BDEA 4AVXA 1IJ5A 3MACA 2ETCA 2C5IT 3PUZF 3EUHA 2XS8A 1I94T 2VGYA 5FVKA 3ZHEA 2EQXA 3BU8A 5LOZA 3JAEA 2P9IG 4E7SA 3QDNA 1WR0A 3ZEFA 2PM7A 3CHQA 1FCHA 4XZCA 3T5XA 3MKQB 4H9NC 2BF0X 4UI9K 2XAQB 4BFRA 2D9DA 4NIQA 4FA6A 4EYYR 4P09A 2IDOB 4LMJA 3RRWA 2R5SA 3EHMA 4XBFB 1OT8A 1WYBA 1W9RA 2WXRA 3VRAA 4ZOLE 5C8YE 3C3RA 2X38A 4DI4A 3VLDA 4K0UA 2AVPA 3LDZA 1E96B 2E8IA 2NP9A 4DI3A 3WAJA 3FTSA 5CMYA 3C50A 3SS1A 3PV0F 3KFWX 2KZTA 2X6FA 2DLRA 1OWOA 1UN8A 2IONA 1IAPA 4AI6A 2IMLA 2NOXA 3AE1A 2KM4A 3CVPA 5FQ4A 3SQVA 4G11A 3IA3A 2J8SD 2E0IA 2JQKA 2LKGA 3MCXA 3E34A 4WW0A 2VVNA 4QWNB 2GRLA 2WXJA 1IYGA 4GMRA 3D9HA 4BY6A 2GRPB 3NOCD 2CXDA 2DL1A 5EK3A 3I9YA 2A5UA 3MA9A 3RIUC 5D66A 4TX5A 1TJFA 2DHRA 2WMNA 1SHZC 3C4XA 2WXIA 1N36T 3C98A 1WRDA 2LM9A 3R7QA 4PNIA 4J8SA 3I4RB 4FI5A 3RRMB 2R6GF 2CEAA 1WLXA 4YXDA 4G26A 3PE4A 2DBAA 4JI6T 4CEMA 4OFZA 3QNUA 4CXYA 5JDQA 1N11A 1QYMA 2XQ5A 2K5BB 3CSFA 4AOFA 3ZMTB 2IFUA 2XSAA 5KJKA 1Z5SC 2QZAA 4DR2T 4YDEA 1VCTA 2FJDA 3PNLB 1KT0A 1UJJA 2P58C 2P9PG 2L3LA 3L16A 5C1DA 1ELWA 1IHGA 2ZGDA 1AP7A 3LY8A 2J08A 4DX5D 3N9NA 4V1Av 4ZS3A 4K5AB 3FZFB 5L4HA 3P50A 4PDXA 2A4ZA 4AXPA 3SFDA 3JCFA 2LE8A 3URZA 4OAVB 2I1KA 2WXMA 2X9YA 4MFRA 5HXEA 3UIOC 3JAFA 4EZLA 1KNZA 4HRNA 1W09A 4ILBA 3D9NA 3PUWF 5TAOA 2R02A 2ZM6T 3ZMSB 4RSYA 3UU3A 3KVBA 4DX6D 5HYAA 3G2VA 5KCMA 2LSVA 5CA0E 4WWOA 1SQMA 5HEHA 5FQ7A 3DTOA 3G2SA 4LFAT 3AG3E 2J1DG 4IL4A 5EK4A 3APFA 4I6EA 5ENQD 2X3MA 3SY2A 2BG9E 2XHEA 3PUGA 4DX7D 2KLQA 3Q5XA 2CG2A 1O1SA 3PZ2A 5ABFB 1VDYA 3DWLG 4HWIB 3UT7A 1D8EA 4H9PC 1HNZT 2UUBT 4B89A 2E9XC 4BX8A 2XAFB 2IO3C 1YW0A 3F31A 4LSZE 4WAFA 1MIVA 4BSZB 4EBAG 2N2NA 5GONE 3UUXB 2M6BA 2KNDA 2RD0A 4GYSA 3HYMB 3CK8A 4DR1T 4B8CB 3I0OA 4GKKT 4IDNA 3ZVVA 3Q7FA 2UXXB 2XAHB 3KV9A 3P4QA 3JCKC 2I59A 3PZ1A 1LD8A 5F5WA 3ZSSA 3L09A 2R03A 5FJYA 3ZJ2A 5LHGB 1RZ4A 5FXZA 2OV9A 2WDVA 4O2AE 4UQXA 3EHRA 2A5EA 3RU0A 3AE3A 3AVRA 2E5VA 3LK2B 5JDHA 3BG1B 4JHJA 4CRWA 1Y01A 3T9KA 2A9UA 4A98A 1PAQA 1NP7A 4BERA 2MPKA 4I6GA 4LCTA 4LEUA 3RX6A 5JJTA 4FLBA 4OVUA 4UWGA 2NW8A 1OCOE 5JR9A 3DSVA 3D9MA 5LGNB 2BKGA 4BJNA 1KT1A 3AU4A 1HO8A 3QWVA 3ULYA 5JJ7A 3IHVA 5HEJA 4DPRA 4YTNA 4H63H 4CGVA 1WCRA 4GYRA 5LCYA 1MX6A 3S7FA 3V2OA 4J6IA 2N9DA 1FPPA 2WXPA 3ZNGA 4G8KA 4JV5T 4GCOA 2KMFA 3LSVA 4ILIA 4J8EA 1N95A 2XEEA 3RRUA 3ZSTA 4ILHB 4QH1A 2Q9QA 5HXRA 2BKOA 2D2SA 4GIWA 4GTSA 4LRZA 4OVVA 5CJ5A 2LRKA 4C0MA 1ZB1A 4LERA 3ABLE 3QB2A 4IN3B 2V7KA 5AENA 3T8OA 2WXLA 1OXZA 5FZQA 4AY6A 1NEKA 4Q94A 4TWHA 3O4ZA 2WBLA 2OCCE 1UOHA 3AAAC 3LK42 1OXJA 5DBKA 4LMLA 3ZC0A 4N78D 4BT9A 1ZKEA 2CFUA 3VTYA 2ES0A 5LP0A 3RH3A 5KXJA 1D9SA 3UU4A 5J0ZA 2CA5A 3JQ0A 1HG2A 4JL0A 2XAJB 5ABHA 2Y1LE 5JRCA 4L1BA 2J09A 4G24A 1NA0A 3FU6A 4GZ6A 4HQDA 1TEZA 2BKPA 3NZSA 2OLTA 3AE8A 3MYVA 4U07A 3V31A 1AWCB 2G0UA 4MHCA 5EIBE 3BEEA 4CN6A 2VK9A 5CA1E 3N5LA 2MAWA 2P9NG 2XUEA 4UWHA 5FQ8A 5FTPA 3W15B 4YFSA 4RG6A 3ZUVB 3ASDA 1DVPA 3Q49B 3CIRA 4DX1A 5KX5E 2WB5A 3CLJA 4UELA 3ZKRA 2X6HA 3PTRB 2WVIA 3E4BA 3SRZA 4Z90A 2WWUA 4X1YE 2RA1A 2IJGX 1XNQT 3FP3A 5A1LA 1MX4A 4PJJA 2V5CA 4HORA 3DXKG 2H7OA 3CK7A 2WU5A 4ANWA 4BETA 2WPVA 4B3TT 1FEWA 1XMQT 2VKJA 2AW6A 1BR4A 3AAAB 5DQWA 4A3TA 2XGOA 4HWFA 3FH7A 3D9LA 4JW1A 3HKBE 4URKA 1HXIA 4C0EA 3TLWA 3PZ3A 2XQ6A 5EIDA 4GOUA 3TLVA 4HOQA 4KMOA 3ASOE 4HVBA 2V4HC 4UXNB 2QFCA 1H6OA 3UXGA 3FUMA 1D1BA 3ABVA 2ODUA 2CWOA 5ABFA 1NAFA 1FMWA 4WNFA 1B7TA 1MX2A 1MMDA 2C0MA 4L9PA 4ZS2A 1XZYA 3RYHE 3RAUA 3KINB 3ONLC 4LF4T 2F4VT 2MOZA 3MGBA 4MALA 4WNEA 2OA5A 4N3BA 2W63A 4IL9A 3D9JA 5G04J 3I5PA 5DABA 1UN9A 5L2LA 3N2KE 3FU0A 1BR0A 5FY0A 2FJAA 3VKGA 4HI8A 2BS3A 4A1GA 2V4LA 2IOLA 1QBQA 1OCCE 3IEGA 3EHNA 1U2VG 2XPIA 3RPUA 3HKEE 1WYCA 3BQKA 3G2TA 4H9QC 3NAWA 2K3WA 2WXHA 2A3DA 3ISMC 3UQ3A 3C72A 3F6QA 4DV7T 5AQOB 1BD8A 3PZDA 1QNFA 2X66A 3Q73A 4XI0A 1T7SA 1XWMA 2DNXA 2WZHA 2V7MA 4IE4A 3RK6A 4LUNU 1UW4B 5M72A 2CMRA 3Q5EA 3RRNB 4I2WA 5FT9A 1Y6IA 3SFYA 1HX1B 3OYZA 4HRLA 5C2YA 1MJ0A 4I50E 4HWCA 2KCVA 3VHLA 3GA8A 3MX3A 1FJGT 4X64T 2V7JA 3L39A 4MS6A 3E33A 4HKAA 2WQYA 2IF4A 4U63A 2F8XK 2B0OE 4DR7T 3V30A 4EGWA 3PUVF 1DNPA 4JI2T 4GTMA 3FWVA 2VTBA 4GYOA 3QC9A 4HFDA 4IREA 4KZ0A 2CLYB 2C5JA 5FMNA 1MNDA 5LOVE 3DEOA 4AKHA 2KT9A 1R8IA 1KZPA 1Z0PA 5LCWJ 5AQHB 3AAIA 5LHHB 3ABKE 1SUMB 4WBOA 2A2FX 3TWVA 3AA0B 4I17A 3D9IA 1N52A 3KVAA 5JTGA 2NWBA 3KEAA 5E76A 2WAUA 3UFEA 2ILRA 3MKDA 4DUZT 3LCAA 2XZDG 3PUAA 3AEDA 2BUGA 3AG1E 1H0AA 2VL0A 1Y8MA 3UULA 5HWYA 2LEHA 3NWIA 4IE7A 4NRHB 2XQ8A 4EPZA 3O48A 4H63V 3FZMB 1ZBPA 5AQAA 2KZTB 2XCCA 3QNKA 3AA6B 4JPSA 4PUCA 1HU3A 4O4IE 3QB5K 3E22E 3W9GA 5KBAA 3LKUA 3AE7A 4CI3B 5ENRD 5AQJB 5H6QB 5AJLA 3NRXA 3VLFA 2LSUA 5BV1A 2BTDA 3J7Yq 2WU2A 4HGAA 4CZ2D 2FI7A 4AQYT 3RJVA 5FYMA 3H3AA 3ZLIA 2RFAA 3FUDA 3RLFF 3ZU7B 2ZMAA 3RIFA 1SA5A 1O1TA 4DV0T 1UCUA 2D0TA 3L17A 3BG0B 3FZHB 2L0IA 2H3RA 3ESLA 2VSOE 3CVNA 4CCAA 2QYUA 4DBQA 2LSJA 5HQ8A 4I1AA 3LBXB 2R59A 3SO8A 3F2EA 2LT3A 3QOFA 1D1CA 2CG3A 4W9RA 4JI5T 4FADA 5ENOD 3EDVA 2WXGA 2IW5B 2LXLA 4LMKA 4EV6A 1TNOA 1UX4A 1JPLA 1TNYA 4ANVA 3ULQA 2NXPA 2Y69E 4G23A 3CQCB 4L2LA 4KBMB 4YLHA 4P0BA 3D9PA 3MA5A 2HPLA 4DMVA 2JQQA 3RKGA 4ZEYA 1YXRA 1SA4A 4C90A 5JH7E 3B95A 4G63A 2MOWA 5G05C 5IHYA 4LFBT 4F7AA 2V7LA 2DWZA 1OWNA 2VQFT 3N71A 3Q78A 4N3AA 5JMND 4UF0A 2XCBA 4J0UA 2XQAA 3O4XE 3ZYQA 4I6JA 2LSKA 1SZ9A 4CI1B 1K8KG 3AE9A 3BQIA 4HOTA 4U2ZA 4YVQC 2ONDA 4L7TA 3HVEA 2X9HA 3BQLA 2R2LA 1G3NB 3MK7C 2UWJG 4L5GA 4ILUA 2UXCT 2J9QA 2EHOB 4F8HA 1E90A 2IOSA 2RFMA 4DK5A 2LHRA 2E9XB 4RG9A 4U8YD 3Q9UC 3RO3A 2AJAA 1QUUA 2XZEA 4EIWA 3DRAA 4U8HA 3SD5A 4GA1A 4N3CA 5AQGB 2ETAA 3FTYA 4EQFA 5LMNT 3CHMA 1JCRA 2LJLA 2V8SV 2HR2A 1T98A 5EX3A 1HNWT 2E9XA 4B3MT 2QY7A 3CMLA 2I0MA 3FUNA 3M65A 1MHQA 2P9KG 5JHAA 4GK5E 1IQRA 1WFDA 2LKHA 4GTVA 4XX5A 3LJNA 2VGXB 4DUIA 4HWDA 3OPCA 2RG8A 3AXJA 2HN2A 5FVLA 4YJ2E 3HRAA 4I43B 3CVLA 4BT8A 2UU9T 3RC8A 1B89A 3QUJA 3J9X1 3CIAA 2M6IA 4HLLA 2KINB 5ENSD 2VKHA 3ZPJA 4U31A 1HH8A 1TNBA 3FEYA 3DBSA 3NZPA 4DR5T 4O4HE 4JEHA 5EDSA 1LVFA 4A1SA 4DUYT 3K1SA 5HCJA 3GW4A 4BWRA 1H6PA 3L22A 3C5RA 4OAUC 3RYCE 2OOEA 2QRXA 4PJNA 2WMOA 2WP9A 5ETWA 3EU5A 3CGHA 4JC8A 4AJWA 5JA4D 5FP3A 3ASFA 2ZIRA 4GYYA 5FL1A 1QQEA 3RKOA 5FWQA 5AQBA 2BZBA 2GK9A 5LBMA 3KDSE 3V5UA 1L5JA 4KHPT 5HKPA 4GTPA 4EXTA 4Y6CA 2K48A 3ZEFB 2V6YB 4JEHB 4IDQA 4JD2G 1I6ZA 1K3ZD 2Y6XA 4PW8A 2C2LA 3Q9NC 2L0TB 4Z68A 3SFXA 4PS8A 2GRRB 1UG3A 4TXRA 2PTFA 4TV9E 2WY2A 1L0VA 1ZOYA 3UTMA 5CRVA 4XE0A 4HRMB 5LJMA 1HZ4A 3SWHA 4YSZA 2LO6A 3NF1A 2I1JA 5CBNA 3R84B 1HS6A 2P9UG 4TUMA 4BSXA 2JPFA 4ASKA 3VLEA 2R05A 2XRYA 4DX2A 5DQVA 4HFVA 3RSEG 5D0OD 5B3SE 3MZLB 5F3JA 1E7UA 2CHOA 4LG6A 4JVSA 5L3GB 2FBNA 3S7BA 3LDQB 4ATGA 4HFGA 4B3ST 1MIYA 2BG9C 3SBTB 2E5LT 2F0YA 3DSWA 2H6IA 3FU3A 1IBMT 4TWDA 3DEPA 4WBNE 2H6GA 3NB2A 3KS2A 3PUKA 2ZU6B 1WR6A 3DSUA 3FZKB 1WDYA 4QH4A 2ZM2A 3S7JA 3PREA 2E2AA 3U3WA 5LBQB 4U2YA 4K5BA 3UUXA 3ZN3A 2WQ6A 2ACXA 3RGLA 4DR4T 2JMKA 2MTQA 3AG2E 3WG7E 1BLXB 3AB3B 2BVMA 2W4XA 5AQMB 3N9OA 4FJOA 3DP7A 1NWMX 3PDNA 4MLKA 1XNRT 3ASGA 4N5QA 2HO1A 2BG9B 1FT1A 3L9TA 4JB8P 5CMWA 3LJ3A 4O4JE 2GGFA 2XM1A 3TG4A 4UF0B 1G8XA 3FTWA 2XAGB 3B7RL 2XPKA 2HN1A 2IEJA 2YQ8A 2XPZA 3FZLB 2WXKA 4A3VA 2HHHT 3HG0D 3QJZA 3S2AA 4JXTA 3E37A 2VSNA 2F37A 4K0RA 1OUVA 4YHJA 4GMLA 3T5VA 4JHKA 3QC1A 4WNDA 3UU8A 5AQSB 3KBTA 4EZ4A 2J49A 3CKBA 4F3VA 5FY1A 2WDQA 2LOSA 4JI4T 4L2YA 4L9IA 2KWHA 4X1IE 2HM8A 2NC9A 3K8PC 4NPPA 5HXCA 3SNXA 1N54A 4B93B 4H9RC 4AIFA 4RLYA 2Y8DA 5LJNA 3C64A 4GTQA 4F1PA 1M62A 1LVKA 4U8VD 1D0XA 2WXFA 3KV4A 1TYQG 4A55A 1KPSB 3PJAA 1X81A 2JMHA 4DO0A 3TWQA 1M7KA 3RIUA 5IYZE 2XQ3A 4J8FA 5ENPD 1KNPA 5JDFA 3EUVA 1SE7A 4RVBA 3AE6A 5D0QD 4ZHQE 3LK3B 3UU5A 1E7VA 4C48B 3GYZA 3UI2A 2MHKA 4GAAA 2Y4TA 5HI7A 1IJ6A 2M63A 3ESKA 2H6FA 3JADA 4JHRA 1S94A 3R9AB 2WS3A 3FY4A 3AEFA 4ISTA 4K0KT 2P9BA 3CQXC 2IHR1 4U74A 5A23A 3UKUG 1JNZA 2CWYA 4DBRA 4J8DA 4TNVA 4UI9C 3NVOA 2V5QC 4HNAD 3CVVA 5JR9C 4DMWA 2Q9QC 3HA4A 1KK7A 3ZCIA 1ZV4X 3CWZB 1GQEA 3D9OA 1LTXA 5B1BE 1OWLA 2VVSA 1XDPA 4UQZA 4GMJA 1O1RA 5AN8A 3OBVE 4UIGA 3IXEA 4GTOA 4Q69A 1OEDE 2V5FA 3P8CD 4IIJE 3VKHA 2XJ7A 3PE0A 3Q2MA 4HTEA 5BPPA 4I55E 4Z8XA 2X6KA 4WUYA 5BR8T 3ULEG 4HB5A 4QHOA 3ANWB 4EOZB 2CHNA 4EBAA 4WNKA 3QK0A 3RO2A 3CVXA 4I0UA 4AQFC 4CN1A 2J47A 2EIKE 2JQ9A 1ELRA 4C9BB 3PU8A 2XRZA 3ZW3A 5EYPF 2EHOD 3S4UA 2VQ2A 2XEHA 4JI7T 5AAOA 5F8PA 2DVWA 3PUJA 4F53A 3OYXA 2DI4A 3ZKJA 1HFAA 4AKIA 5JDNA 3FTVA 4U0ZA 3TWWA 4DLOA 1DCEA 5T3RA 1BI8B 3C3OA 4DV3T 3LEWA 2EHOC 3IHRA 2H88A 5AQLB 2Y0BG 5ANLA 4I2ZA 2X9WA 3PURA 3DPYA 4WWNA 4X62T 3FBZA 4IE5A 3FXEB 5JDLA 4FHJA 4I43A 4E7ZA 3L6AA 4BJMA 2BS4A 4B94A 4I9CA 3SFEA 4DNDA 1H2TC 2X6IA 3ENEA 3GZ2A 4LNGA 3JXIA 1MNEA 4U95D 5LMUT 4JYAT 4YSYA 2LNIA 3G06A 5G55A 3SI5A 1H6KA 1K1BA 2KCLA 3ANWA 3PJAJ 5FQ6A 4I1MA 2X6JA 1EYHA 4LF7T 4B6XA 2C0LA 4U0SA 2DYRE 3HXCA 5B1AE 4HFBA 2IC6A 3P4WA 4HN9A 5FL0A 5LG4A 1OEDB 3N2OA 1W0AA 3CX6B 4E85A 4FU3A 3DSXA 4HFHA 3CHPA 2Q9QB 4CT4A 3TLSA 2Y4UA 3EDUA 3MKRA 3IKOB 2JRKA 3AEBA 4KBQA 2W62A 3Q4AB 2ZM8A 3UUBA 1N0QA 1NFIE 4MBGA 1NL4A 3UT8A 4DIDB 3CHRA 3SFZA 3MJXA 3N9QA 2V7IA 4A56A 1TN8A 4G25A 4DV5T 2XZTG 4IGUA 4AQFA 5CCLA 2YEVC 3UT4A 2PL2A 3VR9A 5KJLA 1KNRA 3UM1A 3RKVA 3HIZA 4O8SA 2RPAA 4NURA 4KUMB 3UU6A 2XSBA 1BU9A 4I4TE 5AQRB 4A63B 5JJ6A 4JI1T 2XEVA 4DRXE 4JI8T 2AXZA 1X5BA 2EIME 3TLTA 2VSXE 1OWPA 3FFLA 2GRNB 4QH5A 1NENA 4UV8B 2CLYC 3K3NA 2P2CP 4V3IA 3RI5A 3DSSA 5EILA 1SW6A 3KD7A 2J07A 4CYMD 1H19A 5FXWA 4GZDA 4K03A 3ZN0B 3GZSA 3WXXA 4NUUA 4U0UA 2VTBB 5AQ9A 3AS8A 2RP4A 3LXUX 4EZKA 2FO1E 4COFA 1EDUA 2PFVA 1E2AA 5HEOA 2UXBT 3CVRA 1D8DA 3UUMA 3AE2A 4KVMA 3T1YT 2ETBA 5CRUA 5J08A 1TN6A 3BK9A 5CB4E 3FH5A 5LCWC 1N94A 4FHKA 3QAQA 2KWIB 1H7CA 2BBJA 5CFBA 3KEZA 2QC9A 2I6HA 4UVAB 4HEAA 4G8LA 4BTBA 3ZJ1A 5FXXA 3TWUA 3IBPA 4APFA 4CDRA 2W0GA 1HNXT 2NTYA 3BUAA 1S64A 2ACZA 4KHZF 3N2GE 4ILGA 4TWFA 2WZIA 1UUSA 2VB6A 4BA9A 1N4PA 3FTUA 5BXOA 2NR4A 5M4YA 1TNUA 5JREA 3P4RA 1N33T 2CPTA 2OVFA 2QYJA 3CVWA 2EILE 3AA1B 4GYWA 4XEIG 5A7DB 2DYSE 3EIQC 3SBSA 3ONKA 4YT0A 2YNQA 3FU5A 3UM3A 3OXLA 2JJ9A 4GZCA 4LF9T 3B13A 3HXBA 4ISSA 1CHUA 3CK9A 3TJPA 4WYVA 5L3EB 4IE0A 4TNWA 4TV8E 5ABGA 1KZOA 3ZYKA 1TR4A 2CHXA 3LVRE 1E8XA 4ZFHA 3PU3A 1N4RA 4PAGA 3I3NA 3V79K 2ZM0A 5BMVE 2OV8A 2V26A 3JUIA 4UQYA 5AYWD 5AARA 4L0RA 3FB2A 3RYIE 1N0RA 2KC7A 4KYOB 2VGXA 3DPDA 4AXHA 3PUYF 1TNZA 3HHMA 4YJ3E 4LNUD 5KWDA 2V6YA 3FUFA 2WB2A 3TWTA 3ASHA 1PY1A 3TL5A 1FVHA 1JWFA 3EU9A 3GN5B 2H6HA 5LNKA 4B3RT 3C4ZA 4PFOA 2PJQA 2X68A 2YU1A 3MZKB 5ABEA 2I9CA 4HLEA 1U4QA 5BXUA 2E2EA 5HAXA 4GKJT 4KZCA 2PZIA 4L23A 4AV7A 1BR1A 3MJWA 2WSSV 2YKSA 3FBLA 3NZUA 5BT1A 1INZA 4NACA 4GB9A 4U33A 3HKDE 4WWPA 1Z6TA 1O3XA 2Q7FA 2GRQB 5EN5D 5CEAA 2VYIA 5G05J 2MYOA 2Y48B 1GW6A 4U96D 5KJMA 2IY0C 3ZGQA 4Q25A 2HYZA 4QXBB 2VGEA 4PS3A 4PJLA 2BVLA 2CXFA 1IKND 3CKDA 4OYKA 5JDMA 5LA6E 5L47A 2NTXA 1Q2ZA 3W9FA 1MYOA 2VURA 3E32A 1IHBA 3C3QA 3TGOA 3FEXA 4NXMT 4FP7A 4N2QA 3Q75A 1YQ4A 5FNVE 4IT4A 2KXPC 3CQGB 3N9PA 3I1AA 1AJ3A 3TG5A 1UK5A 5JQGE 3AVSA 2XASB 2ZLYA 3EAMA 4HFCA 3RIAA 3TWSA 4ILAA 4DV2T 1IQUA 3CKCA 2RKKA 3I0QA 3HXEA 4O1PA 2LHNA 3Q9DA 3RC3A 2HE0A 4APOA 4LF6T 4AKRB 2LOPA 5L3BB 1XDOA 2QGSA 5HEUA 4EYUA 4JA7A 2IC9A 5G04C 3TKLB 4KI0F 1D0ZA 2IIUA 2JABA 5FZRA 2K24A 5ARFA 2VJ8A 3UQ4A 2XPYA 4A5XA 4IDOA 2XQ4A 2Q9QD 4TZ4C 3HVEB 4RQIA 2X0LB 4HOUA 3H37A 3PE3A 1ZU2A 4ZI2D 2LLYA 3ZN1B 3AS4A 2FUPA 4EZHA 4JBWF 3I9WA 3CVYA 3UUNA 4Z91A 5L4EA 2UUCT 4ANUA 3CSTA 3ZMUB 4BAYB 4F1SA 3TXMA 2V0PA 3K3QC 4J2CA 1MQSA 5FZSA 1LRZA 1U3DA 3Q5MA 4GK0E 4NQ0A 4DLQA 1JCSA 4XIFA 2L8KA 1UJKA 5FXVA 4NXNT 3O1HA 1H2VC 3ETVA 4LF5T 1VRBA 3N9LA 1FIOA 3HI2A 3FUKA 3U66A 1J5ET 3PNTB 4X8QA 5JR9B 3GWHA 1Y64B 3G2WA 4JUYA 4IULA 2H7VC 4JEUB 5AQPB 4OYSA 3D0TA 4ACLA 1UURA 2P9SG 2X9XA 3NOGD 4NUVA 4JI3T 3QK6A 1ZEEA 2FJEA 5LGTB 2OVBA 3FTXA 3X2QE 4EECA 4HBDA 4DR3T 2YDSA 3CX7B 3FUHA 3UX4A 3FDHA 3OXFA 4HXIA 3AXJB 4UVCB 1K1AA 3UINC 5LX8A 5ARGA 3LBXA 2JQHA 1HR0T 2YK0A 2BS2A 4GTTA 5CECB 4H9OC 4KP3C 2DZOA 4AP2A 2J62A 2FBWA 4O6FA 2NSZA 5J90A 2YOEA 4GZ3A 4N39A 1OWMA 3ETUA 3KV5A 3CHSA 1V55E 4G1TA 4P0AA 4HWHA 2UXDT
chains in the Genus database with same CATH topology
3F57A 3ZRHA 3LVQE 5LGUB 5T4YA 3A5XA 2KXPB 2FEZA 2DIWA 1EF1C 1YA0A 3AA7B 4MLPA 2XTLA 1S35A 2AWIA 3D9KA 3RIBA 4G2AA 3L3PA 4CT0A 3GMIA 1WAO1 4GU5A 2XHEB 5BNWA 2YHCA 2CFZA 5EKQD 2MRIA 2EHOA 2UXNB 3N9MA 1YD8G 3UT5E 3EJNA 4GPKA 5LHIB 4D10C 1FVFA 4WNGA 4H7XA 4UWKA 5CHEE 4ABNA 2ODVA 5DIZA 1WM5A 4DVDA 3QARA 1JWGA 4KT6B 1Z3XA 3B57A 3QKYA 3SGHA 3R7RA 4CZZB 2IQCA 3C4WA 3JQ1A 4N2SA 5G2NA 3UPVA 4ZI7E 4AY5A 1NZNA 2CM0A 2VSYA 4CI2B 4TUUA 2XQ0A 3MKQA 3B7SA 4KMCA 3NZQA 4R7LA 4PK5A 3AAEB 3D3MA 4PS7A 3EIJA 4PK6A 1BPOA 4AQGA 4UWLA 2V8SE 5J2TE 3FHEA 1JUQA 3ZFWA 4O4LE 4OK0A 3ZC1A 3EVYA 3NRYA 3MEKA 2HPJA 3CVUA 5J1GA 5ENNA 1LF8A 2AXUA 1MMAA 3CX8B 1P5QA 1IZNB 4IYPA 1TJCA 2SPCA 2JEKA 3IV0A 2PG8A 4PK4A 3T8MA 4B8AA 5HWXA 1HCIA 2D5UA 4HS2A 3U78A 3DJBA 3ML9A 5JVDE 3G2UA 2W61A 3PDYA 3UTKA 1W3BA 3SOLA 4QXCB 3IBEA 4AKLA 3LY7A 4TRQA 3PEUB 4QFVA 1G73A 4UI9J 3VU7H 4YNDA 1OWAA 3CPZA 3R6NA 3ZHEB 3HL6A 3I4GA 5KMGP 4TUYE 1EZ3A 2MYSA 2J4BA 2V1DB 4P29A 3CVQA 4QX7B 3NQPA 1YKEB 5L3CB 2W00A 1XGWA 2XGMA 2N1GA 1MMGA 4ERRA 1E8ZA 3PVLA 5BV0A 1SZAA 4XKBA 3WAKA 3AS5A 3LG7A 4XZ4A 3IHYA 3OKQA 3CEQA 2WXQA 4CXXA 2L9BA 2YU2A 3B7UX 3SHFA 3UMVA 3PS6A 4F6RC 3RRCA 4CDMA 5EK2A 5JHBA 3ZYLA 2GW1A 1A17A 4FC8A 3C98B 2PBIA 3HR0A 4OHFA 3LFMA 3OJAA 2QA7A 3Q47B 2FF4A 3IEEA 2C0SA 4MKTA 1U5PA 2XGSA 3LYAA 3JYSA 5L3FB 2VKOA 4JEUA 4TV3A 4JZYA 4IHJE 2LSGA 3U64A 5JDGA 4FULA 5HXHA 4PJMA 1U3CA 2B1EA 3U3IA 4E6HA 4PH4B 2LSYA 1EPUA 2LAIA 4Q96A 3L08A 5DJQC 3K9IA 3QOUA 1E8YA 4MBQA 3OTNA 2CE7A 2I2OA 5H6RB 2DWKA 3E0ZA 3ZMZB 3PUQA 3E08A 4UEMA 4HE8A 3MXZA 3SZ7A 2PQNA 3GN5A 4X1KE 3GZ1A 3L54A 5E75A 4YVOA 4DJAA 5AIJA 2WQ7A 2X51A 4FJZA 2NW7A 4TN7B 4H7YA 4GCNA 3OXGA 4EAHA 3NBXX 2KZ7B 2R17C 3LS8A 3O9XA 5KDMC 3VTXA 2MBGA 1H2UA 2M67A 4FLHA 1D1AA 1SA0E 3ONLA 3TXNA 3ZMVB 4ZI3D 4BTAA 4GA0A 1HE8A 1WY6A 4ZI3C 2E9XD 3O1JA 1LKXA 3U9WA 3JC6D 4EZJA 3K3OA 1HF8A 5LXTE 4XI9A 5ANRA 3FUIA 4PFPA 4JLEA 4CQIA 2KATA 2FO7A 2K9AA 4I9EA 4ANXA 3P2BA 3V5SA 3AU5A 3LY9A 4X20E 1US7B 3Q5WA 2DCPA 2NW9A 4XAXB 2LSIA 5L3DB 4FJYA 1ZHCA 4UV9B 1HX8A 5LFAA 2D0UA 5T8IA 4ACKA 4C91A 5JRCB 4I1OB 2X67A 3APDA 4MRUA 5BW8C 4H9SE 4IRUA 4AM9A 3QWWA 3KAEA 2C5KT 1X79A 2YINA 3SF4A 5BUZA 1NA3A 3MV2B 5J2UE 3ZPOA 3ZCJA 3FUJA 5HXSA 3U4TA 3WI3A 2XQYA 2Y3AA 3IF8B 3KV6A 1CUNA 1QSDA 3QWPA 2A72A 3P7IA 4M1PA 3ONXA 1MIWA 4QX8B 4KXKB 4IDZA 3ZIMA 2PQRA 3FHNA 3LPZA 2L6JA 1KLXA 2HH7A 5A6CA 2CCQA 1BR2A 2JLBA 5EZYE 4G2VA 5EX0A 4GZ5A 5E0OA 3LJCA 2CHZA 1YKHB 4UWFA 1HG5A 1E1HB 5LP6E 2DCFA 4QKNA 4IE6A 3FULA 1E8WA 4XKCA 5FY7A 5AJDA 3PUSA 2J4DA 3FH8A 3L13A 4Y6WA 2WM9A 3HDXA 2UY1B 1MMNA 4U04A 3ZXSA 2WQHA 1XNFA 2WXNA 2CXLA 2KCKA 3MV3B 2IU1A 2VASA 5AFUL 4AEZC 3RYFE 3KBUA 3CHOA 5KJNA 3FUEA 2DWGA 4QXHB 1HTJF 2PM6A 4HOSA 2VKDA 3APCA 3OAWA 4M3OA 3CV0A 2VWAA 4BX9A 2LAHA 1VOMA 2GRMA 5LYJE 3PH0C 2L9QA 3PRZA 4EB6E 3JC6C 1FMVA 3C51A 2UY1A 3Q15A 1S0PA 4CDNA 4B0ZA 3P1UA 4ADZA 4KVOA 4JA9A 2Z6EA 4ME2A 2AXVA 1PC2A 4CXWA 1UX5A 4ANJA 3TAXA 2FULA 3PEVB 2CHWA 3CR3A 5ADXL 1HS7A 5CCMA 4ZI2C 1D0YA 4N5CA 4UVBB 4GA2A 3S7DA 4U72A 2WXOA 4OYJA 3FXDB 2VL8A 2YHEA 3HKCE 4CGWA 4AKGA 3ML8A 1V9DA 1QZ2A 1Z3YA 4O2BE 2IAKA 3ZYMA 1ELKA 3B7TA 3FTZA 3EDTB 3O1IA 2BDEA 4AVXA 1IJ5A 3MACA 2C5IT 3EUHA 2VGYA 3ZHEA 2EQXA 5LOZA 4E7SA 3QDNA 3ZEFA 2PM7A 3CHQA 1FCHA 4XZCA 3T5XA 3MKQB 4H9NC 2BF0X 4UI9K 2XAQB 4BFRA 4FA6A 4EYYR 4P09A 3RRWA 2R5SA 3EHMA 4XBFB 1WYBA 2WXRA 4ZOLE 5C8YE 2X38A 4DI4A 3VLDA 4K0UA 2AVPA 3LDZA 1E96B 2E8IA 2NP9A 4DI3A 3WAJA 3FTSA 5CMYA 3C50A 3SS1A 3KFWX 2KZTA 2X6FA 2DLRA 1OWOA 1UN8A 2IONA 1IAPA 4AI6A 2KM4A 2NOXA 3CVPA 5FQ4A 4G11A 2E0IA 3MCXA 4WW0A 4QWNB 2GRLA 2WXJA 1IYGA 4BY6A 2CXDA 5EK3A 3I9YA 2A5UA 3MA9A 4TX5A 1TJFA 2DHRA 2WMNA 1SHZC 3C4XA 2WXIA 3C98A 1WRDA 2LM9A 3R7QA 4PNIA 4J8SA 3I4RB 4FI5A 3RRMB 2CEAA 4G26A 1WLXA 3PE4A 2DBAA 4CEMA 4OFZA 4AOFA 4CXYA 5JDQA 2K5BB 3CSFA 3ZMTB 2IFUA 5KJKA 3PNLB 1KT0A 1UJJA 2P58C 3L16A 2L3LA 5C1DA 1ELWA 1IHGA 3LY8A 2J08A 3N9NA 4V1Av 4ZS3A 4PDXA 2A4ZA 4AXPA 2LE8A 3URZA 2I1KA 2WXMA 2X9YA 4MFRA 5HXEA 4EZLA 1KNZA 3D9NA 5TAOA 3ZMSB 4RSYA 3KVBA 5HYAA 3G2VA 5KCMA 2LSVA 5CA0E 4WWOA 1SQMA 5FQ7A 3DTOA 4I6EA 3G2SA 3APFA 2J1DG 5EK4A 2X3MA 2XHEA 3PUGA 2KLQA 3Q5XA 2CG2A 1VDYA 3UT7A 4H9PC 4B89A 2E9XC 4BX8A 2XAFB 1YW0A 3F31A 4WAFA 1MIVA 4EBAG 2N2NA 5GONE 3UUXB 2RD0A 2KNDA 4GYSA 3HYMB 3CK8A 4B8CB 3I0OA 3ZVVA 2UXXB 2XAHB 3KV9A 3JCKC 2I59A 3L09A 5FJYA 3ZJ2A 5LHGB 5FXZA 4O2AE 4UQXA 3RU0A 3AVRA 3LK2B 5JDHA 3BG1B 4JHJA 4CRWA 1PAQA 1NP7A 4I6GA 4LCTA 4LEUA 3RX6A 5JJTA 4FLBA 4OVUA 4UWGA 2NW8A 5JR9A 3D9MA 5LGNB 4BJNA 1KT1A 3AU4A 1HO8A 3QWVA 5JJ7A 3IHVA 4DPRA 4H63H 4CGVA 4GYRA 5LCYA 3S7FA 4J6IA 2N9DA 2WXPA 4GCOA 2KMFA 4ILIA 4J8EA 3RRUA 4ILHB 2Q9QA 5HXRA 2D2SA 4GIWA 4LRZA 4OVVA 4C0MA 4LERA 3QB2A 4IN3B 2V7KA 5AENA 3T8OA 2WXLA 1OXZA 5FZQA 4AY6A 4Q94A 3O4ZA 2WBLA 3LK42 5DBKA 3ZC0A 4N78D 4BT9A 1ZKEA 2CFUA 3VTYA 2ES0A 5LP0A 3RH3A 2CA5A 3JQ0A 1HG2A 4JL0A 2XAJB 5JRCA 4L1BA 2J09A 4G24A 1NA0A 3FU6A 4GZ6A 1TEZA 3NZSA 3MYVA 4U07A 2G0UA 4MHCA 3BEEA 2VK9A 3N5LA 5CA1E 4UWHA 5FTPA 2XUEA 5FQ8A 3W15B 4YFSA 4RG6A 3ASDA 1DVPA 3Q49B 5KX5E 3CLJA 4UELA 2X6HA 3PTRB 2WVIA 3E4BA 3SRZA 2WWUA 4X1YE 2RA1A 2IJGX 3FP3A 5A1LA 4PJJA 4HORA 2H7OA 3CK7A 4ANWA 2WPVA 1FEWA 2VKJA 2AW6A 1BR4A 3AAAB 5DQWA 4A3TA 2XGOA 3FH7A 3D9LA 4JW1A 3HKBE 4URKA 1HXIA 4C0EA 4GOUA 4HOQA 4KMOA 4HVBA 4UXNB 2QFCA 3FUMA 1D1BA 2ODUA 2CWOA 1NAFA 1FMWA 4WNFA 1B7TA 1MMDA 2C0MA 4ZS2A 3RYHE 3KINB 2MOZA 3MGBA 4MALA 4WNEA 2OA5A 4N3BA 2W63A 3D9JA 5G04J 3I5PA 5DABA 1UN9A 5L2LA 3N2KE 3FU0A 1BR0A 5FY0A 3VKGA 4A1GA 2V4LA 2IOLA 3IEGA 3EHNA 2XPIA 3RPUA 3HKEE 1WYCA 3BQKA 3G2TA 4H9QC 2WXHA 2A3DA 3UQ3A 3PZDA 1QNFA 2X66A 4XI0A 2DNXA 2V7MA 4IE4A 3RK6A 4LUNU 1UW4B 5M72A 2CMRA 3RRNB 4I2WA 5FT9A 1Y6IA 3OYZA 5C2YA 4I50E 2KCVA 3VHLA 3GA8A 3MX3A 2V7JA 4MS6A 4HKAA 2IF4A 4U63A 1DNPA 3FWVA 2VTBA 4GYOA 3QC9A 4KZ0A 2CLYB 2C5JA 5FMNA 1MNDA 5LOVE 4AKHA 2KT9A 1Z0PA 5LCWJ 3AAIA 5LHHB 4WBOA 2A2FX 4I17A 3AA0B 3D9IA 1N52A 3KVAA 2NWBA 5E76A 2WAUA 3UFEA 2ILRA 3MKDA 3LCAA 3PUAA 2BUGA 1H0AA 1Y8MA 3UULA 5HWYA 2LEHA 4IE7A 4NRHB 4EPZA 3O48A 4H63V 1ZBPA 2KZTB 2XCCA 3QNKA 3AA6B 4JPSA 4PUCA 1HU3A 4O4IE 3E22E 3LKUA 4CI3B 5H6QB 5AJLA 3NRXA 3VLFA 2LSUA 5BV1A 2BTDA 3J7Yq 4HGAA 2FI7A 3RJVA 5FYMA 3H3AA 3ZLIA 3FUDA 2ZMAA 1UCUA 2D0TA 3L17A 3BG0B 3CVNA 2L0IA 2H3RA 3ESLA 2VSOE 4CCAA 4DBQA 2LSJA 5HQ8A 4I1AA 3LBXB 2R59A 3F2EA 2LT3A 1D1CA 2CG3A 4W9RA 4FADA 3EDVA 2WXGA 2IW5B 1UX4A 1JPLA 4ANVA 3ULQA 2NXPA 4G23A 3CQCB 4L2LA 4KBMB 4YLHA 4P0BA 3D9PA 3MA5A 2HPLA 4DMVA 2JQQA 4C90A 5JH7E 4G63A 2MOWA 5G05C 5IHYA 4F7AA 2V7LA 1OWNA 3N71A 4N3AA 4UF0A 2XCBA 4J0UA 3O4XE 3ZYQA 4I6JA 2LSKA 1SZ9A 4CI1B 3BQIA 4HOTA 4YVQC 2ONDA 4L7TA 3HVEA 2X9HA 3BQLA 3MK7C 2UWJG 4L5GA 4ILUA 2J9QA 2EHOB 1E90A 2IOSA 4DK5A 2LHRA 2E9XB 4RG9A 3RO3A 1QUUA 4EIWA 4U8HA 3SD5A 4GA1A 4N3CA 3FTYA 4EQFA 3CHMA 2LJLA 2HR2A 1T98A 5EX3A 2E9XA 2QY7A 3CMLA 3FUNA 3M65A 1MHQA 5JHAA 4GK5E 1IQRA 4XX5A 2VGXB 2RG8A 4YJ2E 4I43B 3CVLA 4BT8A 3RC8A 3QUJA 1B89A 3J9X1 3CIAA 2KINB 2VKHA 3ZPJA 1HH8A 3FEYA 3DBSA 3NZPA 4O4HE 4JEHA 5EDSA 1LVFA 4A1SA 3GW4A 4BWRA 3L22A 3RYCE 2OOEA 4PJNA 2WMOA 5ETWA 3CGHA 4JC8A 4AJWA 5FP3A 3ASFA 4GYYA 1QQEA 3RKOA 5FWQA 2BZBA 2GK9A 5LBMA 3KDSE 3V5UA 1L5JA 4EXTA 4Y6CA 2K48A 3ZEFB 4JEHB 2Y6XA 4PW8A 2C2LA 2L0TB 4PS8A 1UG3A 4TV9E 4XE0A 5LJMA 1HZ4A 3SWHA 2LO6A 3NF1A 2I1JA 3R84B 1HS6A 4BSXA 2JPFA 4ASKA 3VLEA 2XRYA 5DQVA 4HFVA 5D0OD 3MZLB 5F3JA 1E7UA 4JVSA 5L3GB 2FBNA 3S7BA 4ATGA 4HFGA 1MIYA 3SBTB 3FU3A 4WBNE 3KS2A 3PUKA 2ZU6B 1WR6A 2ZM2A 3S7JA 3PREA 3U3WA 5LBQB 3UUXA 3ZN3A 2WQ6A 2ACXA 2JMKA 2MTQA 3AB3B 2BVMA 3N9OA 4FJOA 3DP7A 1NWMX 3PDNA 4MLKA 3ASGA 2HO1A 5CMWA 3LJ3A 4O4JE 2GGFA 3TG4A 4UF0B 1G8XA 3FTWA 2XAGB 3B7RL 2YQ8A 2XPZA 2WXKA 4A3VA 3QJZA 3S2AA 4JXTA 2VSNA 4K0RA 1OUVA 4GMLA 4YHJA 3T5VA 4JHKA 3QC1A 4WNDA 4EZ4A 3KBTA 2J49A 3CKBA 4F3VA 5FY1A 2LOSA 4L2YA 4L9IA 2KWHA 4X1IE 2HM8A 2NC9A 3K8PC 3SNXA 5HXCA 1N54A 4H9RC 4AIFA 2Y8DA 5LJNA 3C64A 1LVKA 1D0XA 2WXFA 3KV4A 4A55A 2JMHA 4DO0A 5IYZE 4J8FA 5JDFA 4RVBA 5D0QD 4ZHQE 3LK3B 1E7VA 3GYZA 2MHKA 4GAAA 2Y4TA 5HI7A 1IJ6A 2M63A 3ESKA 4JHRA 1S94A 3R9AB 3FY4A 4ISTA 2P9BA 3CQXC 4U74A 5A23A 2CWYA 4DBRA 4J8DA 4UI9C 3CVVA 5JR9C 4DMWA 2Q9QC 3HA4A 1KK7A 3ZCIA 1ZV4X 3CWZB 3D9OA 1OWLA 4UQZA 4GMJA 3OBVE 4UIGA 4Q69A 2V5FA 3P8CD 4IIJE 3VKHA 3PE0A 3Q2MA 4HTEA 5BPPA 4I55E 4Z8XA 2X6KA 4WUYA 4QHOA 3ANWB 4EOZB 4EBAA 4WNKA 3QK0A 3RO2A 3CVXA 4AQFC 1ELRA 4C9BB 3PU8A 2XRZA 3ZW3A 2EHOD 3S4UA 2VQ2A 5F8PA 3PUJA 4F53A 3OYXA 2DI4A 1HFAA 4AKIA 5JDNA 3FTVA 4U0ZA 4DLOA 5T3RA 3LEWA 2EHOC 3IHRA 5ANLA 4I2ZA 2X9WA 3PURA 4WWNA 3FBZA 4IE5A 3FXEB 5JDLA 4FHJA 4I43A 4E7ZA 3L6AA 4BJMA 4B94A 4I9CA 4DNDA 1H2TC 2X6IA 3ENEA 3GZ2A 1MNEA 2LNIA 5G55A 3SI5A 1H6KA 2KCLA 3ANWA 5FQ6A 4I1MA 2X6JA 1EYHA 4B6XA 2C0LA 4U0SA 2IC6A 4HN9A 5LG4A 3N2OA 3CX6B 4E85A 4FU3A 3CHPA 2Q9QB 4CT4A 2Y4UA 3EDUA 3MKRA 3IKOB 2JRKA 4KBQA 2W62A 3Q4AB 2ZM8A 3UT8A 3CHRA 3SFZA 3MJXA 3N9QA 2V7IA 4A56A 4G25A 4IGUA 4AQFA 5CCLA 2YEVC 3UT4A 2PL2A 5KJLA 3RKVA 3HIZA 4O8SA 4NURA 4KUMB 4I4TE 5JJ6A 2XEVA 2AXZA 1X5BA 2VSXE 1OWPA 3FFLA 4UV8B 2CLYC 3K3NA 4V3IA 3KD7A 2J07A 1H19A 5FXWA 4GZDA 4K03A 3ZN0B 3GZSA 3WXXA 4NUUA 4U0UA 2VTBB 3AS8A 2RP4A 3LXUX 4EZKA 1EDUA 2PFVA 3CVRA 3UUMA 4KVMA 5J08A 3BK9A 5CB4E 3FH5A 5LCWC 4FHKA 3QAQA 1H7CA 2KWIB 3KEZA 2I6HA 4UVAB 4HEAA 4BTBA 3ZJ1A 5FXXA 3IBPA 4APFA 4CDRA 2W0GA 2NTYA 3N2GE 4ILGA 2VB6A 4BA9A 3FTUA 5M4YA 5JREA 2OVFA 3CVWA 3AA1B 4GYWA 5A7DB 3EIQC 3SBSA 3ONKA 3FU5A 2YNQA 3OXLA 2JJ9A 4GZCA 3B13A 4ISSA 3CK9A 3TJPA 5L3EB 4IE0A 4TV8E 3ZYKA 2CHXA 3LVRE 1E8XA 3PU3A 4PAGA 3I3NA 2ZM0A 5BMVE 2OV8A 2V26A 3JUIA 4UQYA 5AYWD 4L0RA 3FB2A 3RYIE 2KC7A 4KYOB 2VGXA 3DPDA 4AXHA 3HHMA 4YJ3E 3FUFA 2WB2A 3ASHA 1PY1A 3TL5A 1FVHA 1JWFA 3GN5B 5LNKA 3C4ZA 4PFOA 2PJQA 2X68A 2YU1A 3MZKB 2I9CA 4HLEA 1U4QA 2E2EA 5HAXA 4KZCA 2PZIA 4L23A 4AV7A 1BR1A 3MJWA 2WSSV 3FBLA 3NZUA 5BT1A 1INZA 4NACA 4GB9A 3HKDE 4WWPA 1Z6TA 1O3XA 2Q7FA 2VYIA 5G05J 2Y48B 1GW6A 5KJMA 3ZGQA 2HYZA 4QXBB 4PS3A 4PJLA 2BVLA 2CXFA 3CKDA 4OYKA 5JDMA 5LA6E 2NTXA 3TGOA 3FEXA 4FP7A 4N2QA 5FNVE 3CQGB 3N9PA 3I1AA 1AJ3A 3TG5A 5JQGE 3AVSA 2XASB 2ZLYA 1IQUA 3CKCA 3I0QA 2LHNA 3Q9DA 3RC3A 4APOA 4AKRB 2LOPA 5L3BB 2QGSA 4EYUA 4JA7A 2IC9A 5G04C 3TKLB 1D0ZA 5FZRA 2K24A 5ARFA 2VJ8A 2XPYA 2Q9QD 4TZ4C 3HVEB 4HOUA 2X0LB 3H37A 3PE3A 1ZU2A 4ZI2D 3ZN1B 3AS4A 4EZHA 3I9WA 3CVYA 3UUNA 4ANUA 3CSTA 3ZMUB 4BAYB 4F1SA 3TXMA 2V0PA 3K3QC 4J2CA 1MQSA 5FZSA 1LRZA 1U3DA 3Q5MA 4GK0E 4NQ0A 4DLQA 4XIFA 2L8KA 1UJKA 5FXVA 3O1HA 1H2VC 3ETVA 1VRBA 3N9LA 1FIOA 3HI2A 3FUKA 3U66A 3PNTB 5JR9B 3GWHA 1Y64B 3G2WA 4JUYA 4IULA 2H7VC 4JEUB 4OYSA 3D0TA 4ACLA 2X9XA 4NUVA 3QK6A 1ZEEA 5LGTB 2OVBA 3FTXA 4EECA 3CX7B 3FUHA 3UX4A 3FDHA 3OXFA 4HXIA 4UVCB 5LX8A 5ARGA 3LBXA 2YK0A 4H9OC 4KP3C 4AP2A 5J90A 4O6FA 2NSZA 4GZ3A 4N39A 1OWMA 3ETUA 3KV5A 3CHSA 4G1TA 4P0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5B A;  1PY1 A;  4GZC A;  1SZA A;  3ZYM A;  2V8S E;  4Q96 A;  3D9I A;  5J08 A;  1JWF A;  3G2S A;  1EYH A;  1JUQ A;  1JPL A;  3D9J A;  1ELK A;  3ONL A;  3D9O A;  3ZYQ A;  4FLB A;  2LO6 A;  3RRU A;  1SZ9 A;  3ZYK A;  4AVX A;  4JXT A;  2L0I A;  2DIW A;  1HG5 A;  3D9M A;  2L0T B;  5LP0 A;  2DCP A;  4GZD A;  1UJK A;  3LDZ A;  1VDY A;  1H0A A;  4FU3 A;  3D9P A;  1DVP A;  1HG2 A;  5CMY A;  5LOZ A;  2QY7 A;  1LF8 A;  1HX8 A;  1HFA A;  3ZYL A;  1UJJ A;  3CLJ A;  3D9K A;  3D9L A;  3D9N A;  4HFG A;  3G2W A;  1INZ A;  1HF8 A;  3ONK A;  2MOW A;  4NAC A;  1XGW A;  2KM4 A;  3G2T A;  1MHQ A;  1EDU A;  2BF0 X;  1JWG A;  3G2U A;  5CMW A;  3G2V A;  4Q94 A; 
#chains in the Genus database with same CATH topology
 1NI1 A;  1W0B A;  3J5P A;  3F57 A;  2XQ9 A;  3ZRH A;  3LVQ E;  5LGU B;  5T4Y A;  4J7W A;  4P1N A;  3A5X A;  2KXP B;  2FEZ A;  2DIW A;  1EF1 C;  3PZ4 A;  1YA0 A;  3AA7 B;  4MLP A;  4O60 A;  2QYW A;  4YSX A;  5KNH D;  2XTL A;  1S35 A;  2AWI A;  3D9K A;  3RIB A;  4G2A A;  3L3P A;  4CT0 A;  3GMI A;  1WAO 1;  4GU5 A;  1J1J A;  2XHE B;  3V2X A;  2YHC A;  2CFZ A;  5EKQ D;  2MRI A;  4YTP A;  5BNW A;  2EHO A;  3ZT5 A;  2UXN B;  3N9M A;  1YD8 G;  2OEV A;  5LG3 A;  3UT5 E;  3EJN A;  5AQV B;  4GPK A;  5LHI B;  3UM0 A;  4D10 C;  1FVF A;  4WNG A;  5C3J A;  3UQ7 A;  4H7X A;  1XMO T;  4UWK A;  5CHE E;  4ABN A;  1DU2 A;  2ODV A;  5DIZ A;  2EIJ E;  1WM5 A;  2J4G A;  1TN7 A;  4DVD A;  2L6B A;  3CK6 A;  3AEG A;  1IBL T;  3QAR A;  1JWG A;  4ZZC A;  2OEW A;  1V54 E;  4KT6 B;  1Z3X A;  3B57 A;  3QKY A;  3SGH A;  4YDW A;  4CZZ B;  5HEG A;  2IQC A;  3R7R A;  3C4W A;  3JQ1 A;  3AEE A;  5G2N A;  3DXM G;  4ZI7 E;  5FIN A;  3UPV A;  4N2S A;  4AY5 A;  1NZN A;  2CM0 A;  2VSY A;  4CI2 B;  4TUU A;  2XQ0 A;  3MKQ A;  3B7S A;  4KMC A;  1OY3 D;  3NZQ A;  4R7L A;  4PK5 A;  1IXV A;  3AAE B;  2AE9 A;  5IWA T;  3D3M A;  4PS7 A;  3EIJ A;  4PK6 A;  1BPO A;  4AQG A;  4UWL A;  2V8S E;  5J2T E;  3FHE A;  1JUQ A;  3ZFW A;  4O4L E;  4OK0 A;  3ZC1 A;  3EVY A;  5KNG A;  4GTR A;  3NRY A;  3MEK A;  5CER B;  2HPJ A;  3CVU A;  5J1G A;  4GPM A;  3UIP C;  2IO2 C;  5ENN A;  4O1O A;  2WDR A;  3TWX A;  1LF8 A;  1OCR E;  2AXU A;  1YCS B;  1MMA A;  4UUC A;  3UM2 A;  2EIN E;  3CX8 B;  1P5Q A;  1IZN B;  4U3C A;  1TJC A;  4HFI A;  4IYP A;  2SPC A;  2GRO B;  2JEK A;  3IV0 A;  2YDQ A;  4QQI A;  2PG8 A;  1JNR A;  2V5D A;  4PK4 A;  4ILC A;  3T8M A;  3VR8 A;  4B8A A;  2CBI A;  3EAB A;  5HWX A;  5AQQ B;  1HCI A;  2D5U A;  2YN6 A;  4HS2 A;  2WWV A;  5EYL A;  3U78 A;  5AQI B;  1N34 T;  3DJB A;  3ML9 A;  5JVD E;  3G2U A;  2W61 A;  2XY8 B;  3PDY A;  3UTK A;  1W3B A;  3SOL A;  4QXC B;  5AQK B;  3IBE A;  4AKL A;  2BED A;  2W67 A;  3LY7 A;  4TRQ A;  3PEU B;  4QFV A;  1G73 A;  1UGO A;  3UFG A;  3VU7 H;  4UI9 J;  4YND A;  1OWA A;  1A5E A;  3CPZ A;  3R6N A;  4DV4 T;  3ZHE B;  3HL6 A;  3I4G A;  5KMG P;  4TUY E;  5FIO A;  1EZ3 A;  2MYS A;  2J4B A;  2V1D B;  4P29 A;  3CVQ A;  4QX7 B;  3NQP A;  1YKE B;  2YDR A;  2W00 A;  5L3C B;  1XGW A;  2XGM A;  4HI9 A;  2N1G A;  1MMG A;  4ERR A;  1E8Z A;  3PVL A;  5BV0 A;  1SZA A;  4XKB A;  3WAK A;  3AS5 A;  3LG7 A;  4XZ4 A;  3OKQ A;  3CEQ A;  3IHY A;  2WXQ A;  4CXX A;  2L9B A;  4X5T A;  2AXD S;  2YU2 A;  2XS1 A;  1FT2 A;  3B7U X;  3SHF A;  3UMV A;  1VCS A;  1KFY A;  3PS6 A;  5HS0 A;  4F6R C;  3RRC A;  2JIW A;  3KSL A;  5EK2 A;  4CDM A;  5JHB A;  3ZYL A;  4A97 A;  2GW1 A;  1A17 A;  4FC8 A;  3C98 B;  2CBJ A;  2PBI A;  3HR0 A;  4OHF A;  1YQ3 A;  3LFM A;  3OJA A;  2QA7 A;  3Q47 B;  1OCZ E;  2FF4 A;  3IEE A;  2C0S A;  4MKT A;  1U5P A;  1YYH A;  2XGS A;  3LYA A;  3JYS A;  5L3F B;  2VKO A;  4JEU A;  4TV3 A;  1T8B A;  4JZY A;  4EHM A;  4IHJ E;  3RF1 A;  2LSG A;  3QB5 A;  3U64 A;  5JDG A;  4FUL A;  3A7M A;  5HXH A;  4PJM A;  1U3C A;  1Z8U A;  2B1E A;  3U3I A;  4E6H A;  1JCQ A;  4PH4 B;  2LSY A;  4DR6 T;  1EPU A;  2LAI A;  4Q96 A;  3L08 A;  4X65 T;  5DJQ C;  3K9I A;  3QOU A;  1E8Y A;  5HRY A;  4MBQ A;  3OTN A;  2CE7 A;  4LFC T;  2I2O A;  5H6R B;  2NYJ A;  4YDY A;  5AQF B;  2DWK A;  2WCA A;  2ZIS A;  3E0Z A;  3ZMZ B;  2W66 A;  3PUQ A;  3R9M A;  3E08 A;  4AIU A;  4UEM A;  4HE8 A;  3MXZ A;  3SZ7 A;  2PQN A;  2X0Y A;  2LM2 A;  1BI7 B;  1RW2 A;  1N4S A;  3GN5 A;  3E30 A;  4X1K E;  5AQ7 A;  3GZ1 A;  3L54 A;  5E75 A;  4YY3 T;  1OED C;  4YVO A;  4DJA A;  5AIJ A;  2WQ7 A;  2X51 A;  2BG9 A;  4FJZ A;  2NW7 A;  4TN7 B;  4H7Y A;  4GCN A;  3B5M A;  3OXG A;  4EAH A;  3OTO T;  4LNB A;  4DV6 T;  3NBX X;  2KZ7 B;  2R17 C;  3LS8 A;  5CED B;  3H3M A;  3O9X A;  5KDM C;  3VTX A;  3A8Y C;  2MBG A;  1H2U A;  2M67 A;  5ITZ F;  5IUX A;  4FLH A;  4EED A;  1D1A A;  1SA0 E;  3ONL A;  3TXN A;  4CN4 A;  3ZMV B;  4ZI3 D;  2LUH A;  3TLU A;  4BTA A;  2KSR A;  4GA0 A;  3TWR A;  1HE8 A;  5HCM A;  3L82 A;  2PNN A;  1WY6 A;  4ZI3 C;  3RQU A;  2E9X D;  3O1J A;  1LKX A;  2B6C A;  3U9W A;  3JC6 D;  4EZJ A;  3K3O A;  1HF8 A;  5LXT E;  4XI9 A;  5ANR A;  4ATZ D;  3FUI A;  4AIS A;  4PFP A;  4JLE A;  4CQI A;  4X66 T;  2KAT A;  5D2M C;  1J5W A;  2FO7 A;  2K9A A;  3OVU A;  1YMP A;  4I9E A;  4ANX A;  3P2B A;  3V5S A;  3AU5 A;  3LY9 A;  4X20 E;  1US7 B;  3Q5W A;  2DCP A;  4U7E B;  2NW9 A;  4XAX B;  2LSI A;  5L3D B;  4FJY A;  1O5M A;  1ZHC A;  4KX6 A;  4UV9 B;  4J8Y A;  1HX8 A;  5CGM A;  5ENT D;  4NIK A;  2LRL A;  5LFA A;  2D0U A;  4EEB A;  5T8I A;  4ACK A;  4C91 A;  3VRB A;  3PUX F;  5JRC B;  4I1O B;  2X67 A;  4IDP A;  3APD A;  4MRU A;  5BW8 C;  4H9S E;  4IRU A;  1N4Q A;  4AM9 A;  3QWW A;  3KAE A;  1WG0 A;  2C5K T;  3BQO A;  1X79 A;  2YIN A;  3SF4 A;  5BUZ A;  1NA3 A;  3MV2 B;  4F6R D;  5J2U E;  3ZPO A;  3ZCJ A;  4YTM A;  3FUJ A;  4LF8 T;  5HXS A;  3U4T A;  3WI3 A;  2XQY A;  3ABM E;  2Y3A A;  3IF8 B;  3P4S A;  3KV6 A;  1CUN A;  5C2T A;  1QSD A;  1S63 A;  2F8Y A;  1OED A;  3Q79 A;  3QWP A;  2A72 A;  1T72 A;  3P7I A;  2H89 A;  5AQU B;  3HXF A;  4M1P A;  3ONX A;  1MIW A;  3RQW A;  4QX8 B;  4KXK B;  3L8R A;  3Q7A A;  4DV1 T;  4IDZ A;  3ZIM A;  2PQR A;  3FHN A;  2CRB A;  3LPZ A;  2L6J A;  4OX9 T;  1KLX A;  3NBN B;  2HH7 A;  4K5C A;  5A6C A;  2CCQ A;  1BR2 A;  2JLB A;  3HXD A;  2X0H A;  5EZY E;  4BEP A;  4G2V A;  2XQ7 A;  5EX0 A;  4GZ5 A;  2UUA T;  5E0O A;  2VQE T;  3LJC A;  2CHZ A;  4U7Y A;  1YKH B;  4UWF A;  1HG5 A;  1E1H B;  5LP6 E;  2DCF A;  4QKN A;  3ZT6 A;  4IE6 A;  3FUL A;  1E8W A;  3JUE A;  4XKC A;  2B76 A;  3J5Q B;  2LXM A;  2W2U A;  5FY7 A;  5AJD A;  3PUS A;  2J4D A;  3FH8 A;  1MZC A;  3L13 A;  1ZP0 A;  4Y6W A;  2WM9 A;  3HDX A;  2UY1 B;  1MMN A;  3ZT7 A;  4U04 A;  1KF6 A;  3ZXS A;  4YDO A;  2WQH A;  1XNF A;  2WXN A;  3T1H T;  5LB7 B;  4M7C A;  2CXL A;  2KCK A;  3MV3 B;  2FJB A;  2IU1 A;  3B7B A;  2VAS A;  3AG4 E;  5AFU L;  3ASN E;  2V6X A;  4TXQ A;  4ZZB A;  4AEZ C;  4WZX A;  5CBO A;  3RYF E;  3KBU A;  3AEA A;  3CHO A;  5KJN A;  5FKY A;  4ZXL A;  3FUE A;  2QVA A;  2DWG A;  4QXH B;  1HTJ F;  2IUB A;  2PM6 A;  3T8K A;  1IBK T;  4HOS A;  3AEC A;  1S70 B;  2VKD A;  3APC A;  3OAW A;  2XM2 A;  4M3O A;  5AQT B;  3CV0 A;  2VWA A;  4BX9 A;  5IY5 E;  2LAH A;  1VOM A;  3M3Z B;  2GRM A;  4TXP A;  4ZHB A;  5LYJ E;  2P9L G;  3PH0 C;  3EHQ A;  2L9Q A;  5AQN B;  3AE5 A;  3PRZ A;  4BES A;  4EB6 E;  3JC6 C;  3EI0 A;  1FMV A;  3C51 A;  2UY1 A;  3Q15 A;  2BKK B;  1S0P A;  2BKN A;  4CDN A;  4B0Z A;  3P1U A;  3UKR G;  4ADZ A;  4KVO A;  4JA9 A;  3ONJ A;  2Z6E A;  3AJI A;  4ME2 A;  4JI0 T;  2BBH A;  1DC2 A;  2AXV A;  1PC2 A;  1E7P A;  4CXW A;  3ZXP A;  1UX5 A;  1KEY A;  4ANJ A;  3TAX A;  1X9B A;  2FUL A;  3PEV B;  2XEN A;  4HFE A;  3Q5D A;  2CHW A;  3CR3 A;  5ADX L;  1HS7 A;  5CCM A;  1QLB A;  2ZGG A;  1DCQ A;  3RHW A;  4ZI2 C;  3P4P A;  1D0Y A;  4N5C A;  1N9A A;  3NKZ A;  3JXJ A;  4UVB B;  4UR9 A;  4GA2 A;  2KBX A;  3S7D A;  1SVX A;  3AE4 A;  4U72 A;  2WXO A;  1N32 T;  4OYJ A;  3FXD B;  2VL8 A;  2YHE A;  3HKC E;  4CGW A;  4AKG A;  3KSQ A;  2ZXW E;  3EHZ A;  3X1D A;  3ML8 A;  4U7I A;  1LD7 A;  1V9D A;  5H7P A;  1QZ2 A;  1Z3Y A;  4O2B E;  2IAK A;  3ZYM A;  3DST A;  4YHH T;  1ELK A;  3B7T A;  3FTZ A;  3EDT B;  3O1I A;  2DZN A;  2BDE A;  4AVX A;  1IJ5 A;  3MAC A;  2ETC A;  2C5I T;  3PUZ F;  3EUH A;  2XS8 A;  1I94 T;  2VGY A;  5FVK A;  3ZHE A;  2EQX A;  3BU8 A;  5LOZ A;  3JAE A;  2P9I G;  4E7S A;  3QDN A;  1WR0 A;  3ZEF A;  2PM7 A;  3CHQ A;  1FCH A;  4XZC A;  3T5X A;  3MKQ B;  4H9N C;  2BF0 X;  4UI9 K;  2XAQ B;  4BFR A;  2D9D A;  4NIQ A;  4FA6 A;  4EYY R;  4P09 A;  2IDO B;  4LMJ A;  3RRW A;  2R5S A;  3EHM A;  4XBF B;  1OT8 A;  1WYB A;  1W9R A;  2WXR A;  3VRA A;  4ZOL E;  5C8Y E;  3C3R A;  2X38 A;  4DI4 A;  3VLD A;  4K0U A;  2AVP A;  3LDZ A;  1E96 B;  2E8I A;  2NP9 A;  4DI3 A;  3WAJ A;  3FTS A;  5CMY A;  3C50 A;  3SS1 A;  3PV0 F;  3KFW X;  2KZT A;  2X6F A;  2DLR A;  1OWO A;  1UN8 A;  2ION A;  1IAP A;  4AI6 A;  2IML A;  2NOX A;  3AE1 A;  2KM4 A;  3CVP A;  5FQ4 A;  3SQV A;  4G11 A;  3IA3 A;  2J8S D;  2E0I A;  2JQK A;  2LKG A;  3MCX A;  3E34 A;  4WW0 A;  2VVN A;  4QWN B;  2GRL A;  2WXJ A;  1IYG A;  4GMR A;  3D9H A;  4BY6 A;  2GRP B;  3NOC D;  2CXD A;  2DL1 A;  5EK3 A;  3I9Y A;  2A5U A;  3MA9 A;  3RIU C;  5D66 A;  4TX5 A;  1TJF A;  2DHR A;  2WMN A;  1SHZ C;  3C4X A;  2WXI A;  1N36 T;  3C98 A;  1WRD A;  2LM9 A;  3R7Q A;  4PNI A;  4J8S A;  3I4R B;  4FI5 A;  3RRM B;  2R6G F;  2CEA A;  1WLX A;  4YXD A;  4G26 A;  3PE4 A;  2DBA A;  4JI6 T;  4CEM A;  4OFZ A;  3QNU A;  4CXY A;  5JDQ A;  1N11 A;  1QYM A;  2XQ5 A;  2K5B B;  3CSF A;  4AOF A;  3ZMT B;  2IFU A;  2XSA A;  5KJK A;  1Z5S C;  2QZA A;  4DR2 T;  4YDE A;  1VCT A;  2FJD A;  3PNL B;  1KT0 A;  1UJJ A;  2P58 C;  2P9P G;  2L3L A;  3L16 A;  5C1D A;  1ELW A;  1IHG A;  2ZGD A;  1AP7 A;  3LY8 A;  2J08 A;  4DX5 D;  3N9N A;  4V1A v;  4ZS3 A;  4K5A B;  3FZF B;  5L4H A;  3P50 A;  4PDX A;  2A4Z A;  4AXP A;  3SFD A;  3JCF A;  2LE8 A;  3URZ A;  4OAV B;  2I1K A;  2WXM A;  2X9Y A;  4MFR A;  5HXE A;  3UIO C;  3JAF A;  4EZL A;  1KNZ A;  4HRN A;  1W09 A;  4ILB A;  3D9N A;  3PUW F;  5TAO A;  2R02 A;  2ZM6 T;  3ZMS B;  4RSY A;  3UU3 A;  3KVB A;  4DX6 D;  5HYA A;  3G2V A;  5KCM A;  2LSV A;  5CA0 E;  4WWO A;  1SQM A;  5HEH A;  5FQ7 A;  3DTO A;  3G2S A;  4LFA T;  3AG3 E;  2J1D G;  4IL4 A;  5EK4 A;  3APF A;  4I6E A;  5ENQ D;  2X3M A;  3SY2 A;  2BG9 E;  2XHE A;  3PUG A;  4DX7 D;  2KLQ A;  3Q5X A;  2CG2 A;  1O1S A;  3PZ2 A;  5ABF B;  1VDY A;  3DWL G;  4HWI B;  3UT7 A;  1D8E A;  4H9P C;  1HNZ T;  2UUB T;  4B89 A;  2E9X C;  4BX8 A;  2XAF B;  2IO3 C;  1YW0 A;  3F31 A;  4LSZ E;  4WAF A;  1MIV A;  4BSZ B;  4EBA G;  2N2N A;  5GON E;  3UUX B;  2M6B A;  2KND A;  2RD0 A;  4GYS A;  3HYM B;  3CK8 A;  4DR1 T;  4B8C B;  3I0O A;  4GKK T;  4IDN A;  3ZVV A;  3Q7F A;  2UXX B;  2XAH B;  3KV9 A;  3P4Q A;  3JCK C;  2I59 A;  3PZ1 A;  1LD8 A;  5F5W A;  3ZSS A;  3L09 A;  2R03 A;  5FJY A;  3ZJ2 A;  5LHG B;  1RZ4 A;  5FXZ A;  2OV9 A;  2WDV A;  4O2A E;  4UQX A;  3EHR A;  2A5E A;  3RU0 A;  3AE3 A;  3AVR A;  2E5V A;  3LK2 B;  5JDH A;  3BG1 B;  4JHJ A;  4CRW A;  1Y01 A;  3T9K A;  2A9U A;  4A98 A;  1PAQ A;  1NP7 A;  4BER A;  2MPK A;  4I6G A;  4LCT A;  4LEU A;  3RX6 A;  5JJT A;  4FLB A;  4OVU A;  4UWG A;  2NW8 A;  1OCO E;  5JR9 A;  3DSV A;  3D9M A;  5LGN B;  2BKG A;  4BJN A;  1KT1 A;  3AU4 A;  1HO8 A;  3QWV A;  3ULY A;  5JJ7 A;  3IHV A;  5HEJ A;  4DPR A;  4YTN A;  4H63 H;  4CGV A;  1WCR A;  4GYR A;  5LCY A;  1MX6 A;  3S7F A;  3V2O A;  4J6I A;  2N9D A;  1FPP A;  2WXP A;  3ZNG A;  4G8K A;  4JV5 T;  4GCO A;  2KMF A;  3LSV A;  4ILI A;  4J8E A;  1N95 A;  2XEE A;  3RRU A;  3ZST A;  4ILH B;  4QH1 A;  2Q9Q A;  5HXR A;  2BKO A;  2D2S A;  4GIW A;  4GTS A;  4LRZ A;  4OVV A;  5CJ5 A;  2LRK A;  4C0M A;  1ZB1 A;  4LER A;  3ABL E;  3QB2 A;  4IN3 B;  2V7K A;  5AEN A;  3T8O A;  2WXL A;  1OXZ A;  5FZQ A;  4AY6 A;  1NEK A;  4Q94 A;  4TWH A;  3O4Z A;  2WBL A;  2OCC E;  1UOH A;  3AAA C;  3LK4 2;  1OXJ A;  5DBK A;  4LML A;  3ZC0 A;  4N78 D;  4BT9 A;  1ZKE A;  2CFU A;  3VTY A;  2ES0 A;  5LP0 A;  3RH3 A;  5KXJ A;  1D9S A;  3UU4 A;  5J0Z A;  2CA5 A;  3JQ0 A;  1HG2 A;  4JL0 A;  2XAJ B;  5ABH A;  2Y1L E;  5JRC A;  4L1B A;  2J09 A;  4G24 A;  1NA0 A;  3FU6 A;  4GZ6 A;  4HQD A;  1TEZ A;  2BKP A;  3NZS A;  2OLT A;  3AE8 A;  3MYV A;  4U07 A;  3V31 A;  1AWC B;  2G0U A;  4MHC A;  5EIB E;  3BEE A;  4CN6 A;  2VK9 A;  5CA1 E;  3N5L A;  2MAW A;  2P9N G;  2XUE A;  4UWH A;  5FQ8 A;  5FTP A;  3W15 B;  4YFS A;  4RG6 A;  3ZUV B;  3ASD A;  1DVP A;  3Q49 B;  3CIR A;  4DX1 A;  5KX5 E;  2WB5 A;  3CLJ A;  4UEL A;  3ZKR A;  2X6H A;  3PTR B;  2WVI A;  3E4B A;  3SRZ A;  4Z90 A;  2WWU A;  4X1Y E;  2RA1 A;  2IJG X;  1XNQ T;  3FP3 A;  5A1L A;  1MX4 A;  4PJJ A;  2V5C A;  4HOR A;  3DXK G;  2H7O A;  3CK7 A;  2WU5 A;  4ANW A;  4BET A;  2WPV A;  4B3T T;  1FEW A;  1XMQ T;  2VKJ A;  2AW6 A;  1BR4 A;  3AAA B;  5DQW A;  4A3T A;  2XGO A;  4HWF A;  3FH7 A;  3D9L A;  4JW1 A;  3HKB E;  4URK A;  1HXI A;  4C0E A;  3TLW A;  3PZ3 A;  2XQ6 A;  5EID A;  4GOU A;  3TLV A;  4HOQ A;  4KMO A;  3ASO E;  4HVB A;  2V4H C;  4UXN B;  2QFC A;  1H6O A;  3UXG A;  3FUM A;  1D1B A;  3ABV A;  2ODU A;  2CWO A;  5ABF A;  1NAF A;  1FMW A;  4WNF A;  1B7T A;  1MX2 A;  1MMD A;  2C0M A;  4L9P A;  4ZS2 A;  1XZY A;  3RYH E;  3RAU A;  3KIN B;  3ONL C;  4LF4 T;  2F4V T;  2MOZ A;  3MGB A;  4MAL A;  4WNE A;  2OA5 A;  4N3B A;  2W63 A;  4IL9 A;  3D9J A;  5G04 J;  3I5P A;  5DAB A;  1UN9 A;  5L2L A;  3N2K E;  3FU0 A;  1BR0 A;  5FY0 A;  2FJA A;  3VKG A;  4HI8 A;  2BS3 A;  4A1G A;  2V4L A;  2IOL A;  1QBQ A;  1OCC E;  3IEG A;  3EHN A;  1U2V G;  2XPI A;  3RPU A;  3HKE E;  1WYC A;  3BQK A;  3G2T A;  4H9Q C;  3NAW A;  2K3W A;  2WXH A;  2A3D A;  3ISM C;  3UQ3 A;  3C72 A;  3F6Q A;  4DV7 T;  5AQO B;  1BD8 A;  3PZD A;  1QNF A;  2X66 A;  3Q73 A;  4XI0 A;  1T7S A;  1XWM A;  2DNX A;  2WZH A;  2V7M A;  4IE4 A;  3RK6 A;  4LUN U;  1UW4 B;  5M72 A;  2CMR A;  3Q5E A;  3RRN B;  4I2W A;  5FT9 A;  1Y6I A;  3SFY A;  1HX1 B;  3OYZ A;  4HRL A;  5C2Y A;  1MJ0 A;  4I50 E;  4HWC A;  2KCV A;  3VHL A;  3GA8 A;  3MX3 A;  1FJG T;  4X64 T;  2V7J A;  3L39 A;  4MS6 A;  3E33 A;  4HKA A;  2WQY A;  2IF4 A;  4U63 A;  2F8X K;  2B0O E;  4DR7 T;  3V30 A;  4EGW A;  3PUV F;  1DNP A;  4JI2 T;  4GTM A;  3FWV A;  2VTB A;  4GYO A;  3QC9 A;  4HFD A;  4IRE A;  4KZ0 A;  2CLY B;  2C5J A;  5FMN A;  1MND A;  5LOV E;  3DEO A;  4AKH A;  2KT9 A;  1R8I A;  1KZP A;  1Z0P A;  5LCW J;  5AQH B;  3AAI A;  5LHH B;  3ABK E;  1SUM B;  4WBO A;  2A2F X;  3TWV A;  3AA0 B;  4I17 A;  3D9I A;  1N52 A;  3KVA A;  5JTG A;  2NWB A;  3KEA A;  5E76 A;  2WAU A;  3UFE A;  2ILR A;  3MKD A;  4DUZ T;  3LCA A;  2XZD G;  3PUA A;  3AED A;  2BUG A;  3AG1 E;  1H0A A;  2VL0 A;  1Y8M A;  3UUL A;  5HWY A;  2LEH A;  3NWI A;  4IE7 A;  4NRH B;  2XQ8 A;  4EPZ A;  3O48 A;  4H63 V;  3FZM B;  1ZBP A;  5AQA A;  2KZT B;  2XCC A;  3QNK A;  3AA6 B;  4JPS A;  4PUC A;  1HU3 A;  4O4I E;  3QB5 K;  3E22 E;  3W9G A;  5KBA A;  3LKU A;  3AE7 A;  4CI3 B;  5ENR D;  5AQJ B;  5H6Q B;  5AJL A;  3NRX A;  3VLF A;  2LSU A;  5BV1 A;  2BTD A;  3J7Y q;  2WU2 A;  4HGA A;  4CZ2 D;  2FI7 A;  4AQY T;  3RJV A;  5FYM A;  3H3A A;  3ZLI A;  2RFA A;  3FUD A;  3RLF F;  3ZU7 B;  2ZMA A;  3RIF A;  1SA5 A;  1O1T A;  4DV0 T;  1UCU A;  2D0T A;  3L17 A;  3BG0 B;  3FZH B;  2L0I A;  2H3R A;  3ESL A;  2VSO E;  3CVN A;  4CCA A;  2QYU A;  4DBQ A;  2LSJ A;  5HQ8 A;  4I1A A;  3LBX B;  2R59 A;  3SO8 A;  3F2E A;  2LT3 A;  3QOF A;  1D1C A;  2CG3 A;  4W9R A;  4JI5 T;  4FAD A;  5ENO D;  3EDV A;  2WXG A;  2IW5 B;  2LXL A;  4LMK A;  4EV6 A;  1TNO A;  1UX4 A;  1JPL A;  1TNY A;  4ANV A;  3ULQ A;  2NXP A;  2Y69 E;  4G23 A;  3CQC B;  4L2L A;  4KBM B;  4YLH A;  4P0B A;  3D9P A;  3MA5 A;  2HPL A;  4DMV A;  2JQQ A;  3RKG A;  4ZEY A;  1YXR A;  1SA4 A;  4C90 A;  5JH7 E;  3B95 A;  4G63 A;  2MOW A;  5G05 C;  5IHY A;  4LFB T;  4F7A A;  2V7L A;  2DWZ A;  1OWN A;  2VQF T;  3N71 A;  3Q78 A;  4N3A A;  5JMN D;  4UF0 A;  2XCB A;  4J0U A;  2XQA A;  3O4X E;  3ZYQ A;  4I6J A;  2LSK A;  1SZ9 A;  4CI1 B;  1K8K G;  3AE9 A;  3BQI A;  4HOT A;  4U2Z A;  4YVQ C;  2OND A;  4L7T A;  3HVE A;  2X9H A;  3BQL A;  2R2L A;  1G3N B;  3MK7 C;  2UWJ G;  4L5G A;  4ILU A;  2UXC T;  2J9Q A;  2EHO B;  4F8H A;  1E90 A;  2IOS A;  2RFM A;  4DK5 A;  2LHR A;  2E9X B;  4RG9 A;  4U8Y D;  3Q9U C;  3RO3 A;  2AJA A;  1QUU A;  2XZE A;  4EIW A;  3DRA A;  4U8H A;  3SD5 A;  4GA1 A;  4N3C A;  5AQG B;  2ETA A;  3FTY A;  4EQF A;  5LMN T;  3CHM A;  1JCR A;  2LJL A;  2V8S V;  2HR2 A;  1T98 A;  5EX3 A;  1HNW T;  2E9X A;  4B3M T;  2QY7 A;  3CML A;  2I0M A;  3FUN A;  3M65 A;  1MHQ A;  2P9K G;  5JHA A;  4GK5 E;  1IQR A;  1WFD A;  2LKH A;  4GTV A;  4XX5 A;  3LJN A;  2VGX B;  4DUI A;  4HWD A;  3OPC A;  2RG8 A;  3AXJ A;  2HN2 A;  5FVL A;  4YJ2 E;  3HRA A;  4I43 B;  3CVL A;  4BT8 A;  2UU9 T;  3RC8 A;  1B89 A;  3QUJ A;  3J9X 1;  3CIA A;  2M6I A;  4HLL A;  2KIN B;  5ENS D;  2VKH A;  3ZPJ A;  4U31 A;  1HH8 A;  1TNB A;  3FEY A;  3DBS A;  3NZP A;  4DR5 T;  4O4H E;  4JEH A;  5EDS A;  1LVF A;  4A1S A;  4DUY T;  3K1S A;  5HCJ A;  3GW4 A;  4BWR A;  1H6P A;  3L22 A;  3C5R A;  4OAU C;  3RYC E;  2OOE A;  2QRX A;  4PJN A;  2WMO A;  2WP9 A;  5ETW A;  3EU5 A;  3CGH A;  4JC8 A;  4AJW A;  5JA4 D;  5FP3 A;  3ASF A;  2ZIR A;  4GYY A;  5FL1 A;  1QQE A;  3RKO A;  5FWQ A;  5AQB A;  2BZB A;  2GK9 A;  5LBM A;  3KDS E;  3V5U A;  1L5J A;  4KHP T;  5HKP A;  4GTP A;  4EXT A;  4Y6C A;  2K48 A;  3ZEF B;  2V6Y B;  4JEH B;  4IDQ A;  4JD2 G;  1I6Z A;  1K3Z D;  2Y6X A;  4PW8 A;  2C2L A;  3Q9N C;  2L0T B;  4Z68 A;  3SFX A;  4PS8 A;  2GRR B;  1UG3 A;  4TXR A;  2PTF A;  4TV9 E;  2WY2 A;  1L0V A;  1ZOY A;  3UTM A;  5CRV A;  4XE0 A;  4HRM B;  5LJM A;  1HZ4 A;  3SWH A;  4YSZ A;  2LO6 A;  3NF1 A;  2I1J A;  5CBN A;  3R84 B;  1HS6 A;  2P9U G;  4TUM A;  4BSX A;  2JPF A;  4ASK A;  3VLE A;  2R05 A;  2XRY A;  4DX2 A;  5DQV A;  4HFV A;  3RSE G;  5D0O D;  5B3S E;  3MZL B;  5F3J A;  1E7U A;  2CHO A;  4LG6 A;  4JVS A;  5L3G B;  2FBN A;  3S7B A;  3LDQ B;  4ATG A;  4HFG A;  4B3S T;  1MIY A;  2BG9 C;  3SBT B;  2E5L T;  2F0Y A;  3DSW A;  2H6I A;  3FU3 A;  1IBM T;  4TWD A;  3DEP A;  4WBN E;  2H6G A;  3NB2 A;  3KS2 A;  3PUK A;  2ZU6 B;  1WR6 A;  3DSU A;  3FZK B;  1WDY A;  4QH4 A;  2ZM2 A;  3S7J A;  3PRE A;  2E2A A;  3U3W A;  5LBQ B;  4U2Y A;  4K5B A;  3UUX A;  3ZN3 A;  2WQ6 A;  2ACX A;  3RGL A;  4DR4 T;  2JMK A;  2MTQ A;  3AG2 E;  3WG7 E;  1BLX B;  3AB3 B;  2BVM A;  2W4X A;  5AQM B;  3N9O A;  4FJO A;  3DP7 A;  1NWM X;  3PDN A;  4MLK A;  1XNR T;  3ASG A;  4N5Q A;  2HO1 A;  2BG9 B;  1FT1 A;  3L9T A;  4JB8 P;  5CMW A;  3LJ3 A;  4O4J E;  2GGF A;  2XM1 A;  3TG4 A;  4UF0 B;  1G8X A;  3FTW A;  2XAG B;  3B7R L;  2XPK A;  2HN1 A;  2IEJ A;  2YQ8 A;  2XPZ A;  3FZL B;  2WXK A;  4A3V A;  2HHH T;  3HG0 D;  3QJZ A;  3S2A A;  4JXT A;  3E37 A;  2VSN A;  2F37 A;  4K0R A;  1OUV A;  4YHJ A;  4GML A;  3T5V A;  4JHK A;  3QC1 A;  4WND A;  3UU8 A;  5AQS B;  3KBT A;  4EZ4 A;  2J49 A;  3CKB A;  4F3V A;  5FY1 A;  2WDQ A;  2LOS A;  4JI4 T;  4L2Y A;  4L9I A;  2KWH A;  4X1I E;  2HM8 A;  2NC9 A;  3K8P C;  4NPP A;  5HXC A;  3SNX A;  1N54 A;  4B93 B;  4H9R C;  4AIF A;  4RLY A;  2Y8D A;  5LJN A;  3C64 A;  4GTQ A;  4F1P A;  1M62 A;  1LVK A;  4U8V D;  1D0X A;  2WXF A;  3KV4 A;  1TYQ G;  4A55 A;  1KPS B;  3PJA A;  1X81 A;  2JMH A;  4DO0 A;  3TWQ A;  1M7K A;  3RIU A;  5IYZ E;  2XQ3 A;  4J8F A;  5ENP D;  1KNP A;  5JDF A;  3EUV A;  1SE7 A;  4RVB A;  3AE6 A;  5D0Q D;  4ZHQ E;  3LK3 B;  3UU5 A;  1E7V A;  4C48 B;  3GYZ A;  3UI2 A;  2MHK A;  4GAA A;  2Y4T A;  5HI7 A;  1IJ6 A;  2M63 A;  3ESK A;  2H6F A;  3JAD A;  4JHR A;  1S94 A;  3R9A B;  2WS3 A;  3FY4 A;  3AEF A;  4IST A;  4K0K T;  2P9B A;  3CQX C;  2IHR 1;  4U74 A;  5A23 A;  3UKU G;  1JNZ A;  2CWY A;  4DBR A;  4J8D A;  4TNV A;  4UI9 C;  3NVO A;  2V5Q C;  4HNA D;  3CVV A;  5JR9 C;  4DMW A;  2Q9Q C;  3HA4 A;  1KK7 A;  3ZCI A;  1ZV4 X;  3CWZ B;  1GQE A;  3D9O A;  1LTX A;  5B1B E;  1OWL A;  2VVS A;  1XDP A;  4UQZ A;  4GMJ A;  1O1R A;  5AN8 A;  3OBV E;  4UIG A;  3IXE A;  4GTO A;  4Q69 A;  1OED E;  2V5F A;  3P8C D;  4IIJ E;  3VKH A;  2XJ7 A;  3PE0 A;  3Q2M A;  4HTE A;  5BPP A;  4I55 E;  4Z8X A;  2X6K A;  4WUY A;  5BR8 T;  3ULE G;  4HB5 A;  4QHO A;  3ANW B;  4EOZ B;  2CHN A;  4EBA A;  4WNK A;  3QK0 A;  3RO2 A;  3CVX A;  4I0U A;  4AQF C;  4CN1 A;  2J47 A;  2EIK E;  2JQ9 A;  1ELR A;  4C9B B;  3PU8 A;  2XRZ A;  3ZW3 A;  5EYP F;  2EHO D;  3S4U A;  2VQ2 A;  2XEH A;  4JI7 T;  5AAO A;  5F8P A;  2DVW A;  3PUJ A;  4F53 A;  3OYX A;  2DI4 A;  3ZKJ A;  1HFA A;  4AKI A;  5JDN A;  3FTV A;  4U0Z A;  3TWW A;  4DLO A;  1DCE A;  5T3R A;  1BI8 B;  3C3O A;  4DV3 T;  3LEW A;  2EHO C;  3IHR A;  2H88 A;  5AQL B;  2Y0B G;  5ANL A;  4I2Z A;  2X9W A;  3PUR A;  3DPY A;  4WWN A;  4X62 T;  3FBZ A;  4IE5 A;  3FXE B;  5JDL A;  4FHJ A;  4I43 A;  4E7Z A;  3L6A A;  4BJM A;  2BS4 A;  4B94 A;  4I9C A;  3SFE A;  4DND A;  1H2T C;  2X6I A;  3ENE A;  3GZ2 A;  4LNG A;  3JXI A;  1MNE A;  4U95 D;  5LMU T;  4JYA T;  4YSY A;  2LNI A;  3G06 A;  5G55 A;  3SI5 A;  1H6K A;  1K1B A;  2KCL A;  3ANW A;  3PJA J;  5FQ6 A;  4I1M A;  2X6J A;  1EYH A;  4LF7 T;  4B6X A;  2C0L A;  4U0S A;  2DYR E;  3HXC A;  5B1A E;  4HFB A;  2IC6 A;  3P4W A;  4HN9 A;  5FL0 A;  5LG4 A;  1OED B;  3N2O A;  1W0A A;  3CX6 B;  4E85 A;  4FU3 A;  3DSX A;  4HFH A;  3CHP A;  2Q9Q B;  4CT4 A;  3TLS A;  2Y4U A;  3EDU A;  3MKR A;  3IKO B;  2JRK A;  3AEB A;  4KBQ A;  2W62 A;  3Q4A B;  2ZM8 A;  3UUB A;  1N0Q A;  1NFI E;  4MBG A;  1NL4 A;  3UT8 A;  4DID B;  3CHR A;  3SFZ A;  3MJX A;  3N9Q A;  2V7I A;  4A56 A;  1TN8 A;  4G25 A;  4DV5 T;  2XZT G;  4IGU A;  4AQF A;  5CCL A;  2YEV C;  3UT4 A;  2PL2 A;  3VR9 A;  5KJL A;  1KNR A;  3UM1 A;  3RKV A;  3HIZ A;  4O8S A;  2RPA A;  4NUR A;  4KUM B;  3UU6 A;  2XSB A;  1BU9 A;  4I4T E;  5AQR B;  4A63 B;  5JJ6 A;  4JI1 T;  2XEV A;  4DRX E;  4JI8 T;  2AXZ A;  1X5B A;  2EIM E;  3TLT A;  2VSX E;  1OWP A;  3FFL A;  2GRN B;  4QH5 A;  1NEN A;  4UV8 B;  2CLY C;  3K3N A;  2P2C P;  4V3I A;  3RI5 A;  3DSS A;  5EIL A;  1SW6 A;  3KD7 A;  2J07 A;  4CYM D;  1H19 A;  5FXW A;  4GZD A;  4K03 A;  3ZN0 B;  3GZS A;  3WXX A;  4NUU A;  4U0U A;  2VTB B;  5AQ9 A;  3AS8 A;  2RP4 A;  3LXU X;  4EZK A;  2FO1 E;  4COF A;  1EDU A;  2PFV A;  1E2A A;  5HEO A;  2UXB T;  3CVR A;  1D8D A;  3UUM A;  3AE2 A;  4KVM A;  3T1Y T;  2ETB A;  5CRU A;  5J08 A;  1TN6 A;  3BK9 A;  5CB4 E;  3FH5 A;  5LCW C;  1N94 A;  4FHK A;  3QAQ A;  2KWI B;  1H7C A;  2BBJ A;  5CFB A;  3KEZ A;  2QC9 A;  2I6H A;  4UVA B;  4HEA A;  4G8L A;  4BTB A;  3ZJ1 A;  5FXX A;  3TWU A;  3IBP A;  4APF A;  4CDR A;  2W0G A;  1HNX T;  2NTY A;  3BUA A;  1S64 A;  2ACZ A;  4KHZ F;  3N2G E;  4ILG A;  4TWF A;  2WZI A;  1UUS A;  2VB6 A;  4BA9 A;  1N4P A;  3FTU A;  5BXO A;  2NR4 A;  5M4Y A;  1TNU A;  5JRE A;  3P4R A;  1N33 T;  2CPT A;  2OVF A;  2QYJ A;  3CVW A;  2EIL E;  3AA1 B;  4GYW A;  4XEI G;  5A7D B;  2DYS E;  3EIQ C;  3SBS A;  3ONK A;  4YT0 A;  2YNQ A;  3FU5 A;  3UM3 A;  3OXL A;  2JJ9 A;  4GZC A;  4LF9 T;  3B13 A;  3HXB A;  4ISS A;  1CHU A;  3CK9 A;  3TJP A;  4WYV A;  5L3E B;  4IE0 A;  4TNW A;  4TV8 E;  5ABG A;  1KZO A;  3ZYK A;  1TR4 A;  2CHX A;  3LVR E;  1E8X A;  4ZFH A;  3PU3 A;  1N4R A;  4PAG A;  3I3N A;  3V79 K;  2ZM0 A;  5BMV E;  2OV8 A;  2V26 A;  3JUI A;  4UQY A;  5AYW D;  5AAR A;  4L0R A;  3FB2 A;  3RYI E;  1N0R A;  2KC7 A;  4KYO B;  2VGX A;  3DPD A;  4AXH A;  3PUY F;  1TNZ A;  3HHM A;  4YJ3 E;  4LNU D;  5KWD A;  2V6Y A;  3FUF A;  2WB2 A;  3TWT A;  3ASH A;  1PY1 A;  3TL5 A;  1FVH A;  1JWF A;  3EU9 A;  3GN5 B;  2H6H A;  5LNK A;  4B3R T;  3C4Z A;  4PFO A;  2PJQ A;  2X68 A;  2YU1 A;  3MZK B;  5ABE A;  2I9C A;  4HLE A;  1U4Q A;  5BXU A;  2E2E A;  5HAX A;  4GKJ T;  4KZC A;  2PZI A;  4L23 A;  4AV7 A;  1BR1 A;  3MJW A;  2WSS V;  2YKS A;  3FBL A;  3NZU A;  5BT1 A;  1INZ A;  4NAC A;  4GB9 A;  4U33 A;  3HKD E;  4WWP A;  1Z6T A;  1O3X A;  2Q7F A;  2GRQ B;  5EN5 D;  5CEA A;  2VYI A;  5G05 J;  2MYO A;  2Y48 B;  1GW6 A;  4U96 D;  5KJM A;  2IY0 C;  3ZGQ A;  4Q25 A;  2HYZ A;  4QXB B;  2VGE A;  4PS3 A;  4PJL A;  2BVL A;  2CXF A;  1IKN D;  3CKD A;  4OYK A;  5JDM A;  5LA6 E;  5L47 A;  2NTX A;  1Q2Z A;  3W9F A;  1MYO A;  2VUR A;  3E32 A;  1IHB A;  3C3Q A;  3TGO A;  3FEX A;  4NXM T;  4FP7 A;  4N2Q A;  3Q75 A;  1YQ4 A;  5FNV E;  4IT4 A;  2KXP C;  3CQG B;  3N9P A;  3I1A A;  1AJ3 A;  3TG5 A;  1UK5 A;  5JQG E;  3AVS A;  2XAS B;  2ZLY A;  3EAM A;  4HFC A;  3RIA A;  3TWS A;  4ILA A;  4DV2 T;  1IQU A;  3CKC A;  2RKK A;  3I0Q A;  3HXE A;  4O1P A;  2LHN A;  3Q9D A;  3RC3 A;  2HE0 A;  4APO A;  4LF6 T;  4AKR B;  2LOP A;  5L3B B;  1XDO A;  2QGS A;  5HEU A;  4EYU A;  4JA7 A;  2IC9 A;  5G04 C;  3TKL B;  4KI0 F;  1D0Z A;  2IIU A;  2JAB A;  5FZR A;  2K24 A;  5ARF A;  2VJ8 A;  3UQ4 A;  2XPY A;  4A5X A;  4IDO A;  2XQ4 A;  2Q9Q D;  4TZ4 C;  3HVE B;  4RQI A;  2X0L B;  4HOU A;  3H37 A;  3PE3 A;  1ZU2 A;  4ZI2 D;  2LLY A;  3ZN1 B;  3AS4 A;  2FUP A;  4EZH A;  4JBW F;  3I9W A;  3CVY A;  3UUN A;  4Z91 A;  5L4E A;  2UUC T;  4ANU A;  3CST A;  3ZMU B;  4BAY B;  4F1S A;  3TXM A;  2V0P A;  3K3Q C;  4J2C A;  1MQS A;  5FZS A;  1LRZ A;  1U3D A;  3Q5M A;  4GK0 E;  4NQ0 A;  4DLQ A;  1JCS A;  4XIF A;  2L8K A;  1UJK A;  5FXV A;  4NXN T;  3O1H A;  1H2V C;  3ETV A;  4LF5 T;  1VRB A;  3N9L A;  1FIO A;  3HI2 A;  3FUK A;  3U66 A;  1J5E T;  3PNT B;  4X8Q A;  5JR9 B;  3GWH A;  1Y64 B;  3G2W A;  4JUY A;  4IUL A;  2H7V C;  4JEU B;  5AQP B;  4OYS A;  3D0T A;  4ACL A;  1UUR A;  2P9S G;  2X9X A;  3NOG D;  4NUV A;  4JI3 T;  3QK6 A;  1ZEE A;  2FJE A;  5LGT B;  2OVB A;  3FTX A;  3X2Q E;  4EEC A;  4HBD A;  4DR3 T;  2YDS A;  3CX7 B;  3FUH A;  3UX4 A;  3FDH A;  3OXF A;  4HXI A;  3AXJ B;  4UVC B;  1K1A A;  3UIN C;  5LX8 A;  5ARG A;  3LBX A;  2JQH A;  1HR0 T;  2YK0 A;  2BS2 A;  4GTT A;  5CEC B;  4H9O C;  4KP3 C;  2DZO A;  4AP2 A;  2J62 A;  2FBW A;  4O6F A;  2NSZ A;  5J90 A;  2YOE A;  4GZ3 A;  4N39 A;  1OWM A;  3ETU A;  3KV5 A;  3CHS A;  1V55 E;  4G1T A;  4P0A A;  4HWH A;  2UXD T; 
#chains in the Genus database with same CATH homology
 3F57 A;  3ZRH A;  3LVQ E;  5LGU B;  5T4Y A;  3A5X A;  2KXP B;  2FEZ A;  2DIW A;  1EF1 C;  1YA0 A;  3AA7 B;  4MLP A;  2XTL A;  1S35 A;  2AWI A;  3D9K A;  3RIB A;  4G2A A;  3L3P A;  4CT0 A;  3GMI A;  1WAO 1;  4GU5 A;  2XHE B;  5BNW A;  2YHC A;  2CFZ A;  5EKQ D;  2MRI A;  2EHO A;  2UXN B;  3N9M A;  1YD8 G;  3UT5 E;  3EJN A;  4GPK A;  5LHI B;  4D10 C;  1FVF A;  4WNG A;  4H7X A;  4UWK A;  5CHE E;  4ABN A;  2ODV A;  5DIZ A;  1WM5 A;  4DVD A;  3QAR A;  1JWG A;  4KT6 B;  1Z3X A;  3B57 A;  3QKY A;  3SGH A;  3R7R A;  4CZZ B;  2IQC A;  3C4W A;  3JQ1 A;  4N2S A;  5G2N A;  3UPV A;  4ZI7 E;  4AY5 A;  1NZN A;  2CM0 A;  2VSY A;  4CI2 B;  4TUU A;  2XQ0 A;  3MKQ A;  3B7S A;  4KMC A;  3NZQ A;  4R7L A;  4PK5 A;  3AAE B;  3D3M A;  4PS7 A;  3EIJ A;  4PK6 A;  1BPO A;  4AQG A;  4UWL A;  2V8S E;  5J2T E;  3FHE A;  1JUQ A;  3ZFW A;  4O4L E;  4OK0 A;  3ZC1 A;  3EVY A;  3NRY A;  3MEK A;  2HPJ A;  3CVU A;  5J1G A;  5ENN A;  1LF8 A;  2AXU A;  1MMA A;  3CX8 B;  1P5Q A;  1IZN B;  4IYP A;  1TJC A;  2SPC A;  2JEK A;  3IV0 A;  2PG8 A;  4PK4 A;  3T8M A;  4B8A A;  5HWX A;  1HCI A;  2D5U A;  4HS2 A;  3U78 A;  3DJB A;  3ML9 A;  5JVD E;  3G2U A;  2W61 A;  3PDY A;  3UTK A;  1W3B A;  3SOL A;  4QXC B;  3IBE A;  4AKL A;  3LY7 A;  4TRQ A;  3PEU B;  4QFV A;  1G73 A;  4UI9 J;  3VU7 H;  4YND A;  1OWA A;  3CPZ A;  3R6N A;  3ZHE B;  3HL6 A;  3I4G A;  5KMG P;  4TUY E;  1EZ3 A;  2MYS A;  2J4B A;  2V1D B;  4P29 A;  3CVQ A;  4QX7 B;  3NQP A;  1YKE B;  5L3C B;  2W00 A;  1XGW A;  2XGM A;  2N1G A;  1MMG A;  4ERR A;  1E8Z A;  3PVL A;  5BV0 A;  1SZA A;  4XKB A;  3WAK A;  3AS5 A;  3LG7 A;  4XZ4 A;  3IHY A;  3OKQ A;  3CEQ A;  2WXQ A;  4CXX A;  2L9B A;  2YU2 A;  3B7U X;  3SHF A;  3UMV A;  3PS6 A;  4F6R C;  3RRC A;  4CDM A;  5EK2 A;  5JHB A;  3ZYL A;  2GW1 A;  1A17 A;  4FC8 A;  3C98 B;  2PBI A;  3HR0 A;  4OHF A;  3LFM A;  3OJA A;  2QA7 A;  3Q47 B;  2FF4 A;  3IEE A;  2C0S A;  4MKT A;  1U5P A;  2XGS A;  3LYA A;  3JYS A;  5L3F B;  2VKO A;  4JEU A;  4TV3 A;  4JZY A;  4IHJ E;  2LSG A;  3U64 A;  5JDG A;  4FUL A;  5HXH A;  4PJM A;  1U3C A;  2B1E A;  3U3I A;  4E6H A;  4PH4 B;  2LSY A;  1EPU A;  2LAI A;  4Q96 A;  3L08 A;  5DJQ C;  3K9I A;  3QOU A;  1E8Y A;  4MBQ A;  3OTN A;  2CE7 A;  2I2O A;  5H6R B;  2DWK A;  3E0Z A;  3ZMZ B;  3PUQ A;  3E08 A;  4UEM A;  4HE8 A;  3MXZ A;  3SZ7 A;  2PQN A;  3GN5 A;  4X1K E;  3GZ1 A;  3L54 A;  5E75 A;  4YVO A;  4DJA A;  5AIJ A;  2WQ7 A;  2X51 A;  4FJZ A;  2NW7 A;  4TN7 B;  4H7Y A;  4GCN A;  3OXG A;  4EAH A;  3NBX X;  2KZ7 B;  2R17 C;  3LS8 A;  3O9X A;  5KDM C;  3VTX A;  2MBG A;  1H2U A;  2M67 A;  4FLH A;  1D1A A;  1SA0 E;  3ONL A;  3TXN A;  3ZMV B;  4ZI3 D;  4BTA A;  4GA0 A;  1HE8 A;  1WY6 A;  4ZI3 C;  2E9X D;  3O1J A;  1LKX A;  3U9W A;  3JC6 D;  4EZJ A;  3K3O A;  1HF8 A;  5LXT E;  4XI9 A;  5ANR A;  3FUI A;  4PFP A;  4JLE A;  4CQI A;  2KAT A;  2FO7 A;  2K9A A;  4I9E A;  4ANX A;  3P2B A;  3V5S A;  3AU5 A;  3LY9 A;  4X20 E;  1US7 B;  3Q5W A;  2DCP A;  2NW9 A;  4XAX B;  2LSI A;  5L3D B;  4FJY A;  1ZHC A;  4UV9 B;  1HX8 A;  5LFA A;  2D0U A;  5T8I A;  4ACK A;  4C91 A;  5JRC B;  4I1O B;  2X67 A;  3APD A;  4MRU A;  5BW8 C;  4H9S E;  4IRU A;  4AM9 A;  3QWW A;  3KAE A;  2C5K T;  1X79 A;  2YIN A;  3SF4 A;  5BUZ A;  1NA3 A;  3MV2 B;  5J2U E;  3ZPO A;  3ZCJ A;  3FUJ A;  5HXS A;  3U4T A;  3WI3 A;  2XQY A;  2Y3A A;  3IF8 B;  3KV6 A;  1CUN A;  1QSD A;  3QWP A;  2A72 A;  3P7I A;  4M1P A;  3ONX A;  1MIW A;  4QX8 B;  4KXK B;  4IDZ A;  3ZIM A;  2PQR A;  3FHN A;  3LPZ A;  2L6J A;  1KLX A;  2HH7 A;  5A6C A;  2CCQ A;  1BR2 A;  2JLB A;  5EZY E;  4G2V A;  5EX0 A;  4GZ5 A;  5E0O A;  3LJC A;  2CHZ A;  1YKH B;  4UWF A;  1HG5 A;  1E1H B;  5LP6 E;  2DCF A;  4QKN A;  4IE6 A;  3FUL A;  1E8W A;  4XKC A;  5FY7 A;  5AJD A;  3PUS A;  2J4D A;  3FH8 A;  3L13 A;  4Y6W A;  2WM9 A;  3HDX A;  2UY1 B;  1MMN A;  4U04 A;  3ZXS A;  2WQH A;  1XNF A;  2WXN A;  2CXL A;  2KCK A;  3MV3 B;  2IU1 A;  2VAS A;  5AFU L;  4AEZ C;  3RYF E;  3KBU A;  3CHO A;  5KJN A;  3FUE A;  2DWG A;  4QXH B;  1HTJ F;  2PM6 A;  4HOS A;  2VKD A;  3APC A;  3OAW A;  4M3O A;  3CV0 A;  2VWA A;  4BX9 A;  2LAH A;  1VOM A;  2GRM A;  5LYJ E;  3PH0 C;  2L9Q A;  3PRZ A;  4EB6 E;  3JC6 C;  1FMV A;  3C51 A;  2UY1 A;  3Q15 A;  1S0P A;  4CDN A;  4B0Z A;  3P1U A;  4ADZ A;  4KVO A;  4JA9 A;  2Z6E A;  4ME2 A;  2AXV A;  1PC2 A;  4CXW A;  1UX5 A;  4ANJ A;  3TAX A;  2FUL A;  3PEV B;  2CHW A;  3CR3 A;  5ADX L;  1HS7 A;  5CCM A;  4ZI2 C;  1D0Y A;  4N5C A;  4UVB B;  4GA2 A;  3S7D A;  4U72 A;  2WXO A;  4OYJ A;  3FXD B;  2VL8 A;  2YHE A;  3HKC E;  4CGW A;  4AKG A;  3ML8 A;  1V9D A;  1QZ2 A;  1Z3Y A;  4O2B E;  2IAK A;  3ZYM A;  1ELK A;  3B7T A;  3FTZ A;  3EDT B;  3O1I A;  2BDE A;  4AVX A;  1IJ5 A;  3MAC A;  2C5I T;  3EUH A;  2VGY A;  3ZHE A;  2EQX A;  5LOZ A;  4E7S A;  3QDN A;  3ZEF A;  2PM7 A;  3CHQ A;  1FCH A;  4XZC A;  3T5X A;  3MKQ B;  4H9N C;  2BF0 X;  4UI9 K;  2XAQ B;  4BFR A;  4FA6 A;  4EYY R;  4P09 A;  3RRW A;  2R5S A;  3EHM A;  4XBF B;  1WYB A;  2WXR A;  4ZOL E;  5C8Y E;  2X38 A;  4DI4 A;  3VLD A;  4K0U A;  2AVP A;  3LDZ A;  1E96 B;  2E8I A;  2NP9 A;  4DI3 A;  3WAJ A;  3FTS A;  5CMY A;  3C50 A;  3SS1 A;  3KFW X;  2KZT A;  2X6F A;  2DLR A;  1OWO A;  1UN8 A;  2ION A;  1IAP A;  4AI6 A;  2KM4 A;  2NOX A;  3CVP A;  5FQ4 A;  4G11 A;  2E0I A;  3MCX A;  4WW0 A;  4QWN B;  2GRL A;  2WXJ A;  1IYG A;  4BY6 A;  2CXD A;  5EK3 A;  3I9Y A;  2A5U A;  3MA9 A;  4TX5 A;  1TJF A;  2DHR A;  2WMN A;  1SHZ C;  3C4X A;  2WXI A;  3C98 A;  1WRD A;  2LM9 A;  3R7Q A;  4PNI A;  4J8S A;  3I4R B;  4FI5 A;  3RRM B;  2CEA A;  4G26 A;  1WLX A;  3PE4 A;  2DBA A;  4CEM A;  4OFZ A;  4AOF A;  4CXY A;  5JDQ A;  2K5B B;  3CSF A;  3ZMT B;  2IFU A;  5KJK A;  3PNL B;  1KT0 A;  1UJJ A;  2P58 C;  3L16 A;  2L3L A;  5C1D A;  1ELW A;  1IHG A;  3LY8 A;  2J08 A;  3N9N A;  4V1A v;  4ZS3 A;  4PDX A;  2A4Z A;  4AXP A;  2LE8 A;  3URZ A;  2I1K A;  2WXM A;  2X9Y A;  4MFR A;  5HXE A;  4EZL A;  1KNZ A;  3D9N A;  5TAO A;  3ZMS B;  4RSY A;  3KVB A;  5HYA A;  3G2V A;  5KCM A;  2LSV A;  5CA0 E;  4WWO A;  1SQM A;  5FQ7 A;  3DTO A;  4I6E A;  3G2S A;  3APF A;  2J1D G;  5EK4 A;  2X3M A;  2XHE A;  3PUG A;  2KLQ A;  3Q5X A;  2CG2 A;  1VDY A;  3UT7 A;  4H9P C;  4B89 A;  2E9X C;  4BX8 A;  2XAF B;  1YW0 A;  3F31 A;  4WAF A;  1MIV A;  4EBA G;  2N2N A;  5GON E;  3UUX B;  2RD0 A;  2KND A;  4GYS A;  3HYM B;  3CK8 A;  4B8C B;  3I0O A;  3ZVV A;  2UXX B;  2XAH B;  3KV9 A;  3JCK C;  2I59 A;  3L09 A;  5FJY A;  3ZJ2 A;  5LHG B;  5FXZ A;  4O2A E;  4UQX A;  3RU0 A;  3AVR A;  3LK2 B;  5JDH A;  3BG1 B;  4JHJ A;  4CRW A;  1PAQ A;  1NP7 A;  4I6G A;  4LCT A;  4LEU A;  3RX6 A;  5JJT A;  4FLB A;  4OVU A;  4UWG A;  2NW8 A;  5JR9 A;  3D9M A;  5LGN B;  4BJN A;  1KT1 A;  3AU4 A;  1HO8 A;  3QWV A;  5JJ7 A;  3IHV A;  4DPR A;  4H63 H;  4CGV A;  4GYR A;  5LCY A;  3S7F A;  4J6I A;  2N9D A;  2WXP A;  4GCO A;  2KMF A;  4ILI A;  4J8E A;  3RRU A;  4ILH B;  2Q9Q A;  5HXR A;  2D2S A;  4GIW A;  4LRZ A;  4OVV A;  4C0M A;  4LER A;  3QB2 A;  4IN3 B;  2V7K A;  5AEN A;  3T8O A;  2WXL A;  1OXZ A;  5FZQ A;  4AY6 A;  4Q94 A;  3O4Z A;  2WBL A;  3LK4 2;  5DBK A;  3ZC0 A;  4N78 D;  4BT9 A;  1ZKE A;  2CFU A;  3VTY A;  2ES0 A;  5LP0 A;  3RH3 A;  2CA5 A;  3JQ0 A;  1HG2 A;  4JL0 A;  2XAJ B;  5JRC A;  4L1B A;  2J09 A;  4G24 A;  1NA0 A;  3FU6 A;  4GZ6 A;  1TEZ A;  3NZS A;  3MYV A;  4U07 A;  2G0U A;  4MHC A;  3BEE A;  2VK9 A;  3N5L A;  5CA1 E;  4UWH A;  5FTP A;  2XUE A;  5FQ8 A;  3W15 B;  4YFS A;  4RG6 A;  3ASD A;  1DVP A;  3Q49 B;  5KX5 E;  3CLJ A;  4UEL A;  2X6H A;  3PTR B;  2WVI A;  3E4B A;  3SRZ A;  2WWU A;  4X1Y E;  2RA1 A;  2IJG X;  3FP3 A;  5A1L A;  4PJJ A;  4HOR A;  2H7O A;  3CK7 A;  4ANW A;  2WPV A;  1FEW A;  2VKJ A;  2AW6 A;  1BR4 A;  3AAA B;  5DQW A;  4A3T A;  2XGO A;  3FH7 A;  3D9L A;  4JW1 A;  3HKB E;  4URK A;  1HXI A;  4C0E A;  4GOU A;  4HOQ A;  4KMO A;  4HVB A;  4UXN B;  2QFC A;  3FUM A;  1D1B A;  2ODU A;  2CWO A;  1NAF A;  1FMW A;  4WNF A;  1B7T A;  1MMD A;  2C0M A;  4ZS2 A;  3RYH E;  3KIN B;  2MOZ A;  3MGB A;  4MAL A;  4WNE A;  2OA5 A;  4N3B A;  2W63 A;  3D9J A;  5G04 J;  3I5P A;  5DAB A;  1UN9 A;  5L2L A;  3N2K E;  3FU0 A;  1BR0 A;  5FY0 A;  3VKG A;  4A1G A;  2V4L A;  2IOL A;  3IEG A;  3EHN A;  2XPI A;  3RPU A;  3HKE E;  1WYC A;  3BQK A;  3G2T A;  4H9Q C;  2WXH A;  2A3D A;  3UQ3 A;  3PZD A;  1QNF A;  2X66 A;  4XI0 A;  2DNX A;  2V7M A;  4IE4 A;  3RK6 A;  4LUN U;  1UW4 B;  5M72 A;  2CMR A;  3RRN B;  4I2W A;  5FT9 A;  1Y6I A;  3OYZ A;  5C2Y A;  4I50 E;  2KCV A;  3VHL A;  3GA8 A;  3MX3 A;  2V7J A;  4MS6 A;  4HKA A;  2IF4 A;  4U63 A;  1DNP A;  3FWV A;  2VTB A;  4GYO A;  3QC9 A;  4KZ0 A;  2CLY B;  2C5J A;  5FMN A;  1MND A;  5LOV E;  4AKH A;  2KT9 A;  1Z0P A;  5LCW J;  3AAI A;  5LHH B;  4WBO A;  2A2F X;  4I17 A;  3AA0 B;  3D9I A;  1N52 A;  3KVA A;  2NWB A;  5E76 A;  2WAU A;  3UFE A;  2ILR A;  3MKD A;  3LCA A;  3PUA A;  2BUG A;  1H0A A;  1Y8M A;  3UUL A;  5HWY A;  2LEH A;  4IE7 A;  4NRH B;  4EPZ A;  3O48 A;  4H63 V;  1ZBP A;  2KZT B;  2XCC A;  3QNK A;  3AA6 B;  4JPS A;  4PUC A;  1HU3 A;  4O4I E;  3E22 E;  3LKU A;  4CI3 B;  5H6Q B;  5AJL A;  3NRX A;  3VLF A;  2LSU A;  5BV1 A;  2BTD A;  3J7Y q;  4HGA A;  2FI7 A;  3RJV A;  5FYM A;  3H3A A;  3ZLI A;  3FUD A;  2ZMA A;  1UCU A;  2D0T A;  3L17 A;  3BG0 B;  3CVN A;  2L0I A;  2H3R A;  3ESL A;  2VSO E;  4CCA A;  4DBQ A;  2LSJ A;  5HQ8 A;  4I1A A;  3LBX B;  2R59 A;  3F2E A;  2LT3 A;  1D1C A;  2CG3 A;  4W9R A;  4FAD A;  3EDV A;  2WXG A;  2IW5 B;  1UX4 A;  1JPL A;  4ANV A;  3ULQ A;  2NXP A;  4G23 A;  3CQC B;  4L2L A;  4KBM B;  4YLH A;  4P0B A;  3D9P A;  3MA5 A;  2HPL A;  4DMV A;  2JQQ A;  4C90 A;  5JH7 E;  4G63 A;  2MOW A;  5G05 C;  5IHY A;  4F7A A;  2V7L A;  1OWN A;  3N71 A;  4N3A A;  4UF0 A;  2XCB A;  4J0U A;  3O4X E;  3ZYQ A;  4I6J A;  2LSK A;  1SZ9 A;  4CI1 B;  3BQI A;  4HOT A;  4YVQ C;  2OND A;  4L7T A;  3HVE A;  2X9H A;  3BQL A;  3MK7 C;  2UWJ G;  4L5G A;  4ILU A;  2J9Q A;  2EHO B;  1E90 A;  2IOS A;  4DK5 A;  2LHR A;  2E9X B;  4RG9 A;  3RO3 A;  1QUU A;  4EIW A;  4U8H A;  3SD5 A;  4GA1 A;  4N3C A;  3FTY A;  4EQF A;  3CHM A;  2LJL A;  2HR2 A;  1T98 A;  5EX3 A;  2E9X A;  2QY7 A;  3CML A;  3FUN A;  3M65 A;  1MHQ A;  5JHA A;  4GK5 E;  1IQR A;  4XX5 A;  2VGX B;  2RG8 A;  4YJ2 E;  4I43 B;  3CVL A;  4BT8 A;  3RC8 A;  3QUJ A;  1B89 A;  3J9X 1;  3CIA A;  2KIN B;  2VKH A;  3ZPJ A;  1HH8 A;  3FEY A;  3DBS A;  3NZP A;  4O4H E;  4JEH A;  5EDS A;  1LVF A;  4A1S A;  3GW4 A;  4BWR A;  3L22 A;  3RYC E;  2OOE A;  4PJN A;  2WMO A;  5ETW A;  3CGH A;  4JC8 A;  4AJW A;  5FP3 A;  3ASF A;  4GYY A;  1QQE A;  3RKO A;  5FWQ A;  2BZB A;  2GK9 A;  5LBM A;  3KDS E;  3V5U A;  1L5J A;  4EXT A;  4Y6C A;  2K48 A;  3ZEF B;  4JEH B;  2Y6X A;  4PW8 A;  2C2L A;  2L0T B;  4PS8 A;  1UG3 A;  4TV9 E;  4XE0 A;  5LJM A;  1HZ4 A;  3SWH A;  2LO6 A;  3NF1 A;  2I1J A;  3R84 B;  1HS6 A;  4BSX A;  2JPF A;  4ASK A;  3VLE A;  2XRY A;  5DQV A;  4HFV A;  5D0O D;  3MZL B;  5F3J A;  1E7U A;  4JVS A;  5L3G B;  2FBN A;  3S7B A;  4ATG A;  4HFG A;  1MIY A;  3SBT B;  3FU3 A;  4WBN E;  3KS2 A;  3PUK A;  2ZU6 B;  1WR6 A;  2ZM2 A;  3S7J A;  3PRE A;  3U3W A;  5LBQ B;  3UUX A;  3ZN3 A;  2WQ6 A;  2ACX A;  2JMK A;  2MTQ A;  3AB3 B;  2BVM A;  3N9O A;  4FJO A;  3DP7 A;  1NWM X;  3PDN A;  4MLK A;  3ASG A;  2HO1 A;  5CMW A;  3LJ3 A;  4O4J E;  2GGF A;  3TG4 A;  4UF0 B;  1G8X A;  3FTW A;  2XAG B;  3B7R L;  2YQ8 A;  2XPZ A;  2WXK A;  4A3V A;  3QJZ A;  3S2A A;  4JXT A;  2VSN A;  4K0R A;  1OUV A;  4GML A;  4YHJ A;  3T5V A;  4JHK A;  3QC1 A;  4WND A;  4EZ4 A;  3KBT A;  2J49 A;  3CKB A;  4F3V A;  5FY1 A;  2LOS A;  4L2Y A;  4L9I A;  2KWH A;  4X1I E;  2HM8 A;  2NC9 A;  3K8P C;  3SNX A;  5HXC A;  1N54 A;  4H9R C;  4AIF A;  2Y8D A;  5LJN A;  3C64 A;  1LVK A;  1D0X A;  2WXF A;  3KV4 A;  4A55 A;  2JMH A;  4DO0 A;  5IYZ E;  4J8F A;  5JDF A;  4RVB A;  5D0Q D;  4ZHQ E;  3LK3 B;  1E7V A;  3GYZ A;  2MHK A;  4GAA A;  2Y4T A;  5HI7 A;  1IJ6 A;  2M63 A;  3ESK A;  4JHR A;  1S94 A;  3R9A B;  3FY4 A;  4IST A;  2P9B A;  3CQX C;  4U74 A;  5A23 A;  2CWY A;  4DBR A;  4J8D A;  4UI9 C;  3CVV A;  5JR9 C;  4DMW A;  2Q9Q C;  3HA4 A;  1KK7 A;  3ZCI A;  1ZV4 X;  3CWZ B;  3D9O A;  1OWL A;  4UQZ A;  4GMJ A;  3OBV E;  4UIG A;  4Q69 A;  2V5F A;  3P8C D;  4IIJ E;  3VKH A;  3PE0 A;  3Q2M A;  4HTE A;  5BPP A;  4I55 E;  4Z8X A;  2X6K A;  4WUY A;  4QHO A;  3ANW B;  4EOZ B;  4EBA A;  4WNK A;  3QK0 A;  3RO2 A;  3CVX A;  4AQF C;  1ELR A;  4C9B B;  3PU8 A;  2XRZ A;  3ZW3 A;  2EHO D;  3S4U A;  2VQ2 A;  5F8P A;  3PUJ A;  4F53 A;  3OYX A;  2DI4 A;  1HFA A;  4AKI A;  5JDN A;  3FTV A;  4U0Z A;  4DLO A;  5T3R A;  3LEW A;  2EHO C;  3IHR A;  5ANL A;  4I2Z A;  2X9W A;  3PUR A;  4WWN A;  3FBZ A;  4IE5 A;  3FXE B;  5JDL A;  4FHJ A;  4I43 A;  4E7Z A;  3L6A A;  4BJM A;  4B94 A;  4I9C A;  4DND A;  1H2T C;  2X6I A;  3ENE A;  3GZ2 A;  1MNE A;  2LNI A;  5G55 A;  3SI5 A;  1H6K A;  2KCL A;  3ANW A;  5FQ6 A;  4I1M A;  2X6J A;  1EYH A;  4B6X A;  2C0L A;  4U0S A;  2IC6 A;  4HN9 A;  5LG4 A;  3N2O A;  3CX6 B;  4E85 A;  4FU3 A;  3CHP A;  2Q9Q B;  4CT4 A;  2Y4U A;  3EDU A;  3MKR A;  3IKO B;  2JRK A;  4KBQ A;  2W62 A;  3Q4A B;  2ZM8 A;  3UT8 A;  3CHR A;  3SFZ A;  3MJX A;  3N9Q A;  2V7I A;  4A56 A;  4G25 A;  4IGU A;  4AQF A;  5CCL A;  2YEV C;  3UT4 A;  2PL2 A;  5KJL A;  3RKV A;  3HIZ A;  4O8S A;  4NUR A;  4KUM B;  4I4T E;  5JJ6 A;  2XEV A;  2AXZ A;  1X5B A;  2VSX E;  1OWP A;  3FFL A;  4UV8 B;  2CLY C;  3K3N A;  4V3I A;  3KD7 A;  2J07 A;  1H19 A;  5FXW A;  4GZD A;  4K03 A;  3ZN0 B;  3GZS A;  3WXX A;  4NUU A;  4U0U A;  2VTB B;  3AS8 A;  2RP4 A;  3LXU X;  4EZK A;  1EDU A;  2PFV A;  3CVR A;  3UUM A;  4KVM A;  5J08 A;  3BK9 A;  5CB4 E;  3FH5 A;  5LCW C;  4FHK A;  3QAQ A;  1H7C A;  2KWI B;  3KEZ A;  2I6H A;  4UVA B;  4HEA A;  4BTB A;  3ZJ1 A;  5FXX A;  3IBP A;  4APF A;  4CDR A;  2W0G A;  2NTY A;  3N2G E;  4ILG A;  2VB6 A;  4BA9 A;  3FTU A;  5M4Y A;  5JRE A;  2OVF A;  3CVW A;  3AA1 B;  4GYW A;  5A7D B;  3EIQ C;  3SBS A;  3ONK A;  3FU5 A;  2YNQ A;  3OXL A;  2JJ9 A;  4GZC A;  3B13 A;  4ISS A;  3CK9 A;  3TJP A;  5L3E B;  4IE0 A;  4TV8 E;  3ZYK A;  2CHX A;  3LVR E;  1E8X A;  3PU3 A;  4PAG A;  3I3N A;  2ZM0 A;  5BMV E;  2OV8 A;  2V26 A;  3JUI A;  4UQY A;  5AYW D;  4L0R A;  3FB2 A;  3RYI E;  2KC7 A;  4KYO B;  2VGX A;  3DPD A;  4AXH A;  3HHM A;  4YJ3 E;  3FUF A;  2WB2 A;  3ASH A;  1PY1 A;  3TL5 A;  1FVH A;  1JWF A;  3GN5 B;  5LNK A;  3C4Z A;  4PFO A;  2PJQ A;  2X68 A;  2YU1 A;  3MZK B;  2I9C A;  4HLE A;  1U4Q A;  2E2E A;  5HAX A;  4KZC A;  2PZI A;  4L23 A;  4AV7 A;  1BR1 A;  3MJW A;  2WSS V;  3FBL A;  3NZU A;  5BT1 A;  1INZ A;  4NAC A;  4GB9 A;  3HKD E;  4WWP A;  1Z6T A;  1O3X A;  2Q7F A;  2VYI A;  5G05 J;  2Y48 B;  1GW6 A;  5KJM A;  3ZGQ A;  2HYZ A;  4QXB B;  4PS3 A;  4PJL A;  2BVL A;  2CXF A;  3CKD A;  4OYK A;  5JDM A;  5LA6 E;  2NTX A;  3TGO A;  3FEX A;  4FP7 A;  4N2Q A;  5FNV E;  3CQG B;  3N9P A;  3I1A A;  1AJ3 A;  3TG5 A;  5JQG E;  3AVS A;  2XAS B;  2ZLY A;  1IQU A;  3CKC A;  3I0Q A;  2LHN A;  3Q9D A;  3RC3 A;  4APO A;  4AKR B;  2LOP A;  5L3B B;  2QGS A;  4EYU A;  4JA7 A;  2IC9 A;  5G04 C;  3TKL B;  1D0Z A;  5FZR A;  2K24 A;  5ARF A;  2VJ8 A;  2XPY A;  2Q9Q D;  4TZ4 C;  3HVE B;  4HOU A;  2X0L B;  3H37 A;  3PE3 A;  1ZU2 A;  4ZI2 D;  3ZN1 B;  3AS4 A;  4EZH A;  3I9W A;  3CVY A;  3UUN A;  4ANU A;  3CST A;  3ZMU B;  4BAY B;  4F1S A;  3TXM A;  2V0P A;  3K3Q C;  4J2C A;  1MQS A;  5FZS A;  1LRZ A;  1U3D A;  3Q5M A;  4GK0 E;  4NQ0 A;  4DLQ A;  4XIF A;  2L8K A;  1UJK A;  5FXV A;  3O1H A;  1H2V C;  3ETV A;  1VRB A;  3N9L A;  1FIO A;  3HI2 A;  3FUK A;  3U66 A;  3PNT B;  5JR9 B;  3GWH A;  1Y64 B;  3G2W A;  4JUY A;  4IUL A;  2H7V C;  4JEU B;  4OYS A;  3D0T A;  4ACL A;  2X9X A;  4NUV A;  3QK6 A;  1ZEE A;  5LGT B;  2OVB A;  3FTX A;  4EEC A;  3CX7 B;  3FUH A;  3UX4 A;  3FDH A;  3OXF A;  4HXI A;  4UVC B;  5LX8 A;  5ARG A;  3LBX A;  2YK0 A;  4H9O C;  4KP3 C;  4AP2 A;  5J90 A;  4O6F A;  2NSZ A;  4GZ3 A;  4N39 A;  1OWM A;  3ETU A;  3KV5 A;  3CHS A;  4G1T A;  4P0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...