1HG2A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg2A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg2A01
4HFGA 3ZYKA 1X5BA 1EDUA 3LDZA 5CMWA 2DCPA 2MOWA 3D9JA 1HFAA 1XGWA 4NACA 1EYHA 4GZDA 1HF8A 1PY1A 3G2VA 4FU3A 1SZ9A 3D9LA 4Q94A 1JWGA 3ONLA 1UJKA 3ONKA 5LP0A 4GZCA 5J08A 2KM4A 2V8SE 1ELKA 1HG5A 2L0IA 3ZYLA 1JPLA 3D9NA 1SZAA 3D9MA 4JXTA 1MHQA 4FLBA 4Q96A 2LO6A 1HG2A 3D9KA 3D9IA 3G2TA 3D9PA 5CMYA 1JWFA 3G2SA 1LF8A 2BF0X 3ZYMA 3G2UA 1H0AA 2DIWA 1VDYA 2QY7A 2L0TB 3CLJA 3D9OA 3G2WA 3RRUA 4AVXA 5LOZA 1HX8A 1UJJA 3ZYQA 1INZA 1JUQA 1DVPA
chains in the Genus database with same CATH superfamily
5D66A 2YU1A 3QKYA 2MOWA 3APCA 5LMNT 1QLBA 3RRMB 5E76A 4YTMA 4EECA 1X81A 2X67A 4ATZD 2WZIA 4L7TA 4B3ST 4G8LA 4APOA 4JI8T 2KM4A 2J4GA 1ZKEA 3PURA 1ZV4X 2BKKB 4AQFA 5L3CB 3D9IA 1W0BA 2WQ6A 4PJJA 3GW4A 3CV0A 3G2UA 3CGHA 5FVKA 4GIWA 3SZ7A 2ODVA 4TNVA 3RHWA 1OXJA 5JQGE 2XAQB 3B7SA 3ZFWA 3OPCA 2ZM8A 1KNZA 3O1IA 4HLEA 4M7CA 2WM9A 5FINA 2I59A 1SUMB 1YQ4A 3HXBA 5ANRA 4FADA 2X68A 3EUVA 4BAYB 4LFCT 2VQ2A 4O1OA 4KX6A 3AG4E 3HR0A 1Z8UA 3DP7A 1UUSA 3Q9NC 4JXTA 3W9FA 2CG3A 3CHRA 4EZ4A 4EAHA 4C0EA 5BMVE 3L17A 3AA7B 5CFBA 2IFUA 4CZZB 5LHHB 2AJAA 2Z6EA 3AEDA 4XIFA 4DV0T 5LG4A 4DPRA 4EQFA 2FUPA 3L9TA 2X6IA 2FBWA 1N0RA 1HS7A 4XAXB 3TG4A 1HCIA 4WNEA 5C8YE 1O1SA 5JJ6A 3CIAA 4DV7T 5JA4D 3FTUA 3D9MA 1L0VA 2LSIA 2VURA 4MRUA 4WUYA 3TWTA 3DWLG 4GK5E 2WWUA 3CKDA 5L2LA 5G05C 4U0ZA 3RYFE 1WCRA 3UQ3A 4QFVA 3RKVA 1ZOYA 1N4QA 1TNZA 3C50A 3C3QA 2DBAA 5E75A 3C4XA 2NSZA 2DI4A 2KZ7B 5JRCB 3ETUA 3T5XA 2NW7A 3MZLB 3FH7A 1L5JA 3GZSA 1H19A 1XNFA 4JLEA 3AEEA 4ZS3A 1TYQG 4O2AE 4F8HA 3AAAB 1LF8A 3N71A 2YINA 3FU3A 3NB2A 4N5QA 2YDQA 4HXIA 4J7WA 3JC6D 4B6XA 5C3JA 4UWGA 3PJAJ 5FZRA 4Y6WA 4RG6A 2ZU6B 4MKTA 1D0XA 3PZ1A 2PTFA 5IWAT 1E8XA 2VGXB 3TWQA 4HWHA 1LKXA 4N3CA 3AAIA 1MMNA 1ELKA 3EI0A 3HXFA 2PNNA 3HIZA 2ZM0A 3E0ZA 3SFEA 3L16A 4N3AA 3I5PA 1JCQA 1N52A 2CA5A 1VOMA 2X9HA 4TX5A 4TWHA 1VDYA 2YN6A 3KS2A 2WBLA 5FNVE 2NP9A 2W66A 3PU8A 1QUUA 2X9YA 3TWVA 2Q7FA 4TN7B 5FYMA 3RIUC 4YVQC 4KVOA 1Y8MA 3R7RA 1XDOA 4A3TA 2XS8A 2XHEB 1MMAA 4UI9C 4B3MT 4C0MA 3CKCA 3S4UA 3ZGQA 4M3OA 3MV2B 3L13A 5FIOA 3CVUA 4L0RA 3KV9A 5HEGA 2QA7A 2XPIA 1HO8A 4UXNB 2R6GF 1J5WA 3KD7A 5LCWC 1MIWA 1N0QA 5HCMA 2ILRA 1HR0T 4U8VD 1M7KA 1YXRA 2LE8A 2E0IA 4BSXA 2V8SE 3UM2A 1MJ0A 3WAJA 4EHMA 3WXXA 3O9XA 1N4RA 4U07A 4AY6A 3ZJ1A 4HTEA 3ASDA 4K5BA 2V7JA 4RSYA 3AAAC 3FU0A 5ENOD 4HB5A 4A3VA 2BKOA 4B94A 2JQQA 5IY5E 3R9AB 4GMLA 5EKQD 4GTTA 4IRUA 4HE8A 3JQ1A 2DCPA 3TLSA 4ZXLA 3AEGA 4QH1A 3OYZA 2VJ8A 3HKBE 2XEVA 2XAHB 3GN5A 1U3DA 1NEKA 2HE0A 4YTNA 4CN4A 1W3BA 5FY7A 4DV5T 1OCRE 3LBXA 1N32T 4ZI3C 1OWOA 5A23A 1SVXA 3WG7E 2VTBA 1BR2A 3UU8A 2FJAA 2E5LT 2ZIRA 4CT0A 4ILIA 2KSRA 3RLFF 3ABME 4ZI7E 2ACXA 2C0SA 5JREA 3DEPA 5EK2A 1E90A 3LJNA 3QDNA 2MHKA 3ONLC 4PK5A 3LK2B 3UKUG 4CDMA 4DX2A 4H7YA 3OXFA 4ACKA 3KBTA 4JL0A 2AW6A 2C5JA 2KZTA 2DIWA 5JDMA 3G2WA 4GYYA 5G05J 4BESA 3LVRE 2JMKA 2I9CA 2YEVC 3PJAA 2WXJA 3GMIA 2MOZA 3ISMC 3Q15A 4IYPA 1V55E 4HEAA 4ILBA 2BS2A 4G26A 2OVBA 5AQ9A 4TV8E 5L3GB 2ZGDA 2XQAA 4AP2A 1S35A 3RO2A 4EBAA 2W0GA 2GRPB 5LG3A 4UVBB 4G1TA 3Q5EA 4K03A 2MYOA 1UGOA 4ABNA 3ZC1A 5D2MC 4F53A 3HXDA 2R5SA 2AXZA 2XGSA 1WM5A 1IBLT 5CMWA 4UF0A 5F5WA 2NYJA 3F57A 4E7SA 1A17A 3HRAA 5JDFA 3RJVA 1UN9A 1TNBA 3E32A 3ZSTA 3R9MA 1N95A 5J08A 4IT4A 4CGVA 3HHMA 1KPSB 3TLVA 3BEEA 3CVLA 3QB5K 4W9RA 3AE6A 4AQFC 3LY8A 5AQIB 5HS0A 5CA0E 2UXDT 4LF9T 3TXMA 2GRLA 3ZMUB 2IOLA 3SFYA 1JUQA 4L9IA 4CQIA 4AXPA 2XQ5A 2CE7A 3S7FA 5HEJA 3GA8A 2WXKA 1KF6A 4G23A 4PS7A 1OWLA 2KBXA 4KP3C 4WW0A 5JH7E 4TRQA 1YD8G 3EU5A 3TKLB 1W0AA 4G63A 3CX8B 3X1DA 2AWIA 2XPYA 5CBOA 4GYRA 3OBVE 4QXCB 4C90A 1E96B 2Y6XA 4CCAA 3EABA 3CHPA 4U72A 5AQFB 3RC8A 2QYJA 3ASHA 1J1JA 2CBIA 3O4ZA 4H9NC 1H2TC 3LG7A 2L6BA 2IY0C 2HM8A 2IQCA 3ZYKA 3CK6A 2WU2A 4DR3T 4JI4T 3RX6A 1D8EA 5LCWJ 3JQ0A 1HE8A 3S2AA 4YSZA 4O4HE 4UELA 4P29A 2E5VA 2V5DA 2Y8DA 3MKQA 4YT0A 4AI6A 4G25A 2XGOA 5FZQA 3KINB 2W67A 3AA1B 5ITZF 2GGFA 4J0UA 4I2ZA 3HXEA 4V1Av 1INZA 3AE2A 3RYHE 1LVKA 3PUKA 3B7TA 1IAPA 3CQGB 3EHZA 4IE6A 4OHFA 2KWIB 3UU3A 3EHQA 4A56A 3CHOA 2WSSV 3ZMTB 2ZISA 4JV5T 3UIPC 5EX0A 4FJZA 3LJ3A 2M6BA 1E8YA 3UTKA 4PS8A 4A63B 1UURA 2HN2A 1UW4B 4U74A 1FT2A 1FJGT 3PE3A 4KBQA 5CHEE 1HNZT 2N1GA 2V26A 5ENNA 2CM0A 5LYJE 1BU9A 3UPVA 3ZT7A 4AKRB 2FF4A 1G3NB 5AQTB 5AQKB 2CEAA 1XMQT 3LY7A 2VSYA 4KZ0A 4N5CA 3GN5B 4HFEA 3FEXA 5AQJB 3QB2A 3EVYA 1E2AA 2X6JA 3EHNA 3LBXB 5JVDE 4DIDB 3ZYQA 3CVVA 4BSZB 4MLPA 3IHRA 5FKYA 5BV0A 3NOGD 2VTBB 1TNUA 1N94A 3P8CD 3BU8A 1Z0PA 4DR2T 3MXZA 3TWWA 3Q5XA 4ME2A 3D9LA 4WYVA 2V7IA 1SW6A 3IXEA 4Q94A 2FJDA 1D1CA 1JNZA 4OYJA 4AIFA 2JQKA 1TNYA 3UI2A 3CX6B 3LY9A 1PAQA 4HI9A 5L4HA 1QQEA 1S64A 3I1AA 2KZTB 1MIVA 4JW1A 4L5GA 1KZOA 1S63A 5HXHA 3AE3A 4PNIA 2OCCE 5DBKA 3L54A 1WG0A 2FBNA 4HOSA 2CLYB 3GYZA 4ZI2C 4ACLA 5AQNB 2CG2A 5FQ7A 2LRKA 1WR6A 5DIZA 1CUNA 3PDYA 4IDPA 2VYIA 4GCNA 1KNRA 2HR2A 1DU2A 3C51A 5L3DB 2DCFA 5KX5E 1E7PA 1YCSB 3SF4A 2V7MA 5FL0A 3UU5A 2LRLA 4ADZA 3GZ1A 4GTMA 3ZT5A 4UF0B 4EIWA 3RIFA 1EYHA 5B1BE 3UM1A 4CI2B 1OEDA 1E1HB 2V4HC 3V5SA 4PK6A 4LNBA 4Z91A 4JA9A 2DWZA 2WQ7A 2CRBA 3F2EA 5LMUT 3EHRA 4AV7A 1SQMA 4ZOLE 5BR8T 4I17A 4O4JE 4YSXA 2XENA 5AQUB 4IL9A 3KV4A 4U0SA 3HYMB 3QNUA 2D0TA 3PZ4A 5LHGB 1XDPA 4BT8A 4UQXA 3I0OA 5CECB 5ENQD 4CXXA 4QXBB 3SBSA 2Y4TA 3L3PA 4B3RT 2J09A 3CVYA 3SHFA 2WXRA 2GRRB 2C0MA 3DSXA 4JEHB 2V7LA 3JCKC 3SFZA 2KCLA 1CHUA 4RVBA 2WDVA 1HG2A 4OAVB 2WPVA 4ZEYA 4YDYA 3B13A 3ZNGA 3TWRA 5F3JA 4I50E 2WXGA 3V2XA 3ZPOA 4GU5A 3R7QA 1DCEA 5G04C 4J8DA 3LDZA 1YMPA 2EQXA 3E34A 2VQET 1MMGA 4I6JA 5FXVA 4GB9A 2CLYC 3ONLA 1D1BA 2PM7A 2WXQA 3JYSA 2EINE 3O1HA 5FY1A 2J8SD 4AY5A 1HNWT 3MKQB 3NZQA 2ACZA 2YOEA 5M4YA 5KCMA 3ZCJA 4MBQA 4AKLA 2DHRA 1H2UA 2OEWA 2DYRE 2XZTG 1UCUA 2YK0A 1U3CA 3Q5WA 2K48A 4F1PA 5C2TA 1XGWA 3AEAA 4MBGA 2WDRA 3AU5A 2FO1E 4L9PA 3E08A 2W4XA 1O3XA 5BT1A 4RQIA 3EDTB 3VU7H 4UVCB 3RRWA 3SD5A 2PZIA 3QC1A 2BF0X 4ZI2D 3BG0B 3FU6A 5IYZE 2Y69E 2J47A 2AE9A 4DV6T 4BT9A 5LHIB 3OTNA 1S70B 1HZ4A 3QARA 2XJ7A 4H9OC 5J1GA 4GYOA 1OEDE 5ABHA 1HFAA 4DMWA 5JDHA 3AXJA 2NXPA 3FBZA 1I6ZA 4KZCA 2X0LB 3ZSSA 4I1OB 1J5ET 1A5EA 3AG3E 3N2GE 5ENTD 3PUWF 4X65T 5E0OA 3SGHA 5LB7B 4PAGA 4H9RC 3VRBA 4PH4B 3APFA 4NRHB 2GW1A 1OXZA 2W62A 4FULA 2DL1A 5AIJA 2KATA 3ZRHA 3ANWA 2BBHA 2I1KA 3QOUA 5FY0A 2I6HA 3U78A 2VVSA 3FH5A 5A6CA 3DTOA 3NAWA 4TNWA 3Q5MA 3B95A 3SNXA 3TWXA 1TN6A 3AEBA 2OOEA 1UN8A 4JI3T 3URZA 2J1DG 4WNFA 1TEZA 3LS8A 2CHXA 2K24A 3T1HT 4X66T 3CIRA 3HI2A 3ZXPA 2NR4A 3FZHB 3QB5A 2H6HA 2VASA 4EYYR 1XNQT 2F8XK 4CI3B 4OVUA 1T72A 2HH7A 4IREA 4HFCA 4FLBA 2H6GA 4DX7D 1Z3YA 1MMDA 3FDHA 3I4GA 4DI4A 2NC9A 5CA1E 2QY7A 2WMNA 3EJNA 3ONKA 4DVDA 4B93B 4I2WA 4YFSA 3AS8A 5LBMA 3ZXSA 3W15B 5T8IA 4K5CA 1OT8A 3UT5E 4GZ3A 4AIUA 4X8QA 3V30A 1YA0A 1KT1A 1OEDB 4E7ZA 4I6GA 4NXNT 1QZ2A 3FUHA 3J7Yq 4NURA 1U4QA 3ZN3A 4G2VA 4U7YA 5JR9A 2LHRA 3J5QB 5FT9A 3TLWA 3UFEA 1NWMX 1QNFA 4HFIA 4HFBA 4LF4T 3PZDA 4YVOA 5HEOA 1KLXA 2XM1A 5FTPA 3L39A 4IGUA 4YXDA 4C48B 4F7AA 1NA3A 2PL2A 5G04J 2W63A 2XEEA 5AJDA 4HWFA 1D1AA 1VRBA 3KBUA 3RYIE 3Q73A 3IF8B 4JI0T 4HQDA 2VKHA 3FFLA 4AKIA 4AQYT 3L8RA 4JBWF 1UJKA 3JAFA 3HDXA 2BUGA 3KEZA 2XQ8A 5ABEA 2VKDA 4EBAG 4FP7A 3L09A 2LNIA 4N78D 3UUMA 3QC9A 2VK9A 3U3WA 2WCAA 5HYAA 3JUEA 1PC2A 1RW2A 2IO3C 3CK8A 4UV9B 4UI9K 3ONXA 4ILAA 3MX3A 3AB3B 2P9SG 2AXVA 3PUJA 2H7OA 4O2BE 3FZFB 3LK3B 4KT6B 1H6PA 4DRXE 2RA1A 4A55A 1JCRA 4JZYA 4M1PA 4GYWA 1JPLA 2JMHA 3FZMB 4AQGA 2BZBA 4IE5A 4GMRA 3PV0F 4CN6A 3MYVA 3LCAA 1FMVA 3KVAA 5FL1A 2QVAA 4OAUC 1NP7A 3NWIA 2CXLA 3EDUA 4J8EA 4HWDA 2R59A 4JI6T 5FQ8A 4C9BB 3FUFA 2M63A 3UU6A 1EPUA 3CK9A 4BEPA 1OEDC 2JABA 3DSTA 2MPKA 2X3MA 1AP7A 3NOCD 4BWRA 4UEMA 4CDRA 2L8KA 4UWLA 3RC3A 2DZOA 4DLQA 3DSUA 2BBJA 5C2YA 5AQLB 4J2CA 3I4RB 2HPLA 3N9OA 4QHOA 3FUDA 2XS1A 5KJMA 4GZ6A 3FTZA 5B3SE 1XWMA 2X51A 1X5BA 4HKAA 2KINB 2OV8A 3CHQA 4E6HA 1MQSA 2PFVA 3PEVB 4NQ0A 3ONJA 3UQ7A 1BI8B 1OUVA 3NQPA 3AXJB 3IBEA 3ZKRA 2BVMA 2XUEA 3DBSA 1MX2A 4U96D 3UT7A 3JCFA 2ETAA 1IBMT 2JPFA 4TWDA 3L08A 3X2QE 3U3IA 4GCOA 4BY6A 1KZPA 3T5VA 3I3NA 5FQ6A 1MX6A 3B7RL 3BQOA 4QX7B 4I55E 2A72A 3ANWB 4EEBA 2LHNA 4FU3A 3AVSA 4OX9T 1FCHA 3ZVVA 5H7PA 4HFHA 1YYHA 3UT8A 4Y6CA 5EX3A 1FIOA 4HLLA 4DMVA 4BFRA 1HH8A 3VRAA 5CMYA 2LKGA 1KK7A 5HQ8A 5BXUA 1H2VC 1XMOT 2OLTA 1N4PA 5KNHD 3ABKE 4DX1A 2C5KT 4DUZT 4YJ2E 3S7BA 3DXKG 3P4SA 2IO2C 1UX4A 2JQHA 4KBMB 2UWJG 3AE7A 5AQBA 4XZ4A 4DR6T 4GTRA 1E8ZA 2IHR1 4KI0F 2YHCA 2QC9A 3MJWA 5EYPF 3F31A 1NI1A 2B76A 3AJIA 2NW9A 3E4BA 3L6AA 2BKNA 3N9QA 3T8MA 3JADA 3FH8A 2FJBA 3TG5A 3NBXX 1FT1A 2X9WA 2P9NG 2LSGA 2R03A 2GK9A 2E9XA 4EZKA 1IJ5A 3NVOA 3ML9A 1YKEB 3IA3A 1LVFA 4DR5T 1N33T 1Q2ZA 4I1AA 3A8YC 4TZ4C 1JWGA 3IBPA 2QFCA 3HXCA 3IKOB 3VHLA 3ZIMA 2WXNA 1V54E 4J8SA 1B7TA 5JR9B 3V2OA 4YHJA 4ERRA 4H9PC 4PDXA 4DO0A 4YSYA 2KNDA 2ONDA 3PUGA 5AQRB 3L82A 2L6JA 1S94A 3TL5A 4OFZA 1IYGA 3N9PA 4AEZC 1E7VA 3PNLB 3PS6A 4JC8A 3KDSE 1H7CA 3ZUVB 4L23A 3P4PA 3FXEB 3ZN1B 2G0UA 1D0YA 2LSYA 2ZM6T 2PM6A 4LF7T 5LJNA 1NZNA 5JHBA 1MNDA 4IDQA 4BETA 4CEMA 2V7KA 4JEHA 2K5BB 2VKOA 3LVQE 3ZC0A 3HA4A 1K3ZD 1VCTA 2LO6A 3D9KA 3KEAA 3Q7AA 1T8BA 4JUYA 2XRYA 4A97A 2XCBA 4EZLA 1OWMA 2XZDG 3HG0D 3T8OA 3FULA 4U8YD 4H7XA 3Q9UC 4KUMB 2WZHA 5HWYA 2KCKA 2V4LA 3CVNA 3ZLIA 4TWFA 4GKKT 4B89A 2B0OE 3QNKA 4DLOA 3IHVA 3ZMZB 3LDQB 4PUCA 4JA7A 4XKCA 1OCOE 4KVMA 3C98A 3SFXA 5ABGA 1NA0A 1TJFA 2CHWA 1E7UA 5HKPA 5LJMA 2B6CA 2B1EA 4X62T 5FXXA 2RG8A 1O1TA 5JDLA 2C0LA 2W00A 3PNTB 3QWPA 4LEUA 5LP6E 2V0PA 4IE0A 1FMWA 2XM2A 3CKBA 3G2VA 4QH5A 1KNPA 3FUIA 4ZHBA 2EIJE 3CQXC 4X1IE 2BDEA 3PVLA 2BS4A 2V5CA 2XRZA 2X9XA 4B8CB 3IV0A 4B8AA 2MBGA 1MHQA 2WY2A 5JR9C 2IOSA 3RYCE 3ZU7B 4HORA 4GZ5A 2WB2A 4AVXA 5HCJA 2NTYA 3J5PA 2LAIA 4G11A 3ZT6A 5J0ZA 1DCQA 3E22E 2IAKA 3IEGA 5LGUB 3CPZA 3MEKA 3SWHA 5CGMA 4EZHA 2WQHA 3OXLA 5G2NA 2WQYA 4GA2A 5L3FB 3RU0A 4AJWA 1IHGA 4I4TE 2VB6A 3ETVA 1SA4A 1UG3A 3PZ2A 1SZAA 2DYSE 5HXSA 4CDNA 2VL0A 3NZPA 2N2NA 1NL4A 2XPKA 2F0YA 3UT4A 5LNKA 3O4XE 3AE4A 3DSWA 2WVIA 1DVPA 1T7SA 4WNGA 2D5UA 1BR0A 1SA5A 2XSBA 1WDYA 2EHOA 2H89A 3AE1A 3L22A 4ZZCA 4LMLA 3SS1A 1WY6A 3PRZA 1TJCA 4ILCA 2IU1A 2WXOA 4CRWA 2EILE 4DK5A 4DV4T 4Z68A 2XY8B 2H88A 1K1BA 2CCQA 3ASGA 5EK3A 2LM9A 2PG8A 4J8YA 2JJ9A 2XQ6A 4XZCA 5KJNA 2OEVA 5LOZA 5KJKA 2P2CP 3PUAA 4IN3B 3WAKA 2C2LA 3DEOA 4L2LA 4GKJT 3CR3A 4UWKA 1LTXA 2WMOA 4Z8XA 3J9X1 1HF8A 3CWZB 5AQ7A 2FO7A 5HXRA 1QBQA 2WB5A 4FI5A 4LCTA 1RZ4A 1MNEA 3UUNA 2EIME 2BTDA 2CHNA 1HXIA 3APDA 3D9NA 3HVEA 4HVBA 3MZKB 3SRZA 1BR4A 3ZMVB 4YNDA 3D9PA 2YQ8A 1SHZC 3RSEG 3VTYA 1I94T 3TLTA 2LXMA 4H63H 2HYZA 3H3AA 4UVAB 2HPJA 2WXPA 2RKKA 2Q9QA 2E9XB 3QOFA 4LMKA 2WS3A 4GTPA 2XQYA 3FTXA 3MGBA 4BTBA 5JDNA 3C3RA 3FTSA 4O60A 1Y6IA 2YU2A 4L2YA 2DWKA 2V6YA 5KXJA 2D2SA 3HKDE 1O5MA 2LSJA 5CEDB 2DNXA 2VSXE 4PFOA 4WAFA 2E2AA 3AU4A 5JTGA 2CXFA 4B3TT 2M67A 1NENA 3RO3A 3LYAA 2UXNB 5FQ4A 5IHYA 5HRYA 5LCYA 2P58C 5LA6E 4NACA 4WWPA 4XKBA 2KWHA 3NF1A 4V3IA 2JQ9A 4A98A 1M62A 4K0UA 3MJXA 2W2UA 2R17C 4CI1B 3EUHA 2LJLA 5AQSB 5LGTB 5CRUA 3VLDA 4P09A 5BW8C 3UMVA 4TUMA 3ZPJA 5AFUL 1IZNB 1ZEEA 2YKSA 4Z90A 4HNAD 2HO1A 4UUCA 2CMRA 3T1YT 4HOQA 4XI0A 4HGAA 3BQKA 4NUUA 3TGOA 4ANXA 4HFVA 1N54A 3AA0B 4DR1T 1D0ZA 1VCSA 1YW0A 1HS6A 3ML8A 4PW8A 1W09A 4JVSA 3UIOC 4JI2T 2M6IA 3NRXA 2A9UA 2MTQA 3KSLA 2D0UA 4UWFA 2L0TB 2DZNA 3C98B 2WAUA 3VLEA 5EILA 3O48A 2HHHT 1D9SA 4JI5T 2E9XC 1K1AA 1KEYA 2X0YA 4JPSA 1Z6TA 3LJCA 3VR8A 4U04A 1ZB1A 2UU9T 3UXGA 3ASNE 3A7MA 3ZHEA 2I0MA 2ZXWE 3K3NA 4U7IA 2AXDS 1OWAA 1NAFA 3JAEA 4EEDA 2P9UG 5AQOB 2IJGX 5CCMA 4GTVA 4HI8A 2HN1A 3AEFA 4NIQA 2WXFA 2BG9A 3D9HA 4B0ZA 4ZFHA 2IIUA 4U3CA 2P9BA 2CXDA 2CHOA 4DJAA 2A5UA 1AWCB 4HRLA 1DNPA 2R2LA 3RGLA 4BA9A 4H63V 5FMNA 3PUZF 4JYAT 1FVHA 1U5PA 3G2SA 3LXUX 5DQVA 5A1LA 2A3DA 1SZ9A 1MYOA 3ULYA 5EN5D 4HFGA 1H6KA 2GRMA 2WWVA 1TN7A 5AN8A 2YNQA 3P2BA 2EHOB 5ARFA 5KBAA 2VVNA 4EV6A 2LM2A 3SI5A 1OCZE 3Q4AB 2YDRA 3Q5DA 4G2AA 4ISTA 4Q96A 4O4IE 2ETCA 4HRNA 2VGEA 5LBQB 4ANVA 2XQ7A 3EDVA 3K9IA 2CHZA 3DPYA 1X9BA 4MALA 4YDEA 4YLHA 2ES0A 3QWWA 2LUHA 3D9JA 4QX8B 3LPZA 3FP3A 4GZDA 2V5FA 4P0BA 1N4SA 5JJTA 5TAOA 4BTAA 5BV1A 5HXCA 2F8YA 5BNWA 3HKEE 4DV1T 5ABFA 4NXMT 2L0IA 3FHNA 5AYWD 3HVEB 2ZMAA 4N39A 2LKHA 3C64A 4IE7A 3T8KA 5H6RB 2JEKA 4PJNA 3CLJA 3VKHA 4I9CA 1N9AA 1IQUA 2QZAA 4DR4T 2SPCA 2P9PG 5AENA 2Q9QB 1EDUA 2IMLA 5HI7A 4RLYA 2LAHA 4URKA 5KMGP 2V6XA 2J9QA 3H3MA 1S0PA 1TN8A 5J90A 3C72A 4KYOB 3S7JA 2X6HA 2V6YB 4CZ2D 3ZMSB 2PQRA 5FZSA 2J07A 3FTYA 2E9XD 4U2YA 2JRKA 2WU5A 2X66A 5FVLA 1IBKT 2BKPA 2E2EA 3CVPA 5M72A 4ZHQE 1IQRA 4IE4A 3P50A 2XAGB 3AA6B 4X5TA 4GPKA 2RPAA 2BG9E 2IEJA 3TJPA 4XEIG 4AOFA 4JHRA 2XQ0A 3C3OA 4U0UA 4IIJE 2Y0BG 3UM3A 2FJEA 2EHOC 1PY1A 3PE0A 1WAO1 4HFDA 2LEHA 4YDOA 1OWPA 3LSVA 2I1JA 5BXOA 3CSFA 4WNDA 4XI9A 3AECA 5FP3A 4I1MA 4BX9A 2QRXA 3EU9A 5EZYE 4AXHA 3G2TA 2AXUA 4WZXA 2AVPA 4QQIA 4UV8B 2Y3AA 3B7BA 4X1YE 3P4QA 3MKRA 4GTQA 4YJ3E 4Q69A 3GWHA 4XX5A 4YDWA 4APFA 4JI1T 1LD7A 4CT4A 3ABVA 3ZEFA 5HEUA 2KT9A 1UX5A 5DABA 5L47A 5LP0A 3BUAA 1P5QA 4KMOA 1SA0E 5J2TE 4LRZA 3Q49B 1FEWA 3SFDA 2IDOB 2P9LG 2PQNA 2QYUA 2IC9A 1JCSA 1GQEA 3PUSA 5DJQC 3F6QA 2J4BA 3MACA 5CJ5A 2VQFT 4U63A 3N2OA 2FEZA 5T4YA 2Q9QC 1ZU2A 4K0KT 1N36T 2UXXB 5FJYA 4AISA 4FJOA 1IJ6A 4COFA 4JEUA 2UXBT 1QSDA 3FHEA 4DX6D 4TXQA 3PUXF 1IXVA 5ETWA 3RK6A 5AARA 3AS4A 2J08A 3ZHEB 1UK5A 3RF1A 3BG1B 3C4ZA 3KFWX 4EXTA 4U2ZA 4EZJA 3SO8A 3UUXA 5F8PA 4PJMA 1K8KG 5LFAA 4OK0A 5BPPA 2XAFB 3QAQA 3FU5A 3SOLA 5HWXA 2VKJA 2RFMA 1BLXB 2KCVA 2XQ4A 2MRIA 3U4TA 3NRYA 2BG9B 4ZS2A 3KSQA 3I0QA 4IULA 5ENRD 4I6EA 3UQ4A 4I9EA 3V31A 3OJAA 3LKUA 4DBRA 1GW6A 4ANUA 1AJ3A 4AKHA 2WXIA 4LSZE 4R7LA 4GTOA 1U2VG 4F6RC 5JMND 3VLFA 3BK9A 5A7DB 2PBIA 1IKND 3ESKA 3Q9DA 4EYUA 2XASB 2UY1A 3CX7B 3IEEA 5HEHA 1HU3A 5ANLA 3HL6A 2OV9A 4K0RA 3FY4A 3U66A 4ISSA 4GOUA 4YY3T 4LMJA 3CVRA 4DX5D 3ESLA 5LGNB 3ULEG 2GROB 4U31A 2GRNB 4N2QA 3NZUA 3OKQA 3MV3B 3A5XA 4JHJA 1DC2A 3CVWA 3KV6A 4FHJA 3MA9A 4K5AB 3RRNB 4CXYA 3HKCE 2F37A 3VR9A 4WWOA 3K1SA 2EHOD 1H0AA 2EIKE 2QGSA 5KWDA 2UUAT 4GAAA 4O6FA 4HRMB 3C5RA 5GONE 4O8SA 3TWUA 3S7DA 3QK6A 5B1AE 1W9RA 3PU3A 4MFRA 4UIGA 2ZGGA 3CQCB 4AM9A 3Q7FA 4IDOA 2H3RA 3E30A 5DQWA 4GYSA 4MS6A 4DNDA 5ENPD 2C5IT 3ASOE 4O1PA 5KDMC 3M3ZB 5ABFB 4BX8A 3JXJA 1OCCE 3PEUB 3ZCIA 3EHMA 3LFMA 3ZW3A 2VSOE 3PE4A 4G8KA 4GK0E 2JIWA 2WP9A 3RI5A 3OXGA 3AG2E 4AKGA 4EPZA 2MAWA 1ZHCA 3TAXA 1MZCA 2RD0A 4YHHT 2BG9C 3PUYF 2JLBA 3KVBA 4KHPT 1BPOA 2NWBA 2DLRA 3OYXA 2N9DA 4JI7T 5AAOA 1ZBPA 3RIBA 3P4WA 3UUBA 3P7IA 1ELRA 3H37A 3N2KE 2LXLA 2RFAA 3MA5A 1WRDA 4NUVA 1N34T 2P9KG 2Q9QD 2WDQA 2ZLYA 3D3MA 4A5XA 2V8SV 3UULA 3SBTB 3K3OA 2P9IG 3JXIA 5HXEA 1KFYA 3ASFA 3OVUA 2J4DA 3RAUA 2DWGA 4NIKA 3FUJA 3SQVA 2CWYA 2H6FA 3RIAA 2OA5A 4LUNU 3W9GA 1HG5A 2F4VT 1R8IA 2XEHA 5KJLA 4UQYA 2VSNA 4LF6T 1G8XA 4LNUD 3ZJ2A 4FLHA 5CCLA 4TXRA 3PZ3A 3BQLA 4E85A 5JJ7A 3QWVA 4BERA 1IHBA 4I43A 3ULQA 2V5QC 4F6RD 3FUKA 3P1UA 3R6NA 3ZN0B 3CMLA 1XNRT 5JDGA 2X6KA 3TLUA 4IDNA 2J62A 3FZKB 2UUCT 3ZEFB 4G24A 1WR0A 5AQMB 5EIBE 3IHYA 4HWIB 2LOSA 3DPDA 3MCXA 3CVXA 2A5EA 1BR1A 4UI9J 1JWFA 2XCCA 4LF5T 3FTWA 3FUNA 3UTMA 2VGYA 2KXPB 3DSSA 4A1GA 2FULA 2BVLA 3OTOT 3ABLE 5FXZA 5D0OD 4OYSA 5CRVA 3DSVA 4DI3A 3T9KA 3V79K 5ENSD 4X64T 2LSUA 2H6IA 4EOZB 1BI7B 5H6QB 3PUVF 3C4WA 4J6IA 4C91A 4HN9A 4JEUB 1JNRA 4QWNB 3N9LA 4ZI3D 1EZ3A 3GZ2A 3ZKJA 3B57A 3TWSA 5BUZA 3PH0C 4WBOA 1HX1B 5AQGB 2IF4A 4LF8T 3CSTA 3UINC 1WYCA 3UUXB 1HX8A 3AE5A 4FJYA 1SE7A 2I2OA 5EK4A 4XBFB 2LLYA 4NPPA 3Q75A 4IDZA 3AAEB 1Y01A 3E33A 4O4LE 4OYKA 5LX8A 4ANJA 2V1DB 3JUIA 2UXCT 3AVRA 4DV2T 4UR9A 2GRQB 3N9NA 1WFDA 2PJQA 4ANWA 4I0UA 5IUXA 2R05A 4JB8P 5G55A 3N9MA 4QKNA 4U8HA 5KNGA 3DXMG 3RKGA 3RPUA 3QUJA 2R02A 2UY1B 3G06A 1E8WA 4BJMA 5CBNA 1Y64B 5CEAA 3FXDB 3KAEA 5T3RA 5CB4E 3TXNA 2IUBA 4EB6E 5EIDA 2LSVA 3VTXA 4DBQA 5ADXL 5AQAA 3I9YA 1Z3XA 4HS2A 3O1JA 4H9SE 4LFBT 2NW8A 5J2UE 1MIYA 3PUQA 1US7B 4X20E 4J8FA 3NZSA 2BS3A 2WXLA 2X38A 3EIJA 3VKGA 1WYBA 3EIQC 2IC6A 2XTLA 1BD8A 3UKRG 2NTXA 1MX4A 2KXPC 3SY2A 3CHSA 1QYMA 3I9WA 3UFGA 4P0AA 3FEYA 2XQ9A 4HOTA 1ELWA 2OVFA 1KT0A 2LT3A 3DJBA 4PFPA 2BKGA 4LFAT 5JHAA 4HOUA 3FUMA 2X6FA 3RRCA 2IONA 3RH3A 3AS5A 5L3BB 1B89A 5LXTE 3K3QC 4DUYT 2CFUA 3UX4A 3D9OA 2K9AA 3QJZA 4D10C 5EYLA 3CK7A 4QH4A 4PJLA 4CN1A 1HTJF 4GA0A 5AQVB 2CBJA 3FB2A 3RIUA 3FWVA 4CGWA 4GTSA 2CPTA 5AQQB 4KMCA 4F1SA 2WXMA 2XPZA 4GZCA 3NKZA 4GPMA 1FPPA 1N11A 2RP4A 3AE9A 1H6OA 4RG9A 3KV5A 4A1SA 1TNOA 4CXWA 3ZYLA 4UQZA 4OVVA 2VWAA 5ARGA 5FWQA 3U9WA 3EAMA 2L9BA 2XGMA 3RRUA 3CVQA 4DUIA 4KXKB 1EF1C 4LERA 3MKDA 2LOPA 2IW5B 4GMJA 3FUEA 2CWOA 2H7VC 2KMFA 3QK0A 2K3WA 2XQ3A 4ILUA 3V5UA 4WWNA 4KHZF 5AQPB 1OWNA 3FBLA 5JRCA 1OY3D 1TR4A 3D0TA 1UOHA 2QYWA 4HBDA 4QXHB 3FTVA 3WI3A 3MK7C 1LD8A 4MHCA 1HNXT 2ETBA 2Y4UA 4TUUA 1YKHB 2FI7A 2YHEA 1G73A 2ZM2A 4IHJE 3U64A 4H9QC 2E8IA 4F3VA 1T98A 2L9QA 3FZLB 4U33A 4N2SA 3Q2MA 2J49A 3RQUA 3CHMA 4LG6A 4I43B 2YDSA 4PK4A 4DR7T 2VL8A 1NFIE 4MLKA 2VGXA 5LOVE 5CERB 4JD2G 3Q79A 4DV3T 3N5LA 2Y48B 2MYSA 3PTRB 4YTPA 4TV9E 5FXWA 2XAJB 4P1NA 1XZYA 2UUBT 1Z5SC 3Q47B 5EDSA 4X1KE 4FHKA 4BJNA 4L1BA 3LEWA 3K8PC 3UU4A 3PDNA 1UJJA 2X0HA 4TUYE 4U7EB 2Y1LE 5JDQA 2NOXA 4LNGA 3OAWA 1YQ3A 3M65A 3RKOA 4WBNE 1V9DA 2KC7A 3B7UX 4GA1A 4ILHB 5AJLA 2XZEA 5C1DA 4ILGA 2KLQA 2XHEA 2W61A 1D8DA 3NBNB 4TXPA 3AG1E 2BEDA 3RQWA 3ENEA 3ZYMA 3DRAA 3P4RA 4UWHA 3AE8A 3E37A 4Q25A 4ZZBA 2CFZA 3B5MA 3UM0A 2XSAA 4N3BA 1FVFA 1O1RA 1X79A 1ZP0A 2D9DA 3R84B 4ASKA 4FC8A 4EGWA 1LRZA 2ODUA 4PS3A 3JC6C 3CEQA 4U95D 3PREA 2WXHA 2A2FX 3BQIA 3LK42 2A4ZA 4TV3A 5L3EB 5D0QD 4JHKA 5L4EA 4FA6A 4XE0A 4IL4A 4WNKA 2L3LA 4CYMD 4HWCA 5HAXA 1WLXA 5AQHB 3Q78A 4ATGA 2DVWA 2LSKA
chains in the Genus database with same CATH topology
2YU1A 3QKYA 2MOWA 3APCA 3RRMB 5E76A 4EECA 2X67A 4L7TA 4APOA 2KM4A 1ZKEA 3PURA 1ZV4X 4AQFA 5L3CB 3D9IA 2WQ6A 4PJJA 3GW4A 3CV0A 3G2UA 3CGHA 4GIWA 3SZ7A 2ODVA 5JQGE 2XAQB 3B7SA 3ZFWA 2ZM8A 1KNZA 3O1IA 4HLEA 2WM9A 2I59A 4FADA 5ANRA 2X68A 4BAYB 2VQ2A 3HR0A 3DP7A 4JXTA 2CG3A 3CHRA 4EZ4A 4EAHA 4C0EA 5BMVE 3L17A 3AA7B 2IFUA 4CZZB 5LHHB 2Z6EA 4XIFA 5LG4A 4DPRA 4EQFA 2X6IA 1HS7A 4XAXB 3TG4A 1HCIA 4WNEA 5C8YE 5JJ6A 3CIAA 3FTUA 3D9MA 2LSIA 4MRUA 4WUYA 4GK5E 2WWUA 3CKDA 5L2LA 5G05C 4U0ZA 3RYFE 3UQ3A 4QFVA 3RKVA 3C50A 2DBAA 5E75A 3C4XA 2NSZA 2DI4A 2KZ7B 5JRCB 3ETUA 3T5XA 2NW7A 3MZLB 3FH7A 1L5JA 3GZSA 1H19A 1XNFA 4JLEA 4ZS3A 4O2AE 3AAAB 1LF8A 3N71A 2YINA 3FU3A 4HXIA 3JC6D 4B6XA 4UWGA 5FZRA 4Y6WA 4RG6A 2ZU6B 4MKTA 1D0XA 1E8XA 2VGXB 1LKXA 4N3CA 3AAIA 1MMNA 1ELKA 3HIZA 2ZM0A 3E0ZA 3L16A 4N3AA 3I5PA 1N52A 2CA5A 1VOMA 2X9HA 4TX5A 1VDYA 3KS2A 2WBLA 5FNVE 2NP9A 3PU8A 1QUUA 2X9YA 2Q7FA 4TN7B 5FYMA 4YVQC 4KVOA 1Y8MA 3R7RA 4A3TA 2XHEB 1MMAA 4UI9C 4C0MA 3CKCA 3S4UA 3ZGQA 4M3OA 3MV2B 3L13A 3CVUA 4L0RA 3KV9A 2QA7A 2XPIA 1HO8A 4UXNB 3KD7A 5LCWC 1MIWA 2ILRA 2E0IA 2LE8A 4BSXA 2V8SE 3WAJA 3WXXA 3O9XA 4AY6A 4U07A 3ZJ1A 4HTEA 3ASDA 2V7JA 4RSYA 3FU0A 4A3VA 4B94A 2JQQA 3R9AB 4GMLA 5EKQD 4IRUA 4HE8A 3JQ1A 2DCPA 3OYZA 2VJ8A 3HKBE 2XEVA 2XAHB 3GN5A 1U3DA 1W3BA 5FY7A 3LBXA 4ZI3C 1OWOA 5A23A 2VTBA 1BR2A 4CT0A 4ILIA 4ZI7E 2ACXA 2C0SA 5JREA 5EK2A 1E90A 3QDNA 2MHKA 4PK5A 3LK2B 4CDMA 4H7YA 3OXFA 4ACKA 3KBTA 4JL0A 2AW6A 2C5JA 2KZTA 2DIWA 5JDMA 3G2WA 4GYYA 5G05J 3LVRE 2JMKA 2I9CA 2YEVC 2WXJA 3GMIA 2MOZA 3Q15A 4IYPA 4HEAA 4G26A 2OVBA 4TV8E 5L3GB 4AP2A 1S35A 3RO2A 4EBAA 2W0GA 4UVBB 4G1TA 4K03A 4ABNA 3ZC1A 4F53A 2R5SA 2AXZA 2XGSA 1WM5A 5CMWA 4UF0A 3F57A 4E7SA 1A17A 5JDFA 3RJVA 1UN9A 5J08A 4CGVA 3HHMA 3BEEA 3CVLA 4W9RA 4AQFC 3LY8A 5CA0E 3TXMA 2GRLA 3ZMUB 2IOLA 1JUQA 4L9IA 4CQIA 4AXPA 2CE7A 3S7FA 3GA8A 2WXKA 4G23A 4PS7A 1OWLA 4KP3C 4WW0A 5JH7E 4TRQA 1YD8G 3TKLB 4G63A 3CX8B 2AWIA 2XPYA 1E96B 3OBVE 4GYRA 4QXCB 4C90A 2Y6XA 4CCAA 3CHPA 4U72A 3RC8A 3ASHA 3O4ZA 4H9NC 1H2TC 3LG7A 2HM8A 2IQCA 3ZYKA 3RX6A 5LCWJ 3JQ0A 1HE8A 3S2AA 4O4HE 4UELA 4P29A 2Y8DA 3MKQA 4AI6A 4G25A 2XGOA 5FZQA 3KINB 3AA1B 2GGFA 4J0UA 4I2ZA 4V1Av 1INZA 3RYHE 1LVKA 3PUKA 3B7TA 1IAPA 3CQGB 4IE6A 4OHFA 2KWIB 4A56A 3CHOA 2WSSV 3ZMTB 5EX0A 4FJZA 3LJ3A 1E8YA 3UTKA 4PS8A 1UW4B 4U74A 3PE3A 4KBQA 5CHEE 2N1GA 2V26A 5ENNA 2CM0A 5LYJE 3UPVA 4AKRB 2FF4A 2CEAA 3LY7A 2VSYA 4KZ0A 4N5CA 3GN5B 3FEXA 3QB2A 3EVYA 2X6JA 3EHNA 3LBXB 5JVDE 3ZYQA 3CVVA 4MLPA 3IHRA 5BV0A 2VTBB 3P8CD 1Z0PA 3MXZA 3Q5XA 4ME2A 3D9LA 2V7IA 4Q94A 1D1CA 4OYJA 4AIFA 3CX6B 3LY9A 1PAQA 1QQEA 3I1AA 2KZTB 1MIVA 4JW1A 4L5GA 5HXHA 4PNIA 5DBKA 3L54A 2FBNA 4HOSA 2CLYB 3GYZA 4ZI2C 4ACLA 2CG2A 5FQ7A 1WR6A 5DIZA 1CUNA 3PDYA 2VYIA 4GCNA 2HR2A 3C51A 5L3DB 2DCFA 5KX5E 3SF4A 2V7MA 4ADZA 3GZ1A 4UF0B 4EIWA 1EYHA 4CI2B 1E1HB 3V5SA 4PK6A 4JA9A 2WQ7A 3F2EA 4AV7A 1SQMA 4ZOLE 4I17A 4O4JE 3KV4A 4U0SA 3HYMB 2D0TA 5LHGB 4BT8A 4UQXA 3I0OA 4CXXA 4QXBB 3SBSA 2Y4TA 3L3PA 2J09A 3CVYA 3SHFA 2WXRA 2C0MA 4JEHB 2V7LA 3JCKC 3SFZA 2KCLA 4RVBA 1HG2A 2WPVA 3B13A 5F3JA 4I50E 2WXGA 3ZPOA 4GU5A 3R7QA 5G04C 4J8DA 3LDZA 2EQXA 1MMGA 4I6JA 5FXVA 4GB9A 2CLYC 3ONLA 1D1BA 2PM7A 2WXQA 3JYSA 3O1HA 5FY1A 4AY5A 3MKQB 3NZQA 5M4YA 5KCMA 3ZCJA 4MBQA 4AKLA 2DHRA 1H2UA 1UCUA 2YK0A 1U3CA 3Q5WA 2K48A 1XGWA 3AU5A 3E08A 1O3XA 5BT1A 3EDTB 3VU7H 4UVCB 3RRWA 3SD5A 2PZIA 3QC1A 2BF0X 4ZI2D 3BG0B 3FU6A 5IYZE 4BT9A 5LHIB 3OTNA 3QARA 1HZ4A 4GYOA 4H9OC 5J1GA 1HFAA 4DMWA 5JDHA 2NXPA 3FBZA 4KZCA 2X0LB 4I1OB 3N2GE 5E0OA 3SGHA 4PAGA 4H9RC 4PH4B 3APFA 4NRHB 2GW1A 1OXZA 2W62A 4FULA 5AIJA 2KATA 3ZRHA 3ANWA 2I1KA 3QOUA 5FY0A 2I6HA 3U78A 3FH5A 5A6CA 3DTOA 3Q5MA 3SNXA 2OOEA 1UN8A 3URZA 2J1DG 4WNFA 1TEZA 3LS8A 2CHXA 2K24A 3HI2A 2VASA 4EYYR 4CI3B 4OVUA 2HH7A 4FLBA 1Z3YA 1MMDA 3FDHA 3I4GA 4DI4A 2NC9A 5CA1E 2QY7A 2WMNA 3EJNA 3ONKA 4DVDA 4I2WA 4YFSA 3AS8A 5LBMA 3ZXSA 3W15B 5T8IA 3UT5E 4GZ3A 1YA0A 1KT1A 4E7ZA 4I6GA 1QZ2A 3FUHA 3J7Yq 4NURA 1U4QA 3ZN3A 4G2VA 5JR9A 2LHRA 5FT9A 3UFEA 1NWMX 1QNFA 3PZDA 4YVOA 1KLXA 5FTPA 4IGUA 4F7AA 1NA3A 2PL2A 5G04J 2W63A 5AJDA 1D1AA 1VRBA 3KBUA 3RYIE 3IF8B 2VKHA 3FFLA 4AKIA 1UJKA 3HDXA 2BUGA 3KEZA 2VKDA 4EBAG 4FP7A 3L09A 2LNIA 4N78D 3UUMA 3QC9A 2VK9A 3U3WA 5HYAA 1PC2A 3CK8A 4UV9B 4UI9K 3ONXA 3MX3A 3AB3B 2AXVA 3PUJA 2H7OA 4O2BE 3LK3B 4KT6B 2RA1A 4A55A 4JZYA 4M1PA 4GYWA 1JPLA 2JMHA 4AQGA 2BZBA 4IE5A 3MYVA 3LCAA 1FMVA 3KVAA 1NP7A 2CXLA 3EDUA 4J8EA 2R59A 5FQ8A 4C9BB 3FUFA 2M63A 1EPUA 3CK9A 2X3MA 4BWRA 4UEMA 4CDRA 2L8KA 4UWLA 3RC3A 4DLQA 5C2YA 4J2CA 3I4RB 2HPLA 3N9OA 4QHOA 3FUDA 5KJMA 4GZ6A 3FTZA 2X51A 1X5BA 3CHQA 4HKAA 2KINB 2OV8A 4E6HA 1MQSA 2PFVA 3PEVB 4NQ0A 1OUVA 3NQPA 3IBEA 2BVMA 2XUEA 3DBSA 3UT7A 2JPFA 3L08A 3U3IA 4GCOA 4BY6A 3T5VA 3I3NA 5FQ6A 3B7RL 4QX7B 4I55E 2A72A 3ANWB 2LHNA 4FU3A 3AVSA 1FCHA 3ZVVA 3UT8A 4Y6CA 5EX3A 1FIOA 4DMVA 4BFRA 1HH8A 5CMYA 1KK7A 5HQ8A 1H2VC 2C5KT 4YJ2E 3S7BA 1UX4A 4KBMB 2UWJG 4XZ4A 1E8ZA 2YHCA 3MJWA 3F31A 2NW9A 3E4BA 3L6AA 3N9QA 3T8MA 3FH8A 3TG5A 3NBXX 2X9WA 2LSGA 2GK9A 2E9XA 4EZKA 1IJ5A 3ML9A 1YKEB 1LVFA 4I1AA 1JWGA 4TZ4C 3IBPA 2QFCA 3IKOB 3VHLA 3ZIMA 2WXNA 4J8SA 1B7TA 5JR9B 4YHJA 4ERRA 4H9PC 4PDXA 4DO0A 2KNDA 2ONDA 3PUGA 2L6JA 1S94A 3TL5A 4OFZA 1IYGA 3N9PA 4AEZC 1E7VA 3PNLB 3PS6A 4JC8A 3KDSE 1H7CA 4L23A 3FXEB 3ZN1B 2G0UA 1D0YA 2LSYA 2PM6A 5LJNA 1NZNA 5JHBA 1MNDA 4CEMA 2V7KA 4JEHA 2K5BB 2VKOA 3LVQE 3ZC0A 3HA4A 2LO6A 3D9KA 4JUYA 2XRYA 2XCBA 4EZLA 1OWMA 3T8OA 3FULA 4H7XA 4KUMB 5HWYA 2KCKA 2V4LA 3CVNA 3ZLIA 4B89A 3QNKA 4DLOA 3IHVA 3ZMZB 4PUCA 4JA7A 4XKCA 4KVMA 3C98A 1NA0A 1TJFA 2CHWA 1E7UA 5LJMA 2B1EA 5FXXA 2RG8A 5JDLA 2C0LA 2W00A 3PNTB 3QWPA 4LEUA 5LP6E 2V0PA 4IE0A 1FMWA 3CKBA 3G2VA 3FUIA 3CQXC 4X1IE 2BDEA 3PVLA 2XRZA 2X9XA 4B8CB 3IV0A 4B8AA 2MBGA 1MHQA 5JR9C 2IOSA 3RYCE 4HORA 4GZ5A 2WB2A 4AVXA 2NTYA 2LAIA 4G11A 3E22E 2IAKA 3IEGA 5LGUB 3CPZA 3MEKA 3SWHA 2WQHA 4EZHA 3OXLA 5G2NA 4GA2A 5L3FB 3RU0A 4AJWA 1IHGA 4I4TE 2VB6A 3ETVA 1UG3A 1SZAA 5HXSA 4CDNA 3NZPA 2N2NA 3UT4A 5LNKA 3O4XE 2WVIA 1DVPA 4WNGA 2D5UA 1BR0A 2EHOA 3L22A 1WY6A 3SS1A 3PRZA 1TJCA 2IU1A 2WXOA 4CRWA 4DK5A 2CCQA 3ASGA 5EK3A 2LM9A 2PG8A 2JJ9A 4XZCA 5KJNA 5LOZA 5KJKA 3PUAA 4IN3B 3WAKA 2C2LA 4L2LA 3CR3A 4UWKA 2WMOA 4Z8XA 3J9X1 1HF8A 3CWZB 2FO7A 5HXRA 4FI5A 4LCTA 1MNEA 3UUNA 2BTDA 1HXIA 3APDA 3D9NA 3HVEA 4HVBA 3MZKB 3SRZA 1BR4A 3ZMVB 4YNDA 3D9PA 2YQ8A 1SHZC 3VTYA 4H63H 2HYZA 3H3AA 4UVAB 2HPJA 2WXPA 2Q9QA 2E9XB 2XQYA 3FTXA 3MGBA 4BTBA 5JDNA 3FTSA 1Y6IA 2YU2A 4L2YA 2DWKA 2D2SA 3HKDE 2LSJA 2DNXA 2VSXE 4PFOA 4WAFA 3AU4A 2CXFA 2M67A 3RO3A 3LYAA 2UXNB 5FQ4A 5IHYA 5LCYA 2P58C 5LA6E 4NACA 4WWPA 4XKBA 2KWHA 3NF1A 4V3IA 4K0UA 3MJXA 2R17C 4CI1B 3EUHA 2LJLA 5LGTB 3VLDA 4P09A 5BW8C 3UMVA 3ZPJA 5AFUL 1IZNB 1ZEEA 2HO1A 2CMRA 4HOQA 4XI0A 4HGAA 3BQKA 4NUUA 3TGOA 4ANXA 4HFVA 1N54A 3AA0B 1D0ZA 1YW0A 1HS6A 3ML8A 4PW8A 4JVSA 3NRXA 2MTQA 2D0UA 4UWFA 2L0TB 3C98B 2WAUA 3VLEA 3O48A 2E9XC 4JPSA 1Z6TA 3LJCA 4U04A 3ZHEA 3K3NA 1OWAA 1NAFA 2IJGX 5CCMA 2WXFA 4B0ZA 2P9BA 2CXDA 4DJAA 2A5UA 1DNPA 4BA9A 4H63V 5FMNA 1FVHA 1U5PA 3G2SA 3LXUX 5DQVA 5A1LA 2A3DA 1SZ9A 4HFGA 1H6KA 2GRMA 2YNQA 3P2BA 2EHOB 5ARFA 3SI5A 3Q4AB 4G2AA 4ISTA 4Q96A 4O4IE 5LBQB 4ANVA 3EDVA 3K9IA 2CHZA 4MALA 4YLHA 2ES0A 3QWWA 3D9JA 4QX8B 3LPZA 3FP3A 4GZDA 2V5FA 4P0BA 5JJTA 5TAOA 4BTAA 5BV1A 5HXCA 5BNWA 3HKEE 2L0IA 3FHNA 5AYWD 3HVEB 2ZMAA 4N39A 3C64A 4IE7A 5H6RB 2JEKA 4PJNA 3CLJA 3VKHA 4I9CA 1IQUA 2SPCA 5AENA 2Q9QB 1EDUA 5HI7A 2LAHA 4URKA 5KMGP 2J9QA 1S0PA 5J90A 4KYOB 3S7JA 2X6HA 3ZMSB 2PQRA 5FZSA 2J07A 3FTYA 2E9XD 2JRKA 2X66A 3CVPA 2E2EA 5M72A 4ZHQE 1IQRA 4IE4A 4GPKA 2XAGB 3AA6B 3TJPA 4AOFA 4JHRA 2XQ0A 4U0UA 4IIJE 2EHOC 1PY1A 3PE0A 1WAO1 2LEHA 1OWPA 2I1JA 3CSFA 4WNDA 4XI9A 5FP3A 4I1MA 4BX9A 5EZYE 4AXHA 3G2TA 2AXUA 2AVPA 4UV8B 2Y3AA 4X1YE 3MKRA 4YJ3E 4Q69A 3GWHA 4XX5A 4APFA 4CT4A 3ZEFA 2KT9A 1UX5A 5DABA 5LP0A 1P5QA 4KMOA 1SA0E 5J2TE 4LRZA 3Q49B 1FEWA 2PQNA 2IC9A 3PUSA 5DJQC 2J4BA 3MACA 4U63A 3N2OA 2FEZA 5T4YA 2Q9QC 1ZU2A 2UXXB 5FJYA 4FJOA 1IJ6A 4JEUA 1QSDA 3FHEA 3RK6A 5ETWA 3AS4A 2J08A 3ZHEB 3BG1B 3C4ZA 3KFWX 4EXTA 4EZJA 3UUXA 5F8PA 4PJMA 5LFAA 4OK0A 5BPPA 2XAFB 3QAQA 3FU5A 3SOLA 5HWXA 2VKJA 2KCVA 2MRIA 3U4TA 3NRYA 4ZS2A 3I0QA 4IULA 4I6EA 4I9EA 3OJAA 3LKUA 4DBRA 1GW6A 4ANUA 1AJ3A 4AKHA 2WXIA 4R7LA 4F6RC 3VLFA 3BK9A 5A7DB 2PBIA 3ESKA 3Q9DA 4EYUA 2XASB 2UY1A 3CX7B 3IEEA 1HU3A 5ANLA 3HL6A 4K0RA 3FY4A 3U66A 4ISSA 4GOUA 3CVRA 3ESLA 5LGNB 4N2QA 3NZUA 3OKQA 3MV3B 3A5XA 4JHJA 3CVWA 3KV6A 4FHJA 3MA9A 3RRNB 4CXYA 3HKCE 4WWOA 2EHOD 1H0AA 2QGSA 4O6FA 4GAAA 5GONE 4O8SA 3S7DA 3QK6A 3PU3A 4MFRA 4UIGA 3CQCB 4AM9A 2H3RA 5DQWA 4GYSA 4MS6A 4DNDA 2C5IT 5KDMC 4BX8A 3PEUB 3ZCIA 3EHMA 3LFMA 3ZW3A 2VSOE 3PE4A 4GK0E 3OXGA 4AKGA 4EPZA 1ZHCA 3TAXA 2RD0A 2JLBA 3KVBA 1BPOA 2NWBA 2DLRA 3OYXA 2N9DA 1ZBPA 3RIBA 1ELRA 3P7IA 3H37A 3N2KE 3MA5A 1WRDA 4NUVA 2Q9QD 2ZLYA 3D3MA 3UULA 3SBTB 3K3OA 5HXEA 3ASFA 2J4DA 2DWGA 3FUJA 2CWYA 2OA5A 4LUNU 1HG5A 5KJLA 4UQYA 2VSNA 1G8XA 3ZJ2A 4FLHA 5CCLA 3BQLA 4E85A 5JJ7A 3QWVA 4I43A 3ULQA 3FUKA 3P1UA 3R6NA 3ZN0B 3CMLA 5JDGA 2X6KA 3ZEFB 4G24A 3IHYA 2LOSA 3DPDA 3MCXA 3CVXA 1BR1A 4UI9J 1JWFA 2XCCA 3FTWA 3FUNA 2VGYA 2KXPB 4A1GA 2FULA 2BVLA 5FXZA 5D0OD 4OYSA 4DI3A 2LSUA 4EOZB 5H6QB 4J6IA 3C4WA 4C91A 4HN9A 4JEUB 4QWNB 3N9LA 4ZI3D 1EZ3A 3GZ2A 3B57A 5BUZA 3PH0C 4WBOA 2IF4A 3CSTA 1WYCA 3UUXB 1HX8A 4FJYA 2I2OA 5EK4A 4XBFB 4IDZA 3AAEB 4O4LE 4OYKA 5LX8A 4ANJA 2V1DB 3JUIA 3AVRA 3N9NA 2PJQA 4ANWA 5G55A 3N9MA 4QKNA 4U8HA 3RPUA 3QUJA 2UY1B 1E8WA 4BJMA 1Y64B 3FXDB 3KAEA 5T3RA 5CB4E 3TXNA 4EB6E 2LSVA 3VTXA 4DBQA 5ADXL 3I9YA 1Z3XA 4HS2A 3O1JA 4H9SE 2NW8A 5J2UE 1MIYA 3PUQA 1US7B 4X20E 4J8FA 3NZSA 2WXLA 2X38A 3EIJA 3VKGA 1WYBA 3EIQC 2IC6A 2XTLA 2NTXA 3CHSA 3I9WA 4P0AA 3FEYA 4HOTA 1ELWA 2OVFA 1KT0A 2LT3A 3DJBA 4PFPA 5JHAA 4HOUA 3FUMA 2X6FA 3RRCA 2IONA 3RH3A 3AS5A 5L3BB 1B89A 5LXTE 3K3QC 2CFUA 3UX4A 3D9OA 2K9AA 3QJZA 4D10C 3CK7A 4PJLA 1HTJF 4GA0A 3FB2A 4CGWA 3FWVA 4KMCA 4F1SA 2WXMA 2XPZA 4GZCA 2RP4A 4RG9A 3KV5A 4A1SA 4CXWA 3ZYLA 4UQZA 4OVVA 2VWAA 5ARGA 5FWQA 3U9WA 2L9BA 2XGMA 3RRUA 3CVQA 4KXKB 1EF1C 4LERA 3MKDA 2LOPA 2IW5B 4GMJA 3FUEA 2CWOA 2H7VC 2KMFA 3QK0A 4ILUA 3V5UA 4WWNA 1OWNA 3FBLA 5JRCA 3D0TA 4QXHB 3FTVA 3WI3A 3MK7C 4MHCA 2Y4UA 4TUUA 1YKHB 2FI7A 2YHEA 1G73A 2ZM2A 4IHJE 3U64A 4H9QC 2E8IA 4F3VA 1T98A 2L9QA 4N2SA 3Q2MA 2J49A 3CHMA 4I43B 4PK4A 2VL8A 4MLKA 2VGXA 5LOVE 3N5LA 2Y48B 2MYSA 3PTRB 4TV9E 5FXWA 2XAJB 3Q47B 5EDSA 4X1KE 4FHKA 4BJNA 4L1BA 3LEWA 3K8PC 3PDNA 1UJJA 4TUYE 5JDQA 2NOXA 3OAWA 3M65A 3RKOA 4WBNE 1V9DA 2KC7A 3B7UX 4GA1A 4ILHB 5AJLA 5C1DA 4ILGA 2KLQA 2XHEA 2W61A 3ENEA 3ZYMA 4UWHA 2CFZA 4N3BA 1FVFA 1X79A 3R84B 4ASKA 4FC8A 1LRZA 2ODUA 4PS3A 3JC6C 3CEQA 3PREA 2WXHA 2A2FX 3BQIA 3LK42 2A4ZA 4TV3A 5L3EB 5D0QD 4JHKA 4FA6A 4XE0A 2L3LA 4WNKA 5HAXA 1WLXA 4ATGA 2LSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFG A;  3ZYK A;  1X5B A;  1EDU A;  3LDZ A;  5CMW A;  2DCP A;  2MOW A;  3D9J A;  1HFA A;  1XGW A;  4NAC A;  1EYH A;  4GZD A;  1HF8 A;  1PY1 A;  3G2V A;  4FU3 A;  1SZ9 A;  3D9L A;  4Q94 A;  1JWG A;  3ONL A;  1UJK A;  3ONK A;  5LP0 A;  4GZC A;  5J08 A;  2KM4 A;  2V8S E;  1ELK A;  1HG5 A;  2L0I A;  3ZYL A;  1JPL A;  3D9N A;  1SZA A;  3D9M A;  4JXT A;  1MHQ A;  4FLB A;  4Q96 A;  2LO6 A;  1HG2 A;  3D9K A;  3D9I A;  3G2T A;  3D9P A;  5CMY A;  1JWF A;  3G2S A;  1LF8 A;  2BF0 X;  3ZYM A;  3G2U A;  1H0A A;  2DIW A;  1VDY A;  2QY7 A;  2L0T B;  3CLJ A;  3D9O A;  3G2W A;  3RRU A;  4AVX A;  5LOZ A;  1HX8 A;  1UJJ A;  3ZYQ A;  1INZ A;  1JUQ A;  1DVP A; 
#chains in the Genus database with same CATH topology
 5D66 A;  2YU1 A;  3QKY A;  2MOW A;  3APC A;  5LMN T;  1QLB A;  3RRM B;  5E76 A;  4YTM A;  4EEC A;  1X81 A;  2X67 A;  4ATZ D;  2WZI A;  4L7T A;  4B3S T;  4G8L A;  4APO A;  4JI8 T;  2KM4 A;  2J4G A;  1ZKE A;  3PUR A;  1ZV4 X;  2BKK B;  4AQF A;  5L3C B;  3D9I A;  1W0B A;  2WQ6 A;  4PJJ A;  3GW4 A;  3CV0 A;  3G2U A;  3CGH A;  5FVK A;  4GIW A;  3SZ7 A;  2ODV A;  4TNV A;  3RHW A;  1OXJ A;  5JQG E;  2XAQ B;  3B7S A;  3ZFW A;  3OPC A;  2ZM8 A;  1KNZ A;  3O1I A;  4HLE A;  4M7C A;  2WM9 A;  5FIN A;  2I59 A;  1SUM B;  1YQ4 A;  3HXB A;  5ANR A;  4FAD A;  2X68 A;  3EUV A;  4BAY B;  4LFC T;  2VQ2 A;  4O1O A;  4KX6 A;  3AG4 E;  3HR0 A;  1Z8U A;  3DP7 A;  1UUS A;  3Q9N C;  4JXT A;  3W9F A;  2CG3 A;  3CHR A;  4EZ4 A;  4EAH A;  4C0E A;  5BMV E;  3L17 A;  3AA7 B;  5CFB A;  2IFU A;  4CZZ B;  5LHH B;  2AJA A;  2Z6E A;  3AED A;  4XIF A;  4DV0 T;  5LG4 A;  4DPR A;  4EQF A;  2FUP A;  3L9T A;  2X6I A;  2FBW A;  1N0R A;  1HS7 A;  4XAX B;  3TG4 A;  1HCI A;  4WNE A;  5C8Y E;  1O1S A;  5JJ6 A;  3CIA A;  4DV7 T;  5JA4 D;  3FTU A;  3D9M A;  1L0V A;  2LSI A;  2VUR A;  4MRU A;  4WUY A;  3TWT A;  3DWL G;  4GK5 E;  2WWU A;  3CKD A;  5L2L A;  5G05 C;  4U0Z A;  3RYF E;  1WCR A;  3UQ3 A;  4QFV A;  3RKV A;  1ZOY A;  1N4Q A;  1TNZ A;  3C50 A;  3C3Q A;  2DBA A;  5E75 A;  3C4X A;  2NSZ A;  2DI4 A;  2KZ7 B;  5JRC B;  3ETU A;  3T5X A;  2NW7 A;  3MZL B;  3FH7 A;  1L5J A;  3GZS A;  1H19 A;  1XNF A;  4JLE A;  3AEE A;  4ZS3 A;  1TYQ G;  4O2A E;  4F8H A;  3AAA B;  1LF8 A;  3N71 A;  2YIN A;  3FU3 A;  3NB2 A;  4N5Q A;  2YDQ A;  4HXI A;  4J7W A;  3JC6 D;  4B6X A;  5C3J A;  4UWG A;  3PJA J;  5FZR A;  4Y6W A;  4RG6 A;  2ZU6 B;  4MKT A;  1D0X A;  3PZ1 A;  2PTF A;  5IWA T;  1E8X A;  2VGX B;  3TWQ A;  4HWH A;  1LKX A;  4N3C A;  3AAI A;  1MMN A;  1ELK A;  3EI0 A;  3HXF A;  2PNN A;  3HIZ A;  2ZM0 A;  3E0Z A;  3SFE A;  3L16 A;  4N3A A;  3I5P A;  1JCQ A;  1N52 A;  2CA5 A;  1VOM A;  2X9H A;  4TX5 A;  4TWH A;  1VDY A;  2YN6 A;  3KS2 A;  2WBL A;  5FNV E;  2NP9 A;  2W66 A;  3PU8 A;  1QUU A;  2X9Y A;  3TWV A;  2Q7F A;  4TN7 B;  5FYM A;  3RIU C;  4YVQ C;  4KVO A;  1Y8M A;  3R7R A;  1XDO A;  4A3T A;  2XS8 A;  2XHE B;  1MMA A;  4UI9 C;  4B3M T;  4C0M A;  3CKC A;  3S4U A;  3ZGQ A;  4M3O A;  3MV2 B;  3L13 A;  5FIO A;  3CVU A;  4L0R A;  3KV9 A;  5HEG A;  2QA7 A;  2XPI A;  1HO8 A;  4UXN B;  2R6G F;  1J5W A;  3KD7 A;  5LCW C;  1MIW A;  1N0Q A;  5HCM A;  2ILR A;  1HR0 T;  4U8V D;  1M7K A;  1YXR A;  2LE8 A;  2E0I A;  4BSX A;  2V8S E;  3UM2 A;  1MJ0 A;  3WAJ A;  4EHM A;  3WXX A;  3O9X A;  1N4R A;  4U07 A;  4AY6 A;  3ZJ1 A;  4HTE A;  3ASD A;  4K5B A;  2V7J A;  4RSY A;  3AAA C;  3FU0 A;  5ENO D;  4HB5 A;  4A3V A;  2BKO A;  4B94 A;  2JQQ A;  5IY5 E;  3R9A B;  4GML A;  5EKQ D;  4GTT A;  4IRU A;  4HE8 A;  3JQ1 A;  2DCP A;  3TLS A;  4ZXL A;  3AEG A;  4QH1 A;  3OYZ A;  2VJ8 A;  3HKB E;  2XEV A;  2XAH B;  3GN5 A;  1U3D A;  1NEK A;  2HE0 A;  4YTN A;  4CN4 A;  1W3B A;  5FY7 A;  4DV5 T;  1OCR E;  3LBX A;  1N32 T;  4ZI3 C;  1OWO A;  5A23 A;  1SVX A;  3WG7 E;  2VTB A;  1BR2 A;  3UU8 A;  2FJA A;  2E5L T;  2ZIR A;  4CT0 A;  4ILI A;  2KSR A;  3RLF F;  3ABM E;  4ZI7 E;  2ACX A;  2C0S A;  5JRE A;  3DEP A;  5EK2 A;  1E90 A;  3LJN A;  3QDN A;  2MHK A;  3ONL C;  4PK5 A;  3LK2 B;  3UKU G;  4CDM A;  4DX2 A;  4H7Y A;  3OXF A;  4ACK A;  3KBT A;  4JL0 A;  2AW6 A;  2C5J A;  2KZT A;  2DIW A;  5JDM A;  3G2W A;  4GYY A;  5G05 J;  4BES A;  3LVR E;  2JMK A;  2I9C A;  2YEV C;  3PJA A;  2WXJ A;  3GMI A;  2MOZ A;  3ISM C;  3Q15 A;  4IYP A;  1V55 E;  4HEA A;  4ILB A;  2BS2 A;  4G26 A;  2OVB A;  5AQ9 A;  4TV8 E;  5L3G B;  2ZGD A;  2XQA A;  4AP2 A;  1S35 A;  3RO2 A;  4EBA A;  2W0G A;  2GRP B;  5LG3 A;  4UVB B;  4G1T A;  3Q5E A;  4K03 A;  2MYO A;  1UGO A;  4ABN A;  3ZC1 A;  5D2M C;  4F53 A;  3HXD A;  2R5S A;  2AXZ A;  2XGS A;  1WM5 A;  1IBL T;  5CMW A;  4UF0 A;  5F5W A;  2NYJ A;  3F57 A;  4E7S A;  1A17 A;  3HRA A;  5JDF A;  3RJV A;  1UN9 A;  1TNB A;  3E32 A;  3ZST A;  3R9M A;  1N95 A;  5J08 A;  4IT4 A;  4CGV A;  3HHM A;  1KPS B;  3TLV A;  3BEE A;  3CVL A;  3QB5 K;  4W9R A;  3AE6 A;  4AQF C;  3LY8 A;  5AQI B;  5HS0 A;  5CA0 E;  2UXD T;  4LF9 T;  3TXM A;  2GRL A;  3ZMU B;  2IOL A;  3SFY A;  1JUQ A;  4L9I A;  4CQI A;  4AXP A;  2XQ5 A;  2CE7 A;  3S7F A;  5HEJ A;  3GA8 A;  2WXK A;  1KF6 A;  4G23 A;  4PS7 A;  1OWL A;  2KBX A;  4KP3 C;  4WW0 A;  5JH7 E;  4TRQ A;  1YD8 G;  3EU5 A;  3TKL B;  1W0A A;  4G63 A;  3CX8 B;  3X1D A;  2AWI A;  2XPY A;  5CBO A;  4GYR A;  3OBV E;  4QXC B;  4C90 A;  1E96 B;  2Y6X A;  4CCA A;  3EAB A;  3CHP A;  4U72 A;  5AQF B;  3RC8 A;  2QYJ A;  3ASH A;  1J1J A;  2CBI A;  3O4Z A;  4H9N C;  1H2T C;  3LG7 A;  2L6B A;  2IY0 C;  2HM8 A;  2IQC A;  3ZYK A;  3CK6 A;  2WU2 A;  4DR3 T;  4JI4 T;  3RX6 A;  1D8E A;  5LCW J;  3JQ0 A;  1HE8 A;  3S2A A;  4YSZ A;  4O4H E;  4UEL A;  4P29 A;  2E5V A;  2V5D A;  2Y8D A;  3MKQ A;  4YT0 A;  4AI6 A;  4G25 A;  2XGO A;  5FZQ A;  3KIN B;  2W67 A;  3AA1 B;  5ITZ F;  2GGF A;  4J0U A;  4I2Z A;  3HXE A;  4V1A v;  1INZ A;  3AE2 A;  3RYH E;  1LVK A;  3PUK A;  3B7T A;  1IAP A;  3CQG B;  3EHZ A;  4IE6 A;  4OHF A;  2KWI B;  3UU3 A;  3EHQ A;  4A56 A;  3CHO A;  2WSS V;  3ZMT B;  2ZIS A;  4JV5 T;  3UIP C;  5EX0 A;  4FJZ A;  3LJ3 A;  2M6B A;  1E8Y A;  3UTK A;  4PS8 A;  4A63 B;  1UUR A;  2HN2 A;  1UW4 B;  4U74 A;  1FT2 A;  1FJG T;  3PE3 A;  4KBQ A;  5CHE E;  1HNZ T;  2N1G A;  2V26 A;  5ENN A;  2CM0 A;  5LYJ E;  1BU9 A;  3UPV A;  3ZT7 A;  4AKR B;  2FF4 A;  1G3N B;  5AQT B;  5AQK B;  2CEA A;  1XMQ T;  3LY7 A;  2VSY A;  4KZ0 A;  4N5C A;  3GN5 B;  4HFE A;  3FEX A;  5AQJ B;  3QB2 A;  3EVY A;  1E2A A;  2X6J A;  3EHN A;  3LBX B;  5JVD E;  4DID B;  3ZYQ A;  3CVV A;  4BSZ B;  4MLP A;  3IHR A;  5FKY A;  5BV0 A;  3NOG D;  2VTB B;  1TNU A;  1N94 A;  3P8C D;  3BU8 A;  1Z0P A;  4DR2 T;  3MXZ A;  3TWW A;  3Q5X A;  4ME2 A;  3D9L A;  4WYV A;  2V7I A;  1SW6 A;  3IXE A;  4Q94 A;  2FJD A;  1D1C A;  1JNZ A;  4OYJ A;  4AIF A;  2JQK A;  1TNY A;  3UI2 A;  3CX6 B;  3LY9 A;  1PAQ A;  4HI9 A;  5L4H A;  1QQE A;  1S64 A;  3I1A A;  2KZT B;  1MIV A;  4JW1 A;  4L5G A;  1KZO A;  1S63 A;  5HXH A;  3AE3 A;  4PNI A;  2OCC E;  5DBK A;  3L54 A;  1WG0 A;  2FBN A;  4HOS A;  2CLY B;  3GYZ A;  4ZI2 C;  4ACL A;  5AQN B;  2CG2 A;  5FQ7 A;  2LRK A;  1WR6 A;  5DIZ A;  1CUN A;  3PDY A;  4IDP A;  2VYI A;  4GCN A;  1KNR A;  2HR2 A;  1DU2 A;  3C51 A;  5L3D B;  2DCF A;  5KX5 E;  1E7P A;  1YCS B;  3SF4 A;  2V7M A;  5FL0 A;  3UU5 A;  2LRL A;  4ADZ A;  3GZ1 A;  4GTM A;  3ZT5 A;  4UF0 B;  4EIW A;  3RIF A;  1EYH A;  5B1B E;  3UM1 A;  4CI2 B;  1OED A;  1E1H B;  2V4H C;  3V5S A;  4PK6 A;  4LNB A;  4Z91 A;  4JA9 A;  2DWZ A;  2WQ7 A;  2CRB A;  3F2E A;  5LMU T;  3EHR A;  4AV7 A;  1SQM A;  4ZOL E;  5BR8 T;  4I17 A;  4O4J E;  4YSX A;  2XEN A;  5AQU B;  4IL9 A;  3KV4 A;  4U0S A;  3HYM B;  3QNU A;  2D0T A;  3PZ4 A;  5LHG B;  1XDP A;  4BT8 A;  4UQX A;  3I0O A;  5CEC B;  5ENQ D;  4CXX A;  4QXB B;  3SBS A;  2Y4T A;  3L3P A;  4B3R T;  2J09 A;  3CVY A;  3SHF A;  2WXR A;  2GRR B;  2C0M A;  3DSX A;  4JEH B;  2V7L A;  3JCK C;  3SFZ A;  2KCL A;  1CHU A;  4RVB A;  2WDV A;  1HG2 A;  4OAV B;  2WPV A;  4ZEY A;  4YDY A;  3B13 A;  3ZNG A;  3TWR A;  5F3J A;  4I50 E;  2WXG A;  3V2X A;  3ZPO A;  4GU5 A;  3R7Q A;  1DCE A;  5G04 C;  4J8D A;  3LDZ A;  1YMP A;  2EQX A;  3E34 A;  2VQE T;  1MMG A;  4I6J A;  5FXV A;  4GB9 A;  2CLY C;  3ONL A;  1D1B A;  2PM7 A;  2WXQ A;  3JYS A;  2EIN E;  3O1H A;  5FY1 A;  2J8S D;  4AY5 A;  1HNW T;  3MKQ B;  3NZQ A;  2ACZ A;  2YOE A;  5M4Y A;  5KCM A;  3ZCJ A;  4MBQ A;  4AKL A;  2DHR A;  1H2U A;  2OEW A;  2DYR E;  2XZT G;  1UCU A;  2YK0 A;  1U3C A;  3Q5W A;  2K48 A;  4F1P A;  5C2T A;  1XGW A;  3AEA A;  4MBG A;  2WDR A;  3AU5 A;  2FO1 E;  4L9P A;  3E08 A;  2W4X A;  1O3X A;  5BT1 A;  4RQI A;  3EDT B;  3VU7 H;  4UVC B;  3RRW A;  3SD5 A;  2PZI A;  3QC1 A;  2BF0 X;  4ZI2 D;  3BG0 B;  3FU6 A;  5IYZ E;  2Y69 E;  2J47 A;  2AE9 A;  4DV6 T;  4BT9 A;  5LHI B;  3OTN A;  1S70 B;  1HZ4 A;  3QAR A;  2XJ7 A;  4H9O C;  5J1G A;  4GYO A;  1OED E;  5ABH A;  1HFA A;  4DMW A;  5JDH A;  3AXJ A;  2NXP A;  3FBZ A;  1I6Z A;  4KZC A;  2X0L B;  3ZSS A;  4I1O B;  1J5E T;  1A5E A;  3AG3 E;  3N2G E;  5ENT D;  3PUW F;  4X65 T;  5E0O A;  3SGH A;  5LB7 B;  4PAG A;  4H9R C;  3VRB A;  4PH4 B;  3APF A;  4NRH B;  2GW1 A;  1OXZ A;  2W62 A;  4FUL A;  2DL1 A;  5AIJ A;  2KAT A;  3ZRH A;  3ANW A;  2BBH A;  2I1K A;  3QOU A;  5FY0 A;  2I6H A;  3U78 A;  2VVS A;  3FH5 A;  5A6C A;  3DTO A;  3NAW A;  4TNW A;  3Q5M A;  3B95 A;  3SNX A;  3TWX A;  1TN6 A;  3AEB A;  2OOE A;  1UN8 A;  4JI3 T;  3URZ A;  2J1D G;  4WNF A;  1TEZ A;  3LS8 A;  2CHX A;  2K24 A;  3T1H T;  4X66 T;  3CIR A;  3HI2 A;  3ZXP A;  2NR4 A;  3FZH B;  3QB5 A;  2H6H A;  2VAS A;  4EYY R;  1XNQ T;  2F8X K;  4CI3 B;  4OVU A;  1T72 A;  2HH7 A;  4IRE A;  4HFC A;  4FLB A;  2H6G A;  4DX7 D;  1Z3Y A;  1MMD A;  3FDH A;  3I4G A;  4DI4 A;  2NC9 A;  5CA1 E;  2QY7 A;  2WMN A;  3EJN A;  3ONK A;  4DVD A;  4B93 B;  4I2W A;  4YFS A;  3AS8 A;  5LBM A;  3ZXS A;  3W15 B;  5T8I A;  4K5C A;  1OT8 A;  3UT5 E;  4GZ3 A;  4AIU A;  4X8Q A;  3V30 A;  1YA0 A;  1KT1 A;  1OED B;  4E7Z A;  4I6G A;  4NXN T;  1QZ2 A;  3FUH A;  3J7Y q;  4NUR A;  1U4Q A;  3ZN3 A;  4G2V A;  4U7Y A;  5JR9 A;  2LHR A;  3J5Q B;  5FT9 A;  3TLW A;  3UFE A;  1NWM X;  1QNF A;  4HFI A;  4HFB A;  4LF4 T;  3PZD A;  4YVO A;  5HEO A;  1KLX A;  2XM1 A;  5FTP A;  3L39 A;  4IGU A;  4YXD A;  4C48 B;  4F7A A;  1NA3 A;  2PL2 A;  5G04 J;  2W63 A;  2XEE A;  5AJD A;  4HWF A;  1D1A A;  1VRB A;  3KBU A;  3RYI E;  3Q73 A;  3IF8 B;  4JI0 T;  4HQD A;  2VKH A;  3FFL A;  4AKI A;  4AQY T;  3L8R A;  4JBW F;  1UJK A;  3JAF A;  3HDX A;  2BUG A;  3KEZ A;  2XQ8 A;  5ABE A;  2VKD A;  4EBA G;  4FP7 A;  3L09 A;  2LNI A;  4N78 D;  3UUM A;  3QC9 A;  2VK9 A;  3U3W A;  2WCA A;  5HYA A;  3JUE A;  1PC2 A;  1RW2 A;  2IO3 C;  3CK8 A;  4UV9 B;  4UI9 K;  3ONX A;  4ILA A;  3MX3 A;  3AB3 B;  2P9S G;  2AXV A;  3PUJ A;  2H7O A;  4O2B E;  3FZF B;  3LK3 B;  4KT6 B;  1H6P A;  4DRX E;  2RA1 A;  4A55 A;  1JCR A;  4JZY A;  4M1P A;  4GYW A;  1JPL A;  2JMH A;  3FZM B;  4AQG A;  2BZB A;  4IE5 A;  4GMR A;  3PV0 F;  4CN6 A;  3MYV A;  3LCA A;  1FMV A;  3KVA A;  5FL1 A;  2QVA A;  4OAU C;  1NP7 A;  3NWI A;  2CXL A;  3EDU A;  4J8E A;  4HWD A;  2R59 A;  4JI6 T;  5FQ8 A;  4C9B B;  3FUF A;  2M63 A;  3UU6 A;  1EPU A;  3CK9 A;  4BEP A;  1OED C;  2JAB A;  3DST A;  2MPK A;  2X3M A;  1AP7 A;  3NOC D;  4BWR A;  4UEM A;  4CDR A;  2L8K A;  4UWL A;  3RC3 A;  2DZO A;  4DLQ A;  3DSU A;  2BBJ A;  5C2Y A;  5AQL B;  4J2C A;  3I4R B;  2HPL A;  3N9O A;  4QHO A;  3FUD A;  2XS1 A;  5KJM A;  4GZ6 A;  3FTZ A;  5B3S E;  1XWM A;  2X51 A;  1X5B A;  4HKA A;  2KIN B;  2OV8 A;  3CHQ A;  4E6H A;  1MQS A;  2PFV A;  3PEV B;  4NQ0 A;  3ONJ A;  3UQ7 A;  1BI8 B;  1OUV A;  3NQP A;  3AXJ B;  3IBE A;  3ZKR A;  2BVM A;  2XUE A;  3DBS A;  1MX2 A;  4U96 D;  3UT7 A;  3JCF A;  2ETA A;  1IBM T;  2JPF A;  4TWD A;  3L08 A;  3X2Q E;  3U3I A;  4GCO A;  4BY6 A;  1KZP A;  3T5V A;  3I3N A;  5FQ6 A;  1MX6 A;  3B7R L;  3BQO A;  4QX7 B;  4I55 E;  2A72 A;  3ANW B;  4EEB A;  2LHN A;  4FU3 A;  3AVS A;  4OX9 T;  1FCH A;  3ZVV A;  5H7P A;  4HFH A;  1YYH A;  3UT8 A;  4Y6C A;  5EX3 A;  1FIO A;  4HLL A;  4DMV A;  4BFR A;  1HH8 A;  3VRA A;  5CMY A;  2LKG A;  1KK7 A;  5HQ8 A;  5BXU A;  1H2V C;  1XMO T;  2OLT A;  1N4P A;  5KNH D;  3ABK E;  4DX1 A;  2C5K T;  4DUZ T;  4YJ2 E;  3S7B A;  3DXK G;  3P4S A;  2IO2 C;  1UX4 A;  2JQH A;  4KBM B;  2UWJ G;  3AE7 A;  5AQB A;  4XZ4 A;  4DR6 T;  4GTR A;  1E8Z A;  2IHR 1;  4KI0 F;  2YHC A;  2QC9 A;  3MJW A;  5EYP F;  3F31 A;  1NI1 A;  2B76 A;  3AJI A;  2NW9 A;  3E4B A;  3L6A A;  2BKN A;  3N9Q A;  3T8M A;  3JAD A;  3FH8 A;  2FJB A;  3TG5 A;  3NBX X;  1FT1 A;  2X9W A;  2P9N G;  2LSG A;  2R03 A;  2GK9 A;  2E9X A;  4EZK A;  1IJ5 A;  3NVO A;  3ML9 A;  1YKE B;  3IA3 A;  1LVF A;  4DR5 T;  1N33 T;  1Q2Z A;  4I1A A;  3A8Y C;  4TZ4 C;  1JWG A;  3IBP A;  2QFC A;  3HXC A;  3IKO B;  3VHL A;  3ZIM A;  2WXN A;  1V54 E;  4J8S A;  1B7T A;  5JR9 B;  3V2O A;  4YHJ A;  4ERR A;  4H9P C;  4PDX A;  4DO0 A;  4YSY A;  2KND A;  2OND A;  3PUG A;  5AQR B;  3L82 A;  2L6J A;  1S94 A;  3TL5 A;  4OFZ A;  1IYG A;  3N9P A;  4AEZ C;  1E7V A;  3PNL B;  3PS6 A;  4JC8 A;  3KDS E;  1H7C A;  3ZUV B;  4L23 A;  3P4P A;  3FXE B;  3ZN1 B;  2G0U A;  1D0Y A;  2LSY A;  2ZM6 T;  2PM6 A;  4LF7 T;  5LJN A;  1NZN A;  5JHB A;  1MND A;  4IDQ A;  4BET A;  4CEM A;  2V7K A;  4JEH A;  2K5B B;  2VKO A;  3LVQ E;  3ZC0 A;  3HA4 A;  1K3Z D;  1VCT A;  2LO6 A;  3D9K A;  3KEA A;  3Q7A A;  1T8B A;  4JUY A;  2XRY A;  4A97 A;  2XCB A;  4EZL A;  1OWM A;  2XZD G;  3HG0 D;  3T8O A;  3FUL A;  4U8Y D;  4H7X A;  3Q9U C;  4KUM B;  2WZH A;  5HWY A;  2KCK A;  2V4L A;  3CVN A;  3ZLI A;  4TWF A;  4GKK T;  4B89 A;  2B0O E;  3QNK A;  4DLO A;  3IHV A;  3ZMZ B;  3LDQ B;  4PUC A;  4JA7 A;  4XKC A;  1OCO E;  4KVM A;  3C98 A;  3SFX A;  5ABG A;  1NA0 A;  1TJF A;  2CHW A;  1E7U A;  5HKP A;  5LJM A;  2B6C A;  2B1E A;  4X62 T;  5FXX A;  2RG8 A;  1O1T A;  5JDL A;  2C0L A;  2W00 A;  3PNT B;  3QWP A;  4LEU A;  5LP6 E;  2V0P A;  4IE0 A;  1FMW A;  2XM2 A;  3CKB A;  3G2V A;  4QH5 A;  1KNP A;  3FUI A;  4ZHB A;  2EIJ E;  3CQX C;  4X1I E;  2BDE A;  3PVL A;  2BS4 A;  2V5C A;  2XRZ A;  2X9X A;  4B8C B;  3IV0 A;  4B8A A;  2MBG A;  1MHQ A;  2WY2 A;  5JR9 C;  2IOS A;  3RYC E;  3ZU7 B;  4HOR A;  4GZ5 A;  2WB2 A;  4AVX A;  5HCJ A;  2NTY A;  3J5P A;  2LAI A;  4G11 A;  3ZT6 A;  5J0Z A;  1DCQ A;  3E22 E;  2IAK A;  3IEG A;  5LGU B;  3CPZ A;  3MEK A;  3SWH A;  5CGM A;  4EZH A;  2WQH A;  3OXL A;  5G2N A;  2WQY A;  4GA2 A;  5L3F B;  3RU0 A;  4AJW A;  1IHG A;  4I4T E;  2VB6 A;  3ETV A;  1SA4 A;  1UG3 A;  3PZ2 A;  1SZA A;  2DYS E;  5HXS A;  4CDN A;  2VL0 A;  3NZP A;  2N2N A;  1NL4 A;  2XPK A;  2F0Y A;  3UT4 A;  5LNK A;  3O4X E;  3AE4 A;  3DSW A;  2WVI A;  1DVP A;  1T7S A;  4WNG A;  2D5U A;  1BR0 A;  1SA5 A;  2XSB A;  1WDY A;  2EHO A;  2H89 A;  3AE1 A;  3L22 A;  4ZZC A;  4LML A;  3SS1 A;  1WY6 A;  3PRZ A;  1TJC A;  4ILC A;  2IU1 A;  2WXO A;  4CRW A;  2EIL E;  4DK5 A;  4DV4 T;  4Z68 A;  2XY8 B;  2H88 A;  1K1B A;  2CCQ A;  3ASG A;  5EK3 A;  2LM9 A;  2PG8 A;  4J8Y A;  2JJ9 A;  2XQ6 A;  4XZC A;  5KJN A;  2OEV A;  5LOZ A;  5KJK A;  2P2C P;  3PUA A;  4IN3 B;  3WAK A;  2C2L A;  3DEO A;  4L2L A;  4GKJ T;  3CR3 A;  4UWK A;  1LTX A;  2WMO A;  4Z8X A;  3J9X 1;  1HF8 A;  3CWZ B;  5AQ7 A;  2FO7 A;  5HXR A;  1QBQ A;  2WB5 A;  4FI5 A;  4LCT A;  1RZ4 A;  1MNE A;  3UUN A;  2EIM E;  2BTD A;  2CHN A;  1HXI A;  3APD A;  3D9N A;  3HVE A;  4HVB A;  3MZK B;  3SRZ A;  1BR4 A;  3ZMV B;  4YND A;  3D9P A;  2YQ8 A;  1SHZ C;  3RSE G;  3VTY A;  1I94 T;  3TLT A;  2LXM A;  4H63 H;  2HYZ A;  3H3A A;  4UVA B;  2HPJ A;  2WXP A;  2RKK A;  2Q9Q A;  2E9X B;  3QOF A;  4LMK A;  2WS3 A;  4GTP A;  2XQY A;  3FTX A;  3MGB A;  4BTB A;  5JDN A;  3C3R A;  3FTS A;  4O60 A;  1Y6I A;  2YU2 A;  4L2Y A;  2DWK A;  2V6Y A;  5KXJ A;  2D2S A;  3HKD E;  1O5M A;  2LSJ A;  5CED B;  2DNX A;  2VSX E;  4PFO A;  4WAF A;  2E2A A;  3AU4 A;  5JTG A;  2CXF A;  4B3T T;  2M67 A;  1NEN A;  3RO3 A;  3LYA A;  2UXN B;  5FQ4 A;  5IHY A;  5HRY A;  5LCY A;  2P58 C;  5LA6 E;  4NAC A;  4WWP A;  4XKB A;  2KWH A;  3NF1 A;  4V3I A;  2JQ9 A;  4A98 A;  1M62 A;  4K0U A;  3MJX A;  2W2U A;  2R17 C;  4CI1 B;  3EUH A;  2LJL A;  5AQS B;  5LGT B;  5CRU A;  3VLD A;  4P09 A;  5BW8 C;  3UMV A;  4TUM A;  3ZPJ A;  5AFU L;  1IZN B;  1ZEE A;  2YKS A;  4Z90 A;  4HNA D;  2HO1 A;  4UUC A;  2CMR A;  3T1Y T;  4HOQ A;  4XI0 A;  4HGA A;  3BQK A;  4NUU A;  3TGO A;  4ANX A;  4HFV A;  1N54 A;  3AA0 B;  4DR1 T;  1D0Z A;  1VCS A;  1YW0 A;  1HS6 A;  3ML8 A;  4PW8 A;  1W09 A;  4JVS A;  3UIO C;  4JI2 T;  2M6I A;  3NRX A;  2A9U A;  2MTQ A;  3KSL A;  2D0U A;  4UWF A;  2L0T B;  2DZN A;  3C98 B;  2WAU A;  3VLE A;  5EIL A;  3O48 A;  2HHH T;  1D9S A;  4JI5 T;  2E9X C;  1K1A A;  1KEY A;  2X0Y A;  4JPS A;  1Z6T A;  3LJC A;  3VR8 A;  4U04 A;  1ZB1 A;  2UU9 T;  3UXG A;  3ASN E;  3A7M A;  3ZHE A;  2I0M A;  2ZXW E;  3K3N A;  4U7I A;  2AXD S;  1OWA A;  1NAF A;  3JAE A;  4EED A;  2P9U G;  5AQO B;  2IJG X;  5CCM A;  4GTV A;  4HI8 A;  2HN1 A;  3AEF A;  4NIQ A;  2WXF A;  2BG9 A;  3D9H A;  4B0Z A;  4ZFH A;  2IIU A;  4U3C A;  2P9B A;  2CXD A;  2CHO A;  4DJA A;  2A5U A;  1AWC B;  4HRL A;  1DNP A;  2R2L A;  3RGL A;  4BA9 A;  4H63 V;  5FMN A;  3PUZ F;  4JYA T;  1FVH A;  1U5P A;  3G2S A;  3LXU X;  5DQV A;  5A1L A;  2A3D A;  1SZ9 A;  1MYO A;  3ULY A;  5EN5 D;  4HFG A;  1H6K A;  2GRM A;  2WWV A;  1TN7 A;  5AN8 A;  2YNQ A;  3P2B A;  2EHO B;  5ARF A;  5KBA A;  2VVN A;  4EV6 A;  2LM2 A;  3SI5 A;  1OCZ E;  3Q4A B;  2YDR A;  3Q5D A;  4G2A A;  4IST A;  4Q96 A;  4O4I E;  2ETC A;  4HRN A;  2VGE A;  5LBQ B;  4ANV A;  2XQ7 A;  3EDV A;  3K9I A;  2CHZ A;  3DPY A;  1X9B A;  4MAL A;  4YDE A;  4YLH A;  2ES0 A;  3QWW A;  2LUH A;  3D9J A;  4QX8 B;  3LPZ A;  3FP3 A;  4GZD A;  2V5F A;  4P0B A;  1N4S A;  5JJT A;  5TAO A;  4BTA A;  5BV1 A;  5HXC A;  2F8Y A;  5BNW A;  3HKE E;  4DV1 T;  5ABF A;  4NXM T;  2L0I A;  3FHN A;  5AYW D;  3HVE B;  2ZMA A;  4N39 A;  2LKH A;  3C64 A;  4IE7 A;  3T8K A;  5H6R B;  2JEK A;  4PJN A;  3CLJ A;  3VKH A;  4I9C A;  1N9A A;  1IQU A;  2QZA A;  4DR4 T;  2SPC A;  2P9P G;  5AEN A;  2Q9Q B;  1EDU A;  2IML A;  5HI7 A;  4RLY A;  2LAH A;  4URK A;  5KMG P;  2V6X A;  2J9Q A;  3H3M A;  1S0P A;  1TN8 A;  5J90 A;  3C72 A;  4KYO B;  3S7J A;  2X6H A;  2V6Y B;  4CZ2 D;  3ZMS B;  2PQR A;  5FZS A;  2J07 A;  3FTY A;  2E9X D;  4U2Y A;  2JRK A;  2WU5 A;  2X66 A;  5FVL A;  1IBK T;  2BKP A;  2E2E A;  3CVP A;  5M72 A;  4ZHQ E;  1IQR A;  4IE4 A;  3P50 A;  2XAG B;  3AA6 B;  4X5T A;  4GPK A;  2RPA A;  2BG9 E;  2IEJ A;  3TJP A;  4XEI G;  4AOF A;  4JHR A;  2XQ0 A;  3C3O A;  4U0U A;  4IIJ E;  2Y0B G;  3UM3 A;  2FJE A;  2EHO C;  1PY1 A;  3PE0 A;  1WAO 1;  4HFD A;  2LEH A;  4YDO A;  1OWP A;  3LSV A;  2I1J A;  5BXO A;  3CSF A;  4WND A;  4XI9 A;  3AEC A;  5FP3 A;  4I1M A;  4BX9 A;  2QRX A;  3EU9 A;  5EZY E;  4AXH A;  3G2T A;  2AXU A;  4WZX A;  2AVP A;  4QQI A;  4UV8 B;  2Y3A A;  3B7B A;  4X1Y E;  3P4Q A;  3MKR A;  4GTQ A;  4YJ3 E;  4Q69 A;  3GWH A;  4XX5 A;  4YDW A;  4APF A;  4JI1 T;  1LD7 A;  4CT4 A;  3ABV A;  3ZEF A;  5HEU A;  2KT9 A;  1UX5 A;  5DAB A;  5L47 A;  5LP0 A;  3BUA A;  1P5Q A;  4KMO A;  1SA0 E;  5J2T E;  4LRZ A;  3Q49 B;  1FEW A;  3SFD A;  2IDO B;  2P9L G;  2PQN A;  2QYU A;  2IC9 A;  1JCS A;  1GQE A;  3PUS A;  5DJQ C;  3F6Q A;  2J4B A;  3MAC A;  5CJ5 A;  2VQF T;  4U63 A;  3N2O A;  2FEZ A;  5T4Y A;  2Q9Q C;  1ZU2 A;  4K0K T;  1N36 T;  2UXX B;  5FJY A;  4AIS A;  4FJO A;  1IJ6 A;  4COF A;  4JEU A;  2UXB T;  1QSD A;  3FHE A;  4DX6 D;  4TXQ A;  3PUX F;  1IXV A;  5ETW A;  3RK6 A;  5AAR A;  3AS4 A;  2J08 A;  3ZHE B;  1UK5 A;  3RF1 A;  3BG1 B;  3C4Z A;  3KFW X;  4EXT A;  4U2Z A;  4EZJ A;  3SO8 A;  3UUX A;  5F8P A;  4PJM A;  1K8K G;  5LFA A;  4OK0 A;  5BPP A;  2XAF B;  3QAQ A;  3FU5 A;  3SOL A;  5HWX A;  2VKJ A;  2RFM A;  1BLX B;  2KCV A;  2XQ4 A;  2MRI A;  3U4T A;  3NRY A;  2BG9 B;  4ZS2 A;  3KSQ A;  3I0Q A;  4IUL A;  5ENR D;  4I6E A;  3UQ4 A;  4I9E A;  3V31 A;  3OJA A;  3LKU A;  4DBR A;  1GW6 A;  4ANU A;  1AJ3 A;  4AKH A;  2WXI A;  4LSZ E;  4R7L A;  4GTO A;  1U2V G;  4F6R C;  5JMN D;  3VLF A;  3BK9 A;  5A7D B;  2PBI A;  1IKN D;  3ESK A;  3Q9D A;  4EYU A;  2XAS B;  2UY1 A;  3CX7 B;  3IEE A;  5HEH A;  1HU3 A;  5ANL A;  3HL6 A;  2OV9 A;  4K0R A;  3FY4 A;  3U66 A;  4ISS A;  4GOU A;  4YY3 T;  4LMJ A;  3CVR A;  4DX5 D;  3ESL A;  5LGN B;  3ULE G;  2GRO B;  4U31 A;  2GRN B;  4N2Q A;  3NZU A;  3OKQ A;  3MV3 B;  3A5X A;  4JHJ A;  1DC2 A;  3CVW A;  3KV6 A;  4FHJ A;  3MA9 A;  4K5A B;  3RRN B;  4CXY A;  3HKC E;  2F37 A;  3VR9 A;  4WWO A;  3K1S A;  2EHO D;  1H0A A;  2EIK E;  2QGS A;  5KWD A;  2UUA T;  4GAA A;  4O6F A;  4HRM B;  3C5R A;  5GON E;  4O8S A;  3TWU A;  3S7D A;  3QK6 A;  5B1A E;  1W9R A;  3PU3 A;  4MFR A;  4UIG A;  2ZGG A;  3CQC B;  4AM9 A;  3Q7F A;  4IDO A;  2H3R A;  3E30 A;  5DQW A;  4GYS A;  4MS6 A;  4DND A;  5ENP D;  2C5I T;  3ASO E;  4O1P A;  5KDM C;  3M3Z B;  5ABF B;  4BX8 A;  3JXJ A;  1OCC E;  3PEU B;  3ZCI A;  3EHM A;  3LFM A;  3ZW3 A;  2VSO E;  3PE4 A;  4G8K A;  4GK0 E;  2JIW A;  2WP9 A;  3RI5 A;  3OXG A;  3AG2 E;  4AKG A;  4EPZ A;  2MAW A;  1ZHC A;  3TAX A;  1MZC A;  2RD0 A;  4YHH T;  2BG9 C;  3PUY F;  2JLB A;  3KVB A;  4KHP T;  1BPO A;  2NWB A;  2DLR A;  3OYX A;  2N9D A;  4JI7 T;  5AAO A;  1ZBP A;  3RIB A;  3P4W A;  3UUB A;  3P7I A;  1ELR A;  3H37 A;  3N2K E;  2LXL A;  2RFA A;  3MA5 A;  1WRD A;  4NUV A;  1N34 T;  2P9K G;  2Q9Q D;  2WDQ A;  2ZLY A;  3D3M A;  4A5X A;  2V8S V;  3UUL A;  3SBT B;  3K3O A;  2P9I G;  3JXI A;  5HXE A;  1KFY A;  3ASF A;  3OVU A;  2J4D A;  3RAU A;  2DWG A;  4NIK A;  3FUJ A;  3SQV A;  2CWY A;  2H6F A;  3RIA A;  2OA5 A;  4LUN U;  3W9G A;  1HG5 A;  2F4V T;  1R8I A;  2XEH A;  5KJL A;  4UQY A;  2VSN A;  4LF6 T;  1G8X A;  4LNU D;  3ZJ2 A;  4FLH A;  5CCL A;  4TXR A;  3PZ3 A;  3BQL A;  4E85 A;  5JJ7 A;  3QWV A;  4BER A;  1IHB A;  4I43 A;  3ULQ A;  2V5Q C;  4F6R D;  3FUK A;  3P1U A;  3R6N A;  3ZN0 B;  3CML A;  1XNR T;  5JDG A;  2X6K A;  3TLU A;  4IDN A;  2J62 A;  3FZK B;  2UUC T;  3ZEF B;  4G24 A;  1WR0 A;  5AQM B;  5EIB E;  3IHY A;  4HWI B;  2LOS A;  3DPD A;  3MCX A;  3CVX A;  2A5E A;  1BR1 A;  4UI9 J;  1JWF A;  2XCC A;  4LF5 T;  3FTW A;  3FUN A;  3UTM A;  2VGY A;  2KXP B;  3DSS A;  4A1G A;  2FUL A;  2BVL A;  3OTO T;  3ABL E;  5FXZ A;  5D0O D;  4OYS A;  5CRV A;  3DSV A;  4DI3 A;  3T9K A;  3V79 K;  5ENS D;  4X64 T;  2LSU A;  2H6I A;  4EOZ B;  1BI7 B;  5H6Q B;  3PUV F;  3C4W A;  4J6I A;  4C91 A;  4HN9 A;  4JEU B;  1JNR A;  4QWN B;  3N9L A;  4ZI3 D;  1EZ3 A;  3GZ2 A;  3ZKJ A;  3B57 A;  3TWS A;  5BUZ A;  3PH0 C;  4WBO A;  1HX1 B;  5AQG B;  2IF4 A;  4LF8 T;  3CST A;  3UIN C;  1WYC A;  3UUX B;  1HX8 A;  3AE5 A;  4FJY A;  1SE7 A;  2I2O A;  5EK4 A;  4XBF B;  2LLY A;  4NPP A;  3Q75 A;  4IDZ A;  3AAE B;  1Y01 A;  3E33 A;  4O4L E;  4OYK A;  5LX8 A;  4ANJ A;  2V1D B;  3JUI A;  2UXC T;  3AVR A;  4DV2 T;  4UR9 A;  2GRQ B;  3N9N A;  1WFD A;  2PJQ A;  4ANW A;  4I0U A;  5IUX A;  2R05 A;  4JB8 P;  5G55 A;  3N9M A;  4QKN A;  4U8H A;  5KNG A;  3DXM G;  3RKG A;  3RPU A;  3QUJ A;  2R02 A;  2UY1 B;  3G06 A;  1E8W A;  4BJM A;  5CBN A;  1Y64 B;  5CEA A;  3FXD B;  3KAE A;  5T3R A;  5CB4 E;  3TXN A;  2IUB A;  4EB6 E;  5EID A;  2LSV A;  3VTX A;  4DBQ A;  5ADX L;  5AQA A;  3I9Y A;  1Z3X A;  4HS2 A;  3O1J A;  4H9S E;  4LFB T;  2NW8 A;  5J2U E;  1MIY A;  3PUQ A;  1US7 B;  4X20 E;  4J8F A;  3NZS A;  2BS3 A;  2WXL A;  2X38 A;  3EIJ A;  3VKG A;  1WYB A;  3EIQ C;  2IC6 A;  2XTL A;  1BD8 A;  3UKR G;  2NTX A;  1MX4 A;  2KXP C;  3SY2 A;  3CHS A;  1QYM A;  3I9W A;  3UFG A;  4P0A A;  3FEY A;  2XQ9 A;  4HOT A;  1ELW A;  2OVF A;  1KT0 A;  2LT3 A;  3DJB A;  4PFP A;  2BKG A;  4LFA T;  5JHA A;  4HOU A;  3FUM A;  2X6F A;  3RRC A;  2ION A;  3RH3 A;  3AS5 A;  5L3B B;  1B89 A;  5LXT E;  3K3Q C;  4DUY T;  2CFU A;  3UX4 A;  3D9O A;  2K9A A;  3QJZ A;  4D10 C;  5EYL A;  3CK7 A;  4QH4 A;  4PJL A;  4CN1 A;  1HTJ F;  4GA0 A;  5AQV B;  2CBJ A;  3FB2 A;  3RIU A;  3FWV A;  4CGW A;  4GTS A;  2CPT A;  5AQQ B;  4KMC A;  4F1S A;  2WXM A;  2XPZ A;  4GZC A;  3NKZ A;  4GPM A;  1FPP A;  1N11 A;  2RP4 A;  3AE9 A;  1H6O A;  4RG9 A;  3KV5 A;  4A1S A;  1TNO A;  4CXW A;  3ZYL A;  4UQZ A;  4OVV A;  2VWA A;  5ARG A;  5FWQ A;  3U9W A;  3EAM A;  2L9B A;  2XGM A;  3RRU A;  3CVQ A;  4DUI A;  4KXK B;  1EF1 C;  4LER A;  3MKD A;  2LOP A;  2IW5 B;  4GMJ A;  3FUE A;  2CWO A;  2H7V C;  2KMF A;  3QK0 A;  2K3W A;  2XQ3 A;  4ILU A;  3V5U A;  4WWN A;  4KHZ F;  5AQP B;  1OWN A;  3FBL A;  5JRC A;  1OY3 D;  1TR4 A;  3D0T A;  1UOH A;  2QYW A;  4HBD A;  4QXH B;  3FTV A;  3WI3 A;  3MK7 C;  1LD8 A;  4MHC A;  1HNX T;  2ETB A;  2Y4U A;  4TUU A;  1YKH B;  2FI7 A;  2YHE A;  1G73 A;  2ZM2 A;  4IHJ E;  3U64 A;  4H9Q C;  2E8I A;  4F3V A;  1T98 A;  2L9Q A;  3FZL B;  4U33 A;  4N2S A;  3Q2M A;  2J49 A;  3RQU A;  3CHM A;  4LG6 A;  4I43 B;  2YDS A;  4PK4 A;  4DR7 T;  2VL8 A;  1NFI E;  4MLK A;  2VGX A;  5LOV E;  5CER B;  4JD2 G;  3Q79 A;  4DV3 T;  3N5L A;  2Y48 B;  2MYS A;  3PTR B;  4YTP A;  4TV9 E;  5FXW A;  2XAJ B;  4P1N A;  1XZY A;  2UUB T;  1Z5S C;  3Q47 B;  5EDS A;  4X1K E;  4FHK A;  4BJN A;  4L1B A;  3LEW A;  3K8P C;  3UU4 A;  3PDN A;  1UJJ A;  2X0H A;  4TUY E;  4U7E B;  2Y1L E;  5JDQ A;  2NOX A;  4LNG A;  3OAW A;  1YQ3 A;  3M65 A;  3RKO A;  4WBN E;  1V9D A;  2KC7 A;  3B7U X;  4GA1 A;  4ILH B;  5AJL A;  2XZE A;  5C1D A;  4ILG A;  2KLQ A;  2XHE A;  2W61 A;  1D8D A;  3NBN B;  4TXP A;  3AG1 E;  2BED A;  3RQW A;  3ENE A;  3ZYM A;  3DRA A;  3P4R A;  4UWH A;  3AE8 A;  3E37 A;  4Q25 A;  4ZZB A;  2CFZ A;  3B5M A;  3UM0 A;  2XSA A;  4N3B A;  1FVF A;  1O1R A;  1X79 A;  1ZP0 A;  2D9D A;  3R84 B;  4ASK A;  4FC8 A;  4EGW A;  1LRZ A;  2ODU A;  4PS3 A;  3JC6 C;  3CEQ A;  4U95 D;  3PRE A;  2WXH A;  2A2F X;  3BQI A;  3LK4 2;  2A4Z A;  4TV3 A;  5L3E B;  5D0Q D;  4JHK A;  5L4E A;  4FA6 A;  4XE0 A;  4IL4 A;  4WNK A;  2L3L A;  4CYM D;  4HWC A;  5HAX A;  1WLX A;  5AQH B;  3Q78 A;  4ATG A;  2DVW A;  2LSK A; 
#chains in the Genus database with same CATH homology
 2YU1 A;  3QKY A;  2MOW A;  3APC A;  3RRM B;  5E76 A;  4EEC A;  2X67 A;  4L7T A;  4APO A;  2KM4 A;  1ZKE A;  3PUR A;  1ZV4 X;  4AQF A;  5L3C B;  3D9I A;  2WQ6 A;  4PJJ A;  3GW4 A;  3CV0 A;  3G2U A;  3CGH A;  4GIW A;  3SZ7 A;  2ODV A;  5JQG E;  2XAQ B;  3B7S A;  3ZFW A;  2ZM8 A;  1KNZ A;  3O1I A;  4HLE A;  2WM9 A;  2I59 A;  4FAD A;  5ANR A;  2X68 A;  4BAY B;  2VQ2 A;  3HR0 A;  3DP7 A;  4JXT A;  2CG3 A;  3CHR A;  4EZ4 A;  4EAH A;  4C0E A;  5BMV E;  3L17 A;  3AA7 B;  2IFU A;  4CZZ B;  5LHH B;  2Z6E A;  4XIF A;  5LG4 A;  4DPR A;  4EQF A;  2X6I A;  1HS7 A;  4XAX B;  3TG4 A;  1HCI A;  4WNE A;  5C8Y E;  5JJ6 A;  3CIA A;  3FTU A;  3D9M A;  2LSI A;  4MRU A;  4WUY A;  4GK5 E;  2WWU A;  3CKD A;  5L2L A;  5G05 C;  4U0Z A;  3RYF E;  3UQ3 A;  4QFV A;  3RKV A;  3C50 A;  2DBA A;  5E75 A;  3C4X A;  2NSZ A;  2DI4 A;  2KZ7 B;  5JRC B;  3ETU A;  3T5X A;  2NW7 A;  3MZL B;  3FH7 A;  1L5J A;  3GZS A;  1H19 A;  1XNF A;  4JLE A;  4ZS3 A;  4O2A E;  3AAA B;  1LF8 A;  3N71 A;  2YIN A;  3FU3 A;  4HXI A;  3JC6 D;  4B6X A;  4UWG A;  5FZR A;  4Y6W A;  4RG6 A;  2ZU6 B;  4MKT A;  1D0X A;  1E8X A;  2VGX B;  1LKX A;  4N3C A;  3AAI A;  1MMN A;  1ELK A;  3HIZ A;  2ZM0 A;  3E0Z A;  3L16 A;  4N3A A;  3I5P A;  1N52 A;  2CA5 A;  1VOM A;  2X9H A;  4TX5 A;  1VDY A;  3KS2 A;  2WBL A;  5FNV E;  2NP9 A;  3PU8 A;  1QUU A;  2X9Y A;  2Q7F A;  4TN7 B;  5FYM A;  4YVQ C;  4KVO A;  1Y8M A;  3R7R A;  4A3T A;  2XHE B;  1MMA A;  4UI9 C;  4C0M A;  3CKC A;  3S4U A;  3ZGQ A;  4M3O A;  3MV2 B;  3L13 A;  3CVU A;  4L0R A;  3KV9 A;  2QA7 A;  2XPI A;  1HO8 A;  4UXN B;  3KD7 A;  5LCW C;  1MIW A;  2ILR A;  2E0I A;  2LE8 A;  4BSX A;  2V8S E;  3WAJ A;  3WXX A;  3O9X A;  4AY6 A;  4U07 A;  3ZJ1 A;  4HTE A;  3ASD A;  2V7J A;  4RSY A;  3FU0 A;  4A3V A;  4B94 A;  2JQQ A;  3R9A B;  4GML A;  5EKQ D;  4IRU A;  4HE8 A;  3JQ1 A;  2DCP A;  3OYZ A;  2VJ8 A;  3HKB E;  2XEV A;  2XAH B;  3GN5 A;  1U3D A;  1W3B A;  5FY7 A;  3LBX A;  4ZI3 C;  1OWO A;  5A23 A;  2VTB A;  1BR2 A;  4CT0 A;  4ILI A;  4ZI7 E;  2ACX A;  2C0S A;  5JRE A;  5EK2 A;  1E90 A;  3QDN A;  2MHK A;  4PK5 A;  3LK2 B;  4CDM A;  4H7Y A;  3OXF A;  4ACK A;  3KBT A;  4JL0 A;  2AW6 A;  2C5J A;  2KZT A;  2DIW A;  5JDM A;  3G2W A;  4GYY A;  5G05 J;  3LVR E;  2JMK A;  2I9C A;  2YEV C;  2WXJ A;  3GMI A;  2MOZ A;  3Q15 A;  4IYP A;  4HEA A;  4G26 A;  2OVB A;  4TV8 E;  5L3G B;  4AP2 A;  1S35 A;  3RO2 A;  4EBA A;  2W0G A;  4UVB B;  4G1T A;  4K03 A;  4ABN A;  3ZC1 A;  4F53 A;  2R5S A;  2AXZ A;  2XGS A;  1WM5 A;  5CMW A;  4UF0 A;  3F57 A;  4E7S A;  1A17 A;  5JDF A;  3RJV A;  1UN9 A;  5J08 A;  4CGV A;  3HHM A;  3BEE A;  3CVL A;  4W9R A;  4AQF C;  3LY8 A;  5CA0 E;  3TXM A;  2GRL A;  3ZMU B;  2IOL A;  1JUQ A;  4L9I A;  4CQI A;  4AXP A;  2CE7 A;  3S7F A;  3GA8 A;  2WXK A;  4G23 A;  4PS7 A;  1OWL A;  4KP3 C;  4WW0 A;  5JH7 E;  4TRQ A;  1YD8 G;  3TKL B;  4G63 A;  3CX8 B;  2AWI A;  2XPY A;  1E96 B;  3OBV E;  4GYR A;  4QXC B;  4C90 A;  2Y6X A;  4CCA A;  3CHP A;  4U72 A;  3RC8 A;  3ASH A;  3O4Z A;  4H9N C;  1H2T C;  3LG7 A;  2HM8 A;  2IQC A;  3ZYK A;  3RX6 A;  5LCW J;  3JQ0 A;  1HE8 A;  3S2A A;  4O4H E;  4UEL A;  4P29 A;  2Y8D A;  3MKQ A;  4AI6 A;  4G25 A;  2XGO A;  5FZQ A;  3KIN B;  3AA1 B;  2GGF A;  4J0U A;  4I2Z A;  4V1A v;  1INZ A;  3RYH E;  1LVK A;  3PUK A;  3B7T A;  1IAP A;  3CQG B;  4IE6 A;  4OHF A;  2KWI B;  4A56 A;  3CHO A;  2WSS V;  3ZMT B;  5EX0 A;  4FJZ A;  3LJ3 A;  1E8Y A;  3UTK A;  4PS8 A;  1UW4 B;  4U74 A;  3PE3 A;  4KBQ A;  5CHE E;  2N1G A;  2V26 A;  5ENN A;  2CM0 A;  5LYJ E;  3UPV A;  4AKR B;  2FF4 A;  2CEA A;  3LY7 A;  2VSY A;  4KZ0 A;  4N5C A;  3GN5 B;  3FEX A;  3QB2 A;  3EVY A;  2X6J A;  3EHN A;  3LBX B;  5JVD E;  3ZYQ A;  3CVV A;  4MLP A;  3IHR A;  5BV0 A;  2VTB B;  3P8C D;  1Z0P A;  3MXZ A;  3Q5X A;  4ME2 A;  3D9L A;  2V7I A;  4Q94 A;  1D1C A;  4OYJ A;  4AIF A;  3CX6 B;  3LY9 A;  1PAQ A;  1QQE A;  3I1A A;  2KZT B;  1MIV A;  4JW1 A;  4L5G A;  5HXH A;  4PNI A;  5DBK A;  3L54 A;  2FBN A;  4HOS A;  2CLY B;  3GYZ A;  4ZI2 C;  4ACL A;  2CG2 A;  5FQ7 A;  1WR6 A;  5DIZ A;  1CUN A;  3PDY A;  2VYI A;  4GCN A;  2HR2 A;  3C51 A;  5L3D B;  2DCF A;  5KX5 E;  3SF4 A;  2V7M A;  4ADZ A;  3GZ1 A;  4UF0 B;  4EIW A;  1EYH A;  4CI2 B;  1E1H B;  3V5S A;  4PK6 A;  4JA9 A;  2WQ7 A;  3F2E A;  4AV7 A;  1SQM A;  4ZOL E;  4I17 A;  4O4J E;  3KV4 A;  4U0S A;  3HYM B;  2D0T A;  5LHG B;  4BT8 A;  4UQX A;  3I0O A;  4CXX A;  4QXB B;  3SBS A;  2Y4T A;  3L3P A;  2J09 A;  3CVY A;  3SHF A;  2WXR A;  2C0M A;  4JEH B;  2V7L A;  3JCK C;  3SFZ A;  2KCL A;  4RVB A;  1HG2 A;  2WPV A;  3B13 A;  5F3J A;  4I50 E;  2WXG A;  3ZPO A;  4GU5 A;  3R7Q A;  5G04 C;  4J8D A;  3LDZ A;  2EQX A;  1MMG A;  4I6J A;  5FXV A;  4GB9 A;  2CLY C;  3ONL A;  1D1B A;  2PM7 A;  2WXQ A;  3JYS A;  3O1H A;  5FY1 A;  4AY5 A;  3MKQ B;  3NZQ A;  5M4Y A;  5KCM A;  3ZCJ A;  4MBQ A;  4AKL A;  2DHR A;  1H2U A;  1UCU A;  2YK0 A;  1U3C A;  3Q5W A;  2K48 A;  1XGW A;  3AU5 A;  3E08 A;  1O3X A;  5BT1 A;  3EDT B;  3VU7 H;  4UVC B;  3RRW A;  3SD5 A;  2PZI A;  3QC1 A;  2BF0 X;  4ZI2 D;  3BG0 B;  3FU6 A;  5IYZ E;  4BT9 A;  5LHI B;  3OTN A;  3QAR A;  1HZ4 A;  4GYO A;  4H9O C;  5J1G A;  1HFA A;  4DMW A;  5JDH A;  2NXP A;  3FBZ A;  4KZC A;  2X0L B;  4I1O B;  3N2G E;  5E0O A;  3SGH A;  4PAG A;  4H9R C;  4PH4 B;  3APF A;  4NRH B;  2GW1 A;  1OXZ A;  2W62 A;  4FUL A;  5AIJ A;  2KAT A;  3ZRH A;  3ANW A;  2I1K A;  3QOU A;  5FY0 A;  2I6H A;  3U78 A;  3FH5 A;  5A6C A;  3DTO A;  3Q5M A;  3SNX A;  2OOE A;  1UN8 A;  3URZ A;  2J1D G;  4WNF A;  1TEZ A;  3LS8 A;  2CHX A;  2K24 A;  3HI2 A;  2VAS A;  4EYY R;  4CI3 B;  4OVU A;  2HH7 A;  4FLB A;  1Z3Y A;  1MMD A;  3FDH A;  3I4G A;  4DI4 A;  2NC9 A;  5CA1 E;  2QY7 A;  2WMN A;  3EJN A;  3ONK A;  4DVD A;  4I2W A;  4YFS A;  3AS8 A;  5LBM A;  3ZXS A;  3W15 B;  5T8I A;  3UT5 E;  4GZ3 A;  1YA0 A;  1KT1 A;  4E7Z A;  4I6G A;  1QZ2 A;  3FUH A;  3J7Y q;  4NUR A;  1U4Q A;  3ZN3 A;  4G2V A;  5JR9 A;  2LHR A;  5FT9 A;  3UFE A;  1NWM X;  1QNF A;  3PZD A;  4YVO A;  1KLX A;  5FTP A;  4IGU A;  4F7A A;  1NA3 A;  2PL2 A;  5G04 J;  2W63 A;  5AJD A;  1D1A A;  1VRB A;  3KBU A;  3RYI E;  3IF8 B;  2VKH A;  3FFL A;  4AKI A;  1UJK A;  3HDX A;  2BUG A;  3KEZ A;  2VKD A;  4EBA G;  4FP7 A;  3L09 A;  2LNI A;  4N78 D;  3UUM A;  3QC9 A;  2VK9 A;  3U3W A;  5HYA A;  1PC2 A;  3CK8 A;  4UV9 B;  4UI9 K;  3ONX A;  3MX3 A;  3AB3 B;  2AXV A;  3PUJ A;  2H7O A;  4O2B E;  3LK3 B;  4KT6 B;  2RA1 A;  4A55 A;  4JZY A;  4M1P A;  4GYW A;  1JPL A;  2JMH A;  4AQG A;  2BZB A;  4IE5 A;  3MYV A;  3LCA A;  1FMV A;  3KVA A;  1NP7 A;  2CXL A;  3EDU A;  4J8E A;  2R59 A;  5FQ8 A;  4C9B B;  3FUF A;  2M63 A;  1EPU A;  3CK9 A;  2X3M A;  4BWR A;  4UEM A;  4CDR A;  2L8K A;  4UWL A;  3RC3 A;  4DLQ A;  5C2Y A;  4J2C A;  3I4R B;  2HPL A;  3N9O A;  4QHO A;  3FUD A;  5KJM A;  4GZ6 A;  3FTZ A;  2X51 A;  1X5B A;  3CHQ A;  4HKA A;  2KIN B;  2OV8 A;  4E6H A;  1MQS A;  2PFV A;  3PEV B;  4NQ0 A;  1OUV A;  3NQP A;  3IBE A;  2BVM A;  2XUE A;  3DBS A;  3UT7 A;  2JPF A;  3L08 A;  3U3I A;  4GCO A;  4BY6 A;  3T5V A;  3I3N A;  5FQ6 A;  3B7R L;  4QX7 B;  4I55 E;  2A72 A;  3ANW B;  2LHN A;  4FU3 A;  3AVS A;  1FCH A;  3ZVV A;  3UT8 A;  4Y6C A;  5EX3 A;  1FIO A;  4DMV A;  4BFR A;  1HH8 A;  5CMY A;  1KK7 A;  5HQ8 A;  1H2V C;  2C5K T;  4YJ2 E;  3S7B A;  1UX4 A;  4KBM B;  2UWJ G;  4XZ4 A;  1E8Z A;  2YHC A;  3MJW A;  3F31 A;  2NW9 A;  3E4B A;  3L6A A;  3N9Q A;  3T8M A;  3FH8 A;  3TG5 A;  3NBX X;  2X9W A;  2LSG A;  2GK9 A;  2E9X A;  4EZK A;  1IJ5 A;  3ML9 A;  1YKE B;  1LVF A;  4I1A A;  1JWG A;  4TZ4 C;  3IBP A;  2QFC A;  3IKO B;  3VHL A;  3ZIM A;  2WXN A;  4J8S A;  1B7T A;  5JR9 B;  4YHJ A;  4ERR A;  4H9P C;  4PDX A;  4DO0 A;  2KND A;  2OND A;  3PUG A;  2L6J A;  1S94 A;  3TL5 A;  4OFZ A;  1IYG A;  3N9P A;  4AEZ C;  1E7V A;  3PNL B;  3PS6 A;  4JC8 A;  3KDS E;  1H7C A;  4L23 A;  3FXE B;  3ZN1 B;  2G0U A;  1D0Y A;  2LSY A;  2PM6 A;  5LJN A;  1NZN A;  5JHB A;  1MND A;  4CEM A;  2V7K A;  4JEH A;  2K5B B;  2VKO A;  3LVQ E;  3ZC0 A;  3HA4 A;  2LO6 A;  3D9K A;  4JUY A;  2XRY A;  2XCB A;  4EZL A;  1OWM A;  3T8O A;  3FUL A;  4H7X A;  4KUM B;  5HWY A;  2KCK A;  2V4L A;  3CVN A;  3ZLI A;  4B89 A;  3QNK A;  4DLO A;  3IHV A;  3ZMZ B;  4PUC A;  4JA7 A;  4XKC A;  4KVM A;  3C98 A;  1NA0 A;  1TJF A;  2CHW A;  1E7U A;  5LJM A;  2B1E A;  5FXX A;  2RG8 A;  5JDL A;  2C0L A;  2W00 A;  3PNT B;  3QWP A;  4LEU A;  5LP6 E;  2V0P A;  4IE0 A;  1FMW A;  3CKB A;  3G2V A;  3FUI A;  3CQX C;  4X1I E;  2BDE A;  3PVL A;  2XRZ A;  2X9X A;  4B8C B;  3IV0 A;  4B8A A;  2MBG A;  1MHQ A;  5JR9 C;  2IOS A;  3RYC E;  4HOR A;  4GZ5 A;  2WB2 A;  4AVX A;  2NTY A;  2LAI A;  4G11 A;  3E22 E;  2IAK A;  3IEG A;  5LGU B;  3CPZ A;  3MEK A;  3SWH A;  2WQH A;  4EZH A;  3OXL A;  5G2N A;  4GA2 A;  5L3F B;  3RU0 A;  4AJW A;  1IHG A;  4I4T E;  2VB6 A;  3ETV A;  1UG3 A;  1SZA A;  5HXS A;  4CDN A;  3NZP A;  2N2N A;  3UT4 A;  5LNK A;  3O4X E;  2WVI A;  1DVP A;  4WNG A;  2D5U A;  1BR0 A;  2EHO A;  3L22 A;  1WY6 A;  3SS1 A;  3PRZ A;  1TJC A;  2IU1 A;  2WXO A;  4CRW A;  4DK5 A;  2CCQ A;  3ASG A;  5EK3 A;  2LM9 A;  2PG8 A;  2JJ9 A;  4XZC A;  5KJN A;  5LOZ A;  5KJK A;  3PUA A;  4IN3 B;  3WAK A;  2C2L A;  4L2L A;  3CR3 A;  4UWK A;  2WMO A;  4Z8X A;  3J9X 1;  1HF8 A;  3CWZ B;  2FO7 A;  5HXR A;  4FI5 A;  4LCT A;  1MNE A;  3UUN A;  2BTD A;  1HXI A;  3APD A;  3D9N A;  3HVE A;  4HVB A;  3MZK B;  3SRZ A;  1BR4 A;  3ZMV B;  4YND A;  3D9P A;  2YQ8 A;  1SHZ C;  3VTY A;  4H63 H;  2HYZ A;  3H3A A;  4UVA B;  2HPJ A;  2WXP A;  2Q9Q A;  2E9X B;  2XQY A;  3FTX A;  3MGB A;  4BTB A;  5JDN A;  3FTS A;  1Y6I A;  2YU2 A;  4L2Y A;  2DWK A;  2D2S A;  3HKD E;  2LSJ A;  2DNX A;  2VSX E;  4PFO A;  4WAF A;  3AU4 A;  2CXF A;  2M67 A;  3RO3 A;  3LYA A;  2UXN B;  5FQ4 A;  5IHY A;  5LCY A;  2P58 C;  5LA6 E;  4NAC A;  4WWP A;  4XKB A;  2KWH A;  3NF1 A;  4V3I A;  4K0U A;  3MJX A;  2R17 C;  4CI1 B;  3EUH A;  2LJL A;  5LGT B;  3VLD A;  4P09 A;  5BW8 C;  3UMV A;  3ZPJ A;  5AFU L;  1IZN B;  1ZEE A;  2HO1 A;  2CMR A;  4HOQ A;  4XI0 A;  4HGA A;  3BQK A;  4NUU A;  3TGO A;  4ANX A;  4HFV A;  1N54 A;  3AA0 B;  1D0Z A;  1YW0 A;  1HS6 A;  3ML8 A;  4PW8 A;  4JVS A;  3NRX A;  2MTQ A;  2D0U A;  4UWF A;  2L0T B;  3C98 B;  2WAU A;  3VLE A;  3O48 A;  2E9X C;  4JPS A;  1Z6T A;  3LJC A;  4U04 A;  3ZHE A;  3K3N A;  1OWA A;  1NAF A;  2IJG X;  5CCM A;  2WXF A;  4B0Z A;  2P9B A;  2CXD A;  4DJA A;  2A5U A;  1DNP A;  4BA9 A;  4H63 V;  5FMN A;  1FVH A;  1U5P A;  3G2S A;  3LXU X;  5DQV A;  5A1L A;  2A3D A;  1SZ9 A;  4HFG A;  1H6K A;  2GRM A;  2YNQ A;  3P2B A;  2EHO B;  5ARF A;  3SI5 A;  3Q4A B;  4G2A A;  4IST A;  4Q96 A;  4O4I E;  5LBQ B;  4ANV A;  3EDV A;  3K9I A;  2CHZ A;  4MAL A;  4YLH A;  2ES0 A;  3QWW A;  3D9J A;  4QX8 B;  3LPZ A;  3FP3 A;  4GZD A;  2V5F A;  4P0B A;  5JJT A;  5TAO A;  4BTA A;  5BV1 A;  5HXC A;  5BNW A;  3HKE E;  2L0I A;  3FHN A;  5AYW D;  3HVE B;  2ZMA A;  4N39 A;  3C64 A;  4IE7 A;  5H6R B;  2JEK A;  4PJN A;  3CLJ A;  3VKH A;  4I9C A;  1IQU A;  2SPC A;  5AEN A;  2Q9Q B;  1EDU A;  5HI7 A;  2LAH A;  4URK A;  5KMG P;  2J9Q A;  1S0P A;  5J90 A;  4KYO B;  3S7J A;  2X6H A;  3ZMS B;  2PQR A;  5FZS A;  2J07 A;  3FTY A;  2E9X D;  2JRK A;  2X66 A;  3CVP A;  2E2E A;  5M72 A;  4ZHQ E;  1IQR A;  4IE4 A;  4GPK A;  2XAG B;  3AA6 B;  3TJP A;  4AOF A;  4JHR A;  2XQ0 A;  4U0U A;  4IIJ E;  2EHO C;  1PY1 A;  3PE0 A;  1WAO 1;  2LEH A;  1OWP A;  2I1J A;  3CSF A;  4WND A;  4XI9 A;  5FP3 A;  4I1M A;  4BX9 A;  5EZY E;  4AXH A;  3G2T A;  2AXU A;  2AVP A;  4UV8 B;  2Y3A A;  4X1Y E;  3MKR A;  4YJ3 E;  4Q69 A;  3GWH A;  4XX5 A;  4APF A;  4CT4 A;  3ZEF A;  2KT9 A;  1UX5 A;  5DAB A;  5LP0 A;  1P5Q A;  4KMO A;  1SA0 E;  5J2T E;  4LRZ A;  3Q49 B;  1FEW A;  2PQN A;  2IC9 A;  3PUS A;  5DJQ C;  2J4B A;  3MAC A;  4U63 A;  3N2O A;  2FEZ A;  5T4Y A;  2Q9Q C;  1ZU2 A;  2UXX B;  5FJY A;  4FJO A;  1IJ6 A;  4JEU A;  1QSD A;  3FHE A;  3RK6 A;  5ETW A;  3AS4 A;  2J08 A;  3ZHE B;  3BG1 B;  3C4Z A;  3KFW X;  4EXT A;  4EZJ A;  3UUX A;  5F8P A;  4PJM A;  5LFA A;  4OK0 A;  5BPP A;  2XAF B;  3QAQ A;  3FU5 A;  3SOL A;  5HWX A;  2VKJ A;  2KCV A;  2MRI A;  3U4T A;  3NRY A;  4ZS2 A;  3I0Q A;  4IUL A;  4I6E A;  4I9E A;  3OJA A;  3LKU A;  4DBR A;  1GW6 A;  4ANU A;  1AJ3 A;  4AKH A;  2WXI A;  4R7L A;  4F6R C;  3VLF A;  3BK9 A;  5A7D B;  2PBI A;  3ESK A;  3Q9D A;  4EYU A;  2XAS B;  2UY1 A;  3CX7 B;  3IEE A;  1HU3 A;  5ANL A;  3HL6 A;  4K0R A;  3FY4 A;  3U66 A;  4ISS A;  4GOU A;  3CVR A;  3ESL A;  5LGN B;  4N2Q A;  3NZU A;  3OKQ A;  3MV3 B;  3A5X A;  4JHJ A;  3CVW A;  3KV6 A;  4FHJ A;  3MA9 A;  3RRN B;  4CXY A;  3HKC E;  4WWO A;  2EHO D;  1H0A A;  2QGS A;  4O6F A;  4GAA A;  5GON E;  4O8S A;  3S7D A;  3QK6 A;  3PU3 A;  4MFR A;  4UIG A;  3CQC B;  4AM9 A;  2H3R A;  5DQW A;  4GYS A;  4MS6 A;  4DND A;  2C5I T;  5KDM C;  4BX8 A;  3PEU B;  3ZCI A;  3EHM A;  3LFM A;  3ZW3 A;  2VSO E;  3PE4 A;  4GK0 E;  3OXG A;  4AKG A;  4EPZ A;  1ZHC A;  3TAX A;  2RD0 A;  2JLB A;  3KVB A;  1BPO A;  2NWB A;  2DLR A;  3OYX A;  2N9D A;  1ZBP A;  3RIB A;  1ELR A;  3P7I A;  3H37 A;  3N2K E;  3MA5 A;  1WRD A;  4NUV A;  2Q9Q D;  2ZLY A;  3D3M A;  3UUL A;  3SBT B;  3K3O A;  5HXE A;  3ASF A;  2J4D A;  2DWG A;  3FUJ A;  2CWY A;  2OA5 A;  4LUN U;  1HG5 A;  5KJL A;  4UQY A;  2VSN A;  1G8X A;  3ZJ2 A;  4FLH A;  5CCL A;  3BQL A;  4E85 A;  5JJ7 A;  3QWV A;  4I43 A;  3ULQ A;  3FUK A;  3P1U A;  3R6N A;  3ZN0 B;  3CML A;  5JDG A;  2X6K A;  3ZEF B;  4G24 A;  3IHY A;  2LOS A;  3DPD A;  3MCX A;  3CVX A;  1BR1 A;  4UI9 J;  1JWF A;  2XCC A;  3FTW A;  3FUN A;  2VGY A;  2KXP B;  4A1G A;  2FUL A;  2BVL A;  5FXZ A;  5D0O D;  4OYS A;  4DI3 A;  2LSU A;  4EOZ B;  5H6Q B;  4J6I A;  3C4W A;  4C91 A;  4HN9 A;  4JEU B;  4QWN B;  3N9L A;  4ZI3 D;  1EZ3 A;  3GZ2 A;  3B57 A;  5BUZ A;  3PH0 C;  4WBO A;  2IF4 A;  3CST A;  1WYC A;  3UUX B;  1HX8 A;  4FJY A;  2I2O A;  5EK4 A;  4XBF B;  4IDZ A;  3AAE B;  4O4L E;  4OYK A;  5LX8 A;  4ANJ A;  2V1D B;  3JUI A;  3AVR A;  3N9N A;  2PJQ A;  4ANW A;  5G55 A;  3N9M A;  4QKN A;  4U8H A;  3RPU A;  3QUJ A;  2UY1 B;  1E8W A;  4BJM A;  1Y64 B;  3FXD B;  3KAE A;  5T3R A;  5CB4 E;  3TXN A;  4EB6 E;  2LSV A;  3VTX A;  4DBQ A;  5ADX L;  3I9Y A;  1Z3X A;  4HS2 A;  3O1J A;  4H9S E;  2NW8 A;  5J2U E;  1MIY A;  3PUQ A;  1US7 B;  4X20 E;  4J8F A;  3NZS A;  2WXL A;  2X38 A;  3EIJ A;  3VKG A;  1WYB A;  3EIQ C;  2IC6 A;  2XTL A;  2NTX A;  3CHS A;  3I9W A;  4P0A A;  3FEY A;  4HOT A;  1ELW A;  2OVF A;  1KT0 A;  2LT3 A;  3DJB A;  4PFP A;  5JHA A;  4HOU A;  3FUM A;  2X6F A;  3RRC A;  2ION A;  3RH3 A;  3AS5 A;  5L3B B;  1B89 A;  5LXT E;  3K3Q C;  2CFU A;  3UX4 A;  3D9O A;  2K9A A;  3QJZ A;  4D10 C;  3CK7 A;  4PJL A;  1HTJ F;  4GA0 A;  3FB2 A;  4CGW A;  3FWV A;  4KMC A;  4F1S A;  2WXM A;  2XPZ A;  4GZC A;  2RP4 A;  4RG9 A;  3KV5 A;  4A1S A;  4CXW A;  3ZYL A;  4UQZ A;  4OVV A;  2VWA A;  5ARG A;  5FWQ A;  3U9W A;  2L9B A;  2XGM A;  3RRU A;  3CVQ A;  4KXK B;  1EF1 C;  4LER A;  3MKD A;  2LOP A;  2IW5 B;  4GMJ A;  3FUE A;  2CWO A;  2H7V C;  2KMF A;  3QK0 A;  4ILU A;  3V5U A;  4WWN A;  1OWN A;  3FBL A;  5JRC A;  3D0T A;  4QXH B;  3FTV A;  3WI3 A;  3MK7 C;  4MHC A;  2Y4U A;  4TUU A;  1YKH B;  2FI7 A;  2YHE A;  1G73 A;  2ZM2 A;  4IHJ E;  3U64 A;  4H9Q C;  2E8I A;  4F3V A;  1T98 A;  2L9Q A;  4N2S A;  3Q2M A;  2J49 A;  3CHM A;  4I43 B;  4PK4 A;  2VL8 A;  4MLK A;  2VGX A;  5LOV E;  3N5L A;  2Y48 B;  2MYS A;  3PTR B;  4TV9 E;  5FXW A;  2XAJ B;  3Q47 B;  5EDS A;  4X1K E;  4FHK A;  4BJN A;  4L1B A;  3LEW A;  3K8P C;  3PDN A;  1UJJ A;  4TUY E;  5JDQ A;  2NOX A;  3OAW A;  3M65 A;  3RKO A;  4WBN E;  1V9D A;  2KC7 A;  3B7U X;  4GA1 A;  4ILH B;  5AJL A;  5C1D A;  4ILG A;  2KLQ A;  2XHE A;  2W61 A;  3ENE A;  3ZYM A;  4UWH A;  2CFZ A;  4N3B A;  1FVF A;  1X79 A;  3R84 B;  4ASK A;  4FC8 A;  1LRZ A;  2ODU A;  4PS3 A;  3JC6 C;  3CEQ A;  3PRE A;  2WXH A;  2A2F X;  3BQI A;  3LK4 2;  2A4Z A;  4TV3 A;  5L3E B;  5D0Q D;  4JHK A;  4FA6 A;  4XE0 A;  2L3L A;  4WNK A;  5HAX A;  1WLX A;  4ATG A;  2LSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...