1HG2A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
b'GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg2A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg2A01
4HFGA 1LF8A 3RRUA 2KM4A 2BF0X 1DVPA 2LO6A 1H0AA 3G2TA 3ZYKA 5LP0A 1HF8A 4JXTA 3CLJA 1PY1A 1EDUA 5LOZA 1UJJA 4GZCA 3G2VA 3LDZA 3D9IA 3ONLA 3D9MA 1JUQA 3G2WA 3D9PA 1EYHA 3ONKA 4FLBA 1ELKA 2QY7A 2V8SE 4AVXA 1JWGA 1JWFA 1JPLA 3G2SA 1HG5A 3D9LA 1SZAA 3D9KA 3G2UA 3ZYMA 1MHQA 1INZA 1SZ9A 2L0TB 1VDYA 3D9OA 3ZYLA 4FU3A 2L0IA 5CMWA 1XGWA 3ZYQA 2MOWA 1UJKA 4GZDA 2DCPA 2DIWA 3D9JA 4NACA 4Q96A 4Q94A 1HX8A 1HG2A 5J08A 5CMYA 1X5BA 1HFAA 3D9NA
chains in the Genus database with same CATH superfamily
4DK5A 1O5MA 1IQRA 4JEHB 4ILBA 4NUUA 1HR0T 3IHVA 2WVIA 4AEZC 4B3ST 3E37A 2PQNA 3CVLA 2PG8A 1QUUA 4DNDA 3FU6A 2AXDS 5HEUA 3ABKE 3QUJA 1OWAA 2H89A 2A4ZA 3ZUVB 3PUSA 1E8XA 2CFUA 3CGHA 3ONXA 4H9PC 4UR9A 2X51A 2QC9A 2IJGX 3F6QA 4K0RA 3HXFA 3CQGB 5HXHA 5L47A 4YSYA 2JJ9A 4OYSA 3HKCE 2KNDA 5D66A 3KEAA 3GA8A 4JPSA 3BEEA 2LSVA 2P58C 2YQ8A 5HEJA 4OYJA 4I0UA 1HNZT 3PUKA 3UUXB 3GW4A 3J5QB 3VKGA 4IN3B 3W9FA 5ENTD 4QH5A 1H2TC 2J1DG 4CT0A 3VRBA 4DLQA 2ZIRA 1YXRA 3N2KE 3HIZA 3C4ZA 5FQ4A 4K03A 4IE4A 2WU5A 2VB6A 3RRUA 4HOSA 2XPKA 5AQMB 3DJBA 1W0BA 3ABLE 3AS5A 4HI9A 2L3LA 4QKNA 5KDMC 3ASHA 3G2VA 3ONLA 2OLTA 2R6GF 4LMJA 3F57A 4GTRA 2K48A 3TLSA 4ZI2D 2LKHA 4ZS3A 3I3NA 3QWPA 4B93B 2CXFA 4C9BB 2VVNA 4LNGA 4C48B 4U04A 4DJAA 2FJDA 4OHFA 5LNKA 1YKHB 5HS0A 3SWHA 3C98A 5HYAA 4I6EA 3AAAC 1GQEA 3U3IA 4MRUA 4K0KT 2BG9A 4GZCA 5AQIB 2YDRA 4DUZT 4CCAA 2IIUA 5FXZA 3AEDA 1Z3XA 4PDXA 3Q2MA 3UULA 5CFBA 1BR2A 4GZ6A 4FC8A 3IEGA 1UUSA 3K9IA 1VCSA 3D9KA 4H9OC 4I6GA 2W2UA 2DL1A 5FJYA 4A55A 4HRMB 1HTJF 1HG2A 3V79K 4BESA 1QZ2A 4ZOLE 3Q9DA 4ME2A 2P9UG 3FEYA 2VSYA 3KFWX 4RG9A 3SFXA 3Q5DA 4Z90A 2CLYC 2JPFA 1ELRA 2ZMAA 5EZYE 2CHOA 4KHZF 4TWDA 4AVXA 1L0VA 4G26A 5FNVE 1D8DA 5BV0A 3O4XE 2KZ7B 3UTKA 2XCCA 3ML9A 3PDYA 1N36T 2QYUA 4FULA 4KMOA 4GTMA 1D0YA 3VLDA 1JNZA 4YY3T 5BNWA 4HFEA 4CXWA 5AQJB 1WLXA 1H0AA 2N9DA 2X6KA 1TR4A 2LAIA 2K5BB 4UI9K 3CVXA 1QSDA 5IUXA 1N34T 5M4YA 5G05C 5CECB 3I9WA 3AECA 3VR8A 3AA1B 5TAOA 2WQ7A 1UJKA 2IEJA 4EAHA 3FUKA 3OKQA 4H63V 5LGUB 5EKQD 4I9CA 5A1LA 1M62A 3G2TA 5FVKA 2BZBA 4DUYT 5JR9B 4JYAT 1DNPA 4N5CA 3TWTA 3RRMB 5FY1A 1TN6A 2WXGA 4X1IE 2VSNA 1P5QA 5L3BB 3VTXA 4GYOA 2NR4A 4IGUA 1OWPA 1TNUA 5AQVB 3ZFWA 3R7RA 4E85A 2XQ9A 3UI2A 2W0GA 3EAMA 1OXZA 2PTFA 1MYOA 3S2AA 1IYGA 4AM9A 3RI5A 3VLEA 2LKGA 4U8YD 3I0OA 2PNNA 3PJAJ 2CHNA 2EHOA 1I94T 3TXMA 2UXDT 3ANWB 2EIJE 5HAXA 3PNLB 2BS2A 1D0XA 3ZCJA 5AQ7A 5LCWJ 4PAGA 3F31A 2XQ0A 2A9UA 1N33T 3UM0A 4BSZB 2OVFA 3P4SA 3MX3A 3FUNA 4DR5T 5AQOB 3ZT7A 5AARA 3RRWA 2QY7A 4YVQC 2L0TB 5F8PA 2AJAA 4EHMA 3A5XA 2LOSA 3BK9A 2IOSA 1V55E 1WCRA 4Q96A 3H3MA 3EHZA 5JDFA 4GAAA 3QWVA 2X3MA 2BS4A 2VQET 3BQLA 4MHCA 4ZI7E 2HPLA 2XENA 4JI8T 4U96D 4CT4A 3T1YT 3FUEA 2NWBA 5CA1E 5AENA 3EUVA 1NA0A 4N3AA 3N9LA 4KUMB 2DHRA 4L9IA 3ZNGA 4A97A 3ETVA 3SFDA 4WNFA 3RYCE 1LTXA 1XWMA 5LMNT 4O8SA 5CGMA 2F4VT 2XZDG 2AXZA 2FI7A 2ZM0A 1A5EA 4JL0A 2BF0X 3MJXA 2QVAA 3V30A 4L0RA 2IAKA 3WAKA 4TXRA 5BXOA 2XS8A 5JTGA 1JUQA 4A5XA 1FT2A 3CX8B 1E7PA 4HFDA 4JV5T 4GK0E 4DRXE 1I6ZA 4ATZD 3NWIA 3TKLB 4JI7T 1U3DA 4NIKA 2GW1A 2MYOA 3DTOA 2JABA 4GMLA 3TXNA 4GB9A 2IO2C 3MV2B 2HPJA 3OTOT 4BERA 1NFIE 3I0QA 4ANVA 4CDNA 2HE0A 5LYJE 4FHKA 3HRAA 4GZ3A 3QNKA 2XQ5A 2BG9C 3ETUA 1SHZC 4H9QC 4UQZA 2NSZA 4I6JA 5ENPD 5E76A 5L3GB 3ZT6A 4XZCA 1DCQA 3CHMA 3CVRA 4DO0A 3OBVE 2V7KA 2XAQB 5FL0A 3FXDB 3DSVA 3UMVA 4LF8T 4KX6A 3WG7E 3PZDA 2XAHB 3P2BA 1KNPA 3RYFE 5LMUT 2Y69E 3Q7AA 3A7MA 3LK2B 3S7BA 3CEQA 3L22A 3Q78A 3EJNA 4E7ZA 3ZMUB 4WW0A 4EZKA 3IXEA 2C0SA 4BTAA 4JB8P 3LG7A 3ZC0A 2CG3A 2CE7A 5E75A 5AQTB 4A98A 2R2LA 2LXMA 2BTDA 3PUQA 1HFAA 3SFEA 4UI9C 2V4HC 3EVYA 1NEKA 2FUPA 2KATA 2ODVA 2C5JA 2F8XK 4QWNB 3I5PA 3UUNA 3R9AB 2KZTB 3PE0A 4ZHQE 3HKDE 2W4XA 4U95D 4MLPA 4OVVA 2KT9A 4U2ZA 2L6JA 2QFCA 2J4DA 3F2EA 1XMQT 3Q9UC 4PJMA 3VR9A 2ZGDA 5LX8A 2X0YA 3ZHEB 4ACKA 3H37A 3TGOA 5C1DA 4CN1A 2JIWA 1HF8A 3T8OA 4X20E 4BJMA 2IFUA 2MHKA 3UUBA 2FO7A 5C3JA 2X6IA 1DCEA 3NRXA 3AAEB 5G04J 4ISSA 4PW8A 4MS6A 5FT9A 2IC9A 3NKZA 4ZZCA 2YU1A 3UM2A 2BKGA 4QH1A 3IHYA 1QYMA 3ZYQA 5JDHA 1W3BA 1HZ4A 2F37A 4IE7A 2LSIA 4M1PA 5AQQB 3EU9A 4BETA 5AQPB 4HN9A 3PREA 4FADA 2ETCA 3UQ4A 5JJTA 2H7OA 4JI6T 2EHOC 4YT0A 2H6HA 3NZPA 4AKIA 4GTOA 3TWVA 2WB2A 1NA3A 2BS3A 5B3SE 2YOEA 1LD7A 1E8WA 2PQRA 2BBJA 3UKRG 3RH3A 4I2ZA 2VKHA 2CXLA 2J8SD 4DV0T 3APDA 3UXGA 4YTMA 2P9LG 4B6XA 2HN2A 1D0ZA 1EDUA 3ASDA 3FHEA 3D9IA 3MKRA 4DLOA 3FTXA 5HXRA 4DV3T 4M7CA 3RQWA 5CRUA 2VSXE 3S7FA 3JQ1A 1AJ3A 4TV3A 4ZI3C 3DEPA 4I55E 1JWFA 3LVQE 1ZEEA 3QARA 4W9RA 1GW6A 1E8YA 3U3WA 1WM5A 3FUHA 4N78D 5FXVA 3QDNA 4ANUA 2HR2A 2X0LB 2R5SA 4U74A 3AE9A 4IIJE 5AQBA 4EV6A 4PK5A 2VGXA 1RZ4A 1DVPA 3CHOA 2ZM6T 1BD8A 4KMCA 5FZQA 1SUMB 2ES0A 2NTYA 3PDNA 5G2NA 4LFBT 3CQXC 2MYSA 2B0OE 1PC2A 5JQGE 2E9XB 4IREA 4YSXA 3PH0C 1BI7B 2KWIB 3Q9NC 2DLRA 3ZYLA 3CVPA 2XASB 5JDQA 1G3NB 2DIWA 3C51A 5ENSD 4V3IA 4RVBA 3B7TA 3QWWA 1H7CA 2V6YA 4JI4T 3FUJA 4AKRB 4HGAA 4O4HE 3Q5XA 2I1JA 4GZ5A 2P9BA 4B89A 3ZSTA 1Q2ZA 3J5PA 2KWHA 4HOQA 5BT1A 3ZYMA 4JD2G 1VDYA 4LEUA 5EDSA 3UU8A 3FH8A 3U78A 1US7B 3AEFA 2Y6XA 3JAFA 2RA1A 2KCKA 3IEEA 4HFBA 4JI2T 4WWNA 2WXJA 1LVKA 2GRPB 3ZN1B 5BR8T 2WXNA 3AB3B 3P50A 5FYMA 5JREA 2YN6A 4YNDA 3SZ7A 1TEZA 1D1AA 5ABFB 4P0BA 4UVAB 3FY4A 5B1BE 4YJ2E 4O6FA 3Q5WA 4XAXB 2CEAA 2DYRE 2V5FA 3UX4A 5AQHB 4G8LA 1D9SA 1IQUA 3G06A 5T3RA 2ACZA 3DWLG 2CBJA 4DVDA 3LY8A 2XY8B 1UG3A 3ZSSA 4HRNA 5FKYA 2WXPA 2X66A 3OVUA 2VVSA 4LFCT 5AJLA 3PZ3A 5FQ7A 4L23A 3FXEB 4O1PA 5KX5E 3W9GA 1HE8A 3L13A 3LS8A 5DABA 4APOA 4ANJA 4DIDB 4RQIA 4PJLA 3NBNB 2Q7FA 3UQ7A 1H6PA 3FU0A 5T8IA 1U5PA 4JI5T 1OCCE 3ZW3A 2XQ6A 2WSSV 2L9QA 2KXPC 3CWZB 4LF9T 1E7VA 4ZZBA 4ACLA 2X6JA 2WM9A 3KV9A 1S70B 3P1UA 4LERA 3JC6C 5JVDE 4PJJA 4U33A 2JLBA 2PL2A 2R05A 1J5ET 3QKYA 3E22E 4GK5E 2LE8A 2WDQA 3MACA 4O4LE 3OYZA 4EYYR 2XGOA 5J2UE 3MK7C 3I4RB 5H7PA 1LRZA 5JHBA 4WNGA 4CQIA 1J1JA 3KBUA 4NACA 3MKQA 4PS7A 2Y0BG 3FFLA 5J08A 2I59A 5FMNA 5JRCB 4L9PA 1S64A 1MNDA 2H3RA 1NWMX 3LBXB 3PZ4A 1OUVA 2LSUA 3GZ1A 4DX7D 4O4JE 3B95A 3C3OA 3QC9A 3SOLA 1OCRE 4AQFA 3PUWF 2RG8A 2I2OA 3AXJA 2UY1A 4WZXA 3MZLB 4O1OA 3ASGA 3AEEA 3H3AA 3JADA 2XQ4A 1NZNA 2L9BA 4IDOA 2QZAA 1BI8B 2PJQA 1KT0A 4AOFA 2FF4A 2HHHT 2WU2A 4B3RT 4DR7T 2J47A 4DV7T 3P4RA 2NC9A 4U7IA 5H6QB 1YMPA 3HI2A 5AQKB 1EPUA 3JAEA 3VU7H 1T7SA 4JI1T 2OEWA 4HFIA 2XQ8A 4LMLA 3ONKA 5T4YA 1MX4A 2J4GA 2Q9QD 1ZHCA 4DR6T 2WXMA 5JHAA 1AWCB 4APFA 1H19A 3U66A 3RLFF 1MX2A 3JXIA 3RKVA 5DQVA 3VRAA 2WQYA 1IJ5A 1QNFA 3TWQA 2W62A 4EYUA 4OX9T 2H6FA 3LY7A 4WNEA 3LJ3A 4I9EA 1TNOA 2AWIA 3NB2A 4G24A 4JI3T 2NP9A 3CIAA 4GTQA 1V9DA 2ZM8A 2D5UA 3UU6A 4ZHBA 4UF0B 3AG3E 3TJPA 5EX3A 2XGMA 2Q9QC 2WXFA 3V2XA 5D2MC 1FIOA 3TWUA 4QXBB 4X1KE 1BLXB 4EBAG 2BEDA 2V5CA 2FJEA 3J9X1 5ADXL 4UWFA 3RX6A 2P9KG 5AQAA 1N4PA 1OEDA 3SD5A 3ASOE 3IKOB 3AE2A 1XZYA 4YSZA 4A1GA 5HXEA 2A5UA 4G2AA 4EPZA 2UU9T 4D10C 3RF1A 4HVBA 4U3CA 4Y6WA 2W63A 4C0EA 4A3TA 1SQMA 3AAIA 4EZHA 4ZI2C 3C3QA 3LY9A 3LEWA 3CK9A 4BFRA 5FZSA 4H9NC 2MOWA 4L1BA 5C2TA 2IDOB 5L4HA 5F3JA 4GCOA 2V5DA 3KBTA 3ZEFA 2OV8A 1S0PA 4U2YA 4JBWF 3ZXSA 2QYWA 3LSVA 5ANLA 3SBSA 5BXUA 3FUMA 3ZJ1A 1K3ZD 2WMOA 4PS8A 3Q4AB 1O1SA 3AAAB 5AAOA 5LG4A 1FCHA 2XEHA 4IHJE 2ETAA 3ASNE 4QX7B 5CERB 1WY6A 3FU3A 3AS8A 4UV9B 4H7YA 1FMVA 3GMIA 2ZLYA 5ENNA 4HB5A 4DX2A 2EINE 3NOGD 2JEKA 4I43B 4YXDA 3CLJA 5IY5E 3MA9A 4KBQA 5ENQD 3EHNA 4IDNA 4K5BA 5AIJA 1WDYA 3PU8A 1UURA 2IO3C 3RK6A 2KSRA 1O3XA 2X6FA 1D1BA 4IE5A 3QNUA 4LMKA 1QLBA 5B1AE 1IXVA 2CLYB 4U72A 4P09A 3UM3A 2P9SG 1OT8A 1Y6IA 4GU5A 2M67A 3FZLB 2XTLA 4DR1T 2E5LT 1PY1A 2XZEA 3LDQB 1BR4A 3Q73A 5LOZA 4LFAT 5HEOA 1W09A 1H6KA 3RHWA 2CHWA 4OAVB 1EYHA 5LA6E 2D2SA 5LHIB 5HQ8A 2MTQA 3NZSA 3URZA 3ZT5A 2OOEA 3TLWA 1EF1C 2ACXA 4J8FA 1LVFA 3GZ2A 2QGSA 3AE3A 1ZB1A 3CVQA 5LBQB 4GTVA 4Q94A 5CJ5A 4JC8A 3DRAA 2WS3A 4OK0A 2F0YA 2XHEA 4CN4A 3LCAA 4JW1A 4U0SA 2A72A 5FXWA 2CFZA 3B13A 5BW8C 1IJ6A 4UQXA 4QQIA 3J7Yq 3D9MA 4YHHT 4M3OA 3IBPA 1KT1A 4MBGA 1N4QA 1E2AA 4DV1T 4EOZB 4ZEYA 5C8YE 4A3VA 5ENRD 1HS7A 4HOTA 3ZMZB 1TJFA 4ANWA 5KJMA 2MPKA 4AQFC 3P7IA 3SGHA 2BDEA 5CA0E 3D9JA 2XJ7A 3FULA 4N3BA 5HKPA 3CMLA 4YDYA 2NW8A 3AE1A 1IKND 2CCQA 2V7JA 4ZFHA 4DPRA 3AG1E 5LJNA 4CGWA 2NXPA 3VKHA 1T8BA 1S35A 2A3DA 4XBFB 4XX5A 3S7DA 5KNGA 5A6CA 1SA4A 2IOLA 4PFOA 4NURA 4U0UA 4TNVA 3T9KA 4HE8A 2JQ9A 4I4TE 2WXOA 2ZXWE 2DZOA 2D0UA 1ZOYA 1TN8A 3ZC1A 2FULA 4UWHA 3K3OA 4IT4A 3QB5A 2DWZA 3P8CD 3O9XA 5FP3A 4OAUC 5EX0A 1JCRA 5HWYA 3OXGA 2GGFA 4LG6A 1NAFA 5G04C 1XDPA 2UY1B 3MYVA 1BR1A 2RP4A 2W66A 3QB5K 5L3DB 3N71A 3FHNA 2FJBA 4H9SE 2XAJB 4IDQA 4YJ3E 4COFA 1R8IA 4TN7B 1XNQT 1SVXA 3HXDA 1ZP0A 3PU3A 4ABNA 1DC2A 4TV9E 4UVBB 5CMWA 3CKCA 5AQSB 4QH4A 4KBMB 4F53A 1JCSA 2CG2A 2BKKB 2RD0A 3ZYKA 1OEDC 3EHMA 3OYXA 3DBSA 4Z8XA 3RU0A 5AQ9A 4O2AE 3N5LA 4Z91A 2IC6A 2XEEA 3NRYA 1XNRT 3PZ1A 1ELKA 4AQGA 3LK3B 2KC7A 3TLUA 1W0AA 2GRMA 2XUEA 2LHRA 3L54A 3RKGA 4I17A 2VTBA 2ZGGA 3FB2A 5AQLB 2XEVA 5EIBE 1B89A 3PEUB 1YKEB 1Z3YA 3MEKA 2WWUA 1KNRA 5ARGA 1Z0PA 3KEZA 3N2OA 3BQOA 1J5WA 3CPZA 3PUGA 3RIAA 2WZHA 2YINA 2WBLA 4MALA 4OVUA 2QYJA 2X68A 3GWHA 5AQGB 3E34A 3LVRE 4FJYA 1T72A 1MIWA 3LXUX 2JQHA 3C98B 1Z5SC 3RIBA 2CMRA 2WXHA 3ZMVB 2WDRA 3Q79A 2BG9B 3L8RA 1K1AA 1TNZA 1FJGT 2YKSA 5L2LA 2LHNA 3FBLA 3IV0A 3U4TA 4YHJA 3T5VA 4TUYE 4UV8B 1G8XA 2YDSA 2YDQA 3T8MA 3KAEA 4N39A 3B5MA 3UFGA 3N9OA 3SO8A 3KSLA 5FZRA 2UUAT 4AY6A 2NYJA 4BT8A 5CCLA 4K5AB 2DNXA 3SRZA 1TNBA 2VKOA 2X6HA 4KZCA 5HXSA 4KVMA 4J8EA 2LSYA 2XZTG 3PUXF 3TG4A 1OY3D 2XGSA 3ZPJA 4CDMA 1IBLT 2OV9A 1KNZA 4ZS2A 3RRCA 2Y8DA 4UEMA 3TLVA 3KSQA 4JEHA 3ULQA 5FXXA 4YVOA 3S4UA 5HXCA 3QOUA 5FY0A 4FLBA 2LXLA 4X8QA 1N0QA 2VURA 1UW4B 4CEMA 4HORA 4JEUA 4KZ0A 1INZA 2IY0C 4IDZA 1V54E 1XNFA 3N2GE 2UXBT 2EIKE 4J8DA 4X1YE 2CM0A 5JDNA 1OCZE 3NVOA 3AE7A 4A1SA 2OVBA 2CWYA 3D9HA 1IBKT 1YQ3A 3KV5A 5DJQC 1WR6A 3IF8B 3V31A 1WR0A 1KFYA 3L16A 5KMGP 4BJNA 5IYZE 3FUIA 4NXMT 3FZHB 3UQ3A 4AISA 4DX1A 2NW9A 4X66T 3L82A 1E96B 1RW2A 1MMAA 3BQIA 2LSGA 3CVYA 3ABME 4FU3A 3GN5A 2WPVA 4JHKA 2JMKA 3AA0B 2XRZA 4F6RD 3Q7FA 4U0ZA 4EQFA 2V7LA 4DV4T 4FA6A 4ZXLA 1U4QA 4CI3B 2CBIA 3U9WA 1CUNA 1BPOA 2E9XD 4G25A 4XI0A 1OXJA 1IHBA 2N1GA 4FI5A 1OWMA 3QAQA 5JDMA 5KNHD 4AV7A 4U07A 3I9YA 4AY5A 5EK4A 3TWRA 3ZN3A 3PRZA 2VGYA 3ULYA 3ZMTB 3CKDA 2LJLA 2WP9A 3ENEA 4GA0A 2J62A 3SNXA 4HLEA 4GYYA 3S7JA 2EHOB 4I1OB 2EQXA 3PUYF 5HEGA 4MBQA 4J6IA 1HU3A 2ONDA 5ITZF 4U7EB 3ZRHA 4A63B 3V2OA 5EILA 5EIDA 1QBQA 4HWHA 1S63A 2Q9QA 2IW5B 4LCTA 4UWLA 3VTYA 1Z6TA 5J1GA 1MNEA 3CVUA 2NW7A 3PJAA 2DBAA 2C5IT 2XAGB 5AJDA 3HHMA 2I6HA 3FBZA 4DR4T 2VL8A 2ETBA 4EEBA 2E2AA 3HL6A 1OCOE 4UELA 2X9YA 3M3ZB 5HCJA 3RAUA 2V8SV 2SPCA 2I0MA 4BT9A 3LYAA 5LBMA 2E5VA 3AE6A 5FWQA 3EU5A 5AQFB 4AIUA 3N9NA 4UI9J 3R84B 1N9AA 2KCVA 5ABHA 4PUCA 4KP3C 4RLYA 2Y4TA 3KDSE 4ILUA 3D9LA 5DBKA 4L5GA 3N9QA 3UU3A 3FTSA 2CWOA 2H88A 4LF7T 4ILIA 3GZSA 4B3TT 2GK9A 1N4SA 1N32T 2RKKA 3P4PA 3CHQA 2WXKA 1KEYA 5LCYA 1QQEA 2AW6A 5LXTE 5FL1A 1WYBA 4MFRA 4DUIA 4DV2T 3SFZA 4HWIB 3P4QA 2L6BA 1HXIA 5HEHA 4H9RC 1LKXA 3AG4E 3D9PA 4E7SA 4HEAA 3PZ2A 5HRYA 4B0ZA 3ZCIA 2WAUA 2L8KA 3UT4A 2PFVA 4F7AA 2V4LA 1E1HB 3RIFA 1SZAA 2KINB 4GTTA 4N2QA 4EXTA 1KZOA 2Y3AA 3UT5E 2YNQA 3Q15A 4C0MA 2K9AA 1ZV4X 4DV5T 2XQYA 4HFGA 3FTYA 5ABEA 4HBDA 4CI2B 3B7RL 3B7SA 4LNUD 3L09A 4QX8B 3JQ0A 3DEOA 4TV8E 4YFSA 2VK9A 5JR9A 3CHPA 4TXQA 3V5UA 1UX5A 4YDOA 3FZMB 3ZIMA 2LSKA 3KD7A 2DVWA 4DMVA 3O1HA 4BA9A 1NI1A 2H6IA 4HWCA 5EK3A 3I4GA 3RO2A 2IHR1 4DX6D 1G73A 4FJZA 3DPYA 1MIYA 2OCCE 2WQHA 2LAHA 4FP7A 2WWVA 1HNWT 4JVSA 3RPUA 2XSAA 5EYPF 5J0ZA 3ZXPA 5BMVE 3LJNA 1HG5A 5JJ7A 3PNTB 2LLYA 4TNWA 3BG0B 1HX1B 1H2VC 1TYQG 4QHOA 3TWWA 2C2LA 4U63A 2X9WA 2V0PA 4O2BE 3EIJA 2LO6A 1A17A 2RPAA 3KINB 3D3MA 3FDHA 4PFPA 1VRBA 2KXPB 4JLEA 2HH7A 1O1TA 3C3RA 1HS6A 2LM2A 4QXHB 3HG0D 3AA7B 5D0QD 3N9MA 4OYKA 4J7WA 5KCMA 2XPYA 4FHJA 3RC3A 4BX9A 5FIOA 3ZU7B 4BWRA 4KHPT 2BVMA 3SFYA 2YU2A 4G1TA 3HKBE 3Q5EA 5CMYA 1LF8A 1TN7A 1KPSB 5ABGA 4WAFA 1MMDA 2KLQA 3C50A 3AVRA 3HYMB 4XI9A 2LSJA 4JEUB 4J8SA 3K8PC 5LGTB 3CSTA 2YEVC 4TUUA 1OEDE 5AN8A 5BUZA 2XPZA 4AXHA 3E33A 2P9IG 4HFCA 1HCIA 3AVSA 2KCLA 4ILCA 2XPIA 3SF4A 5JH7E 3P4WA 4UIGA 2BG9E 2K24A 4TWHA 4WYVA 3UT8A 2WCAA 5KJNA 4TXPA 1CHUA 5ARFA 3TG5A 4B94A 1E90A 4I2WA 2Z6EA 4A56A 3LK42 2DZNA 3MCXA 2BBHA 3PUVF 2Y1LE 3G2WA 3X1DA 4GOUA 3RC8A 3DXMG 4I1MA 1VOMA 5HCMA 3GN5B 3EIQC 3DSXA 3UKUG 4JUYA 2B6CA 3TWSA 4UUCA 4LF5T 4B3MT 4UWKA 4K0UA 3AE4A 2LRKA 3APFA 3AU5A 5LCWC 2B1EA 4G11A 3LJCA 5KJKA 2C0LA 5LHHB 3BU8A 1JNRA 4BY6A 3NBXX 4IDPA 5FVLA 2VSOE 1UGOA 4E6HA 3MXZA 4Y6CA 1BR0A 2E0IA 3SS1A 2NOXA 3E30A 4HKAA 1FMWA 3G2UA 4JHJA 2B76A 3SQVA 3TAXA 3NAWA 4U31A 2VGXB 4H7XA 2V6XA 3EHQA 4G8KA 5LFAA 1X81A 2P9PG 3TLTA 3ASFA 3C64A 4UQYA 2N2NA 2Q9QB 4I1AA 2KM4A 4CRWA 4CGVA 2ILRA 3CV0A 3ZLIA 3E08A 1KLXA 3LDZA 2OA5A 2RFAA 2IF4A 2IUBA 4TUMA 3T5XA 5E0OA 3ZVVA 4EEDA 3AEBA 3Q47B 1JCQA 4F3VA 3FZFB 1LD8A 2LT3A 4PJNA 1M7KA 2LNIA 3WAJA 2KZTA 2VQFT 4BSXA 3L9TA 2V6YB 3DSSA 4V1Av 2FBWA 4IULA 5LG3A 3NF1A 1B7TA 4Q25A 2Y48B 3PTRB 1UOHA 3HKEE 1KK7A 2W61A 5CEAA 3ULEG 2FBNA 1MQSA 2VJ8A 1FVHA 4QFVA 1WYCA 3ZHEA 5AFUL 4N2SA 4WWOA 1NENA 1HH8A 2HM8A 3ZGQA 2XCBA 2UXNB 1JWGA 4J2CA 4RG6A 4DI3A 2J49A 2JRKA 3CHRA 5JR9C 2A5EA 3MGBA 5ENOD 2UWJG 4GTSA 4LF4T 1XGWA 3WXXA 4ILAA 1Y8MA 3MZKB 3OAWA 3T1HT 1IBMT 2DYSE 1U2VG 2P9NG 4IYPA 2VQ2A 3GYZA 4X64T 3CVVA 5L3FB 2PBIA 3JXJA 1N11A 3FTZA 3UFEA 2ZM2A 2K3WA 4EB6E 4Q69A 5F5WA 2EILE 4AKGA 2VWAA 1ELWA 1ZBPA 5DIZA 3EDTB 1UN9A 4YTNA 5JDLA 3B7BA 1N54A 2BKOA 3A8YC 3NOCD 3ESLA 5AYWD 3ZN0B 3KS2A 4X62T 2M6IA 4HI8A 3AA6B 3PEVB 1YA0A 4J0UA 1N0RA 1WAO1 3TWXA 4ERRA 4MKTA 4ATGA 1SE7A 4DR3T 3R9MA 3N9PA 3EHRA 4DBRA 1X9BA 1YW0A 2LRLA 4ISTA 2J09A 3U64A 1UX4A 4GMJA 5JA4D 4GCNA 5KXJA 3UUMA 4ILHB 4C91A 2IQCA 3UU4A 5HWXA 4WBOA 4PK6A 2HO1A 3K3QC 4EECA 4L7TA 2XQ3A 1HX8A 4HOUA 3CVWA 5FY7A 3OPCA 2KBXA 4L2YA 4EGWA 2E2EA 2CHZA 3QK0A 3CX7B 2MBGA 3X2QE 4CI1B 3HXCA 5AQNB 5D0OD 4L2LA 3DPDA 3PV0F 4DBQA 3MKQB 1IZNB 4G63A 2V7MA 4IRUA 5JJ6A 3DSUA 2E9XA 2ZU6B 3PE4A 3HR0A 4KYOB 4EBAA 4DI4A 3AEAA 1UN8A 3RYIE 2CRBA 2AVPA 3AJIA 4X65T 3AXJB 2J4BA 4CYMD 3L39A 1FPPA 3CR3A 4EZ4A 3IBEA 4AXPA 5ANRA 5J2TE 1K1BA 4GKKT 4JA7A 2V8SE 3UIOC 1SA0E 1ZU2A 3JYSA 1DU2A 1OWNA 4XIFA 4AI6A 1MJ0A 2VKJA 2J07A 3JUIA 4EZLA 1MIVA 4CDRA 2V5QC 2WXRA 3MJWA 2I9CA 5KJLA 2WY2A 2XM1A 5LB7B 5FQ6A 2JQKA 1VCTA 3B57A 3PURA 3RO3A 1O1RA 4Z68A 4UVCB 5ETWA 3RGLA 1KZPA 4F8HA 2XM2A 4QXCB 5FINA 4I50E 4ADZA 3Q5MA 1D8EA 3IHRA 3EI0A 3ONJA 5JDGA 3FU5A 3JCFA 4P0AA 2J08A 2JQQA 3C5RA 3ISMC 2IONA 4KVOA 4LSZE 3T8KA 2V1DB 3ONLC 5A23A 3AS4A 1UCUA 2LOPA 2PZIA 2E8IA 3UINC 4NIQA 5ABFA 1MZCA 3VHLA 4WNDA 1H6OA 4HXIA 3MA5A 2R17C 2L0IA 4P1NA 2DCPA 5G05J 1YD8G 2DI4A 5A7DB 4HFHA 3C4WA 1YYHA 2VYIA 1WRDA 3JCKC 4LUNU 3L17A 3UT7A 3UTMA 4CXXA 2GRLA 1OWOA 4XEIG 1FVFA 2D0TA 3QK6A 4U7YA 1N52A 4HNAD 5HI7A 3C72A 3EABA 3L08A 2GRRB 3UU5A 4HWDA 3SI5A 4IL9A 1OEDB 3CX6B 3FTUA 2LUHA 2R02A 2FO1E 3MV3B 5C2YA 1Y01A 4AQYT 2YK0A 4WUYA 2UXXB 3HA4A 3KVAA 4FJOA 2HYZA 3RIUA 3LFMA 1X5BA 4HLLA 3RSEG 3L3PA 5LJMA 4XKBA 3ESKA 4JXTA 3ABVA 4GPKA 2DWKA 3HVEA 4GMRA 3ZKRA 3QOFA 4NQ0A 4GTPA 2G0UA 4JA9A 1JPLA 4HWFA 4KI0F 5EK2A 2A2FX 2XAFB 3D9OA 2UUBT 3ZEFB 4IE6A 5FQ8A 2C0MA 4ANXA 4F1PA 3CSFA 4GKJT 5LGNB 3SY2A 4URKA 2FJAA 3QB2A 5KBAA 4U8VD 2H6GA 5IWAT 4XE0A 2WB5A 5JRCA 3AEGA 3ZPOA 2YHEA 4O4IE 3PUAA 4JI0T 4GYSA 3LBXA 3FTVA 5G55A 4NPPA 3I1AA 3CK7A 4CN6A 3G2SA 1U3CA 3W15B 3SBTB 3E4BA 2X67A 3OXLA 2M63A 1OWLA 2CXDA 3DSWA 5AQUB 5EN5D 3VLFA 1N4RA 3RYHE 4BX8A 3D9NA 2C5KT 2X9HA 1E8ZA 4HRLA 2PM7A 3B7UX 3EUHA 4BTBA 2EHOD 3UIPC 3E0ZA 3BUAA 3CVNA 2I1KA 3AG2E 3RJVA 3R6NA 4YDEA 3R7QA 3O4ZA 2HN1A 1YCSB 4IE0A 3UUXA 2VASA 4CZ2D 2ZISA 3KV4A 2W67A 2GRQB 4C90A 2WXQA 2WXLA 4AJWA 4F1SA 4WBNE 5LHGB 3FUDA 4FLHA 4LNBA 4TWFA 5CB4E 4WNKA 4PS3A 4N3CA 4R7LA 2X38A 3OXFA 1TJCA 5M72A 2XQAA 5LOVE 3SHFA 3CQCB 4EIWA 2XQ7A 3JUEA 2CPTA 4HFVA 4NRHB 4ZI3D 2IMLA 3PUZF 3DXKG 1SZ9A 3UM1A 4UF0A 2VKDA 2XHEB 2XRYA 2AXVA 2WDVA 2NTXA 3TL5A 4F6RC 4RSYA 3NZUA 4P29A 5IHYA 1N94A 2BKPA 3FUFA 2CHXA 1EZ3A 2UUCT 4OFZA 2E9XC 4H63H 5EYLA 2AE9A 3V5SA 4U8HA 3ZMSB 2F8YA 4GA2A 4XKCA 2BVLA 2R59A 5DQWA 3ML8A 1IAPA 4TZ4C 4HS2A 1KF6A 4X5TA 5L4EA 4PNIA 1N95A 1XMOT 5JMND 2GROB 3FWVA 1Z8UA 4BEPA 2YHCA 1T98A 2AXUA 3CHSA 3CKBA 3Q75A 5CBNA 5GONE 1E7UA 3PE3A 3NZQA 3BG1B 4WWPA 3ZKJA 5KWDA 1L5JA 4LRZA 4BAYB 3O1IA 4AIFA 2LM9A 2IU1A 4GIWA 4GYWA 2V26A 2VGEA 2KMFA 3QJZA 3EDVA 3FEXA 3PVLA 4B8CB 1WFDA 1WG0A 4GPMA 4IL4A 3PUJA 2UXCT 2EIME 2PM6A 2JMHA 4CXYA 3E32A 1HO8A 3HDXA 5LP0A 3IA3A 3RKOA 2MRIA 5LP6E 1UJJA 4JZYA 1W9RA 5J90A 4UXNB 3KV6A 4GYRA 4EZJA 4I43A 3LKUA 4G2VA 2DCFA 3M65A 3C4XA 2BUGA 2V7IA 1PAQA 2WXIA 3OTNA 2FEZA 1SA5A 2XS1A 4JHRA 2QRXA 2RFMA 2W00A 2OEVA 4AP2A 2DWGA 3K3NA 5CRVA 1NL4A 4PH4B 1XDOA 3HXEA 5L3EB 3EDUA 5BPPA 4PK4A 3O48A 5L3CB 1K8KG 4AKHA 1X79A 2X9XA 3RIUC 3FH5A 1MX6A 3RRNB 4HQDA 3UPVA 3FP3A 5CHEE 4DMWA 1TNYA 2WQ6A 3Q49B 1Y64B 3CIRA 2Y4UA 1S94A 1FEWA 1MMNA 2VTBB 2M6BA 4DR2T 2ODUA 4NXNT 3KVBA 4N5QA 5AQRB 4GZDA 2QA7A 4J8YA 4DX5D 3BQKA 4YLHA 2GRNB 3FH7A 4XZ4A 3FTWA 2D9DA 3AE5A 4CZZB 2CA5A 2MAWA 3APCA 3JC6D 1ZKEA 3LPZA 2P2CP 1BU9A 3WI3A 4LF6T 3CK6A 5BV1A 1AP7A 3O1JA 3ANWA 2J9QA 4YDWA 3DSTA 5CCMA 3FZKB 4O60A 5CBOA 1SW6A 1MHQA 4B8AA 3RQUA 2XSBA 4NUVA 3AE8A 3DP7A 4TX5A 3QC1A 5FTPA 3HVEB 2LEHA 4YTPA 3HXBA 4UWGA 4AKLA 3PS6A 4KT6B 2VL0A 2H7VC 2WZIA 4TRQA 1D1CA 3ZJ2A 4MLKA 3AU4A 3D0TA 5H6RB 4ILGA 2X0HA 1UK5A 3NQPA 4DV6T 4ASKA 4GA1A 1IHGA 3CK8A 3MKDA 4HTEA 2WMNA 1FT1A 2MOZA 2BKNA 4G23A 5CEDB 1NP7A 3L6AA 1YQ4A 4K5CA 1MMGA 3OJAA 3K1SA 2R03A 1HNXT 1H2UA 4KXKB
chains in the Genus database with same CATH topology
4DK5A 1IQRA 4JEHB 4NUUA 3IHVA 2WVIA 4AEZC 2PQNA 3CVLA 2PG8A 1QUUA 4DNDA 3FU6A 3QUJA 1OWAA 2A4ZA 3PUSA 1E8XA 2CFUA 3CGHA 3ONXA 4H9PC 2X51A 2IJGX 4K0RA 3CQGB 5HXHA 2JJ9A 4OYSA 3HKCE 2KNDA 3GA8A 4JPSA 3BEEA 2LSVA 2P58C 2YQ8A 4OYJA 3PUKA 3UUXB 3GW4A 3VKGA 4IN3B 1H2TC 2J1DG 4CT0A 4DLQA 3N2KE 3HIZA 3C4ZA 5FQ4A 4K03A 4IE4A 2VB6A 3RRUA 4HOSA 3DJBA 3AS5A 2L3LA 4QKNA 5KDMC 3ASHA 3G2VA 3ONLA 3F57A 2K48A 4ZI2D 4ZS3A 3I3NA 3QWPA 2CXFA 4C9BB 4U04A 4DJAA 4OHFA 5LNKA 1YKHB 3SWHA 3C98A 5HYAA 4I6EA 3U3IA 4MRUA 4GZCA 4CCAA 5FXZA 1Z3XA 4PDXA 3Q2MA 3UULA 1BR2A 4GZ6A 4FC8A 3IEGA 3K9IA 3D9KA 4H9OC 4I6GA 5FJYA 4A55A 1HTJF 1HG2A 1QZ2A 4ZOLE 3Q9DA 4ME2A 3FEYA 2VSYA 3KFWX 4RG9A 2CLYC 2JPFA 1ELRA 2ZMAA 5EZYE 4AVXA 4G26A 5FNVE 5BV0A 3O4XE 2KZ7B 3UTKA 2XCCA 3ML9A 3PDYA 4FULA 4KMOA 1D0YA 3VLDA 5BNWA 4CXWA 1WLXA 1H0AA 2N9DA 2X6KA 2LAIA 2K5BB 4UI9K 3CVXA 1QSDA 5M4YA 5G05C 3I9WA 3AA1B 5TAOA 2WQ7A 1UJKA 4EAHA 3FUKA 3OKQA 4H63V 5LGUB 5EKQD 4I9CA 5A1LA 3G2TA 2BZBA 5JR9B 4N5CA 1DNPA 3RRMB 5FY1A 2WXGA 4X1IE 2VSNA 1P5QA 5L3BB 3VTXA 4GYOA 4IGUA 1OWPA 3ZFWA 3R7RA 4E85A 2W0GA 1OXZA 3S2AA 1IYGA 4AM9A 3VLEA 3I0OA 2EHOA 3TXMA 3ANWB 3PNLB 5HAXA 1D0XA 3ZCJA 5LCWJ 4PAGA 3F31A 2XQ0A 2OVFA 3MX3A 3FUNA 3RRWA 2QY7A 4YVQC 2L0TB 5F8PA 3A5XA 2LOSA 3BK9A 2IOSA 4Q96A 5JDFA 4GAAA 3QWVA 2X3MA 3BQLA 4MHCA 4ZI7E 2HPLA 4CT4A 3FUEA 2NWBA 5CA1E 5AENA 1NA0A 4N3AA 3N9LA 4KUMB 2DHRA 4L9IA 3ETVA 4WNFA 3RYCE 4O8SA 2AXZA 2FI7A 2ZM0A 4JL0A 2BF0X 3MJXA 4L0RA 2IAKA 3WAKA 1JUQA 3CX8B 4GK0E 3TKLB 1U3DA 2GW1A 3DTOA 4GMLA 3TXNA 4GB9A 3MV2B 2HPJA 3I0QA 4ANVA 4CDNA 5LYJE 4FHKA 4GZ3A 3QNKA 3ETUA 1SHZC 4H9QC 4UQZA 2NSZA 4I6JA 5E76A 5L3GB 4XZCA 3CHMA 3CVRA 4DO0A 3OBVE 2V7KA 2XAQB 3FXDB 3UMVA 3PZDA 2XAHB 3P2BA 3RYFE 3LK2B 3S7BA 3CEQA 3L22A 3EJNA 4E7ZA 3ZMUB 4WW0A 4EZKA 2C0SA 4BTAA 3LG7A 3ZC0A 2CG3A 2CE7A 5E75A 2BTDA 3PUQA 1HFAA 4UI9C 3EVYA 2KATA 2ODVA 2C5JA 4QWNB 3I5PA 3UUNA 3R9AB 2KZTB 3PE0A 4ZHQE 3HKDE 4MLPA 4OVVA 2KT9A 2L6JA 2QFCA 2J4DA 3F2EA 4PJMA 5LX8A 3ZHEB 4ACKA 3H37A 3TGOA 5C1DA 1HF8A 2MHKA 3T8OA 4X20E 4BJMA 2IFUA 2FO7A 2X6IA 3NRXA 3AAEB 5G04J 4ISSA 4PW8A 4MS6A 5FT9A 2IC9A 2YU1A 3IHYA 3ZYQA 5JDHA 1W3BA 1HZ4A 4IE7A 2LSIA 4M1PA 4HN9A 3PREA 4FADA 5JJTA 2H7OA 2EHOC 3NZPA 4AKIA 2WB2A 1NA3A 1E8WA 2PQRA 3RH3A 4I2ZA 2VKHA 2CXLA 3APDA 4B6XA 1D0ZA 1EDUA 3FHEA 3ASDA 3D9IA 3MKRA 4DLOA 3FTXA 5HXRA 2VSXE 3S7FA 3JQ1A 1AJ3A 4TV3A 4ZI3C 3LVQE 1JWFA 4I55E 1ZEEA 3QARA 4W9RA 1GW6A 1E8YA 3U3WA 1WM5A 3FUHA 4N78D 5FXVA 3QDNA 4ANUA 2HR2A 2X0LB 2R5SA 4U74A 4IIJE 2VGXA 4PK5A 1DVPA 3CHOA 4KMCA 5FZQA 2ES0A 2NTYA 3PDNA 5G2NA 3CQXC 2MYSA 1PC2A 5JQGE 2E9XB 3PH0C 2KWIB 2DLRA 3ZYLA 3CVPA 2XASB 5JDQA 2DIWA 3C51A 4V3IA 4RVBA 3B7TA 3QWWA 1H7CA 3FUJA 4AKRB 4HGAA 4O4HE 3Q5XA 2I1JA 4GZ5A 2P9BA 4B89A 2KWHA 4HOQA 5BT1A 3ZYMA 1VDYA 4LEUA 5EDSA 3FH8A 3U78A 1US7B 2Y6XA 2RA1A 2KCKA 3IEEA 4WWNA 2WXJA 1LVKA 3ZN1B 2WXNA 3AB3B 5FYMA 5JREA 4YNDA 3SZ7A 1TEZA 1D1AA 4P0BA 4UVAB 3FY4A 4YJ2E 4O6FA 3Q5WA 4XAXB 2CEAA 2V5FA 3UX4A 1IQUA 5T3RA 4DVDA 3LY8A 1UG3A 2WXPA 2X66A 5AJLA 5FQ7A 4L23A 3FXEB 5KX5E 1HE8A 3L13A 3LS8A 5DABA 4APOA 4ANJA 4PJLA 2Q7FA 3FU0A 5T8IA 1U5PA 3ZW3A 2WSSV 2L9QA 3CWZB 1E7VA 4ACLA 2X6JA 2WM9A 3KV9A 3P1UA 4LERA 3JC6C 5JVDE 4PJJA 2PL2A 2JLBA 3QKYA 3E22E 4GK5E 2LE8A 3MACA 4O4LE 3OYZA 4EYYR 2XGOA 5J2UE 3MK7C 3I4RB 1LRZA 5JHBA 4WNGA 4CQIA 3KBUA 4NACA 3MKQA 4PS7A 3FFLA 5J08A 2I59A 5FMNA 5JRCB 1MNDA 2H3RA 1NWMX 3LBXB 1OUVA 2LSUA 3GZ1A 4O4JE 3QC9A 3SOLA 4AQFA 2RG8A 2I2OA 2UY1A 3MZLB 3ASGA 3H3AA 2L9BA 1NZNA 2PJQA 1KT0A 4AOFA 2FF4A 2NC9A 5H6QB 3HI2A 1EPUA 3VU7H 3ONKA 5T4YA 2Q9QD 1ZHCA 2WXMA 5JHAA 4APFA 1H19A 3U66A 3RKVA 5DQVA 1IJ5A 1QNFA 3LY7A 2W62A 4EYUA 4WNEA 3LJ3A 4I9EA 2AWIA 4G24A 2NP9A 3CIAA 1V9DA 2ZM8A 2D5UA 4UF0B 3TJPA 5EX3A 2XGMA 2Q9QC 2WXFA 1FIOA 4QXBB 4X1KE 4EBAG 3J9X1 5ADXL 4UWFA 3RX6A 3SD5A 3IKOB 4A1GA 5HXEA 2A5UA 4G2AA 4EPZA 4D10C 4HVBA 4Y6WA 2W63A 4C0EA 4A3TA 1SQMA 3AAIA 4EZHA 4ZI2C 3LY9A 3LEWA 3CK9A 4BFRA 5FZSA 4H9NC 2MOWA 4L1BA 5F3JA 4GCOA 3KBTA 3ZEFA 2OV8A 1S0PA 3ZXSA 5ANLA 3SBSA 3FUMA 3ZJ1A 2WMOA 4PS8A 3Q4AB 3AAAB 5LG4A 1FCHA 4IHJE 4QX7B 1WY6A 3FU3A 3AS8A 4UV9B 4H7YA 1FMVA 3GMIA 2ZLYA 5ENNA 2JEKA 4I43B 3CLJA 3MA9A 4KBQA 3EHNA 5AIJA 3PU8A 3RK6A 1O3XA 2X6FA 1D1BA 4IE5A 2CLYB 4U72A 4P09A 1Y6IA 4GU5A 2M67A 2XTLA 1PY1A 1BR4A 5LOZA 1H6KA 2CHWA 1EYHA 5LA6E 2D2SA 5LHIB 5HQ8A 2MTQA 3NZSA 3URZA 2OOEA 1EF1C 2ACXA 4J8FA 1LVFA 3GZ2A 2QGSA 3CVQA 5LBQB 4Q94A 4JC8A 4OK0A 2XHEA 4JW1A 3LCAA 4U0SA 2A72A 5FXWA 2CFZA 3B13A 5BW8C 1IJ6A 4UQXA 3J7Yq 3D9MA 4M3OA 3IBPA 1KT1A 4EOZB 5C8YE 4A3VA 4HOTA 1HS7A 3ZMZB 1TJFA 4ANWA 5KJMA 4AQFC 3P7IA 3SGHA 2BDEA 5CA0E 3D9JA 3FULA 4N3BA 3CMLA 2NW8A 2CCQA 2V7JA 4DPRA 5LJNA 4CGWA 2NXPA 3VKHA 1S35A 2A3DA 4XBFB 4XX5A 3S7DA 5A6CA 4U0UA 2IOLA 4PFOA 4NURA 4HE8A 4I4TE 2WXOA 2D0UA 3ZC1A 2FULA 4UWHA 3K3OA 3P8CD 3O9XA 5FP3A 5EX0A 3OXGA 5HWYA 2GGFA 1NAFA 5G04C 2UY1B 3MYVA 1BR1A 2RP4A 3N71A 5L3DB 3FHNA 4H9SE 2XAJB 4YJ3E 4TN7B 3PU3A 4ABNA 4TV9E 4UVBB 5CMWA 3CKCA 4KBMB 4F53A 2CG2A 2RD0A 3ZYKA 3EHMA 3OYXA 3DBSA 4Z8XA 3RU0A 4O2AE 3N5LA 2IC6A 3NRYA 1ELKA 4AQGA 2KC7A 3LK3B 2GRMA 2XUEA 2LHRA 3L54A 4I17A 2VTBA 3FB2A 2XEVA 1B89A 3PEUB 1YKEB 1Z3YA 3MEKA 2WWUA 5ARGA 1Z0PA 3KEZA 3N2OA 3CPZA 3PUGA 2YINA 2WBLA 4MALA 4OVUA 2X68A 3GWHA 3LVRE 4FJYA 3LXUX 1MIWA 3C98B 3RIBA 2CMRA 2WXHA 3ZMVB 5L2LA 2LHNA 3FBLA 3IV0A 3U4TA 4YHJA 3T5VA 4TUYE 4UV8B 1G8XA 3T8MA 3KAEA 4N39A 3N9OA 5FZRA 4AY6A 4BT8A 5CCLA 2DNXA 3SRZA 2VKOA 2X6HA 4KZCA 5HXSA 4KVMA 4J8EA 2LSYA 3TG4A 2XGSA 3ZPJA 4CDMA 1KNZA 4ZS2A 3RRCA 2Y8DA 4UEMA 4JEHA 3ULQA 5FXXA 4YVOA 3S4UA 5HXCA 3QOUA 5FY0A 4FLBA 1UW4B 4CEMA 4HORA 4JEUA 4KZ0A 1INZA 4IDZA 1XNFA 3N2GE 4J8DA 4X1YE 2CM0A 5JDNA 4A1SA 2OVBA 2CWYA 3KV5A 5DJQC 1WR6A 3IF8B 3L16A 5KMGP 4BJNA 5IYZE 3FUIA 3UQ3A 2NW9A 1E96B 1MMAA 3BQIA 2LSGA 3CVYA 4FU3A 3GN5A 2WPVA 4JHKA 2JMKA 3AA0B 2XRZA 4U0ZA 4EQFA 2V7LA 4FA6A 1U4QA 4CI3B 3U9WA 1CUNA 1BPOA 2E9XD 4G25A 4XI0A 2N1GA 4FI5A 1OWMA 3QAQA 5JDMA 4AV7A 4U07A 3I9YA 4AY5A 5EK4A 3ZN3A 3PRZA 2VGYA 3ZMTB 3CKDA 2LJLA 3ENEA 4GA0A 3SNXA 4HLEA 4GYYA 3S7JA 2EHOB 4I1OB 2EQXA 4MBQA 4J6IA 1HU3A 2ONDA 3ZRHA 2Q9QA 2IW5B 4LCTA 4UWLA 3VTYA 1Z6TA 5J1GA 1MNEA 3CVUA 2NW7A 2DBAA 2C5IT 2XAGB 5AJDA 3HHMA 2I6HA 3FBZA 2VL8A 3HL6A 4UELA 2X9YA 2SPCA 4BT9A 3LYAA 5LBMA 5FWQA 3N9NA 4UI9J 3R84B 2KCVA 4PUCA 4KP3C 2Y4TA 3KDSE 4ILUA 3D9LA 5DBKA 4L5GA 3N9QA 3FTSA 2CWOA 4ILIA 3GZSA 2GK9A 3CHQA 2WXKA 5LCYA 2AW6A 1QQEA 5LXTE 1WYBA 4MFRA 3SFZA 1HXIA 4H9RC 1LKXA 3D9PA 4E7SA 4HEAA 4B0ZA 3ZCIA 2WAUA 2L8KA 3UT4A 2PFVA 4F7AA 2V4LA 1E1HB 1SZAA 2KINB 4N2QA 4EXTA 2Y3AA 3UT5E 2YNQA 3Q15A 4C0MA 2K9AA 1ZV4X 2XQYA 4HFGA 3FTYA 4CI2B 3B7RL 3B7SA 3L09A 4QX8B 3JQ0A 4TV8E 4YFSA 2VK9A 5JR9A 3CHPA 3V5UA 1UX5A 3ZIMA 2LSKA 3KD7A 4DMVA 3O1HA 4BA9A 5EK3A 3I4GA 3RO2A 1G73A 4FJZA 1MIYA 2WQHA 2LAHA 4FP7A 4JVSA 3RPUA 5BMVE 1HG5A 5JJ7A 3PNTB 3BG0B 1H2VC 4QHOA 2C2LA 4U63A 2X9WA 2V0PA 4O2BE 3EIJA 2LO6A 1A17A 3KINB 3D3MA 3FDHA 4PFPA 1VRBA 2KXPB 4JLEA 2HH7A 1HS6A 4QXHB 3AA7B 5D0QD 3N9MA 4OYKA 5KCMA 2XPYA 4FHJA 3RC3A 4BX9A 4BWRA 2BVMA 2YU2A 4G1TA 3HKBE 5CMYA 1LF8A 4WAFA 1MMDA 2KLQA 3C50A 3AVRA 3HYMB 4XI9A 2LSJA 4JEUB 4J8SA 3K8PC 5LGTB 3CSTA 2YEVC 4TUUA 5BUZA 2XPZA 4AXHA 1HCIA 3AVSA 2KCLA 2XPIA 3SF4A 5JH7E 4UIGA 2K24A 3UT8A 5KJNA 5ARFA 4B94A 3TG5A 1E90A 4I2WA 2Z6EA 4A56A 3LK42 3MCXA 3G2WA 4GOUA 3RC8A 4I1MA 1VOMA 3GN5B 3EIQC 4JUYA 4UWKA 4K0UA 3APFA 3AU5A 5LCWC 2B1EA 4G11A 3LJCA 5KJKA 2C0LA 5LHHB 4BY6A 3NBXX 2VSOE 4E6HA 3MXZA 4Y6CA 1BR0A 2E0IA 3SS1A 2NOXA 4HKAA 1FMWA 3G2UA 4JHJA 3TAXA 2VGXB 4H7XA 5LFAA 3ASFA 3C64A 4UQYA 2N2NA 2Q9QB 4I1AA 2KM4A 4CRWA 4CGVA 2ILRA 3CV0A 3ZLIA 3E08A 1KLXA 3LDZA 2OA5A 2IF4A 3T5XA 5E0OA 3ZVVA 3Q47B 4F3VA 2LT3A 4PJNA 2LNIA 3WAJA 2KZTA 4BSXA 4V1Av 4IULA 3NF1A 1B7TA 2Y48B 3PTRB 3HKEE 1KK7A 2W61A 2FBNA 1MQSA 2VJ8A 1FVHA 4QFVA 1WYCA 3ZHEA 5AFUL 4N2SA 4WWOA 1HH8A 2HM8A 3ZGQA 2XCBA 1JWGA 2UXNB 4J2CA 4RG6A 4DI3A 2J49A 2JRKA 3CHRA 5JR9C 3MGBA 2UWJG 1XGWA 3WXXA 1Y8MA 3MZKB 3OAWA 4IYPA 2VQ2A 3GYZA 3CVVA 5L3FB 2PBIA 3FTZA 3UFEA 2ZM2A 4EB6E 4Q69A 4AKGA 2VWAA 1ELWA 1ZBPA 5DIZA 3EDTB 1UN9A 5JDLA 1N54A 3ESLA 5AYWD 3ZN0B 3KS2A 3AA6B 3PEVB 1YA0A 4J0UA 1WAO1 4ERRA 4MKTA 4ATGA 3N9PA 4DBRA 4ISTA 1YW0A 3U64A 2J09A 1UX4A 4GMJA 4GCNA 3UUMA 4ILHB 4C91A 2IQCA 5HWXA 4WBOA 4PK6A 2HO1A 3K3QC 4EECA 4L7TA 1HX8A 4HOUA 3CVWA 5FY7A 4L2YA 2E2EA 2CHZA 3QK0A 3CX7B 2MBGA 4CI1B 5D0OD 4L2LA 3DPDA 4DBQA 3MKQB 1IZNB 4G63A 2V7MA 4IRUA 5JJ6A 2E9XA 2ZU6B 3PE4A 3HR0A 4KYOB 4EBAA 4DI4A 1UN8A 3RYIE 2AVPA 2J4BA 3IBEA 3CR3A 4EZ4A 4AXPA 5ANRA 5J2TE 4JA7A 2V8SE 1SA0E 1ZU2A 3JYSA 1OWNA 4XIFA 4AI6A 2VKJA 2J07A 3JUIA 4EZLA 1MIVA 4CDRA 2WXRA 3MJWA 2I9CA 5KJLA 5FQ6A 3PURA 3B57A 3RO3A 4UVCB 5ETWA 4QXCB 4I50E 4ADZA 3Q5MA 3IHRA 5JDGA 4KVOA 3FU5A 4P0AA 2J08A 2JQQA 2IONA 2V1DB 5A23A 3AS4A 1UCUA 2LOPA 2PZIA 2E8IA 3VHLA 4WNDA 4HXIA 3MA5A 2R17C 2L0IA 2DCPA 5G05J 1YD8G 2DI4A 5A7DB 3C4WA 2VYIA 1WRDA 3JCKC 4LUNU 3L17A 3UT7A 4CXXA 2GRLA 1OWOA 1FVFA 2D0TA 3QK6A 1N52A 5HI7A 3L08A 3SI5A 3CX6B 3FTUA 3MV3B 5C2YA 2YK0A 4WUYA 2UXXB 3HA4A 3KVAA 4FJOA 2HYZA 3LFMA 1X5BA 3L3PA 5LJMA 4XKBA 3ESKA 4JXTA 4GPKA 2DWKA 3HVEA 4NQ0A 2G0UA 4JA9A 1JPLA 5EK2A 2A2FX 2XAFB 3D9OA 3ZEFB 4IE6A 5FQ8A 2C0MA 4ANXA 3CSFA 5LGNB 4URKA 3QB2A 4XE0A 5JRCA 3ZPOA 2YHEA 4O4IE 3PUAA 4GYSA 3LBXA 3FTVA 5G55A 3I1AA 3CK7A 3G2SA 1U3CA 3W15B 3SBTB 3E4BA 2X67A 3OXLA 2M63A 1OWLA 2CXDA 3VLFA 3RYHE 4BX8A 3D9NA 2C5KT 2X9HA 1E8ZA 2PM7A 3B7UX 3EUHA 4BTBA 2EHOD 3E0ZA 3CVNA 2I1KA 3RJVA 3R6NA 3R7QA 3O4ZA 4IE0A 3UUXA 2VASA 3KV4A 2WXLA 4F1SA 4C90A 2WXQA 4AJWA 4WBNE 5LHGB 3FUDA 4FLHA 5CB4E 4WNKA 4PS3A 4N3CA 4R7LA 2X38A 3OXFA 1TJCA 5M72A 5LOVE 3SHFA 3CQCB 4EIWA 4HFVA 4NRHB 4ZI3D 1SZ9A 4UF0A 2VKDA 2XHEB 2XRYA 2AXVA 2NTXA 3TL5A 4F6RC 4RSYA 3NZUA 4P29A 5IHYA 3FUFA 2CHXA 1EZ3A 4OFZA 2E9XC 4H63H 3V5SA 4U8HA 3ZMSB 4GA2A 4XKCA 2BVLA 2R59A 5DQWA 3ML8A 1IAPA 4TZ4C 4HS2A 4PNIA 3FWVA 2YHCA 1T98A 2AXUA 3CHSA 3CKBA 5GONE 1E7UA 3PE3A 3NZQA 3BG1B 4WWPA 1L5JA 4LRZA 4BAYB 3O1IA 4AIFA 2LM9A 2IU1A 4GIWA 4GYWA 2V26A 2KMFA 3QJZA 3EDVA 3FEXA 3PVLA 4B8CB 3PUJA 2PM6A 2JMHA 4CXYA 1HO8A 3HDXA 5LP0A 3RKOA 2MRIA 5LP6E 1UJJA 4JZYA 5J90A 4UXNB 3KV6A 4GYRA 4EZJA 4I43A 3LKUA 4G2VA 2DCFA 3M65A 3C4XA 2BUGA 2V7IA 1PAQA 2WXIA 3OTNA 2FEZA 4JHRA 2W00A 4AP2A 2DWGA 3K3NA 4PH4B 3EDUA 5L3EB 5BPPA 4PK4A 3O48A 5L3CB 4AKHA 1X79A 3FH5A 2X9XA 3RRNB 3UPVA 3FP3A 5CHEE 4DMWA 2WQ6A 3Q49B 1Y64B 2Y4UA 1S94A 1FEWA 1MMNA 2VTBB 2ODUA 3KVBA 4GZDA 2QA7A 3BQKA 4YLHA 3FH7A 4XZ4A 3FTWA 4CZZB 2CA5A 3APCA 3JC6D 1ZKEA 3LPZA 3WI3A 5BV1A 3O1JA 3ANWA 2J9QA 5CCMA 4B8AA 1MHQA 4NUVA 3DP7A 4TX5A 3QC1A 5FTPA 3HVEB 2LEHA 4UWGA 4AKLA 3PS6A 4KT6B 2H7VC 4TRQA 1D1CA 3ZJ2A 4MLKA 3AU4A 3D0TA 5H6RB 4ILGA 3NQPA 4ASKA 4GA1A 1IHGA 3CK8A 3MKDA 4HTEA 2WMNA 2MOZA 4G23A 1NP7A 3L6AA 1MMGA 3OJAA 1H2UA 4KXKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFG A;  1LF8 A;  3RRU A;  2KM4 A;  2BF0 X;  1DVP A;  2LO6 A;  1H0A A;  3G2T A;  3ZYK A;  5LP0 A;  1HF8 A;  4JXT A;  3CLJ A;  1PY1 A;  1EDU A;  5LOZ A;  1UJJ A;  4GZC A;  3G2V A;  3LDZ A;  3D9I A;  3ONL A;  3D9M A;  1JUQ A;  3G2W A;  3D9P A;  1EYH A;  3ONK A;  4FLB A;  1ELK A;  2QY7 A;  2V8S E;  4AVX A;  1JWG A;  1JWF A;  1JPL A;  3G2S A;  1HG5 A;  3D9L A;  1SZA A;  3D9K A;  3G2U A;  3ZYM A;  1MHQ A;  1INZ A;  1SZ9 A;  2L0T B;  1VDY A;  3D9O A;  3ZYL A;  4FU3 A;  2L0I A;  5CMW A;  1XGW A;  3ZYQ A;  2MOW A;  1UJK A;  4GZD A;  2DCP A;  2DIW A;  3D9J A;  4NAC A;  4Q96 A;  4Q94 A;  1HX8 A;  1HG2 A;  5J08 A;  5CMY A;  1X5B A;  1HFA A;  3D9N A; 
#chains in the Genus database with same CATH topology
 4DK5 A;  1O5M A;  1IQR A;  4JEH B;  4ILB A;  4NUU A;  1HR0 T;  3IHV A;  2WVI A;  4AEZ C;  4B3S T;  3E37 A;  2PQN A;  3CVL A;  2PG8 A;  1QUU A;  4DND A;  3FU6 A;  2AXD S;  5HEU A;  3ABK E;  3QUJ A;  1OWA A;  2H89 A;  2A4Z A;  3ZUV B;  3PUS A;  1E8X A;  2CFU A;  3CGH A;  3ONX A;  4H9P C;  4UR9 A;  2X51 A;  2QC9 A;  2IJG X;  3F6Q A;  4K0R A;  3HXF A;  3CQG B;  5HXH A;  5L47 A;  4YSY A;  2JJ9 A;  4OYS A;  3HKC E;  2KND A;  5D66 A;  3KEA A;  3GA8 A;  4JPS A;  3BEE A;  2LSV A;  2P58 C;  2YQ8 A;  5HEJ A;  4OYJ A;  4I0U A;  1HNZ T;  3PUK A;  3UUX B;  3GW4 A;  3J5Q B;  3VKG A;  4IN3 B;  3W9F A;  5ENT D;  4QH5 A;  1H2T C;  2J1D G;  4CT0 A;  3VRB A;  4DLQ A;  2ZIR A;  1YXR A;  3N2K E;  3HIZ A;  3C4Z A;  5FQ4 A;  4K03 A;  4IE4 A;  2WU5 A;  2VB6 A;  3RRU A;  4HOS A;  2XPK A;  5AQM B;  3DJB A;  1W0B A;  3ABL E;  3AS5 A;  4HI9 A;  2L3L A;  4QKN A;  5KDM C;  3ASH A;  3G2V A;  3ONL A;  2OLT A;  2R6G F;  4LMJ A;  3F57 A;  4GTR A;  2K48 A;  3TLS A;  4ZI2 D;  2LKH A;  4ZS3 A;  3I3N A;  3QWP A;  4B93 B;  2CXF A;  4C9B B;  2VVN A;  4LNG A;  4C48 B;  4U04 A;  4DJA A;  2FJD A;  4OHF A;  5LNK A;  1YKH B;  5HS0 A;  3SWH A;  3C98 A;  5HYA A;  4I6E A;  3AAA C;  1GQE A;  3U3I A;  4MRU A;  4K0K T;  2BG9 A;  4GZC A;  5AQI B;  2YDR A;  4DUZ T;  4CCA A;  2IIU A;  5FXZ A;  3AED A;  1Z3X A;  4PDX A;  3Q2M A;  3UUL A;  5CFB A;  1BR2 A;  4GZ6 A;  4FC8 A;  3IEG A;  1UUS A;  3K9I A;  1VCS A;  3D9K A;  4H9O C;  4I6G A;  2W2U A;  2DL1 A;  5FJY A;  4A55 A;  4HRM B;  1HTJ F;  1HG2 A;  3V79 K;  4BES A;  1QZ2 A;  4ZOL E;  3Q9D A;  4ME2 A;  2P9U G;  3FEY A;  2VSY A;  3KFW X;  4RG9 A;  3SFX A;  3Q5D A;  4Z90 A;  2CLY C;  2JPF A;  1ELR A;  2ZMA A;  5EZY E;  2CHO A;  4KHZ F;  4TWD A;  4AVX A;  1L0V A;  4G26 A;  5FNV E;  1D8D A;  5BV0 A;  3O4X E;  2KZ7 B;  3UTK A;  2XCC A;  3ML9 A;  3PDY A;  1N36 T;  2QYU A;  4FUL A;  4KMO A;  4GTM A;  1D0Y A;  3VLD A;  1JNZ A;  4YY3 T;  5BNW A;  4HFE A;  4CXW A;  5AQJ B;  1WLX A;  1H0A A;  2N9D A;  2X6K A;  1TR4 A;  2LAI A;  2K5B B;  4UI9 K;  3CVX A;  1QSD A;  5IUX A;  1N34 T;  5M4Y A;  5G05 C;  5CEC B;  3I9W A;  3AEC A;  3VR8 A;  3AA1 B;  5TAO A;  2WQ7 A;  1UJK A;  2IEJ A;  4EAH A;  3FUK A;  3OKQ A;  4H63 V;  5LGU B;  5EKQ D;  4I9C A;  5A1L A;  1M62 A;  3G2T A;  5FVK A;  2BZB A;  4DUY T;  5JR9 B;  4JYA T;  1DNP A;  4N5C A;  3TWT A;  3RRM B;  5FY1 A;  1TN6 A;  2WXG A;  4X1I E;  2VSN A;  1P5Q A;  5L3B B;  3VTX A;  4GYO A;  2NR4 A;  4IGU A;  1OWP A;  1TNU A;  5AQV B;  3ZFW A;  3R7R A;  4E85 A;  2XQ9 A;  3UI2 A;  2W0G A;  3EAM A;  1OXZ A;  2PTF A;  1MYO A;  3S2A A;  1IYG A;  4AM9 A;  3RI5 A;  3VLE A;  2LKG A;  4U8Y D;  3I0O A;  2PNN A;  3PJA J;  2CHN A;  2EHO A;  1I94 T;  3TXM A;  2UXD T;  3ANW B;  2EIJ E;  5HAX A;  3PNL B;  2BS2 A;  1D0X A;  3ZCJ A;  5AQ7 A;  5LCW J;  4PAG A;  3F31 A;  2XQ0 A;  2A9U A;  1N33 T;  3UM0 A;  4BSZ B;  2OVF A;  3P4S A;  3MX3 A;  3FUN A;  4DR5 T;  5AQO B;  3ZT7 A;  5AAR A;  3RRW A;  2QY7 A;  4YVQ C;  2L0T B;  5F8P A;  2AJA A;  4EHM A;  3A5X A;  2LOS A;  3BK9 A;  2IOS A;  1V55 E;  1WCR A;  4Q96 A;  3H3M A;  3EHZ A;  5JDF A;  4GAA A;  3QWV A;  2X3M A;  2BS4 A;  2VQE T;  3BQL A;  4MHC A;  4ZI7 E;  2HPL A;  2XEN A;  4JI8 T;  4U96 D;  4CT4 A;  3T1Y T;  3FUE A;  2NWB A;  5CA1 E;  5AEN A;  3EUV A;  1NA0 A;  4N3A A;  3N9L A;  4KUM B;  2DHR A;  4L9I A;  3ZNG A;  4A97 A;  3ETV A;  3SFD A;  4WNF A;  3RYC E;  1LTX A;  1XWM A;  5LMN T;  4O8S A;  5CGM A;  2F4V T;  2XZD G;  2AXZ A;  2FI7 A;  2ZM0 A;  1A5E A;  4JL0 A;  2BF0 X;  3MJX A;  2QVA A;  3V30 A;  4L0R A;  2IAK A;  3WAK A;  4TXR A;  5BXO A;  2XS8 A;  5JTG A;  1JUQ A;  4A5X A;  1FT2 A;  3CX8 B;  1E7P A;  4HFD A;  4JV5 T;  4GK0 E;  4DRX E;  1I6Z A;  4ATZ D;  3NWI A;  3TKL B;  4JI7 T;  1U3D A;  4NIK A;  2GW1 A;  2MYO A;  3DTO A;  2JAB A;  4GML A;  3TXN A;  4GB9 A;  2IO2 C;  3MV2 B;  2HPJ A;  3OTO T;  4BER A;  1NFI E;  3I0Q A;  4ANV A;  4CDN A;  2HE0 A;  5LYJ E;  4FHK A;  3HRA A;  4GZ3 A;  3QNK A;  2XQ5 A;  2BG9 C;  3ETU A;  1SHZ C;  4H9Q C;  4UQZ A;  2NSZ A;  4I6J A;  5ENP D;  5E76 A;  5L3G B;  3ZT6 A;  4XZC A;  1DCQ A;  3CHM A;  3CVR A;  4DO0 A;  3OBV E;  2V7K A;  2XAQ B;  5FL0 A;  3FXD B;  3DSV A;  3UMV A;  4LF8 T;  4KX6 A;  3WG7 E;  3PZD A;  2XAH B;  3P2B A;  1KNP A;  3RYF E;  5LMU T;  2Y69 E;  3Q7A A;  3A7M A;  3LK2 B;  3S7B A;  3CEQ A;  3L22 A;  3Q78 A;  3EJN A;  4E7Z A;  3ZMU B;  4WW0 A;  4EZK A;  3IXE A;  2C0S A;  4BTA A;  4JB8 P;  3LG7 A;  3ZC0 A;  2CG3 A;  2CE7 A;  5E75 A;  5AQT B;  4A98 A;  2R2L A;  2LXM A;  2BTD A;  3PUQ A;  1HFA A;  3SFE A;  4UI9 C;  2V4H C;  3EVY A;  1NEK A;  2FUP A;  2KAT A;  2ODV A;  2C5J A;  2F8X K;  4QWN B;  3I5P A;  3UUN A;  3R9A B;  2KZT B;  3PE0 A;  4ZHQ E;  3HKD E;  2W4X A;  4U95 D;  4MLP A;  4OVV A;  2KT9 A;  4U2Z A;  2L6J A;  2QFC A;  2J4D A;  3F2E A;  1XMQ T;  3Q9U C;  4PJM A;  3VR9 A;  2ZGD A;  5LX8 A;  2X0Y A;  3ZHE B;  4ACK A;  3H37 A;  3TGO A;  5C1D A;  4CN1 A;  2JIW A;  1HF8 A;  3T8O A;  4X20 E;  4BJM A;  2IFU A;  2MHK A;  3UUB A;  2FO7 A;  5C3J A;  2X6I A;  1DCE A;  3NRX A;  3AAE B;  5G04 J;  4ISS A;  4PW8 A;  4MS6 A;  5FT9 A;  2IC9 A;  3NKZ A;  4ZZC A;  2YU1 A;  3UM2 A;  2BKG A;  4QH1 A;  3IHY A;  1QYM A;  3ZYQ A;  5JDH A;  1W3B A;  1HZ4 A;  2F37 A;  4IE7 A;  2LSI A;  4M1P A;  5AQQ B;  3EU9 A;  4BET A;  5AQP B;  4HN9 A;  3PRE A;  4FAD A;  2ETC A;  3UQ4 A;  5JJT A;  2H7O A;  4JI6 T;  2EHO C;  4YT0 A;  2H6H A;  3NZP A;  4AKI A;  4GTO A;  3TWV A;  2WB2 A;  1NA3 A;  2BS3 A;  5B3S E;  2YOE A;  1LD7 A;  1E8W A;  2PQR A;  2BBJ A;  3UKR G;  3RH3 A;  4I2Z A;  2VKH A;  2CXL A;  2J8S D;  4DV0 T;  3APD A;  3UXG A;  4YTM A;  2P9L G;  4B6X A;  2HN2 A;  1D0Z A;  1EDU A;  3ASD A;  3FHE A;  3D9I A;  3MKR A;  4DLO A;  3FTX A;  5HXR A;  4DV3 T;  4M7C A;  3RQW A;  5CRU A;  2VSX E;  3S7F A;  3JQ1 A;  1AJ3 A;  4TV3 A;  4ZI3 C;  3DEP A;  4I55 E;  1JWF A;  3LVQ E;  1ZEE A;  3QAR A;  4W9R A;  1GW6 A;  1E8Y A;  3U3W A;  1WM5 A;  3FUH A;  4N78 D;  5FXV A;  3QDN A;  4ANU A;  2HR2 A;  2X0L B;  2R5S A;  4U74 A;  3AE9 A;  4IIJ E;  5AQB A;  4EV6 A;  4PK5 A;  2VGX A;  1RZ4 A;  1DVP A;  3CHO A;  2ZM6 T;  1BD8 A;  4KMC A;  5FZQ A;  1SUM B;  2ES0 A;  2NTY A;  3PDN A;  5G2N A;  4LFB T;  3CQX C;  2MYS A;  2B0O E;  1PC2 A;  5JQG E;  2E9X B;  4IRE A;  4YSX A;  3PH0 C;  1BI7 B;  2KWI B;  3Q9N C;  2DLR A;  3ZYL A;  3CVP A;  2XAS B;  5JDQ A;  1G3N B;  2DIW A;  3C51 A;  5ENS D;  4V3I A;  4RVB A;  3B7T A;  3QWW A;  1H7C A;  2V6Y A;  4JI4 T;  3FUJ A;  4AKR B;  4HGA A;  4O4H E;  3Q5X A;  2I1J A;  4GZ5 A;  2P9B A;  4B89 A;  3ZST A;  1Q2Z A;  3J5P A;  2KWH A;  4HOQ A;  5BT1 A;  3ZYM A;  4JD2 G;  1VDY A;  4LEU A;  5EDS A;  3UU8 A;  3FH8 A;  3U78 A;  1US7 B;  3AEF A;  2Y6X A;  3JAF A;  2RA1 A;  2KCK A;  3IEE A;  4HFB A;  4JI2 T;  4WWN A;  2WXJ A;  1LVK A;  2GRP B;  3ZN1 B;  5BR8 T;  2WXN A;  3AB3 B;  3P50 A;  5FYM A;  5JRE A;  2YN6 A;  4YND A;  3SZ7 A;  1TEZ A;  1D1A A;  5ABF B;  4P0B A;  4UVA B;  3FY4 A;  5B1B E;  4YJ2 E;  4O6F A;  3Q5W A;  4XAX B;  2CEA A;  2DYR E;  2V5F A;  3UX4 A;  5AQH B;  4G8L A;  1D9S A;  1IQU A;  3G06 A;  5T3R A;  2ACZ A;  3DWL G;  2CBJ A;  4DVD A;  3LY8 A;  2XY8 B;  1UG3 A;  3ZSS A;  4HRN A;  5FKY A;  2WXP A;  2X66 A;  3OVU A;  2VVS A;  4LFC T;  5AJL A;  3PZ3 A;  5FQ7 A;  4L23 A;  3FXE B;  4O1P A;  5KX5 E;  3W9G A;  1HE8 A;  3L13 A;  3LS8 A;  5DAB A;  4APO A;  4ANJ A;  4DID B;  4RQI A;  4PJL A;  3NBN B;  2Q7F A;  3UQ7 A;  1H6P A;  3FU0 A;  5T8I A;  1U5P A;  4JI5 T;  1OCC E;  3ZW3 A;  2XQ6 A;  2WSS V;  2L9Q A;  2KXP C;  3CWZ B;  4LF9 T;  1E7V A;  4ZZB A;  4ACL A;  2X6J A;  2WM9 A;  3KV9 A;  1S70 B;  3P1U A;  4LER A;  3JC6 C;  5JVD E;  4PJJ A;  4U33 A;  2JLB A;  2PL2 A;  2R05 A;  1J5E T;  3QKY A;  3E22 E;  4GK5 E;  2LE8 A;  2WDQ A;  3MAC A;  4O4L E;  3OYZ A;  4EYY R;  2XGO A;  5J2U E;  3MK7 C;  3I4R B;  5H7P A;  1LRZ A;  5JHB A;  4WNG A;  4CQI A;  1J1J A;  3KBU A;  4NAC A;  3MKQ A;  4PS7 A;  2Y0B G;  3FFL A;  5J08 A;  2I59 A;  5FMN A;  5JRC B;  4L9P A;  1S64 A;  1MND A;  2H3R A;  1NWM X;  3LBX B;  3PZ4 A;  1OUV A;  2LSU A;  3GZ1 A;  4DX7 D;  4O4J E;  3B95 A;  3C3O A;  3QC9 A;  3SOL A;  1OCR E;  4AQF A;  3PUW F;  2RG8 A;  2I2O A;  3AXJ A;  2UY1 A;  4WZX A;  3MZL B;  4O1O A;  3ASG A;  3AEE A;  3H3A A;  3JAD A;  2XQ4 A;  1NZN A;  2L9B A;  4IDO A;  2QZA A;  1BI8 B;  2PJQ A;  1KT0 A;  4AOF A;  2FF4 A;  2HHH T;  2WU2 A;  4B3R T;  4DR7 T;  2J47 A;  4DV7 T;  3P4R A;  2NC9 A;  4U7I A;  5H6Q B;  1YMP A;  3HI2 A;  5AQK B;  1EPU A;  3JAE A;  3VU7 H;  1T7S A;  4JI1 T;  2OEW A;  4HFI A;  2XQ8 A;  4LML A;  3ONK A;  5T4Y A;  1MX4 A;  2J4G A;  2Q9Q D;  1ZHC A;  4DR6 T;  2WXM A;  5JHA A;  1AWC B;  4APF A;  1H19 A;  3U66 A;  3RLF F;  1MX2 A;  3JXI A;  3RKV A;  5DQV A;  3VRA A;  2WQY A;  1IJ5 A;  1QNF A;  3TWQ A;  2W62 A;  4EYU A;  4OX9 T;  2H6F A;  3LY7 A;  4WNE A;  3LJ3 A;  4I9E A;  1TNO A;  2AWI A;  3NB2 A;  4G24 A;  4JI3 T;  2NP9 A;  3CIA A;  4GTQ A;  1V9D A;  2ZM8 A;  2D5U A;  3UU6 A;  4ZHB A;  4UF0 B;  3AG3 E;  3TJP A;  5EX3 A;  2XGM A;  2Q9Q C;  2WXF A;  3V2X A;  5D2M C;  1FIO A;  3TWU A;  4QXB B;  4X1K E;  1BLX B;  4EBA G;  2BED A;  2V5C A;  2FJE A;  3J9X 1;  5ADX L;  4UWF A;  3RX6 A;  2P9K G;  5AQA A;  1N4P A;  1OED A;  3SD5 A;  3ASO E;  3IKO B;  3AE2 A;  1XZY A;  4YSZ A;  4A1G A;  5HXE A;  2A5U A;  4G2A A;  4EPZ A;  2UU9 T;  4D10 C;  3RF1 A;  4HVB A;  4U3C A;  4Y6W A;  2W63 A;  4C0E A;  4A3T A;  1SQM A;  3AAI A;  4EZH A;  4ZI2 C;  3C3Q A;  3LY9 A;  3LEW A;  3CK9 A;  4BFR A;  5FZS A;  4H9N C;  2MOW A;  4L1B A;  5C2T A;  2IDO B;  5L4H A;  5F3J A;  4GCO A;  2V5D A;  3KBT A;  3ZEF A;  2OV8 A;  1S0P A;  4U2Y A;  4JBW F;  3ZXS A;  2QYW A;  3LSV A;  5ANL A;  3SBS A;  5BXU A;  3FUM A;  3ZJ1 A;  1K3Z D;  2WMO A;  4PS8 A;  3Q4A B;  1O1S A;  3AAA B;  5AAO A;  5LG4 A;  1FCH A;  2XEH A;  4IHJ E;  2ETA A;  3ASN E;  4QX7 B;  5CER B;  1WY6 A;  3FU3 A;  3AS8 A;  4UV9 B;  4H7Y A;  1FMV A;  3GMI A;  2ZLY A;  5ENN A;  4HB5 A;  4DX2 A;  2EIN E;  3NOG D;  2JEK A;  4I43 B;  4YXD A;  3CLJ A;  5IY5 E;  3MA9 A;  4KBQ A;  5ENQ D;  3EHN A;  4IDN A;  4K5B A;  5AIJ A;  1WDY A;  3PU8 A;  1UUR A;  2IO3 C;  3RK6 A;  2KSR A;  1O3X A;  2X6F A;  1D1B A;  4IE5 A;  3QNU A;  4LMK A;  1QLB A;  5B1A E;  1IXV A;  2CLY B;  4U72 A;  4P09 A;  3UM3 A;  2P9S G;  1OT8 A;  1Y6I A;  4GU5 A;  2M67 A;  3FZL B;  2XTL A;  4DR1 T;  2E5L T;  1PY1 A;  2XZE A;  3LDQ B;  1BR4 A;  3Q73 A;  5LOZ A;  4LFA T;  5HEO A;  1W09 A;  1H6K A;  3RHW A;  2CHW A;  4OAV B;  1EYH A;  5LA6 E;  2D2S A;  5LHI B;  5HQ8 A;  2MTQ A;  3NZS A;  3URZ A;  3ZT5 A;  2OOE A;  3TLW A;  1EF1 C;  2ACX A;  4J8F A;  1LVF A;  3GZ2 A;  2QGS A;  3AE3 A;  1ZB1 A;  3CVQ A;  5LBQ B;  4GTV A;  4Q94 A;  5CJ5 A;  4JC8 A;  3DRA A;  2WS3 A;  4OK0 A;  2F0Y A;  2XHE A;  4CN4 A;  3LCA A;  4JW1 A;  4U0S A;  2A72 A;  5FXW A;  2CFZ A;  3B13 A;  5BW8 C;  1IJ6 A;  4UQX A;  4QQI A;  3J7Y q;  3D9M A;  4YHH T;  4M3O A;  3IBP A;  1KT1 A;  4MBG A;  1N4Q A;  1E2A A;  4DV1 T;  4EOZ B;  4ZEY A;  5C8Y E;  4A3V A;  5ENR D;  1HS7 A;  4HOT A;  3ZMZ B;  1TJF A;  4ANW A;  5KJM A;  2MPK A;  4AQF C;  3P7I A;  3SGH A;  2BDE A;  5CA0 E;  3D9J A;  2XJ7 A;  3FUL A;  4N3B A;  5HKP A;  3CML A;  4YDY A;  2NW8 A;  3AE1 A;  1IKN D;  2CCQ A;  2V7J A;  4ZFH A;  4DPR A;  3AG1 E;  5LJN A;  4CGW A;  2NXP A;  3VKH A;  1T8B A;  1S35 A;  2A3D A;  4XBF B;  4XX5 A;  3S7D A;  5KNG A;  5A6C A;  1SA4 A;  2IOL A;  4PFO A;  4NUR A;  4U0U A;  4TNV A;  3T9K A;  4HE8 A;  2JQ9 A;  4I4T E;  2WXO A;  2ZXW E;  2DZO A;  2D0U A;  1ZOY A;  1TN8 A;  3ZC1 A;  2FUL A;  4UWH A;  3K3O A;  4IT4 A;  3QB5 A;  2DWZ A;  3P8C D;  3O9X A;  5FP3 A;  4OAU C;  5EX0 A;  1JCR A;  5HWY A;  3OXG A;  2GGF A;  4LG6 A;  1NAF A;  5G04 C;  1XDP A;  2UY1 B;  3MYV A;  1BR1 A;  2RP4 A;  2W66 A;  3QB5 K;  5L3D B;  3N71 A;  3FHN A;  2FJB A;  4H9S E;  2XAJ B;  4IDQ A;  4YJ3 E;  4COF A;  1R8I A;  4TN7 B;  1XNQ T;  1SVX A;  3HXD A;  1ZP0 A;  3PU3 A;  4ABN A;  1DC2 A;  4TV9 E;  4UVB B;  5CMW A;  3CKC A;  5AQS B;  4QH4 A;  4KBM B;  4F53 A;  1JCS A;  2CG2 A;  2BKK B;  2RD0 A;  3ZYK A;  1OED C;  3EHM A;  3OYX A;  3DBS A;  4Z8X A;  3RU0 A;  5AQ9 A;  4O2A E;  3N5L A;  4Z91 A;  2IC6 A;  2XEE A;  3NRY A;  1XNR T;  3PZ1 A;  1ELK A;  4AQG A;  3LK3 B;  2KC7 A;  3TLU A;  1W0A A;  2GRM A;  2XUE A;  2LHR A;  3L54 A;  3RKG A;  4I17 A;  2VTB A;  2ZGG A;  3FB2 A;  5AQL B;  2XEV A;  5EIB E;  1B89 A;  3PEU B;  1YKE B;  1Z3Y A;  3MEK A;  2WWU A;  1KNR A;  5ARG A;  1Z0P A;  3KEZ A;  3N2O A;  3BQO A;  1J5W A;  3CPZ A;  3PUG A;  3RIA A;  2WZH A;  2YIN A;  2WBL A;  4MAL A;  4OVU A;  2QYJ A;  2X68 A;  3GWH A;  5AQG B;  3E34 A;  3LVR E;  4FJY A;  1T72 A;  1MIW A;  3LXU X;  2JQH A;  3C98 B;  1Z5S C;  3RIB A;  2CMR A;  2WXH A;  3ZMV B;  2WDR A;  3Q79 A;  2BG9 B;  3L8R A;  1K1A A;  1TNZ A;  1FJG T;  2YKS A;  5L2L A;  2LHN A;  3FBL A;  3IV0 A;  3U4T A;  4YHJ A;  3T5V A;  4TUY E;  4UV8 B;  1G8X A;  2YDS A;  2YDQ A;  3T8M A;  3KAE A;  4N39 A;  3B5M A;  3UFG A;  3N9O A;  3SO8 A;  3KSL A;  5FZR A;  2UUA T;  4AY6 A;  2NYJ A;  4BT8 A;  5CCL A;  4K5A B;  2DNX A;  3SRZ A;  1TNB A;  2VKO A;  2X6H A;  4KZC A;  5HXS A;  4KVM A;  4J8E A;  2LSY A;  2XZT G;  3PUX F;  3TG4 A;  1OY3 D;  2XGS A;  3ZPJ A;  4CDM A;  1IBL T;  2OV9 A;  1KNZ A;  4ZS2 A;  3RRC A;  2Y8D A;  4UEM A;  3TLV A;  3KSQ A;  4JEH A;  3ULQ A;  5FXX A;  4YVO A;  3S4U A;  5HXC A;  3QOU A;  5FY0 A;  4FLB A;  2LXL A;  4X8Q A;  1N0Q A;  2VUR A;  1UW4 B;  4CEM A;  4HOR A;  4JEU A;  4KZ0 A;  1INZ A;  2IY0 C;  4IDZ A;  1V54 E;  1XNF A;  3N2G E;  2UXB T;  2EIK E;  4J8D A;  4X1Y E;  2CM0 A;  5JDN A;  1OCZ E;  3NVO A;  3AE7 A;  4A1S A;  2OVB A;  2CWY A;  3D9H A;  1IBK T;  1YQ3 A;  3KV5 A;  5DJQ C;  1WR6 A;  3IF8 B;  3V31 A;  1WR0 A;  1KFY A;  3L16 A;  5KMG P;  4BJN A;  5IYZ E;  3FUI A;  4NXM T;  3FZH B;  3UQ3 A;  4AIS A;  4DX1 A;  2NW9 A;  4X66 T;  3L82 A;  1E96 B;  1RW2 A;  1MMA A;  3BQI A;  2LSG A;  3CVY A;  3ABM E;  4FU3 A;  3GN5 A;  2WPV A;  4JHK A;  2JMK A;  3AA0 B;  2XRZ A;  4F6R D;  3Q7F A;  4U0Z A;  4EQF A;  2V7L A;  4DV4 T;  4FA6 A;  4ZXL A;  1U4Q A;  4CI3 B;  2CBI A;  3U9W A;  1CUN A;  1BPO A;  2E9X D;  4G25 A;  4XI0 A;  1OXJ A;  1IHB A;  2N1G A;  4FI5 A;  1OWM A;  3QAQ A;  5JDM A;  5KNH D;  4AV7 A;  4U07 A;  3I9Y A;  4AY5 A;  5EK4 A;  3TWR A;  3ZN3 A;  3PRZ A;  2VGY A;  3ULY A;  3ZMT B;  3CKD A;  2LJL A;  2WP9 A;  3ENE A;  4GA0 A;  2J62 A;  3SNX A;  4HLE A;  4GYY A;  3S7J A;  2EHO B;  4I1O B;  2EQX A;  3PUY F;  5HEG A;  4MBQ A;  4J6I A;  1HU3 A;  2OND A;  5ITZ F;  4U7E B;  3ZRH A;  4A63 B;  3V2O A;  5EIL A;  5EID A;  1QBQ A;  4HWH A;  1S63 A;  2Q9Q A;  2IW5 B;  4LCT A;  4UWL A;  3VTY A;  1Z6T A;  5J1G A;  1MNE A;  3CVU A;  2NW7 A;  3PJA A;  2DBA A;  2C5I T;  2XAG B;  5AJD A;  3HHM A;  2I6H A;  3FBZ A;  4DR4 T;  2VL8 A;  2ETB A;  4EEB A;  2E2A A;  3HL6 A;  1OCO E;  4UEL A;  2X9Y A;  3M3Z B;  5HCJ A;  3RAU A;  2V8S V;  2SPC A;  2I0M A;  4BT9 A;  3LYA A;  5LBM A;  2E5V A;  3AE6 A;  5FWQ A;  3EU5 A;  5AQF B;  4AIU A;  3N9N A;  4UI9 J;  3R84 B;  1N9A A;  2KCV A;  5ABH A;  4PUC A;  4KP3 C;  4RLY A;  2Y4T A;  3KDS E;  4ILU A;  3D9L A;  5DBK A;  4L5G A;  3N9Q A;  3UU3 A;  3FTS A;  2CWO A;  2H88 A;  4LF7 T;  4ILI A;  3GZS A;  4B3T T;  2GK9 A;  1N4S A;  1N32 T;  2RKK A;  3P4P A;  3CHQ A;  2WXK A;  1KEY A;  5LCY A;  1QQE A;  2AW6 A;  5LXT E;  5FL1 A;  1WYB A;  4MFR A;  4DUI A;  4DV2 T;  3SFZ A;  4HWI B;  3P4Q A;  2L6B A;  1HXI A;  5HEH A;  4H9R C;  1LKX A;  3AG4 E;  3D9P A;  4E7S A;  4HEA A;  3PZ2 A;  5HRY A;  4B0Z A;  3ZCI A;  2WAU A;  2L8K A;  3UT4 A;  2PFV A;  4F7A A;  2V4L A;  1E1H B;  3RIF A;  1SZA A;  2KIN B;  4GTT A;  4N2Q A;  4EXT A;  1KZO A;  2Y3A A;  3UT5 E;  2YNQ A;  3Q15 A;  4C0M A;  2K9A A;  1ZV4 X;  4DV5 T;  2XQY A;  4HFG A;  3FTY A;  5ABE A;  4HBD A;  4CI2 B;  3B7R L;  3B7S A;  4LNU D;  3L09 A;  4QX8 B;  3JQ0 A;  3DEO A;  4TV8 E;  4YFS A;  2VK9 A;  5JR9 A;  3CHP A;  4TXQ A;  3V5U A;  1UX5 A;  4YDO A;  3FZM B;  3ZIM A;  2LSK A;  3KD7 A;  2DVW A;  4DMV A;  3O1H A;  4BA9 A;  1NI1 A;  2H6I A;  4HWC A;  5EK3 A;  3I4G A;  3RO2 A;  2IHR 1;  4DX6 D;  1G73 A;  4FJZ A;  3DPY A;  1MIY A;  2OCC E;  2WQH A;  2LAH A;  4FP7 A;  2WWV A;  1HNW T;  4JVS A;  3RPU A;  2XSA A;  5EYP F;  5J0Z A;  3ZXP A;  5BMV E;  3LJN A;  1HG5 A;  5JJ7 A;  3PNT B;  2LLY A;  4TNW A;  3BG0 B;  1HX1 B;  1H2V C;  1TYQ G;  4QHO A;  3TWW A;  2C2L A;  4U63 A;  2X9W A;  2V0P A;  4O2B E;  3EIJ A;  2LO6 A;  1A17 A;  2RPA A;  3KIN B;  3D3M A;  3FDH A;  4PFP A;  1VRB A;  2KXP B;  4JLE A;  2HH7 A;  1O1T A;  3C3R A;  1HS6 A;  2LM2 A;  4QXH B;  3HG0 D;  3AA7 B;  5D0Q D;  3N9M A;  4OYK A;  4J7W A;  5KCM A;  2XPY A;  4FHJ A;  3RC3 A;  4BX9 A;  5FIO A;  3ZU7 B;  4BWR A;  4KHP T;  2BVM A;  3SFY A;  2YU2 A;  4G1T A;  3HKB E;  3Q5E A;  5CMY A;  1LF8 A;  1TN7 A;  1KPS B;  5ABG A;  4WAF A;  1MMD A;  2KLQ A;  3C50 A;  3AVR A;  3HYM B;  4XI9 A;  2LSJ A;  4JEU B;  4J8S A;  3K8P C;  5LGT B;  3CST A;  2YEV C;  4TUU A;  1OED E;  5AN8 A;  5BUZ A;  2XPZ A;  4AXH A;  3E33 A;  2P9I G;  4HFC A;  1HCI A;  3AVS A;  2KCL A;  4ILC A;  2XPI A;  3SF4 A;  5JH7 E;  3P4W A;  4UIG A;  2BG9 E;  2K24 A;  4TWH A;  4WYV A;  3UT8 A;  2WCA A;  5KJN A;  4TXP A;  1CHU A;  5ARF A;  3TG5 A;  4B94 A;  1E90 A;  4I2W A;  2Z6E A;  4A56 A;  3LK4 2;  2DZN A;  3MCX A;  2BBH A;  3PUV F;  2Y1L E;  3G2W A;  3X1D A;  4GOU A;  3RC8 A;  3DXM G;  4I1M A;  1VOM A;  5HCM A;  3GN5 B;  3EIQ C;  3DSX A;  3UKU G;  4JUY A;  2B6C A;  3TWS A;  4UUC A;  4LF5 T;  4B3M T;  4UWK A;  4K0U A;  3AE4 A;  2LRK A;  3APF A;  3AU5 A;  5LCW C;  2B1E A;  4G11 A;  3LJC A;  5KJK A;  2C0L A;  5LHH B;  3BU8 A;  1JNR A;  4BY6 A;  3NBX X;  4IDP A;  5FVL A;  2VSO E;  1UGO A;  4E6H A;  3MXZ A;  4Y6C A;  1BR0 A;  2E0I A;  3SS1 A;  2NOX A;  3E30 A;  4HKA A;  1FMW A;  3G2U A;  4JHJ A;  2B76 A;  3SQV A;  3TAX A;  3NAW A;  4U31 A;  2VGX B;  4H7X A;  2V6X A;  3EHQ A;  4G8K A;  5LFA A;  1X81 A;  2P9P G;  3TLT A;  3ASF A;  3C64 A;  4UQY A;  2N2N A;  2Q9Q B;  4I1A A;  2KM4 A;  4CRW A;  4CGV A;  2ILR A;  3CV0 A;  3ZLI A;  3E08 A;  1KLX A;  3LDZ A;  2OA5 A;  2RFA A;  2IF4 A;  2IUB A;  4TUM A;  3T5X A;  5E0O A;  3ZVV A;  4EED A;  3AEB A;  3Q47 B;  1JCQ A;  4F3V A;  3FZF B;  1LD8 A;  2LT3 A;  4PJN A;  1M7K A;  2LNI A;  3WAJ A;  2KZT A;  2VQF T;  4BSX A;  3L9T A;  2V6Y B;  3DSS A;  4V1A v;  2FBW A;  4IUL A;  5LG3 A;  3NF1 A;  1B7T A;  4Q25 A;  2Y48 B;  3PTR B;  1UOH A;  3HKE E;  1KK7 A;  2W61 A;  5CEA A;  3ULE G;  2FBN A;  1MQS A;  2VJ8 A;  1FVH A;  4QFV A;  1WYC A;  3ZHE A;  5AFU L;  4N2S A;  4WWO A;  1NEN A;  1HH8 A;  2HM8 A;  3ZGQ A;  2XCB A;  2UXN B;  1JWG A;  4J2C A;  4RG6 A;  4DI3 A;  2J49 A;  2JRK A;  3CHR A;  5JR9 C;  2A5E A;  3MGB A;  5ENO D;  2UWJ G;  4GTS A;  4LF4 T;  1XGW A;  3WXX A;  4ILA A;  1Y8M A;  3MZK B;  3OAW A;  3T1H T;  1IBM T;  2DYS E;  1U2V G;  2P9N G;  4IYP A;  2VQ2 A;  3GYZ A;  4X64 T;  3CVV A;  5L3F B;  2PBI A;  3JXJ A;  1N11 A;  3FTZ A;  3UFE A;  2ZM2 A;  2K3W A;  4EB6 E;  4Q69 A;  5F5W A;  2EIL E;  4AKG A;  2VWA A;  1ELW A;  1ZBP A;  5DIZ A;  3EDT B;  1UN9 A;  4YTN A;  5JDL A;  3B7B A;  1N54 A;  2BKO A;  3A8Y C;  3NOC D;  3ESL A;  5AYW D;  3ZN0 B;  3KS2 A;  4X62 T;  2M6I A;  4HI8 A;  3AA6 B;  3PEV B;  1YA0 A;  4J0U A;  1N0R A;  1WAO 1;  3TWX A;  4ERR A;  4MKT A;  4ATG A;  1SE7 A;  4DR3 T;  3R9M A;  3N9P A;  3EHR A;  4DBR A;  1X9B A;  1YW0 A;  2LRL A;  4IST A;  2J09 A;  3U64 A;  1UX4 A;  4GMJ A;  5JA4 D;  4GCN A;  5KXJ A;  3UUM A;  4ILH B;  4C91 A;  2IQC A;  3UU4 A;  5HWX A;  4WBO A;  4PK6 A;  2HO1 A;  3K3Q C;  4EEC A;  4L7T A;  2XQ3 A;  1HX8 A;  4HOU A;  3CVW A;  5FY7 A;  3OPC A;  2KBX A;  4L2Y A;  4EGW A;  2E2E A;  2CHZ A;  3QK0 A;  3CX7 B;  2MBG A;  3X2Q E;  4CI1 B;  3HXC A;  5AQN B;  5D0O D;  4L2L A;  3DPD A;  3PV0 F;  4DBQ A;  3MKQ B;  1IZN B;  4G63 A;  2V7M A;  4IRU A;  5JJ6 A;  3DSU A;  2E9X A;  2ZU6 B;  3PE4 A;  3HR0 A;  4KYO B;  4EBA A;  4DI4 A;  3AEA A;  1UN8 A;  3RYI E;  2CRB A;  2AVP A;  3AJI A;  4X65 T;  3AXJ B;  2J4B A;  4CYM D;  3L39 A;  1FPP A;  3CR3 A;  4EZ4 A;  3IBE A;  4AXP A;  5ANR A;  5J2T E;  1K1B A;  4GKK T;  4JA7 A;  2V8S E;  3UIO C;  1SA0 E;  1ZU2 A;  3JYS A;  1DU2 A;  1OWN A;  4XIF A;  4AI6 A;  1MJ0 A;  2VKJ A;  2J07 A;  3JUI A;  4EZL A;  1MIV A;  4CDR A;  2V5Q C;  2WXR A;  3MJW A;  2I9C A;  5KJL A;  2WY2 A;  2XM1 A;  5LB7 B;  5FQ6 A;  2JQK A;  1VCT A;  3B57 A;  3PUR A;  3RO3 A;  1O1R A;  4Z68 A;  4UVC B;  5ETW A;  3RGL A;  1KZP A;  4F8H A;  2XM2 A;  4QXC B;  5FIN A;  4I50 E;  4ADZ A;  3Q5M A;  1D8E A;  3IHR A;  3EI0 A;  3ONJ A;  5JDG A;  3FU5 A;  3JCF A;  4P0A A;  2J08 A;  2JQQ A;  3C5R A;  3ISM C;  2ION A;  4KVO A;  4LSZ E;  3T8K A;  2V1D B;  3ONL C;  5A23 A;  3AS4 A;  1UCU A;  2LOP A;  2PZI A;  2E8I A;  3UIN C;  4NIQ A;  5ABF A;  1MZC A;  3VHL A;  4WND A;  1H6O A;  4HXI A;  3MA5 A;  2R17 C;  2L0I A;  4P1N A;  2DCP A;  5G05 J;  1YD8 G;  2DI4 A;  5A7D B;  4HFH A;  3C4W A;  1YYH A;  2VYI A;  1WRD A;  3JCK C;  4LUN U;  3L17 A;  3UT7 A;  3UTM A;  4CXX A;  2GRL A;  1OWO A;  4XEI G;  1FVF A;  2D0T A;  3QK6 A;  4U7Y A;  1N52 A;  4HNA D;  5HI7 A;  3C72 A;  3EAB A;  3L08 A;  2GRR B;  3UU5 A;  4HWD A;  3SI5 A;  4IL9 A;  1OED B;  3CX6 B;  3FTU A;  2LUH A;  2R02 A;  2FO1 E;  3MV3 B;  5C2Y A;  1Y01 A;  4AQY T;  2YK0 A;  4WUY A;  2UXX B;  3HA4 A;  3KVA A;  4FJO A;  2HYZ A;  3RIU A;  3LFM A;  1X5B A;  4HLL A;  3RSE G;  3L3P A;  5LJM A;  4XKB A;  3ESK A;  4JXT A;  3ABV A;  4GPK A;  2DWK A;  3HVE A;  4GMR A;  3ZKR A;  3QOF A;  4NQ0 A;  4GTP A;  2G0U A;  4JA9 A;  1JPL A;  4HWF A;  4KI0 F;  5EK2 A;  2A2F X;  2XAF B;  3D9O A;  2UUB T;  3ZEF B;  4IE6 A;  5FQ8 A;  2C0M A;  4ANX A;  4F1P A;  3CSF A;  4GKJ T;  5LGN B;  3SY2 A;  4URK A;  2FJA A;  3QB2 A;  5KBA A;  4U8V D;  2H6G A;  5IWA T;  4XE0 A;  2WB5 A;  5JRC A;  3AEG A;  3ZPO A;  2YHE A;  4O4I E;  3PUA A;  4JI0 T;  4GYS A;  3LBX A;  3FTV A;  5G55 A;  4NPP A;  3I1A A;  3CK7 A;  4CN6 A;  3G2S A;  1U3C A;  3W15 B;  3SBT B;  3E4B A;  2X67 A;  3OXL A;  2M63 A;  1OWL A;  2CXD A;  3DSW A;  5AQU B;  5EN5 D;  3VLF A;  1N4R A;  3RYH E;  4BX8 A;  3D9N A;  2C5K T;  2X9H A;  1E8Z A;  4HRL A;  2PM7 A;  3B7U X;  3EUH A;  4BTB A;  2EHO D;  3UIP C;  3E0Z A;  3BUA A;  3CVN A;  2I1K A;  3AG2 E;  3RJV A;  3R6N A;  4YDE A;  3R7Q A;  3O4Z A;  2HN1 A;  1YCS B;  4IE0 A;  3UUX A;  2VAS A;  4CZ2 D;  2ZIS A;  3KV4 A;  2W67 A;  2GRQ B;  4C90 A;  2WXQ A;  2WXL A;  4AJW A;  4F1S A;  4WBN E;  5LHG B;  3FUD A;  4FLH A;  4LNB A;  4TWF A;  5CB4 E;  4WNK A;  4PS3 A;  4N3C A;  4R7L A;  2X38 A;  3OXF A;  1TJC A;  5M72 A;  2XQA A;  5LOV E;  3SHF A;  3CQC B;  4EIW A;  2XQ7 A;  3JUE A;  2CPT A;  4HFV A;  4NRH B;  4ZI3 D;  2IML A;  3PUZ F;  3DXK G;  1SZ9 A;  3UM1 A;  4UF0 A;  2VKD A;  2XHE B;  2XRY A;  2AXV A;  2WDV A;  2NTX A;  3TL5 A;  4F6R C;  4RSY A;  3NZU A;  4P29 A;  5IHY A;  1N94 A;  2BKP A;  3FUF A;  2CHX A;  1EZ3 A;  2UUC T;  4OFZ A;  2E9X C;  4H63 H;  5EYL A;  2AE9 A;  3V5S A;  4U8H A;  3ZMS B;  2F8Y A;  4GA2 A;  4XKC A;  2BVL A;  2R59 A;  5DQW A;  3ML8 A;  1IAP A;  4TZ4 C;  4HS2 A;  1KF6 A;  4X5T A;  5L4E A;  4PNI A;  1N95 A;  1XMO T;  5JMN D;  2GRO B;  3FWV A;  1Z8U A;  4BEP A;  2YHC A;  1T98 A;  2AXU A;  3CHS A;  3CKB A;  3Q75 A;  5CBN A;  5GON E;  1E7U A;  3PE3 A;  3NZQ A;  3BG1 B;  4WWP A;  3ZKJ A;  5KWD A;  1L5J A;  4LRZ A;  4BAY B;  3O1I A;  4AIF A;  2LM9 A;  2IU1 A;  4GIW A;  4GYW A;  2V26 A;  2VGE A;  2KMF A;  3QJZ A;  3EDV A;  3FEX A;  3PVL A;  4B8C B;  1WFD A;  1WG0 A;  4GPM A;  4IL4 A;  3PUJ A;  2UXC T;  2EIM E;  2PM6 A;  2JMH A;  4CXY A;  3E32 A;  1HO8 A;  3HDX A;  5LP0 A;  3IA3 A;  3RKO A;  2MRI A;  5LP6 E;  1UJJ A;  4JZY A;  1W9R A;  5J90 A;  4UXN B;  3KV6 A;  4GYR A;  4EZJ A;  4I43 A;  3LKU A;  4G2V A;  2DCF A;  3M65 A;  3C4X A;  2BUG A;  2V7I A;  1PAQ A;  2WXI A;  3OTN A;  2FEZ A;  1SA5 A;  2XS1 A;  4JHR A;  2QRX A;  2RFM A;  2W00 A;  2OEV A;  4AP2 A;  2DWG A;  3K3N A;  5CRV A;  1NL4 A;  4PH4 B;  1XDO A;  3HXE A;  5L3E B;  3EDU A;  5BPP A;  4PK4 A;  3O48 A;  5L3C B;  1K8K G;  4AKH A;  1X79 A;  2X9X A;  3RIU C;  3FH5 A;  1MX6 A;  3RRN B;  4HQD A;  3UPV A;  3FP3 A;  5CHE E;  4DMW A;  1TNY A;  2WQ6 A;  3Q49 B;  1Y64 B;  3CIR A;  2Y4U A;  1S94 A;  1FEW A;  1MMN A;  2VTB B;  2M6B A;  4DR2 T;  2ODU A;  4NXN T;  3KVB A;  4N5Q A;  5AQR B;  4GZD A;  2QA7 A;  4J8Y A;  4DX5 D;  3BQK A;  4YLH A;  2GRN B;  3FH7 A;  4XZ4 A;  3FTW A;  2D9D A;  3AE5 A;  4CZZ B;  2CA5 A;  2MAW A;  3APC A;  3JC6 D;  1ZKE A;  3LPZ A;  2P2C P;  1BU9 A;  3WI3 A;  4LF6 T;  3CK6 A;  5BV1 A;  1AP7 A;  3O1J A;  3ANW A;  2J9Q A;  4YDW A;  3DST A;  5CCM A;  3FZK B;  4O60 A;  5CBO A;  1SW6 A;  1MHQ A;  4B8A A;  3RQU A;  2XSB A;  4NUV A;  3AE8 A;  3DP7 A;  4TX5 A;  3QC1 A;  5FTP A;  3HVE B;  2LEH A;  4YTP A;  3HXB A;  4UWG A;  4AKL A;  3PS6 A;  4KT6 B;  2VL0 A;  2H7V C;  2WZI A;  4TRQ A;  1D1C A;  3ZJ2 A;  4MLK A;  3AU4 A;  3D0T A;  5H6R B;  4ILG A;  2X0H A;  1UK5 A;  3NQP A;  4DV6 T;  4ASK A;  4GA1 A;  1IHG A;  3CK8 A;  3MKD A;  4HTE A;  2WMN A;  1FT1 A;  2MOZ A;  2BKN A;  4G23 A;  5CED B;  1NP7 A;  3L6A A;  1YQ4 A;  4K5C A;  1MMG A;  3OJA A;  3K1S A;  2R03 A;  1HNX T;  1H2U A;  4KXK B; 
#chains in the Genus database with same CATH homology
 4DK5 A;  1IQR A;  4JEH B;  4NUU A;  3IHV A;  2WVI A;  4AEZ C;  2PQN A;  3CVL A;  2PG8 A;  1QUU A;  4DND A;  3FU6 A;  3QUJ A;  1OWA A;  2A4Z A;  3PUS A;  1E8X A;  2CFU A;  3CGH A;  3ONX A;  4H9P C;  2X51 A;  2IJG X;  4K0R A;  3CQG B;  5HXH A;  2JJ9 A;  4OYS A;  3HKC E;  2KND A;  3GA8 A;  4JPS A;  3BEE A;  2LSV A;  2P58 C;  2YQ8 A;  4OYJ A;  3PUK A;  3UUX B;  3GW4 A;  3VKG A;  4IN3 B;  1H2T C;  2J1D G;  4CT0 A;  4DLQ A;  3N2K E;  3HIZ A;  3C4Z A;  5FQ4 A;  4K03 A;  4IE4 A;  2VB6 A;  3RRU A;  4HOS A;  3DJB A;  3AS5 A;  2L3L A;  4QKN A;  5KDM C;  3ASH A;  3G2V A;  3ONL A;  3F57 A;  2K48 A;  4ZI2 D;  4ZS3 A;  3I3N A;  3QWP A;  2CXF A;  4C9B B;  4U04 A;  4DJA A;  4OHF A;  5LNK A;  1YKH B;  3SWH A;  3C98 A;  5HYA A;  4I6E A;  3U3I A;  4MRU A;  4GZC A;  4CCA A;  5FXZ A;  1Z3X A;  4PDX A;  3Q2M A;  3UUL A;  1BR2 A;  4GZ6 A;  4FC8 A;  3IEG A;  3K9I A;  3D9K A;  4H9O C;  4I6G A;  5FJY A;  4A55 A;  1HTJ F;  1HG2 A;  1QZ2 A;  4ZOL E;  3Q9D A;  4ME2 A;  3FEY A;  2VSY A;  3KFW X;  4RG9 A;  2CLY C;  2JPF A;  1ELR A;  2ZMA A;  5EZY E;  4AVX A;  4G26 A;  5FNV E;  5BV0 A;  3O4X E;  2KZ7 B;  3UTK A;  2XCC A;  3ML9 A;  3PDY A;  4FUL A;  4KMO A;  1D0Y A;  3VLD A;  5BNW A;  4CXW A;  1WLX A;  1H0A A;  2N9D A;  2X6K A;  2LAI A;  2K5B B;  4UI9 K;  3CVX A;  1QSD A;  5M4Y A;  5G05 C;  3I9W A;  3AA1 B;  5TAO A;  2WQ7 A;  1UJK A;  4EAH A;  3FUK A;  3OKQ A;  4H63 V;  5LGU B;  5EKQ D;  4I9C A;  5A1L A;  3G2T A;  2BZB A;  5JR9 B;  4N5C A;  1DNP A;  3RRM B;  5FY1 A;  2WXG A;  4X1I E;  2VSN A;  1P5Q A;  5L3B B;  3VTX A;  4GYO A;  4IGU A;  1OWP A;  3ZFW A;  3R7R A;  4E85 A;  2W0G A;  1OXZ A;  3S2A A;  1IYG A;  4AM9 A;  3VLE A;  3I0O A;  2EHO A;  3TXM A;  3ANW B;  3PNL B;  5HAX A;  1D0X A;  3ZCJ A;  5LCW J;  4PAG A;  3F31 A;  2XQ0 A;  2OVF A;  3MX3 A;  3FUN A;  3RRW A;  2QY7 A;  4YVQ C;  2L0T B;  5F8P A;  3A5X A;  2LOS A;  3BK9 A;  2IOS A;  4Q96 A;  5JDF A;  4GAA A;  3QWV A;  2X3M A;  3BQL A;  4MHC A;  4ZI7 E;  2HPL A;  4CT4 A;  3FUE A;  2NWB A;  5CA1 E;  5AEN A;  1NA0 A;  4N3A A;  3N9L A;  4KUM B;  2DHR A;  4L9I A;  3ETV A;  4WNF A;  3RYC E;  4O8S A;  2AXZ A;  2FI7 A;  2ZM0 A;  4JL0 A;  2BF0 X;  3MJX A;  4L0R A;  2IAK A;  3WAK A;  1JUQ A;  3CX8 B;  4GK0 E;  3TKL B;  1U3D A;  2GW1 A;  3DTO A;  4GML A;  3TXN A;  4GB9 A;  3MV2 B;  2HPJ A;  3I0Q A;  4ANV A;  4CDN A;  5LYJ E;  4FHK A;  4GZ3 A;  3QNK A;  3ETU A;  1SHZ C;  4H9Q C;  4UQZ A;  2NSZ A;  4I6J A;  5E76 A;  5L3G B;  4XZC A;  3CHM A;  3CVR A;  4DO0 A;  3OBV E;  2V7K A;  2XAQ B;  3FXD B;  3UMV A;  3PZD A;  2XAH B;  3P2B A;  3RYF E;  3LK2 B;  3S7B A;  3CEQ A;  3L22 A;  3EJN A;  4E7Z A;  3ZMU B;  4WW0 A;  4EZK A;  2C0S A;  4BTA A;  3LG7 A;  3ZC0 A;  2CG3 A;  2CE7 A;  5E75 A;  2BTD A;  3PUQ A;  1HFA A;  4UI9 C;  3EVY A;  2KAT A;  2ODV A;  2C5J A;  4QWN B;  3I5P A;  3UUN A;  3R9A B;  2KZT B;  3PE0 A;  4ZHQ E;  3HKD E;  4MLP A;  4OVV A;  2KT9 A;  2L6J A;  2QFC A;  2J4D A;  3F2E A;  4PJM A;  5LX8 A;  3ZHE B;  4ACK A;  3H37 A;  3TGO A;  5C1D A;  1HF8 A;  2MHK A;  3T8O A;  4X20 E;  4BJM A;  2IFU A;  2FO7 A;  2X6I A;  3NRX A;  3AAE B;  5G04 J;  4ISS A;  4PW8 A;  4MS6 A;  5FT9 A;  2IC9 A;  2YU1 A;  3IHY A;  3ZYQ A;  5JDH A;  1W3B A;  1HZ4 A;  4IE7 A;  2LSI A;  4M1P A;  4HN9 A;  3PRE A;  4FAD A;  5JJT A;  2H7O A;  2EHO C;  3NZP A;  4AKI A;  2WB2 A;  1NA3 A;  1E8W A;  2PQR A;  3RH3 A;  4I2Z A;  2VKH A;  2CXL A;  3APD A;  4B6X A;  1D0Z A;  1EDU A;  3FHE A;  3ASD A;  3D9I A;  3MKR A;  4DLO A;  3FTX A;  5HXR A;  2VSX E;  3S7F A;  3JQ1 A;  1AJ3 A;  4TV3 A;  4ZI3 C;  3LVQ E;  1JWF A;  4I55 E;  1ZEE A;  3QAR A;  4W9R A;  1GW6 A;  1E8Y A;  3U3W A;  1WM5 A;  3FUH A;  4N78 D;  5FXV A;  3QDN A;  4ANU A;  2HR2 A;  2X0L B;  2R5S A;  4U74 A;  4IIJ E;  2VGX A;  4PK5 A;  1DVP A;  3CHO A;  4KMC A;  5FZQ A;  2ES0 A;  2NTY A;  3PDN A;  5G2N A;  3CQX C;  2MYS A;  1PC2 A;  5JQG E;  2E9X B;  3PH0 C;  2KWI B;  2DLR A;  3ZYL A;  3CVP A;  2XAS B;  5JDQ A;  2DIW A;  3C51 A;  4V3I A;  4RVB A;  3B7T A;  3QWW A;  1H7C A;  3FUJ A;  4AKR B;  4HGA A;  4O4H E;  3Q5X A;  2I1J A;  4GZ5 A;  2P9B A;  4B89 A;  2KWH A;  4HOQ A;  5BT1 A;  3ZYM A;  1VDY A;  4LEU A;  5EDS A;  3FH8 A;  3U78 A;  1US7 B;  2Y6X A;  2RA1 A;  2KCK A;  3IEE A;  4WWN A;  2WXJ A;  1LVK A;  3ZN1 B;  2WXN A;  3AB3 B;  5FYM A;  5JRE A;  4YND A;  3SZ7 A;  1TEZ A;  1D1A A;  4P0B A;  4UVA B;  3FY4 A;  4YJ2 E;  4O6F A;  3Q5W A;  4XAX B;  2CEA A;  2V5F A;  3UX4 A;  1IQU A;  5T3R A;  4DVD A;  3LY8 A;  1UG3 A;  2WXP A;  2X66 A;  5AJL A;  5FQ7 A;  4L23 A;  3FXE B;  5KX5 E;  1HE8 A;  3L13 A;  3LS8 A;  5DAB A;  4APO A;  4ANJ A;  4PJL A;  2Q7F A;  3FU0 A;  5T8I A;  1U5P A;  3ZW3 A;  2WSS V;  2L9Q A;  3CWZ B;  1E7V A;  4ACL A;  2X6J A;  2WM9 A;  3KV9 A;  3P1U A;  4LER A;  3JC6 C;  5JVD E;  4PJJ A;  2PL2 A;  2JLB A;  3QKY A;  3E22 E;  4GK5 E;  2LE8 A;  3MAC A;  4O4L E;  3OYZ A;  4EYY R;  2XGO A;  5J2U E;  3MK7 C;  3I4R B;  1LRZ A;  5JHB A;  4WNG A;  4CQI A;  3KBU A;  4NAC A;  3MKQ A;  4PS7 A;  3FFL A;  5J08 A;  2I59 A;  5FMN A;  5JRC B;  1MND A;  2H3R A;  1NWM X;  3LBX B;  1OUV A;  2LSU A;  3GZ1 A;  4O4J E;  3QC9 A;  3SOL A;  4AQF A;  2RG8 A;  2I2O A;  2UY1 A;  3MZL B;  3ASG A;  3H3A A;  2L9B A;  1NZN A;  2PJQ A;  1KT0 A;  4AOF A;  2FF4 A;  2NC9 A;  5H6Q B;  3HI2 A;  1EPU A;  3VU7 H;  3ONK A;  5T4Y A;  2Q9Q D;  1ZHC A;  2WXM A;  5JHA A;  4APF A;  1H19 A;  3U66 A;  3RKV A;  5DQV A;  1IJ5 A;  1QNF A;  3LY7 A;  2W62 A;  4EYU A;  4WNE A;  3LJ3 A;  4I9E A;  2AWI A;  4G24 A;  2NP9 A;  3CIA A;  1V9D A;  2ZM8 A;  2D5U A;  4UF0 B;  3TJP A;  5EX3 A;  2XGM A;  2Q9Q C;  2WXF A;  1FIO A;  4QXB B;  4X1K E;  4EBA G;  3J9X 1;  5ADX L;  4UWF A;  3RX6 A;  3SD5 A;  3IKO B;  4A1G A;  5HXE A;  2A5U A;  4G2A A;  4EPZ A;  4D10 C;  4HVB A;  4Y6W A;  2W63 A;  4C0E A;  4A3T A;  1SQM A;  3AAI A;  4EZH A;  4ZI2 C;  3LY9 A;  3LEW A;  3CK9 A;  4BFR A;  5FZS A;  4H9N C;  2MOW A;  4L1B A;  5F3J A;  4GCO A;  3KBT A;  3ZEF A;  2OV8 A;  1S0P A;  3ZXS A;  5ANL A;  3SBS A;  3FUM A;  3ZJ1 A;  2WMO A;  4PS8 A;  3Q4A B;  3AAA B;  5LG4 A;  1FCH A;  4IHJ E;  4QX7 B;  1WY6 A;  3FU3 A;  3AS8 A;  4UV9 B;  4H7Y A;  1FMV A;  3GMI A;  2ZLY A;  5ENN A;  2JEK A;  4I43 B;  3CLJ A;  3MA9 A;  4KBQ A;  3EHN A;  5AIJ A;  3PU8 A;  3RK6 A;  1O3X A;  2X6F A;  1D1B A;  4IE5 A;  2CLY B;  4U72 A;  4P09 A;  1Y6I A;  4GU5 A;  2M67 A;  2XTL A;  1PY1 A;  1BR4 A;  5LOZ A;  1H6K A;  2CHW A;  1EYH A;  5LA6 E;  2D2S A;  5LHI B;  5HQ8 A;  2MTQ A;  3NZS A;  3URZ A;  2OOE A;  1EF1 C;  2ACX A;  4J8F A;  1LVF A;  3GZ2 A;  2QGS A;  3CVQ A;  5LBQ B;  4Q94 A;  4JC8 A;  4OK0 A;  2XHE A;  4JW1 A;  3LCA A;  4U0S A;  2A72 A;  5FXW A;  2CFZ A;  3B13 A;  5BW8 C;  1IJ6 A;  4UQX A;  3J7Y q;  3D9M A;  4M3O A;  3IBP A;  1KT1 A;  4EOZ B;  5C8Y E;  4A3V A;  4HOT A;  1HS7 A;  3ZMZ B;  1TJF A;  4ANW A;  5KJM A;  4AQF C;  3P7I A;  3SGH A;  2BDE A;  5CA0 E;  3D9J A;  3FUL A;  4N3B A;  3CML A;  2NW8 A;  2CCQ A;  2V7J A;  4DPR A;  5LJN A;  4CGW A;  2NXP A;  3VKH A;  1S35 A;  2A3D A;  4XBF B;  4XX5 A;  3S7D A;  5A6C A;  4U0U A;  2IOL A;  4PFO A;  4NUR A;  4HE8 A;  4I4T E;  2WXO A;  2D0U A;  3ZC1 A;  2FUL A;  4UWH A;  3K3O A;  3P8C D;  3O9X A;  5FP3 A;  5EX0 A;  3OXG A;  5HWY A;  2GGF A;  1NAF A;  5G04 C;  2UY1 B;  3MYV A;  1BR1 A;  2RP4 A;  3N71 A;  5L3D B;  3FHN A;  4H9S E;  2XAJ B;  4YJ3 E;  4TN7 B;  3PU3 A;  4ABN A;  4TV9 E;  4UVB B;  5CMW A;  3CKC A;  4KBM B;  4F53 A;  2CG2 A;  2RD0 A;  3ZYK A;  3EHM A;  3OYX A;  3DBS A;  4Z8X A;  3RU0 A;  4O2A E;  3N5L A;  2IC6 A;  3NRY A;  1ELK A;  4AQG A;  2KC7 A;  3LK3 B;  2GRM A;  2XUE A;  2LHR A;  3L54 A;  4I17 A;  2VTB A;  3FB2 A;  2XEV A;  1B89 A;  3PEU B;  1YKE B;  1Z3Y A;  3MEK A;  2WWU A;  5ARG A;  1Z0P A;  3KEZ A;  3N2O A;  3CPZ A;  3PUG A;  2YIN A;  2WBL A;  4MAL A;  4OVU A;  2X68 A;  3GWH A;  3LVR E;  4FJY A;  3LXU X;  1MIW A;  3C98 B;  3RIB A;  2CMR A;  2WXH A;  3ZMV B;  5L2L A;  2LHN A;  3FBL A;  3IV0 A;  3U4T A;  4YHJ A;  3T5V A;  4TUY E;  4UV8 B;  1G8X A;  3T8M A;  3KAE A;  4N39 A;  3N9O A;  5FZR A;  4AY6 A;  4BT8 A;  5CCL A;  2DNX A;  3SRZ A;  2VKO A;  2X6H A;  4KZC A;  5HXS A;  4KVM A;  4J8E A;  2LSY A;  3TG4 A;  2XGS A;  3ZPJ A;  4CDM A;  1KNZ A;  4ZS2 A;  3RRC A;  2Y8D A;  4UEM A;  4JEH A;  3ULQ A;  5FXX A;  4YVO A;  3S4U A;  5HXC A;  3QOU A;  5FY0 A;  4FLB A;  1UW4 B;  4CEM A;  4HOR A;  4JEU A;  4KZ0 A;  1INZ A;  4IDZ A;  1XNF A;  3N2G E;  4J8D A;  4X1Y E;  2CM0 A;  5JDN A;  4A1S A;  2OVB A;  2CWY A;  3KV5 A;  5DJQ C;  1WR6 A;  3IF8 B;  3L16 A;  5KMG P;  4BJN A;  5IYZ E;  3FUI A;  3UQ3 A;  2NW9 A;  1E96 B;  1MMA A;  3BQI A;  2LSG A;  3CVY A;  4FU3 A;  3GN5 A;  2WPV A;  4JHK A;  2JMK A;  3AA0 B;  2XRZ A;  4U0Z A;  4EQF A;  2V7L A;  4FA6 A;  1U4Q A;  4CI3 B;  3U9W A;  1CUN A;  1BPO A;  2E9X D;  4G25 A;  4XI0 A;  2N1G A;  4FI5 A;  1OWM A;  3QAQ A;  5JDM A;  4AV7 A;  4U07 A;  3I9Y A;  4AY5 A;  5EK4 A;  3ZN3 A;  3PRZ A;  2VGY A;  3ZMT B;  3CKD A;  2LJL A;  3ENE A;  4GA0 A;  3SNX A;  4HLE A;  4GYY A;  3S7J A;  2EHO B;  4I1O B;  2EQX A;  4MBQ A;  4J6I A;  1HU3 A;  2OND A;  3ZRH A;  2Q9Q A;  2IW5 B;  4LCT A;  4UWL A;  3VTY A;  1Z6T A;  5J1G A;  1MNE A;  3CVU A;  2NW7 A;  2DBA A;  2C5I T;  2XAG B;  5AJD A;  3HHM A;  2I6H A;  3FBZ A;  2VL8 A;  3HL6 A;  4UEL A;  2X9Y A;  2SPC A;  4BT9 A;  3LYA A;  5LBM A;  5FWQ A;  3N9N A;  4UI9 J;  3R84 B;  2KCV A;  4PUC A;  4KP3 C;  2Y4T A;  3KDS E;  4ILU A;  3D9L A;  5DBK A;  4L5G A;  3N9Q A;  3FTS A;  2CWO A;  4ILI A;  3GZS A;  2GK9 A;  3CHQ A;  2WXK A;  5LCY A;  2AW6 A;  1QQE A;  5LXT E;  1WYB A;  4MFR A;  3SFZ A;  1HXI A;  4H9R C;  1LKX A;  3D9P A;  4E7S A;  4HEA A;  4B0Z A;  3ZCI A;  2WAU A;  2L8K A;  3UT4 A;  2PFV A;  4F7A A;  2V4L A;  1E1H B;  1SZA A;  2KIN B;  4N2Q A;  4EXT A;  2Y3A A;  3UT5 E;  2YNQ A;  3Q15 A;  4C0M A;  2K9A A;  1ZV4 X;  2XQY A;  4HFG A;  3FTY A;  4CI2 B;  3B7R L;  3B7S A;  3L09 A;  4QX8 B;  3JQ0 A;  4TV8 E;  4YFS A;  2VK9 A;  5JR9 A;  3CHP A;  3V5U A;  1UX5 A;  3ZIM A;  2LSK A;  3KD7 A;  4DMV A;  3O1H A;  4BA9 A;  5EK3 A;  3I4G A;  3RO2 A;  1G73 A;  4FJZ A;  1MIY A;  2WQH A;  2LAH A;  4FP7 A;  4JVS A;  3RPU A;  5BMV E;  1HG5 A;  5JJ7 A;  3PNT B;  3BG0 B;  1H2V C;  4QHO A;  2C2L A;  4U63 A;  2X9W A;  2V0P A;  4O2B E;  3EIJ A;  2LO6 A;  1A17 A;  3KIN B;  3D3M A;  3FDH A;  4PFP A;  1VRB A;  2KXP B;  4JLE A;  2HH7 A;  1HS6 A;  4QXH B;  3AA7 B;  5D0Q D;  3N9M A;  4OYK A;  5KCM A;  2XPY A;  4FHJ A;  3RC3 A;  4BX9 A;  4BWR A;  2BVM A;  2YU2 A;  4G1T A;  3HKB E;  5CMY A;  1LF8 A;  4WAF A;  1MMD A;  2KLQ A;  3C50 A;  3AVR A;  3HYM B;  4XI9 A;  2LSJ A;  4JEU B;  4J8S A;  3K8P C;  5LGT B;  3CST A;  2YEV C;  4TUU A;  5BUZ A;  2XPZ A;  4AXH A;  1HCI A;  3AVS A;  2KCL A;  2XPI A;  3SF4 A;  5JH7 E;  4UIG A;  2K24 A;  3UT8 A;  5KJN A;  5ARF A;  4B94 A;  3TG5 A;  1E90 A;  4I2W A;  2Z6E A;  4A56 A;  3LK4 2;  3MCX A;  3G2W A;  4GOU A;  3RC8 A;  4I1M A;  1VOM A;  3GN5 B;  3EIQ C;  4JUY A;  4UWK A;  4K0U A;  3APF A;  3AU5 A;  5LCW C;  2B1E A;  4G11 A;  3LJC A;  5KJK A;  2C0L A;  5LHH B;  4BY6 A;  3NBX X;  2VSO E;  4E6H A;  3MXZ A;  4Y6C A;  1BR0 A;  2E0I A;  3SS1 A;  2NOX A;  4HKA A;  1FMW A;  3G2U A;  4JHJ A;  3TAX A;  2VGX B;  4H7X A;  5LFA A;  3ASF A;  3C64 A;  4UQY A;  2N2N A;  2Q9Q B;  4I1A A;  2KM4 A;  4CRW A;  4CGV A;  2ILR A;  3CV0 A;  3ZLI A;  3E08 A;  1KLX A;  3LDZ A;  2OA5 A;  2IF4 A;  3T5X A;  5E0O A;  3ZVV A;  3Q47 B;  4F3V A;  2LT3 A;  4PJN A;  2LNI A;  3WAJ A;  2KZT A;  4BSX A;  4V1A v;  4IUL A;  3NF1 A;  1B7T A;  2Y48 B;  3PTR B;  3HKE E;  1KK7 A;  2W61 A;  2FBN A;  1MQS A;  2VJ8 A;  1FVH A;  4QFV A;  1WYC A;  3ZHE A;  5AFU L;  4N2S A;  4WWO A;  1HH8 A;  2HM8 A;  3ZGQ A;  2XCB A;  1JWG A;  2UXN B;  4J2C A;  4RG6 A;  4DI3 A;  2J49 A;  2JRK A;  3CHR A;  5JR9 C;  3MGB A;  2UWJ G;  1XGW A;  3WXX A;  1Y8M A;  3MZK B;  3OAW A;  4IYP A;  2VQ2 A;  3GYZ A;  3CVV A;  5L3F B;  2PBI A;  3FTZ A;  3UFE A;  2ZM2 A;  4EB6 E;  4Q69 A;  4AKG A;  2VWA A;  1ELW A;  1ZBP A;  5DIZ A;  3EDT B;  1UN9 A;  5JDL A;  1N54 A;  3ESL A;  5AYW D;  3ZN0 B;  3KS2 A;  3AA6 B;  3PEV B;  1YA0 A;  4J0U A;  1WAO 1;  4ERR A;  4MKT A;  4ATG A;  3N9P A;  4DBR A;  4IST A;  1YW0 A;  3U64 A;  2J09 A;  1UX4 A;  4GMJ A;  4GCN A;  3UUM A;  4ILH B;  4C91 A;  2IQC A;  5HWX A;  4WBO A;  4PK6 A;  2HO1 A;  3K3Q C;  4EEC A;  4L7T A;  1HX8 A;  4HOU A;  3CVW A;  5FY7 A;  4L2Y A;  2E2E A;  2CHZ A;  3QK0 A;  3CX7 B;  2MBG A;  4CI1 B;  5D0O D;  4L2L A;  3DPD A;  4DBQ A;  3MKQ B;  1IZN B;  4G63 A;  2V7M A;  4IRU A;  5JJ6 A;  2E9X A;  2ZU6 B;  3PE4 A;  3HR0 A;  4KYO B;  4EBA A;  4DI4 A;  1UN8 A;  3RYI E;  2AVP A;  2J4B A;  3IBE A;  3CR3 A;  4EZ4 A;  4AXP A;  5ANR A;  5J2T E;  4JA7 A;  2V8S E;  1SA0 E;  1ZU2 A;  3JYS A;  1OWN A;  4XIF A;  4AI6 A;  2VKJ A;  2J07 A;  3JUI A;  4EZL A;  1MIV A;  4CDR A;  2WXR A;  3MJW A;  2I9C A;  5KJL A;  5FQ6 A;  3PUR A;  3B57 A;  3RO3 A;  4UVC B;  5ETW A;  4QXC B;  4I50 E;  4ADZ A;  3Q5M A;  3IHR A;  5JDG A;  4KVO A;  3FU5 A;  4P0A A;  2J08 A;  2JQQ A;  2ION A;  2V1D B;  5A23 A;  3AS4 A;  1UCU A;  2LOP A;  2PZI A;  2E8I A;  3VHL A;  4WND A;  4HXI A;  3MA5 A;  2R17 C;  2L0I A;  2DCP A;  5G05 J;  1YD8 G;  2DI4 A;  5A7D B;  3C4W A;  2VYI A;  1WRD A;  3JCK C;  4LUN U;  3L17 A;  3UT7 A;  4CXX A;  2GRL A;  1OWO A;  1FVF A;  2D0T A;  3QK6 A;  1N52 A;  5HI7 A;  3L08 A;  3SI5 A;  3CX6 B;  3FTU A;  3MV3 B;  5C2Y A;  2YK0 A;  4WUY A;  2UXX B;  3HA4 A;  3KVA A;  4FJO A;  2HYZ A;  3LFM A;  1X5B A;  3L3P A;  5LJM A;  4XKB A;  3ESK A;  4JXT A;  4GPK A;  2DWK A;  3HVE A;  4NQ0 A;  2G0U A;  4JA9 A;  1JPL A;  5EK2 A;  2A2F X;  2XAF B;  3D9O A;  3ZEF B;  4IE6 A;  5FQ8 A;  2C0M A;  4ANX A;  3CSF A;  5LGN B;  4URK A;  3QB2 A;  4XE0 A;  5JRC A;  3ZPO A;  2YHE A;  4O4I E;  3PUA A;  4GYS A;  3LBX A;  3FTV A;  5G55 A;  3I1A A;  3CK7 A;  3G2S A;  1U3C A;  3W15 B;  3SBT B;  3E4B A;  2X67 A;  3OXL A;  2M63 A;  1OWL A;  2CXD A;  3VLF A;  3RYH E;  4BX8 A;  3D9N A;  2C5K T;  2X9H A;  1E8Z A;  2PM7 A;  3B7U X;  3EUH A;  4BTB A;  2EHO D;  3E0Z A;  3CVN A;  2I1K A;  3RJV A;  3R6N A;  3R7Q A;  3O4Z A;  4IE0 A;  3UUX A;  2VAS A;  3KV4 A;  2WXL A;  4F1S A;  4C90 A;  2WXQ A;  4AJW A;  4WBN E;  5LHG B;  3FUD A;  4FLH A;  5CB4 E;  4WNK A;  4PS3 A;  4N3C A;  4R7L A;  2X38 A;  3OXF A;  1TJC A;  5M72 A;  5LOV E;  3SHF A;  3CQC B;  4EIW A;  4HFV A;  4NRH B;  4ZI3 D;  1SZ9 A;  4UF0 A;  2VKD A;  2XHE B;  2XRY A;  2AXV A;  2NTX A;  3TL5 A;  4F6R C;  4RSY A;  3NZU A;  4P29 A;  5IHY A;  3FUF A;  2CHX A;  1EZ3 A;  4OFZ A;  2E9X C;  4H63 H;  3V5S A;  4U8H A;  3ZMS B;  4GA2 A;  4XKC A;  2BVL A;  2R59 A;  5DQW A;  3ML8 A;  1IAP A;  4TZ4 C;  4HS2 A;  4PNI A;  3FWV A;  2YHC A;  1T98 A;  2AXU A;  3CHS A;  3CKB A;  5GON E;  1E7U A;  3PE3 A;  3NZQ A;  3BG1 B;  4WWP A;  1L5J A;  4LRZ A;  4BAY B;  3O1I A;  4AIF A;  2LM9 A;  2IU1 A;  4GIW A;  4GYW A;  2V26 A;  2KMF A;  3QJZ A;  3EDV A;  3FEX A;  3PVL A;  4B8C B;  3PUJ A;  2PM6 A;  2JMH A;  4CXY A;  1HO8 A;  3HDX A;  5LP0 A;  3RKO A;  2MRI A;  5LP6 E;  1UJJ A;  4JZY A;  5J90 A;  4UXN B;  3KV6 A;  4GYR A;  4EZJ A;  4I43 A;  3LKU A;  4G2V A;  2DCF A;  3M65 A;  3C4X A;  2BUG A;  2V7I A;  1PAQ A;  2WXI A;  3OTN A;  2FEZ A;  4JHR A;  2W00 A;  4AP2 A;  2DWG A;  3K3N A;  4PH4 B;  3EDU A;  5L3E B;  5BPP A;  4PK4 A;  3O48 A;  5L3C B;  4AKH A;  1X79 A;  3FH5 A;  2X9X A;  3RRN B;  3UPV A;  3FP3 A;  5CHE E;  4DMW A;  2WQ6 A;  3Q49 B;  1Y64 B;  2Y4U A;  1S94 A;  1FEW A;  1MMN A;  2VTB B;  2ODU A;  3KVB A;  4GZD A;  2QA7 A;  3BQK A;  4YLH A;  3FH7 A;  4XZ4 A;  3FTW A;  4CZZ B;  2CA5 A;  3APC A;  3JC6 D;  1ZKE A;  3LPZ A;  3WI3 A;  5BV1 A;  3O1J A;  3ANW A;  2J9Q A;  5CCM A;  4B8A A;  1MHQ A;  4NUV A;  3DP7 A;  4TX5 A;  3QC1 A;  5FTP A;  3HVE B;  2LEH A;  4UWG A;  4AKL A;  3PS6 A;  4KT6 B;  2H7V C;  4TRQ A;  1D1C A;  3ZJ2 A;  4MLK A;  3AU4 A;  3D0T A;  5H6R B;  4ILG A;  3NQP A;  4ASK A;  4GA1 A;  1IHG A;  3CK8 A;  3MKD A;  4HTE A;  2WMN A;  2MOZ A;  4G23 A;  1NP7 A;  3L6A A;  1MMG A;  3OJA A;  1H2U A;  4KXK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...