1HG2A

Calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(4,5)p2 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
263
structure length
263
Chain Sequence
GSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN ASSEMBLY PROTEIN SHORT FORM
publication title Simultaneous Binding of Ptdins(4,5)P2 and Clathrin by Ap180 in the Nucleation of Clathrin Lattices on Membranes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 97
structure length 263
sequence length 263
ec nomenclature
pdb deposition date 2000-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07651 ANTH ANTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.150 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1hg2A02
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hg2A01
3D9NA 1JUQA 2QY7A 2L0TB 5J08A 1H0AA 2L0IA 4NACA 1X5BA 1EYHA 4Q94A 3D9MA 4GZDA 1HF8A 3CLJA 1ELKA 4GZCA 1JWGA 4JXTA 5LP0A 1VDYA 3ONKA 4FLBA 3G2TA 3ZYLA 4Q96A 3ZYQA 1HFAA 2DIWA 3D9PA 3G2SA 3D9OA 3ONLA 2DCPA 4HFGA 1PY1A 1HG2A 1SZ9A 2MOWA 2V8SE 3D9KA 1EDUA 3G2UA 3G2WA 3D9IA 1XGWA 4FU3A 1SZAA 3RRUA 5CMWA 1MHQA 1JWFA 3G2VA 5CMYA 5LOZA 1HG5A 1DVPA 3D9JA 3LDZA 1UJJA 2KM4A 3ZYMA 1JPLA 2BF0X 1LF8A 1HX8A 1UJKA 4AVXA 1INZA 3D9LA 3ZYKA 2LO6A
chains in the Genus database with same CATH superfamily
1T72A 1V9DA 1U3DA 2V6XA 2KT9A 4I1AA 2LSVA 3FUJA 4TUYE 5E75A 3JAFA 4N78D 2WXMA 4GTRA 3JADA 5ABFA 3HRAA 1B89A 3VRBA 4TV8E 2VK9A 5ENPD 5FZQA 5JMND 4WZXA 4NIKA 4L5GA 2JMHA 2NP9A 3RRMB 3E0ZA 4A3TA 5HXSA 3V30A 2OV9A 5CBOA 5L3EB 4HOQA 3T8MA 4KX6A 2NW9A 1E7UA 4AVXA 2CWOA 5HQ8A 1K1AA 4WUYA 2KNDA 4EEBA 2LAIA 2YK0A 2I9CA 1XZYA 3OBVE 1OCOE 2YOEA 4PS8A 2XSAA 3FZLB 3FTVA 1Y01A 2QYWA 2LEHA 3AAAB 3BG1B 3FWVA 1BLXB 3F6QA 4NUVA 3FUHA 3CKDA 3A8YC 4TNVA 3DJBA 3PUAA 3A5XA 1SA0E 1NA0A 4NACA 3U78A 2VGYA 2CXLA 1KZOA 3ASGA 3D3MA 2CA5A 2NR4A 4ILGA 4UIGA 3PREA 5ETWA 2RG8A 3FULA 3CHRA 3CK6A 4HBDA 2CRBA 5CBNA 2UXNB 1WYBA 3ZNGA 4P29A 1Z5SC 2Y6XA 5HXCA 4F6RC 3Q15A 3UU8A 4AKIA 4XKCA 2A5EA 3L82A 3P7IA 4LUNU 3TWUA 1XMOT 5CRVA 4JW1A 2YU2A 4OAVB 3T1YT 3ZKJA 5ABGA 2NWBA 1NENA 1OWOA 5G04J 1O1TA 1FT2A 4B3ST 4RG9A 1VDYA 4JLEA 1IJ5A 3HVEA 2WVIA 3VR8A 4JI2T 1DCQA 3QNUA 4U0UA 2WB5A 3D9KA 3OKQA 2LSYA 1KLXA 4GTPA 3N5LA 1XGWA 2R03A 2VSOE 5DBKA 1G8XA 4ANJA 4IE0A 1N34T 3MKQB 4XKBA 3GZ1A 4C0EA 3FUMA 3MXZA 5FKYA 4JBWF 5JJ7A 3UM0A 2Q7FA 3JXJA 3KEZA 4CRWA 4IE7A 2OOEA 5ENSD 2L0IA 3MKDA 1Z6TA 2VTBB 3CK8A 1U5PA 4HN9A 5L4EA 1HFAA 4CQIA 1YYHA 4I2ZA 2I0MA 4HFEA 3IKOB 4JUYA 4QH5A 1IQRA 2EHOC 2FJBA 2LRLA 2DNXA 4JC8A 4UELA 3PNTB 4U04A 3VLEA 4KMCA 4BA9A 2EQXA 2J07A 1MYOA 3SFYA 4QH1A 2IY0C 1YXRA 5JVDE 4IDZA 1LTXA 2AJAA 4DUZT 1HTJF 2X9XA 5GONE 5L4HA 2N2NA 5L3DB 2XASB 5C1DA 4H9NC 3ETVA 5LJNA 2KXPC 4GCOA 4CZ2D 4ZI3C 4ANXA 2CEAA 4AP2A 4L9PA 1PY1A 4MRUA 3KV5A 4J0UA 4YLHA 3FTUA 2IO2C 4BSXA 3UFEA 5AQVB 2WWVA 4DX2A 3UT8A 5LCYA 3TLVA 3PUSA 4UQZA 2W63A 3KSQA 2HPJA 4CEMA 3NQPA 2C0LA 2IFUA 2E0IA 4HORA 3LVQE 2JMKA 3NBNB 3ULYA 2BG9A 5BMVE 4LNUD 4DV5T 4OVUA 1Q2ZA 3RC3A 3CHOA 5J0ZA 4XZCA 2UY1B 5D0OD 1NAFA 3ZN0B 2DWKA 3ESKA 4JEUB 2H88A 4NQ0A 2YU1A 2CCQA 1JCSA 3AA0B 1WR6A 3ZEFB 3Q49B 3QC9A 3FTWA 3QDNA 3PVLA 4UI9J 2LJLA 3MCXA 1L0VA 1TNUA 3PZ2A 2VSYA 4LNGA 3APFA 4ISTA 1H2UA 1T98A 5BUZA 2ZM8A 4HLEA 4JZYA 1ZOYA 1D1BA 1ZU2A 3FZMB 3TJPA 4APOA 4O60A 2WU5A 4KYOB 1FVHA 3PNLB 2KINB 3ABVA 4HVBA 4TN7B 2CFZA 4U3CA 4K5CA 4EZLA 2VQFT 2UXDT 2ZGDA 2XEHA 4AV7A 4KHPT 2XM2A 4JI5T 3A7MA 2RFAA 3RRNB 2OCCE 1V55E 3AE7A 2CPTA 4GTSA 3L09A 3D9LA 3OAWA 2F37A 3FH5A 2Y0BG 5ANLA 4XX5A 2UU9T 1HNZT 3LJNA 4Q94A 5G04C 4H7XA 3B13A 3C51A 3EJNA 3FH7A 3ZGQA 4BX8A 3FUFA 2WDVA 4DVDA 3CVXA 4F1SA 2DIWA 1OT8A 3FUDA 4WNKA 4IE4A 1UURA 3V5SA 4C90A 1L5JA 4G2AA 3PZDA 1XWMA 4Z68A 5LJMA 3SOLA 2CFUA 3FDHA 2KCKA 3ZKRA 4MLKA 2X6KA 1T7SA 1IYGA 3RIUA 4CDMA 2GRLA 4KVMA 3BEEA 2OEWA 1UG3A 3NAWA 5KMGP 5KJLA 3C98B 3RH3A 5JDHA 1ELWA 2KWHA 1XNQT 4H9OC 2XEVA 3AAAC 4J8FA 3SNXA 4ZI2C 4X20E 2LHRA 2V7LA 3EUVA 3FH8A 3SQVA 5ITZF 1OCCE 4UVBB 3R7QA 1MZCA 3D9PA 2M6IA 2C5JA 3MK7C 1IBKT 4GMJA 3B7UX 2BVMA 2R02A 4X65T 3VTXA 3PUWF 1TNOA 3Q5WA 3HR0A 4B3MT 4JA9A 1E7PA 4I6EA 2LKGA 5JDGA 2DYRE 4UQXA 2ETCA 4FJZA 3V79K 5LMUT 1FVFA 4PJNA 4WWNA 4W9RA 3MYVA 4PK5A 4YHHT 3CKCA 3G2WA 4CN4A 5AN8A 2VKOA 3KVBA 3R6NA 2UUCT 2K3WA 3I1AA 4TWDA 2DWZA 3ZHEB 2XENA 1BPOA 3CEQA 4AKGA 5FJYA 4CDRA 4AI6A 2BKGA 2FUPA 4Z90A 1WLXA 2IC9A 1BR4A 2XGSA 3AU4A 1NA3A 2ZIRA 4J8SA 4BWRA 4DR1T 2PG8A 1TR4A 4GZ6A 4M1PA 4APFA 5ARGA 4ZZBA 2XAJB 2CHWA 1M62A 4AOFA 4J8YA 2IDOB 5D0QD 1MMAA 1I94T 4I0UA 4U7YA 4CYMD 5L3FB 4BJMA 5AQ9A 2XUEA 3PS6A 3S7JA 3SFEA 4KBMB 5KCMA 3PU8A 3R84B 2DWGA 3RF1A 5FQ7A 4TWHA 1SVXA 3LBXB 5AQKB 3JAEA 4EAHA 5IWAT 1H2TC 3C98A 5HEHA 4JI1T 4DX1A 1QSDA 5T8IA 4K0UA 1BI8B 3AEAA 3EABA 1FEWA 1Z0PA 3DWLG 4RLYA 1W0AA 4MKTA 5B3SE 2QFCA 3C3OA 3HXEA 3PZ3A 5JRCB 3ZN3A 3ZIMA 2PL2A 3JQ1A 2WP9A 4JXTA 1JWGA 4IGUA 2XGMA 3ZYQA 4EYYR 5JHAA 4X62T 2D9DA 2IMLA 2E9XB 1SZ9A 5E0OA 3ABME 1MJ0A 5KJKA 1T8BA 4DV2T 1NFIE 4Z8XA 4G63A 5LB7B 4OYSA 3S4UA 4PK6A 3QUJA 5F8PA 4GOUA 3P2BA 1WR0A 2BZBA 4GKJT 3E30A 3ZT5A 3N2KE 1ZB1A 2X9YA 4FP7A 2WQYA 5FXVA 1CUNA 3I4RB 1S0PA 3KSLA 2CBIA 1LKXA 4GK5E 3UULA 4O1OA 2GRNB 2XPKA 2GRQB 4B0ZA 2WXOA 2M67A 1JNZA 2FJDA 2IUBA 3EHZA 3PU3A 3FXEB 3HDXA 2D0UA 1X79A 4EEDA 2W4XA 3UQ4A 1WYCA 2QYUA 4B93B 2XQ9A 4JI4T 2FF4A 4N3BA 1K3ZD 1S63A 2WS3A 4KVOA 3GN5A 2L0TB 3UFGA 1OWPA 3JCKC 4FA6A 4EXTA 3AA7B 4YY3T 4DV0T 4FLBA 2CE7A 4ASKA 2E5VA 2H89A 3B7BA 2E8IA 1PC2A 2HYZA 3RRCA 2UWJG 3D9IA 1SUMB 1MHQA 1I6ZA 4MALA 5EX3A 2RD0A 1JCRA 2C0MA 3OXFA 4PDXA 1HNXT 4MS6A 2OEVA 3L54A 3L16A 3N9MA 2KLQA 4ATGA 3ZMVB 4LF8T 2LUHA 2WB2A 4WWOA 1FMWA 4QH4A 3TKLB 4BEPA 4I6JA 3SRZA 4UWKA 2WQ7A 4TNWA 2A5UA 3QB2A 5AQRB 1IQUA 5JDMA 3P4QA 5CA1E 4CN1A 5LCWC 3Q9UC 2J1DG 1NWMX 5JR9A 1E90A 1YCSB 1WY6A 4GTVA 3UINC 4U74A 3ZCJA 1SZAA 2GRRB 4GCNA 4EV6A 3J9X1 3Q9DA 1XDOA 3IBPA 2DI4A 3PJAJ 5EIDA 2LRKA 4ZI7E 3BQIA 4Z91A 5LBQB 1QZ2A 1WDYA 3TWTA 4N2SA 3LS8A 4DBQA 2EIME 2UUBT 2LHNA 2JEKA 4G8LA 4ACLA 4BFRA 3ZMSB 3QOFA 1UK5A 2V0PA 4E6HA 2J4BA 2V6YB 4WBOA 4ZEYA 3G2TA 5D66A 3ZJ2A 3K3OA 4EYUA 5ADXL 4EQFA 4J8DA 4U0SA 4ZXLA 3HXFA 3K3NA 4AKLA 2V4LA 4P09A 2WQHA 3R9AB 4DI4A 4DLQA 1KF6A 2JLBA 5ABFB 4B89A 3UM2A 1HX8A 3ZLIA 4HOTA 3SFDA 3AE6A 4HQDA 4CZZB 1OUVA 3OXGA 4AQYT 4UWGA 5CA0E 4GZCA 4F3VA 3DSUA 4PJJA 2R05A 4TXPA 2IJGX 3UQ3A 2K24A 2H6FA 1LRZA 4KHZF 1VCTA 4L9IA 5AQMB 4R7LA 2EHOD 4HWFA 1E8YA 5FQ6A 3DBSA 3RRWA 4MBGA 3CVRA 3KINB 3SI5A 3DRAA 1HR0T 3JC6C 1MMDA 2LE8A 2MOZA 2XQ8A 5LOVE 2PNNA 4N3AA 3CSFA 3J5QB 4FHJA 4HRLA 3FEYA 3S7FA 5CEDB 3RAUA 3Q2MA 3O9XA 2BKPA 1PAQA 2NC9A 4QHOA 4ZI3D 3LEWA 5J1GA 1ELRA 4LCTA 4IIJE 3Q7FA 4CT4A 3VLDA 1YQ3A 3DPYA 3NOCD 1NL4A 3VKGA 4ILUA 5FY0A 3QK0A 4M3OA 3UU3A 1X9BA 3ASDA 3F31A 2E2AA 2MYOA 3L13A 1OXJA 2VQET 4HFVA 3JUIA 5HWXA 5AYWD 3UM3A 1MX6A 2MAWA 1OEDE 4ZZCA 3W15B 1S64A 1A17A 2HH7A 2H6IA 5AQIB 2LXMA 4JI3T 3ASFA 1K8KG 1YMPA 3C5RA 3BG0B 3SS1A 3NZQA 2P9SG 3E08A 3PUXF 4I17A 3PUQA 1SE7A 5CJ5A 2JJ9A 5G55A 3NRXA 2XM1A 5HI7A 3RSEG 3TXNA 4YTMA 2PJQA 4WYVA 3U64A 1IBLT 4NUUA 4LF4T 2KM4A 3HKCE 2E9XC 2XQ0A 1QYMA 2VGXA 4U7EB 2HR2A 1JNRA 3AG3E 4A3VA 3TXMA 4BETA 2A2FX 2JRKA 5CB4E 4DO0A 4NXNT 5LP0A 3T5VA 2X38A 4ZHQE 3DSTA 2YKSA 5LYJE 3L17A 4UWFA 5KDMC 4GPMA 3WAKA 4V1Av 2WQ6A 1N0RA 2IC6A 2CG3A 4GMLA 3L39A 2H7VC 2VVNA 3AA1B 3G06A 5EILA 1TN7A 4FJOA 4GMRA 4ERRA 2HO1A 2J09A 3LKUA 1QLBA 3OYXA 1NEKA 3UUBA 5B1BE 3UQ7A 3AE8A 3CK9A 5M4YA 2IOSA 4GB9A 3GA8A 3Q7AA 1UCUA 3FUEA 2RPAA 3K1SA 3FBZA 3DTOA 4HFHA 2LAHA 3JYSA 1RW2A 2QVAA 2XAFB 3KV4A 3CK7A 1Y6IA 1AP7A 2GW1A 3LDQB 4GYRA 4XZ4A 2ACXA 4BSZB 1UGOA 3V5UA 3PUZF 3PUYF 3RI5A 1AJ3A 4PS7A 2AWIA 2WXHA 4A1SA 2V26A 4ZI2D 2XQ6A 4U8YD 2LM2A 3UT7A 4PUCA 1VOMA 3LSVA 3D9HA 3PDYA 3T1HT 2J4DA 1OWMA 2WXLA 3LY9A 3O1IA 3AB3B 5KNHD 3N9LA 1KEYA 4TUUA 1GQEA 1VRBA 2P9BA 1FT1A 3FUKA 1MMNA 2BG9B 3MA5A 2X9HA 2DBAA 3ZXSA 2VKHA 2CWYA 4KXKB 3UU6A 4DR7T 3ANWA 3SBTB 4EZKA 1EYHA 4U07A 1K1BA 3D9MA 2IONA 5D2MC 5AQBA 4HI9A 3DEPA 2NW7A 4KP3C 4O6FA 5EK2A 1RZ4A 4A55A 1B7TA 4DV6T 3DEOA 3W9FA 2QA7A 2UXBT 4QXCB 4C9BB 2Q9QA 2XZTG 2GK9A 1BI7B 2XZEA 4X1IE 5FYMA 3D9JA 4U0ZA 4YDYA 4UF0A 1SHZC 4YDOA 4X5TA 2G0UA 3Q75A 3J5PA 3EDVA 3AXJA 3HIZA 2K48A 4A56A 2J49A 2NOXA 1QUUA 1H19A 3LK3B 1O5MA 4G11A 3ISMC 3NZPA 4ISSA 4O4JE 4G25A 3O4XE 5HEJA 2XRYA 4RG6A 3EU5A 1YA0A 2LNIA 5AARA 3Q5EA 2KWIB 3Q5DA 3EHNA 2V7JA 3UUMA 2H6HA 4HFCA 3ASNE 3SO8A 2R17C 2BS3A 5FP3A 3AVSA 1IXVA 5LHIB 4JHRA 3RYHE 2WXPA 3RPUA 3LPZA 4YFSA 5AQJB 3ZU7B 2AXZA 3GZSA 3L9TA 1MIVA 4LF6T 3PUJA 3ZFWA 4DLOA 1OEDB 3APCA 3SWHA 3RIBA 5J90A 3V2XA 2N1GA 2YDSA 3N9QA 1UOHA 5J2UE 3RIFA 4COFA 2W61A 4K0KT 3UU4A 3EUHA 3EDUA 3PEUB 1XMQT 3CSTA 5FINA 2BS2A 3CX7B 3FEXA 3KDSE 2HN2A 2WXJA 4WW0A 5LGTB 2LOSA 3VU7H 2I1JA 3PE0A 2V8SE 4TXRA 4QFVA 4DBRA 4L1BA 3UTKA 5AQPB 3FTSA 3F57A 2KBXA 5ENQD 3N71A 2WPVA 3JXIA 3VRAA 4EBAA 2IIUA 2YDQA 1IBMT 4X64T 2KCLA 2VQ2A 4ILHB 1OWLA 2VYIA 4O4IE 3TG5A 4LG6A 3ZVVA 2P9IG 2FULA 2KCVA 3ONKA 4DRXE 2DZOA 4H9SE 1D0XA 1LD7A 5EKQD 5F3JA 3IHVA 5FXWA 1ZP0A 2VKDA 3CX6B 3FZFB 4BT8A 4A5XA 3L3PA 5AQSB 4JYAT 4XI9A 2ETAA 4DX5D 2ZISA 4GPKA 1SA5A 3PUVF 4QQIA 5ENNA 5KJNA 2DVWA 2EIJE 4H9QC 2ACZA 2WXNA 4WNDA 3BQLA 2CLYB 3Q4AB 5LMNT 5ENOD 3TWVA 5C3JA 4YSXA 3N9OA 3CVPA 3C72A 2WXRA 1LVFA 5FZSA 2J4GA 3MX3A 4I1OB 3E34A 4UQYA 3HA4A 4DR2T 3LDZA 4YDEA 1U3CA 3HG0D 3FFLA 5IYZE 2XY8B 5EX0A 3CVQA 3ULQA 2FO7A 3EU9A 3U66A 4LFCT 1OEDA 2YEVC 4TXQA 1IHGA 2BVLA 1BR1A 2IEJA 1W09A 3UUNA 2V5QC 2BKKB 3WG7E 5B1AE 4BESA 2CBJA 3KVAA 4IHJE 1MMGA 3T9KA 5FVKA 2PQRA 4O2BE 3AECA 3TWQA 2CXDA 2WDRA 2M6BA 3OYZA 4U33A 4HFDA 3GZ2A 5EYPF 3C50A 4YHJA 4Y6WA 1E7VA 4ZOLE 3UM1A 2NYJA 3NB2A 4WBNE 2WZIA 4YVQC 2XZDG 2Y3AA 1WCRA 2KATA 1KFYA 4B3RT 1X5BA 3N2GE 1XDPA 4PK4A 2BG9C 3ENEA 3KFWX 3I5PA 4WWPA 3OVUA 3ZSTA 3FZKB 1HS6A 3JCFA 2R5SA 2R59A 4U95D 3MJXA 1UUSA 2ZM0A 4G2VA 2IF4A 2LM9A 3HXBA 5ENRD 2KMFA 1QQEA 3LJ3A 4PJMA 3SD5A 3AAEB 3LYAA 5FY1A 5LHGB 2Y48B 4FLHA 4B8CB 2W2UA 4B3TT 3K8PC 2R2LA 4XIFA 1XNFA 4O1PA 3VHLA 1E8WA 5LCWJ 3ZPOA 4EPZA 4ATZD 2X6JA 4JHJA 3GN5B 1TYQG 3QARA 4JD2G 4AKHA 3JC6D 4DV1T 4DI3A 2MBGA 4AKRB 3OTOT 4U31A 3WI3A 1HE8A 2AVPA 1E8XA 4O2AE 2IAKA 2DZNA 3D9NA 2AXDS 4HWDA 4X1KE 3RGLA 3CR3A 4GTMA 4LF9T 5KXJA 3KAEA 5C2TA 5A1LA 2XS8A 1FJGT 3X1DA 3IEGA 1EZ3A 3M65A 3ZCIA 3AEGA 1OWNA 4L23A 3TGOA 4HWIB 4KUMB 3I3NA 4FU3A 5A23A 4I43A 1JWFA 3ABKE 3P50A 2XAGB 2UUAT 1V54E 2P9UG 3B7RL 1JCQA 3RIUC 3SHFA 3QK6A 1DNPA 5JR9B 3PH0C 3SFZA 1OEDC 2JPFA 1HZ4A 4GTQA 2J9QA 2LSGA 4B8AA 3AE2A 3AG1E 3S7BA 2ETBA 2X0LB 3ZSSA 3FTZA 3FU5A 2NXPA 4GTTA 4HFGA 4H63V 5AQNB 3G2UA 1HCIA 4H9PC 5HYAA 1Z3YA 3FXDB 2QZAA 5EK4A 2ES0A 4LEUA 3ONXA 2VL0A 4DR5T 2ZGGA 4ANWA 4ILBA 3LJCA 4DUIA 4DUYT 1DU2A 3FBLA 5C8YE 1IZNB 3V2OA 4C48B 3UU5A 3RKVA 3B5MA 2LOPA 3CLJA 5CERB 2H7OA 3TL5A 2V7MA 4L7TA 4ADZA 4EHMA 1HS7A 1MIYA 3IEEA 3BQKA 1YQ4A 3E33A 1HNWT 1WG0A 3WXXA 5T4YA 3MJWA 4GA1A 4HRNA 4N5CA 3AEEA 3X2QE 3VKHA 3OXLA 5DQWA 4JI0T 5FMNA 5BW8C 3HXCA 3ZYKA 5LG4A 3UIPC 2VJ8A 4AY5A 1TEZA 3UPVA 2XEEA 3L8RA 2LSUA 4IDNA 2QRXA 4O4HE 3ASOE 3T5XA 1EPUA 2J47A 4HEAA 1P5QA 5FZRA 2WCAA 3SY2A 2LT3A 3AS5A 3P1UA 4YDWA 2CLYC 2J8SD 1H2VC 2X67A 3H3AA 4U2YA 4AXPA 5LXTE 4AY6A 5AQHB 1WFDA 4FI5A 4LNBA 4JI6T 1OWAA 3ZRHA 4PFOA 2LKHA 2QY7A 3AJIA 3P4SA 2ZMAA 3ML8A 3NZSA 3FTYA 5AAOA 1MNEA 3B7SA 4NRHB 2C5KT 4HB5A 3D0TA 2OLTA 3DSXA 3EVYA 2X6IA 4Y6CA 2F8YA 3IV0A 2V1DB 2WU2A 2EINE 4AQFA 4F6RD 4N2QA 4OAUC 4B6XA 4JI8T 2ZM2A 4U2ZA 2VSNA 1DCEA 4XAXB 1TJCA 2J08A 2LO6A 3PZ4A 4GYOA 5EDSA 5FL1A 2X0HA 1BR2A 4YTNA 3UTMA 4GYSA 2XHEA 3CV0A 2WZHA 4G1TA 4TRQA 3AE5A 3ONLA 1W9RA 3ONJA 1YW0A 2W0GA 1H6OA 5BXUA 4IE5A 2VGXB 2V5CA 5LOZA 3TWSA 1EF1C 1UJJA 3TLWA 1JPLA 5DJQC 1INZA 4QX7B 4JV5T 5LX8A 2XQYA 3IF8B 1SA4A 1D9SA 5AQAA 5HXEA 3RIAA 1J5ET 4X1YE 3QB5K 1KNZA 3QNKA 1N54A 2C2LA 2ZU6B 4HGAA 2L9QA 5FL0A 2DHRA 3HL6A 5C2YA 1GW6A 4N39A 4A97A 2IOLA 4XI0A 4IDQA 1N32T 3L22A 4TUMA 4DX6D 3P4WA 3DXMG 3H3MA 3LG7A 4A1GA 1KPSB 4OYKA 2B76A 3I9WA 3DPDA 3FHEA 4K5BA 5HEUA 2BUGA 3CVYA 4E85A 4E7SA 5L3BB 2QC9A 2LSIA 1N36T 1QBQA 4ILAA 3AS4A 3O4ZA 3CVUA 2GRMA 3NBXX 4AJWA 2OVFA 4RQIA 1J1JA 3AE1A 1HG5A 4PFPA 3ZYMA 4HS2A 3FY4A 4YNDA 1SQMA 3MACA 2CM0A 4IDPA 3TWRA 1JUQA 4L2YA 2PBIA 3DSVA 4H9RC 4ZS3A 5J2TE 2WXIA 1TNYA 4AXHA 4IREA 2XCCA 3U3IA 2BBJA 3B57A 2P9PG 1H6PA 2SPCA 5ABHA 1WAO1 3H37A 5JR9C 5FXZA 2XPZA 4GZ3A 4GK0E 3ANWB 4BTAA 4AQFC 1OY3D 3QWPA 4L0RA 4CN6A 2W67A 2BF0X 3O1JA 1Z8UA 2WSSV 4GTOA 2ODUA 3TWWA 2MYSA 5A6CA 1NZNA 2FBWA 5H6QB 2XQ5A 4IE6A 3T8OA 2OVBA 2Q9QB 2JQHA 3E4BA 3V31A 3U4TA 3LFMA 3NOGD 2KZTA 1H6KA 3SZ7A 4LFBT 3CQCB 3ABLE 3BU8A 4OYJA 3HHMA 3MV3B 3ONLC 2JQQA 4UF0B 1TN8A 2IHR1 2MPKA 1KT1A 3FUIA 2VL8A 3RO3A 3RRUA 1CHUA 4I9CA 3QWVA 4F8HA 4ACKA 3AXJB 2A3DA 2ZLYA 1HXIA 3I4GA 2UXXB 1A5EA 1S35A 1YD8G 1D1AA 2XAHB 3RLFF 1AWCB 4YSYA 3C3QA 3AG4E 2OA5A 3PEVB 3C3RA 3M3ZB 5FTPA 1H0AA 3W9GA 1MIWA 4JEHA 4EGWA 3K3QC 5HAXA 2BBHA 3SFXA 5JDNA 2CHXA 1UW4B 2IU1A 2NTYA 4YSZA 4KBQA 4C0MA 3LK2B 2EHOA 3O1HA 3QWWA 5CGMA 4CDNA 3TLTA 4ILIA 4GKKT 1N4PA 5CCLA 4M7CA 3S7DA 5KX5E 4EBAG 4A98A 2ILRA 1D0ZA 3AVRA 3RU0A 2KSRA 4AIFA 4H63H 5ARFA 5L3CB 4NIQA 5JJ6A 4PH4B 1UX5A 2H3RA 3ZC0A 4GA0A 1FPPA 4ABNA 2PQNA 1N95A 3MV2B 3UUXA 5FXXA 1MQSA 2XSBA 4BAYB 4ZHBA 4J2CA 4LMKA 3RYFE 2E2EA 5DQVA 3E32A 3GYZA 2L3LA 2XAQB 3MGBA 4P0BA 2BS4A 4K5AB 4L2LA 2Z6EA 2WXKA 2LSKA 4PJLA 4UV9B 3QC1A 4LF7T 1G3NB 2XS1A 2VURA 3AE9A 3UT4A 4KMOA 2V5FA 4JA7A 1HU3A 1D8DA 2P2CP 3L08A 1N9AA 3T8KA 2Y1LE 3EIJA 3FTXA 4NURA 4WNFA 4UUCA 3AA6B 1TJFA 3CVVA 3AE4A 4MFRA 4CI2B 3LY8A 5CMYA 2IW5B 4LERA 2PM7A 4HNAD 4IL9A 1XNRT 2HHHT 4QXBB 2HM8A 4YVOA 3NWIA 2HPLA 2D5UA 2N9DA 4HI8A 4WNGA 3Q9NC 4UR9A 3PUGA 3NVOA 4UWHA 3AU5A 5JREA 5G05C 3RQWA 4GA2A 3AE3A 5FIOA 4DR3T 5LG3A 2CHOA 2PTFA 3GW4A 4CCAA 2PZIA 3EDTB 2ODVA 3PUKA 3LCAA 4D10C 2NSZA 5KJMA 3HKEE 3VTYA 3BK9A 4I55E 4U8VD 2FJAA 3ZMZB 1N52A 3ZT7A 3FU0A 3UX4A 5FQ4A 2DL1A 4A63B 4HE8A 4UVCB 2WMOA 3ZYLA 4BTBA 5FNVE 5LFAA 3EHMA 1EDUA 2CG2A 3ZMUB 3ASHA 3PURA 4OK0A 3ZJ1A 3HI2A 2I2OA 2CXFA 5L47A 4LMLA 4IN3B 3RQUA 2F0YA 4QWNB 4TV9E 3OJAA 3IHRA 5JJTA 4PS3A 5BXOA 1N4QA 4DV4T 3JQ0A 4LRZA 3ZC1A 4U8HA 3C64A 1E1HB 2XPIA 5BPPA 2RA1A 2VGEA 4AIUA 1TN6A 2L9BA 4NXMT 1D8EA 1N4SA 4LF5T 4LSZE 4HRMB 3R7RA 3CWZB 4TWFA 2XQAA 3AS8A 2JIWA 2DYSE 5HXHA 3EHRA 5AQLB 4DV7T 2BDEA 3EIQC 4QKNA 3B7TA 4DR4T 3PV0F 4GYWA 4MLPA 4BJNA 5JDQA 5AIJA 3BUAA 1MX4A 2HN1A 2VWAA 2AE9A 4DMWA 4ANUA 2PFVA 4DPRA 3EI0A 3ETUA 1ELKA 5CCMA 5AFUL 5IUXA 5DIZA 1ZV4X 5HXRA 3IHYA 5CRUA 5AENA 1LVKA 4JI7T 1OCZE 5ENTD 1N4RA 1O3XA 4GIWA 3RO2A 2X3MA 5JDLA 3RC8A 3FU6A 4IL4A 2Q9QC 3Q78A 4U7IA 3URZA 5F5WA 4IRUA 1UN8A 3CQXC 3RKOA 2P9NG 2A9UA 2LSJA 4U72A 2I1KA 4FHKA 4HOUA 4AEZC 5LBMA 3MKQA 2ZM6T 5HRYA 3UIOC 2QGSA 5HCMA 3UI2A 4MBQA 4AQGA 4CI3B 2VB6A 1G73A 4OVVA 3TAXA 4AM9A 2VTBA 2W62A 2BEDA 3ZPJA 3MZKB 5CMWA 1MX2A 1Y64B 1ZEEA 1ZKEA 5FWQA 2XGOA 4K0RA 3WAJA 1S70B 4N3CA 5AQGB 3UMVA 4YJ3E 3QAQA 3LXUX 2LLYA 1E8ZA 3PE4A 4URKA 5DABA 4I43B 2V7IA 5EZYE 4JL0A 3DSWA 2K5BB 4PW8A 5HEGA 4F7AA 2MOWA 4HLLA 2W66A 4CXWA 3UKUG 4I2WA 3KV6A 3ULEG 3EHQA 1W3BA 3B95A 3KBUA 2IQCA 2WWUA 4G26A 5A7DB 4HWHA 3C4WA 4HFBA 3CHQA 5EK3A 4GYYA 4YT0A 3IBEA 2E5LT 1X81A 3HYMB 3CX8B 1Z3XA 1IKND 2XRZA 1J5WA 3MEKA 3QKYA 3E37A 2WXGA 2K9AA 2JABA 3UKRG 4GZ5A 5T3RA 2NTXA 4UEMA 1E96B 3CVNA 4ILCA 4YXDA 4XE0A 4U63A 2UY1A 3CHSA 2FO1E 3KEAA 3LY7A 2WBLA 4JEUA 2WDQA 2WXQA 4UXNB 4EZ4A 4EECA 2V4HC 3ZW3A 3NZUA 3QB5A 5L3GB 1YKEB 3ZEFA 4Q25A 4CXYA 4HXIA 1NP7A 2QYJA 3PE3A 4KT6B 3RK6A 4EIWA 1OXZA 5AJDA 1O1SA 2MRIA 2X9WA 5IY5E 3OTNA 4IULA 2CHNA 2M63A 2HE0A 3TLSA 4U96D 1N94A 4FULA 1NI1A 2YINA 4KI0F 4TX5A 2B6CA 2C0SA 4HWCA 5LGNB 3I9YA 3UT5E 2A4ZA 3FZHB 2ONDA 2FI7A 4JB8P 2L6JA 1KNRA 4Q96A 5BV0A 2P58C 5FT9A 1LD8A 3Q79A 4DNDA 1KT0A 3ZMTB 2V5DA 3Q5XA 4BY6A 4E7ZA 3R9MA 2FEZA 3LVRE 3CVLA 3AAIA 5HWYA 4UI9C 2X0YA 3C4ZA 4CI1B 3JUEA 2Y69E 2XTLA 4YTPA 1H7CA 3GMIA 2D2SA 4UVAB 2A72A 4H7YA 1TNBA 4NPPA 4CT0A 5KBAA 3CMLA 4YJ2E 4DJAA 4C91A 3U9WA 1DC2A 3I0QA 4HFIA 3HKBE 3S2AA 3RYCE 2DCPA 2XPYA 1KK7A 1YKHB 5LGUB 3SGHA 2F8XK 3N2OA 1IJ6A 2MTQA 2WM9A 2X51A 3KV9A 3CVWA 2FJEA 4DR6T 1UN9A 3G2VA 5AQ7A 4XEIG 2X6FA 2WXFA 4LFAT 4KZCA 2XHEB 2L8KA 4I50E 2E9XD 1KNPA 3ZN1B 4ZS2A 3SBSA 4KZ0A 1US7B 3DXKG 3L6AA 2F4VT 2EIKE 3ZXPA 3P4RA 2UXCT 4QX8B 4RSYA 4X66T 3AEDA 3D9OA 4JVSA 4N5QA 3TG4A 2YDRA 2PM6A 2D0TA 5FQ8A 3I0OA 3FU3A 4PNIA 1VCSA 4J7WA 3GWHA 3TLUA 5LA6E 2I6HA 1W0BA 2RP4A 5FVLA 4EOZB 4I9EA 1KZPA 2VVSA 4DK5A 4ZFHA 4BX9A 2KZ7B 1BD8A 4CGVA 5CECB 3DSSA 4WNEA 3TWXA 2XQ4A 2OV8A 3ZHEA 1U4QA 5L2LA 3G2SA 4RVBA 3AEBA 1MNDA 4G8KA 5HS0A 5HKPA 3ML9A 4J6IA 3MA9A 2P9KG 2BKNA 3PTRB 2L6BA 5BNWA 4HKAA 4MHCA 5LHHB 5AJLA 4IT4A 4OX9T 3ZUVB 2R6GF 3CGHA 4IYPA 2EILE 5AQFB 1FIOA 2RKKA 4O4LE 4QXHB 3NF1A 4O8SA 5JH7E 3ZT6A 5JHBA 1UX4A 3BQOA 2B1EA 5H7PA 4XBFB 4GAAA 3RKGA 3F2EA 1HO8A 3UXGA 3RYIE 1HG2A 4B94A 3MKRA 5EN5D 3APDA 4OFZA 4P0AA 2ZXWE 4UV8B 5LP6E 2B0OE 4TZ4C 2Y4UA 3LBXA 5BR8T 4UI9K 5EIBE 4F53A 4EB6E 5LNKA 2V7KA 3P8CD 3CIRA 5EYLA 4AISA 2YNQA 2MHKA 2VKJA 3IA3A 5BV1A 4PAGA 2YHEA 4IDOA 3P4PA 3N9NA 4J8EA 4DV3T 1N11A 2LXLA 5AQQB 1FCHA 2XQ3A 5JRCA 2AXUA 3QJZA 2JQ9A 1R8IA 5BT1A 3ESLA 3PDNA 4HTEA 2NW8A 3AEFA 5ABEA 3O48A 1M7KA 4K03A 3FB2A 2E9XA 2DLRA 1FMVA 2VASA 2KZTB 3FUNA 2J62A 4HOSA 3VR9A 2IO3C 2GROB 2BG9E 4GU5A 2BTDA 4DIDB 1N33T 3N9PA 3J7Yq 4Q69A 5CFBA 1OCRE 1O1RA 5AQTB 4ME2A 5JA4D 1SW6A 5H6RB 5TAOA 5JQGE 4UWLA 5AQOB 2AW6A 4P1NA 2Y4TA 5KNGA 2FBNA 3PRZA 2YHCA 1IHBA 3AG2E 2RFMA 3EAMA 4CXXA 4BT9A 3K9IA 3KS2A 4JEHB 3PJAA 2CMRA 3IXEA 1HH8A 3Q5MA 1QNFA 4FJYA 1LF8A 1UJKA 4G24A 4X8QA 1E2AA 4I1MA 3CHPA 3MZLB 3PZ1A 1N0QA 4WAFA 5HCJA 1ZBPA 3HKDE 2EHOB 3HXDA 5E76A 2X68A 5HEOA 3C4XA 1BU9A 2YQ8A 4JPSA 1ZHCA 4LMJA 4FADA 2XJ7A 2GRPB 3KBTA 2KC7A 5ANRA 3FP3A 2AXVA 1WM5A 4V3IA 1D0YA 4G23A 5IHYA 2KXPB 1TNZA 2C5IT 1WRDA 3SF4A 3DP7A 3UUXB 3CPZA 2P9LG 3RJVA 1S94A 5J08A 2W00A 2XQ7A 4GZDA 3Q73A 4ANVA 4EZHA 3OPCA 5G05J 3CIAA 4DMVA 2I59A 3VLFA 5G2NA 1D1CA 3NRYA 1Y8MA 5JDFA 5KWDA 2X6HA 3CKBA 2DCFA 3E22E 2WMNA 2V8SV 5CHEE 1BR0A 4I6GA 5AQUB 4DX7D 4EZJA 3RX6A 3NKZA 2VSXE 3FHNA 4I4TE 3RHWA 1IAPA 1HF8A 2JQKA 4JHKA 2X66A 2WAUA 2Y8DA 1U2VG 5JTGA 2CHZA 4FC8A 3KD7A 2BKOA 4CGWA 5M72A 3CHMA 3Q47B 1HX1B 4F1PA 2Q9QD 2YN6A 3LK42 4TV3A 2V6YA 4OHFA 5CEAA 2GGFA 3QOUA 3CQGB 1DVPA 2WY2A 3HVEB 2H6GA 2XCBA 5FY7A 3U3WA 4BERA
chains in the Genus database with same CATH topology
1V9DA 1U3DA 2KT9A 4I1AA 2LSVA 3FUJA 4TUYE 5E75A 4N78D 2WXMA 1B89A 4TV8E 2VK9A 5FZQA 4L5GA 2JMHA 2NP9A 3RRMB 3E0ZA 4A3TA 5HXSA 5L3EB 4HOQA 3T8MA 2NW9A 1E7UA 4AVXA 2CWOA 5HQ8A 4WUYA 2KNDA 2LAIA 2YK0A 2I9CA 3OBVE 4PS8A 3FTVA 3BG1B 2LEHA 3AAAB 3FWVA 4NUVA 3FUHA 3CKDA 3DJBA 3PUAA 3A5XA 1SA0E 1NA0A 4NACA 3U78A 2VGYA 2CXLA 3ASGA 3D3MA 2CA5A 4ILGA 4UIGA 3PREA 5ETWA 2RG8A 3FULA 3CHRA 2UXNB 1WYBA 4P29A 2Y6XA 5HXCA 4F6RC 3Q15A 4AKIA 4XKCA 3P7IA 4LUNU 4JW1A 2YU2A 2NWBA 1OWOA 5G04J 4RG9A 1VDYA 4JLEA 1IJ5A 3HVEA 2WVIA 4U0UA 3D9KA 3OKQA 2LSYA 1KLXA 3N5LA 1XGWA 2VSOE 5DBKA 1G8XA 4ANJA 4IE0A 3MKQB 4XKBA 3GZ1A 4C0EA 3FUMA 3MXZA 5JJ7A 2Q7FA 3KEZA 4CRWA 4IE7A 2OOEA 2L0IA 3MKDA 1Z6TA 2VTBB 3CK8A 1U5PA 4HN9A 1HFAA 4CQIA 4I2ZA 3IKOB 4JUYA 4JC8A 1IQRA 2EHOC 2DNXA 4UELA 3PNTB 4U04A 3VLEA 4KMCA 4BA9A 2EQXA 2J07A 5JVDE 4IDZA 1HTJF 2X9XA 5GONE 2N2NA 5L3DB 2XASB 5C1DA 4H9NC 3ETVA 5LJNA 4GCOA 4ZI3C 4ANXA 2CEAA 4AP2A 1PY1A 4MRUA 3KV5A 4J0UA 4YLHA 3FTUA 4BSXA 3UFEA 3UT8A 5LCYA 3PUSA 4UQZA 2W63A 2HPJA 4CEMA 3NQPA 2C0LA 2IFUA 2E0IA 4HORA 3LVQE 2JMKA 5BMVE 4OVUA 3RC3A 3CHOA 4XZCA 2UY1B 5D0OD 1NAFA 3ZN0B 2DWKA 3ESKA 4JEUB 4NQ0A 2YU1A 2CCQA 3AA0B 1WR6A 3ZEFB 3Q49B 3QC9A 3FTWA 3QDNA 3PVLA 4UI9J 2LJLA 3MCXA 2VSYA 3APFA 4ISTA 1H2UA 1T98A 5BUZA 2ZM8A 4HLEA 4JZYA 1D1BA 1ZU2A 3TJPA 4APOA 4KYOB 1FVHA 3PNLB 2KINB 4HVBA 4TN7B 2CFZA 4EZLA 4AV7A 3RRNB 3L09A 3D9LA 3OAWA 3FH5A 5ANLA 4XX5A 4Q94A 5G04C 4H7XA 3B13A 3C51A 3EJNA 3FH7A 3ZGQA 4BX8A 3FUFA 4DVDA 3CVXA 4F1SA 2DIWA 3FUDA 4WNKA 4IE4A 3V5SA 4C90A 1L5JA 4G2AA 3PZDA 5LJMA 3SOLA 2CFUA 3FDHA 2KCKA 4MLKA 2X6KA 1IYGA 4CDMA 2GRLA 4KVMA 3BEEA 1UG3A 5KMGP 5KJLA 3C98B 3RH3A 5JDHA 1ELWA 2KWHA 4H9OC 2XEVA 4J8FA 3SNXA 4ZI2C 4X20E 2LHRA 2V7LA 3FH8A 4UVBB 3R7QA 3D9PA 2C5JA 3MK7C 4GMJA 3B7UX 2BVMA 3VTXA 3Q5WA 3HR0A 4JA9A 4I6EA 5JDGA 4UQXA 4FJZA 1FVFA 4PJNA 4WWNA 4W9RA 3MYVA 4PK5A 3CKCA 3G2WA 2VKOA 3KVBA 3R6NA 3I1AA 3ZHEB 1BPOA 3CEQA 4AKGA 5FJYA 4CDRA 4AI6A 1WLXA 2IC9A 1BR4A 2XGSA 3AU4A 1NA3A 4J8SA 4BWRA 2PG8A 4GZ6A 4M1PA 4APFA 5ARGA 2XAJB 2CHWA 4AOFA 5D0QD 1MMAA 5L3FB 4BJMA 2XUEA 3PS6A 3S7JA 4KBMB 5KCMA 3PU8A 3R84B 2DWGA 5FQ7A 3LBXB 4EAHA 1H2TC 3C98A 1QSDA 5T8IA 4K0UA 1FEWA 1Z0PA 4MKTA 2QFCA 3ZN3A 5JRCB 3ZIMA 2PL2A 3JQ1A 4JXTA 1JWGA 4IGUA 2XGMA 3ZYQA 4EYYR 5JHAA 2E9XB 1SZ9A 5E0OA 5KJKA 4Z8XA 4G63A 4OYSA 3S4UA 4PK6A 3QUJA 5F8PA 4GOUA 3P2BA 2BZBA 3N2KE 2X9YA 4FP7A 5FXVA 1CUNA 3I4RB 1S0PA 1LKXA 4GK5E 3UULA 4B0ZA 2WXOA 2M67A 3PU3A 3FXEB 3HDXA 2D0UA 1X79A 1WYCA 2FF4A 4N3BA 4KVOA 3GN5A 2L0TB 1OWPA 4FA6A 3JCKC 4EXTA 3AA7B 4FLBA 2CE7A 4ASKA 2E8IA 1PC2A 2HYZA 3RRCA 2UWJG 3D9IA 1MHQA 4MALA 5EX3A 2RD0A 2C0MA 3OXFA 4PDXA 4MS6A 3L54A 3L16A 3N9MA 2KLQA 4ATGA 3ZMVB 2WB2A 4WWOA 1FMWA 3TKLB 4I6JA 3SRZA 4UWKA 2WQ7A 2A5UA 3QB2A 1IQUA 5JDMA 5CA1E 5LCWC 2J1DG 1NWMX 5JR9A 1E90A 1WY6A 4U74A 3ZCJA 1SZAA 4GCNA 3J9X1 3Q9DA 3IBPA 2DI4A 4ZI7E 3BQIA 1QZ2A 5LBQB 4N2SA 3LS8A 4DBQA 2JEKA 2LHNA 4ACLA 4BFRA 3ZMSB 2V0PA 4E6HA 2J4BA 3G2TA 4WBOA 3ZJ2A 3K3OA 4EYUA 5ADXL 4EQFA 4J8DA 4U0SA 3K3NA 4AKLA 2V4LA 4P09A 2WQHA 3R9AB 4DI4A 4DLQA 2JLBA 4B89A 1HX8A 3ZLIA 4HOTA 4CZZB 1OUVA 3OXGA 4UWGA 5CA0E 4GZCA 4F3VA 4PJJA 2IJGX 3UQ3A 2K24A 1LRZA 4L9IA 4R7LA 2EHOD 1E8YA 5FQ6A 3DBSA 3RRWA 3CVRA 3KINB 3SI5A 3JC6C 1MMDA 2LE8A 2MOZA 5LOVE 4N3AA 3CSFA 4FHJA 3S7FA 3FEYA 3Q2MA 3O9XA 1PAQA 2NC9A 4QHOA 4ZI3D 3LEWA 5J1GA 1ELRA 4LCTA 4IIJE 4CT4A 3VLDA 3VKGA 4ILUA 5FY0A 3QK0A 4M3OA 3ASDA 3F31A 3L13A 4HFVA 3JUIA 5HWXA 5AYWD 3W15B 1A17A 2HH7A 3ASFA 3BG0B 3SS1A 3NZQA 3E08A 4I17A 3PUQA 2JJ9A 5G55A 3NRXA 5HI7A 3TXNA 2PJQA 3U64A 4NUUA 2KM4A 3HKCE 2E9XC 2XQ0A 2VGXA 2HR2A 4A3VA 3TXMA 2A2FX 2JRKA 5CB4E 4DO0A 5LP0A 3T5VA 2X38A 4ZHQE 3L17A 5LYJE 4UWFA 5KDMC 3WAKA 4V1Av 2WQ6A 2IC6A 2CG3A 4GMLA 2H7VC 3AA1B 4FJOA 4ERRA 2HO1A 2J09A 3LKUA 3OYXA 3CK9A 5M4YA 2IOSA 4GB9A 3GA8A 1UCUA 3FUEA 2LAHA 3JYSA 3FBZA 3DTOA 2XAFB 3KV4A 3CK7A 1Y6IA 2GW1A 4GYRA 4XZ4A 2ACXA 3V5UA 1AJ3A 4PS7A 2AWIA 2WXHA 4A1SA 2V26A 4ZI2D 3UT7A 4PUCA 1VOMA 3PDYA 2J4DA 1OWMA 2WXLA 3LY9A 3O1IA 3AB3B 3N9LA 4TUUA 1VRBA 2P9BA 3FUKA 1MMNA 3MA5A 2X9HA 2DBAA 3ZXSA 2VKHA 2CWYA 4KXKB 4EZKA 3ANWA 3SBTB 1EYHA 4U07A 3D9MA 2IONA 2NW7A 4KP3C 4O6FA 5EK2A 4A55A 1B7TA 2QA7A 4QXCB 4C9BB 2Q9QA 2GK9A 4X1IE 5FYMA 3D9JA 4U0ZA 4UF0A 1SHZC 2G0UA 3EDVA 3HIZA 2K48A 4A56A 2J49A 2NOXA 1QUUA 1H19A 3LK3B 4G11A 3NZPA 4ISSA 4O4JE 4G25A 3O4XE 2XRYA 4RG6A 1YA0A 2LNIA 2KWIB 3EHNA 2V7JA 3UUMA 2R17C 5FP3A 3AVSA 5LHIB 4JHRA 3RYHE 2WXPA 3RPUA 3LPZA 4YFSA 2AXZA 3GZSA 1MIVA 3PUJA 3ZFWA 4DLOA 3APCA 3SWHA 3RIBA 5J90A 2N1GA 3N9QA 5J2UE 2W61A 3EUHA 3EDUA 3PEUB 3CSTA 3CX7B 3FEXA 3KDSE 2WXJA 4WW0A 5LGTB 2LOSA 3VU7H 2I1JA 3PE0A 2V8SE 4QFVA 4DBRA 4L1BA 3UTKA 3FTSA 3F57A 3N71A 2WPVA 4EBAA 2KCLA 2VQ2A 3TG5A 4ILHB 1OWLA 2VYIA 4O4IE 3ZVVA 2FULA 2KCVA 3ONKA 4H9SE 1D0XA 5EKQD 5F3JA 3IHVA 5FXWA 2VKDA 3CX6B 4BT8A 3L3PA 4XI9A 4GPKA 5ENNA 5KJNA 4H9QC 2WXNA 4WNDA 3BQLA 2CLYB 3Q4AB 3N9OA 3CVPA 2WXRA 1LVFA 5FZSA 3MX3A 4I1OB 4UQYA 3HA4A 3LDZA 1U3CA 3FFLA 5IYZE 5EX0A 3CVQA 3ULQA 2FO7A 3U66A 2YEVC 1IHGA 2BVLA 1BR1A 3UUNA 3KVAA 4IHJE 1MMGA 2PQRA 4O2BE 2CXDA 3OYZA 3GZ2A 3C50A 4YHJA 4Y6WA 1E7VA 4ZOLE 4WBNE 4YVQC 2Y3AA 2KATA 1X5BA 3N2GE 4PK4A 3ENEA 3KFWX 3I5PA 4WWPA 1HS6A 2R5SA 2R59A 3MJXA 4G2VA 2ZM0A 2IF4A 2LM9A 2KMFA 1QQEA 3LJ3A 4PJMA 3SD5A 3AAEB 3LYAA 5FY1A 5LHGB 2Y48B 4FLHA 4B8CB 3K8PC 4XIFA 1XNFA 3VHLA 1E8WA 5LCWJ 3ZPOA 4EPZA 2X6JA 4JHJA 3GN5B 3QARA 4AKHA 3JC6D 4DI3A 2MBGA 4AKRB 3WI3A 1HE8A 2AVPA 1E8XA 4O2AE 2IAKA 3D9NA 4X1KE 3CR3A 3KAEA 5A1LA 3IEGA 1EZ3A 3M65A 3ZCIA 1OWNA 4L23A 3TGOA 4KUMB 3I3NA 4FU3A 5A23A 4I43A 1JWFA 2XAGB 3B7RL 3SHFA 3QK6A 1DNPA 5JR9B 3PH0C 3SFZA 2JPFA 1HZ4A 2J9QA 2LSGA 4B8AA 3S7BA 2X0LB 3FTZA 3FU5A 2NXPA 4HFGA 4H63V 3G2UA 1HCIA 4H9PC 5HYAA 1Z3YA 3FXDB 5EK4A 2ES0A 4LEUA 3ONXA 4ANWA 3LJCA 3FBLA 5C8YE 1IZNB 3RKVA 2LOPA 3CLJA 2H7OA 3TL5A 2V7MA 4L7TA 4ADZA 1HS7A 1MIYA 3IEEA 3BQKA 3WXXA 5T4YA 3MJWA 4GA1A 4N5CA 3VKHA 3OXLA 5DQWA 5FMNA 5BW8C 4AY5A 3ZYKA 5LG4A 2VJ8A 1TEZA 3UPVA 2LSUA 4O4HE 3T5XA 1EPUA 4HEAA 1P5QA 5FZRA 2LT3A 3AS5A 3P1UA 2CLYC 1H2VC 2X67A 3H3AA 5LXTE 4AXPA 4AY6A 4FI5A 1OWAA 3ZRHA 4PFOA 2QY7A 2ZMAA 3ML8A 3NZSA 3FTYA 1MNEA 3B7SA 4NRHB 2C5KT 3D0TA 3EVYA 2X6IA 4Y6CA 3IV0A 2V1DB 4AQFA 4N2QA 4B6XA 2ZM2A 2VSNA 4XAXB 1TJCA 2J08A 2LO6A 4GYOA 5EDSA 1BR2A 4GYSA 2XHEA 3CV0A 4G1TA 4TRQA 3ONLA 1YW0A 2W0GA 4IE5A 2VGXB 5LOZA 1EF1C 1UJJA 1JPLA 5DJQC 1INZA 4QX7B 5LX8A 2XQYA 3IF8B 5HXEA 4X1YE 1KNZA 3QNKA 1N54A 2C2LA 2ZU6B 4HGAA 2L9QA 2DHRA 3HL6A 5C2YA 1GW6A 4N39A 2IOLA 4XI0A 3L22A 4A1GA 3LG7A 4OYKA 3I9WA 3DPDA 3FHEA 2BUGA 3CVYA 4E85A 4E7SA 5L3BB 2LSIA 3AS4A 3O4ZA 3CVUA 2GRMA 3NBXX 4AJWA 2OVFA 1HG5A 4PFPA 3ZYMA 4HS2A 3FY4A 4YNDA 1SQMA 3MACA 2CM0A 1JUQA 4L2YA 2PBIA 4H9RC 4ZS3A 5J2TE 2WXIA 4AXHA 2XCCA 3U3IA 3B57A 2SPCA 1WAO1 3H37A 5JR9C 5FXZA 2XPZA 4GZ3A 4GK0E 3ANWB 4BTAA 4AQFC 3QWPA 4L0RA 2BF0X 3O1JA 2WSSV 2ODUA 2MYSA 5A6CA 1NZNA 5H6QB 4IE6A 3T8OA 2OVBA 2Q9QB 3E4BA 3U4TA 3LFMA 3SZ7A 2KZTA 1H6KA 3CQCB 3HHMA 4OYJA 3MV3B 2JQQA 4UF0B 3FUIA 1KT1A 2VL8A 3RO3A 3RRUA 4I9CA 3QWVA 4ACKA 2A3DA 2ZLYA 1HXIA 3I4GA 2UXXB 1S35A 1YD8G 1D1AA 2XAHB 2OA5A 3PEVB 5FTPA 1H0AA 1MIWA 4JEHA 3K3QC 5HAXA 5JDNA 2CHXA 1UW4B 2IU1A 2NTYA 4KBQA 4C0MA 3LK2B 2EHOA 3O1HA 3QWWA 4CDNA 4ILIA 5CCLA 3S7DA 5KX5E 4EBAG 2ILRA 1D0ZA 3AVRA 3RU0A 4AIFA 4H63H 5ARFA 5L3CB 5JJ6A 4PH4B 1UX5A 2H3RA 3ZC0A 4GA0A 4ABNA 2PQNA 3MV2B 3UUXA 5FXXA 1MQSA 4BAYB 4J2CA 3RYFE 2E2EA 5DQVA 3GYZA 2L3LA 2XAQB 3MGBA 4P0BA 4L2LA 2Z6EA 2WXKA 2LSKA 4PJLA 4UV9B 3QC1A 3UT4A 4KMOA 2V5FA 4JA7A 1HU3A 3L08A 3EIJA 3FTXA 4NURA 4WNFA 3AA6B 1TJFA 3CVVA 4MFRA 4CI2B 3LY8A 5CMYA 2IW5B 4LERA 2PM7A 4QXBB 2HM8A 4YVOA 2HPLA 2D5UA 2N9DA 4WNGA 3PUGA 4UWHA 3AU5A 5JREA 5G05C 4GA2A 3GW4A 4CCAA 2PZIA 3EDTB 2ODVA 3PUKA 3LCAA 4D10C 2NSZA 5KJMA 3HKEE 3VTYA 3BK9A 4I55E 3ZMZB 1N52A 3FU0A 3UX4A 5FQ4A 4HE8A 4UVCB 2WMOA 3ZYLA 4BTBA 5FNVE 5LFAA 3EHMA 1EDUA 2CG2A 3ZMUB 3ASHA 3PURA 4OK0A 3ZJ1A 3HI2A 2I2OA 2CXFA 4IN3B 4QWNB 4TV9E 3OJAA 3IHRA 5JJTA 4PS3A 3JQ0A 4LRZA 3ZC1A 4U8HA 3C64A 1E1HB 2XPIA 5BPPA 2RA1A 2L9BA 3R7RA 3CWZB 3AS8A 5HXHA 2BDEA 3EIQC 4QKNA 3B7TA 4GYWA 4MLPA 4BJNA 5JDQA 5AIJA 2VWAA 4DMWA 4ANUA 2PFVA 4DPRA 3ETUA 1ELKA 5CCMA 5AFUL 5DIZA 1ZV4X 5HXRA 3IHYA 5AENA 1LVKA 1O3XA 4GIWA 3RO2A 2X3MA 5JDLA 3RC8A 3FU6A 2Q9QC 3URZA 4IRUA 1UN8A 3CQXC 3RKOA 2LSJA 4U72A 2I1KA 4FHKA 4HOUA 4AEZC 5LBMA 3MKQA 2QGSA 4MBQA 4AQGA 4CI3B 2VB6A 1G73A 4OVVA 3TAXA 4AM9A 2VTBA 2W62A 3ZPJA 3MZKB 5CMWA 1Y64B 1ZEEA 1ZKEA 5FWQA 2XGOA 4K0RA 3WAJA 4N3CA 3UMVA 4YJ3E 3QAQA 3LXUX 1E8ZA 3PE4A 4URKA 5DABA 4I43B 2V7IA 5EZYE 4JL0A 2K5BB 4PW8A 4F7AA 2MOWA 4CXWA 4I2WA 3KV6A 1W3BA 3KBUA 2IQCA 2WWUA 4G26A 5A7DB 3C4WA 3CHQA 5EK3A 4GYYA 3IBEA 3HYMB 3CX8B 1Z3XA 2XRZA 3MEKA 3QKYA 2WXGA 2K9AA 4GZ5A 5T3RA 2NTXA 4UEMA 1E96B 3CVNA 4XE0A 4U63A 2UY1A 3CHSA 3LY7A 2WBLA 4JEUA 2WXQA 4UXNB 4EZ4A 4EECA 3ZW3A 3NZUA 5L3GB 1YKEB 3ZEFA 4CXYA 4HXIA 1NP7A 3PE3A 4KT6B 3RK6A 4EIWA 1OXZA 5AJDA 2MRIA 2X9WA 3OTNA 4IULA 2M63A 4FULA 2YINA 4TX5A 2C0SA 5LGNB 3I9YA 3UT5E 2A4ZA 2ONDA 2FI7A 2L6JA 4Q96A 5BV0A 2P58C 5FT9A 4DNDA 1KT0A 3ZMTB 3Q5XA 4BY6A 4E7ZA 2FEZA 3LVRE 3CVLA 3AAIA 5HWYA 4UI9C 3C4ZA 4CI1B 2XTLA 1H7CA 3GMIA 2D2SA 4UVAB 2A72A 4H7YA 4CT0A 3CMLA 4YJ2E 4DJAA 4C91A 3U9WA 3I0QA 3HKBE 3S2AA 3RYCE 2XPYA 2DCPA 1KK7A 1YKHB 5LGUB 3SGHA 3N2OA 1IJ6A 2MTQA 2WM9A 2X51A 3KV9A 3CVWA 1UN9A 3G2VA 2X6FA 2WXFA 4KZCA 2XHEB 2L8KA 4I50E 2E9XD 3ZN1B 4ZS2A 3SBSA 4KZ0A 1US7B 3L6AA 4QX8B 4RSYA 3D9OA 4JVSA 3TG4A 2PM6A 2D0TA 5FQ8A 3I0OA 3FU3A 4PNIA 3GWHA 5LA6E 2RP4A 2I6HA 4EOZB 4I9EA 4DK5A 4BX9A 2KZ7B 4CGVA 4WNEA 2OV8A 3ZHEA 1U4QA 5L2LA 3G2SA 4RVBA 1MNDA 3ML9A 4J6IA 3MA9A 3PTRB 5BNWA 4HKAA 4MHCA 5LHHB 5AJLA 3CGHA 4IYPA 1FIOA 4O4LE 4QXHB 3NF1A 4O8SA 5JH7E 5JHBA 1UX4A 2B1EA 4XBFB 4GAAA 3F2EA 1HO8A 3RYIE 1HG2A 4B94A 3MKRA 3APDA 4OFZA 4P0AA 4UV8B 5LP6E 4TZ4C 2Y4UA 3LBXA 4UI9K 4F53A 4EB6E 5LNKA 2V7KA 3P8CD 2YNQA 2MHKA 2VKJA 5BV1A 4PAGA 2YHEA 3N9NA 4J8EA 1FCHA 5JRCA 2AXUA 3QJZA 5BT1A 3ESLA 3PDNA 4HTEA 2NW8A 3O48A 4K03A 3FB2A 2E9XA 2DLRA 1FMVA 2VASA 2KZTB 3FUNA 4HOSA 4GU5A 2BTDA 3N9PA 3J7Yq 4Q69A 4ME2A 5H6RB 5TAOA 5JQGE 4UWLA 2AW6A 2Y4TA 2FBNA 3PRZA 2YHCA 4BT9A 4CXXA 3K9IA 3KS2A 4JEHB 2CMRA 1HH8A 3Q5MA 1QNFA 4FJYA 1LF8A 1UJKA 4G24A 4I1MA 3CHPA 3MZLB 4WAFA 1ZBPA 3HKDE 2EHOB 5E76A 2X68A 3C4XA 2YQ8A 4JPSA 1ZHCA 4FADA 3KBTA 2KC7A 5ANRA 3FP3A 2AXVA 1WM5A 4V3IA 1D0YA 4G23A 5IHYA 2KXPB 2C5IT 1WRDA 3SF4A 3DP7A 3UUXB 3CPZA 3RJVA 1S94A 5J08A 2W00A 4GZDA 4ANVA 4EZHA 5G05J 3CIAA 4DMVA 2I59A 3VLFA 5G2NA 1D1CA 3NRYA 1Y8MA 5JDFA 2X6HA 3CKBA 2DCFA 3E22E 2WMNA 5CHEE 1BR0A 4I6GA 4EZJA 3RX6A 2VSXE 3FHNA 4I4TE 1IAPA 1HF8A 4JHKA 2X66A 2WAUA 2Y8DA 2CHZA 4FC8A 3KD7A 4CGWA 5M72A 3CHMA 3Q47B 2Q9QD 3LK42 4TV3A 4OHFA 2GGFA 3QOUA 3CQGB 1DVPA 3HVEB 2XCBA 5FY7A 3U3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9N A;  1JUQ A;  2QY7 A;  2L0T B;  5J08 A;  1H0A A;  2L0I A;  4NAC A;  1X5B A;  1EYH A;  4Q94 A;  3D9M A;  4GZD A;  1HF8 A;  3CLJ A;  1ELK A;  4GZC A;  1JWG A;  4JXT A;  5LP0 A;  1VDY A;  3ONK A;  4FLB A;  3G2T A;  3ZYL A;  4Q96 A;  3ZYQ A;  1HFA A;  2DIW A;  3D9P A;  3G2S A;  3D9O A;  3ONL A;  2DCP A;  4HFG A;  1PY1 A;  1HG2 A;  1SZ9 A;  2MOW A;  2V8S E;  3D9K A;  1EDU A;  3G2U A;  3G2W A;  3D9I A;  1XGW A;  4FU3 A;  1SZA A;  3RRU A;  5CMW A;  1MHQ A;  1JWF A;  3G2V A;  5CMY A;  5LOZ A;  1HG5 A;  1DVP A;  3D9J A;  3LDZ A;  1UJJ A;  2KM4 A;  3ZYM A;  1JPL A;  2BF0 X;  1LF8 A;  1HX8 A;  1UJK A;  4AVX A;  1INZ A;  3D9L A;  3ZYK A;  2LO6 A; 
#chains in the Genus database with same CATH topology
 1T72 A;  1V9D A;  1U3D A;  2V6X A;  2KT9 A;  4I1A A;  2LSV A;  3FUJ A;  4TUY E;  5E75 A;  3JAF A;  4N78 D;  2WXM A;  4GTR A;  3JAD A;  5ABF A;  3HRA A;  1B89 A;  3VRB A;  4TV8 E;  2VK9 A;  5ENP D;  5FZQ A;  5JMN D;  4WZX A;  4NIK A;  4L5G A;  2JMH A;  2NP9 A;  3RRM B;  3E0Z A;  4A3T A;  5HXS A;  3V30 A;  2OV9 A;  5CBO A;  5L3E B;  4HOQ A;  3T8M A;  4KX6 A;  2NW9 A;  1E7U A;  4AVX A;  2CWO A;  5HQ8 A;  1K1A A;  4WUY A;  2KND A;  4EEB A;  2LAI A;  2YK0 A;  2I9C A;  1XZY A;  3OBV E;  1OCO E;  2YOE A;  4PS8 A;  2XSA A;  3FZL B;  3FTV A;  1Y01 A;  2QYW A;  2LEH A;  3AAA B;  3BG1 B;  3FWV A;  1BLX B;  3F6Q A;  4NUV A;  3FUH A;  3CKD A;  3A8Y C;  4TNV A;  3DJB A;  3PUA A;  3A5X A;  1SA0 E;  1NA0 A;  4NAC A;  3U78 A;  2VGY A;  2CXL A;  1KZO A;  3ASG A;  3D3M A;  2CA5 A;  2NR4 A;  4ILG A;  4UIG A;  3PRE A;  5ETW A;  2RG8 A;  3FUL A;  3CHR A;  3CK6 A;  4HBD A;  2CRB A;  5CBN A;  2UXN B;  1WYB A;  3ZNG A;  4P29 A;  1Z5S C;  2Y6X A;  5HXC A;  4F6R C;  3Q15 A;  3UU8 A;  4AKI A;  4XKC A;  2A5E A;  3L82 A;  3P7I A;  4LUN U;  3TWU A;  1XMO T;  5CRV A;  4JW1 A;  2YU2 A;  4OAV B;  3T1Y T;  3ZKJ A;  5ABG A;  2NWB A;  1NEN A;  1OWO A;  5G04 J;  1O1T A;  1FT2 A;  4B3S T;  4RG9 A;  1VDY A;  4JLE A;  1IJ5 A;  3HVE A;  2WVI A;  3VR8 A;  4JI2 T;  1DCQ A;  3QNU A;  4U0U A;  2WB5 A;  3D9K A;  3OKQ A;  2LSY A;  1KLX A;  4GTP A;  3N5L A;  1XGW A;  2R03 A;  2VSO E;  5DBK A;  1G8X A;  4ANJ A;  4IE0 A;  1N34 T;  3MKQ B;  4XKB A;  3GZ1 A;  4C0E A;  3FUM A;  3MXZ A;  5FKY A;  4JBW F;  5JJ7 A;  3UM0 A;  2Q7F A;  3JXJ A;  3KEZ A;  4CRW A;  4IE7 A;  2OOE A;  5ENS D;  2L0I A;  3MKD A;  1Z6T A;  2VTB B;  3CK8 A;  1U5P A;  4HN9 A;  5L4E A;  1HFA A;  4CQI A;  1YYH A;  4I2Z A;  2I0M A;  4HFE A;  3IKO B;  4JUY A;  4QH5 A;  1IQR A;  2EHO C;  2FJB A;  2LRL A;  2DNX A;  4JC8 A;  4UEL A;  3PNT B;  4U04 A;  3VLE A;  4KMC A;  4BA9 A;  2EQX A;  2J07 A;  1MYO A;  3SFY A;  4QH1 A;  2IY0 C;  1YXR A;  5JVD E;  4IDZ A;  1LTX A;  2AJA A;  4DUZ T;  1HTJ F;  2X9X A;  5GON E;  5L4H A;  2N2N A;  5L3D B;  2XAS B;  5C1D A;  4H9N C;  3ETV A;  5LJN A;  2KXP C;  4GCO A;  4CZ2 D;  4ZI3 C;  4ANX A;  2CEA A;  4AP2 A;  4L9P A;  1PY1 A;  4MRU A;  3KV5 A;  4J0U A;  4YLH A;  3FTU A;  2IO2 C;  4BSX A;  3UFE A;  5AQV B;  2WWV A;  4DX2 A;  3UT8 A;  5LCY A;  3TLV A;  3PUS A;  4UQZ A;  2W63 A;  3KSQ A;  2HPJ A;  4CEM A;  3NQP A;  2C0L A;  2IFU A;  2E0I A;  4HOR A;  3LVQ E;  2JMK A;  3NBN B;  3ULY A;  2BG9 A;  5BMV E;  4LNU D;  4DV5 T;  4OVU A;  1Q2Z A;  3RC3 A;  3CHO A;  5J0Z A;  4XZC A;  2UY1 B;  5D0O D;  1NAF A;  3ZN0 B;  2DWK A;  3ESK A;  4JEU B;  2H88 A;  4NQ0 A;  2YU1 A;  2CCQ A;  1JCS A;  3AA0 B;  1WR6 A;  3ZEF B;  3Q49 B;  3QC9 A;  3FTW A;  3QDN A;  3PVL A;  4UI9 J;  2LJL A;  3MCX A;  1L0V A;  1TNU A;  3PZ2 A;  2VSY A;  4LNG A;  3APF A;  4IST A;  1H2U A;  1T98 A;  5BUZ A;  2ZM8 A;  4HLE A;  4JZY A;  1ZOY A;  1D1B A;  1ZU2 A;  3FZM B;  3TJP A;  4APO A;  4O60 A;  2WU5 A;  4KYO B;  1FVH A;  3PNL B;  2KIN B;  3ABV A;  4HVB A;  4TN7 B;  2CFZ A;  4U3C A;  4K5C A;  4EZL A;  2VQF T;  2UXD T;  2ZGD A;  2XEH A;  4AV7 A;  4KHP T;  2XM2 A;  4JI5 T;  3A7M A;  2RFA A;  3RRN B;  2OCC E;  1V55 E;  3AE7 A;  2CPT A;  4GTS A;  3L09 A;  3D9L A;  3OAW A;  2F37 A;  3FH5 A;  2Y0B G;  5ANL A;  4XX5 A;  2UU9 T;  1HNZ T;  3LJN A;  4Q94 A;  5G04 C;  4H7X A;  3B13 A;  3C51 A;  3EJN A;  3FH7 A;  3ZGQ A;  4BX8 A;  3FUF A;  2WDV A;  4DVD A;  3CVX A;  4F1S A;  2DIW A;  1OT8 A;  3FUD A;  4WNK A;  4IE4 A;  1UUR A;  3V5S A;  4C90 A;  1L5J A;  4G2A A;  3PZD A;  1XWM A;  4Z68 A;  5LJM A;  3SOL A;  2CFU A;  3FDH A;  2KCK A;  3ZKR A;  4MLK A;  2X6K A;  1T7S A;  1IYG A;  3RIU A;  4CDM A;  2GRL A;  4KVM A;  3BEE A;  2OEW A;  1UG3 A;  3NAW A;  5KMG P;  5KJL A;  3C98 B;  3RH3 A;  5JDH A;  1ELW A;  2KWH A;  1XNQ T;  4H9O C;  2XEV A;  3AAA C;  4J8F A;  3SNX A;  4ZI2 C;  4X20 E;  2LHR A;  2V7L A;  3EUV A;  3FH8 A;  3SQV A;  5ITZ F;  1OCC E;  4UVB B;  3R7Q A;  1MZC A;  3D9P A;  2M6I A;  2C5J A;  3MK7 C;  1IBK T;  4GMJ A;  3B7U X;  2BVM A;  2R02 A;  4X65 T;  3VTX A;  3PUW F;  1TNO A;  3Q5W A;  3HR0 A;  4B3M T;  4JA9 A;  1E7P A;  4I6E A;  2LKG A;  5JDG A;  2DYR E;  4UQX A;  2ETC A;  4FJZ A;  3V79 K;  5LMU T;  1FVF A;  4PJN A;  4WWN A;  4W9R A;  3MYV A;  4PK5 A;  4YHH T;  3CKC A;  3G2W A;  4CN4 A;  5AN8 A;  2VKO A;  3KVB A;  3R6N A;  2UUC T;  2K3W A;  3I1A A;  4TWD A;  2DWZ A;  3ZHE B;  2XEN A;  1BPO A;  3CEQ A;  4AKG A;  5FJY A;  4CDR A;  4AI6 A;  2BKG A;  2FUP A;  4Z90 A;  1WLX A;  2IC9 A;  1BR4 A;  2XGS A;  3AU4 A;  1NA3 A;  2ZIR A;  4J8S A;  4BWR A;  4DR1 T;  2PG8 A;  1TR4 A;  4GZ6 A;  4M1P A;  4APF A;  5ARG A;  4ZZB A;  2XAJ B;  2CHW A;  1M62 A;  4AOF A;  4J8Y A;  2IDO B;  5D0Q D;  1MMA A;  1I94 T;  4I0U A;  4U7Y A;  4CYM D;  5L3F B;  4BJM A;  5AQ9 A;  2XUE A;  3PS6 A;  3S7J A;  3SFE A;  4KBM B;  5KCM A;  3PU8 A;  3R84 B;  2DWG A;  3RF1 A;  5FQ7 A;  4TWH A;  1SVX A;  3LBX B;  5AQK B;  3JAE A;  4EAH A;  5IWA T;  1H2T C;  3C98 A;  5HEH A;  4JI1 T;  4DX1 A;  1QSD A;  5T8I A;  4K0U A;  1BI8 B;  3AEA A;  3EAB A;  1FEW A;  1Z0P A;  3DWL G;  4RLY A;  1W0A A;  4MKT A;  5B3S E;  2QFC A;  3C3O A;  3HXE A;  3PZ3 A;  5JRC B;  3ZN3 A;  3ZIM A;  2PL2 A;  3JQ1 A;  2WP9 A;  4JXT A;  1JWG A;  4IGU A;  2XGM A;  3ZYQ A;  4EYY R;  5JHA A;  4X62 T;  2D9D A;  2IML A;  2E9X B;  1SZ9 A;  5E0O A;  3ABM E;  1MJ0 A;  5KJK A;  1T8B A;  4DV2 T;  1NFI E;  4Z8X A;  4G63 A;  5LB7 B;  4OYS A;  3S4U A;  4PK6 A;  3QUJ A;  5F8P A;  4GOU A;  3P2B A;  1WR0 A;  2BZB A;  4GKJ T;  3E30 A;  3ZT5 A;  3N2K E;  1ZB1 A;  2X9Y A;  4FP7 A;  2WQY A;  5FXV A;  1CUN A;  3I4R B;  1S0P A;  3KSL A;  2CBI A;  1LKX A;  4GK5 E;  3UUL A;  4O1O A;  2GRN B;  2XPK A;  2GRQ B;  4B0Z A;  2WXO A;  2M67 A;  1JNZ A;  2FJD A;  2IUB A;  3EHZ A;  3PU3 A;  3FXE B;  3HDX A;  2D0U A;  1X79 A;  4EED A;  2W4X A;  3UQ4 A;  1WYC A;  2QYU A;  4B93 B;  2XQ9 A;  4JI4 T;  2FF4 A;  4N3B A;  1K3Z D;  1S63 A;  2WS3 A;  4KVO A;  3GN5 A;  2L0T B;  3UFG A;  1OWP A;  3JCK C;  4FA6 A;  4EXT A;  3AA7 B;  4YY3 T;  4DV0 T;  4FLB A;  2CE7 A;  4ASK A;  2E5V A;  2H89 A;  3B7B A;  2E8I A;  1PC2 A;  2HYZ A;  3RRC A;  2UWJ G;  3D9I A;  1SUM B;  1MHQ A;  1I6Z A;  4MAL A;  5EX3 A;  2RD0 A;  1JCR A;  2C0M A;  3OXF A;  4PDX A;  1HNX T;  4MS6 A;  2OEV A;  3L54 A;  3L16 A;  3N9M A;  2KLQ A;  4ATG A;  3ZMV B;  4LF8 T;  2LUH A;  2WB2 A;  4WWO A;  1FMW A;  4QH4 A;  3TKL B;  4BEP A;  4I6J A;  3SRZ A;  4UWK A;  2WQ7 A;  4TNW A;  2A5U A;  3QB2 A;  5AQR B;  1IQU A;  5JDM A;  3P4Q A;  5CA1 E;  4CN1 A;  5LCW C;  3Q9U C;  2J1D G;  1NWM X;  5JR9 A;  1E90 A;  1YCS B;  1WY6 A;  4GTV A;  3UIN C;  4U74 A;  3ZCJ A;  1SZA A;  2GRR B;  4GCN A;  4EV6 A;  3J9X 1;  3Q9D A;  1XDO A;  3IBP A;  2DI4 A;  3PJA J;  5EID A;  2LRK A;  4ZI7 E;  3BQI A;  4Z91 A;  5LBQ B;  1QZ2 A;  1WDY A;  3TWT A;  4N2S A;  3LS8 A;  4DBQ A;  2EIM E;  2UUB T;  2LHN A;  2JEK A;  4G8L A;  4ACL A;  4BFR A;  3ZMS B;  3QOF A;  1UK5 A;  2V0P A;  4E6H A;  2J4B A;  2V6Y B;  4WBO A;  4ZEY A;  3G2T A;  5D66 A;  3ZJ2 A;  3K3O A;  4EYU A;  5ADX L;  4EQF A;  4J8D A;  4U0S A;  4ZXL A;  3HXF A;  3K3N A;  4AKL A;  2V4L A;  4P09 A;  2WQH A;  3R9A B;  4DI4 A;  4DLQ A;  1KF6 A;  2JLB A;  5ABF B;  4B89 A;  3UM2 A;  1HX8 A;  3ZLI A;  4HOT A;  3SFD A;  3AE6 A;  4HQD A;  4CZZ B;  1OUV A;  3OXG A;  4AQY T;  4UWG A;  5CA0 E;  4GZC A;  4F3V A;  3DSU A;  4PJJ A;  2R05 A;  4TXP A;  2IJG X;  3UQ3 A;  2K24 A;  2H6F A;  1LRZ A;  4KHZ F;  1VCT A;  4L9I A;  5AQM B;  4R7L A;  2EHO D;  4HWF A;  1E8Y A;  5FQ6 A;  3DBS A;  3RRW A;  4MBG A;  3CVR A;  3KIN B;  3SI5 A;  3DRA A;  1HR0 T;  3JC6 C;  1MMD A;  2LE8 A;  2MOZ A;  2XQ8 A;  5LOV E;  2PNN A;  4N3A A;  3CSF A;  3J5Q B;  4FHJ A;  4HRL A;  3FEY A;  3S7F A;  5CED B;  3RAU A;  3Q2M A;  3O9X A;  2BKP A;  1PAQ A;  2NC9 A;  4QHO A;  4ZI3 D;  3LEW A;  5J1G A;  1ELR A;  4LCT A;  4IIJ E;  3Q7F A;  4CT4 A;  3VLD A;  1YQ3 A;  3DPY A;  3NOC D;  1NL4 A;  3VKG A;  4ILU A;  5FY0 A;  3QK0 A;  4M3O A;  3UU3 A;  1X9B A;  3ASD A;  3F31 A;  2E2A A;  2MYO A;  3L13 A;  1OXJ A;  2VQE T;  4HFV A;  3JUI A;  5HWX A;  5AYW D;  3UM3 A;  1MX6 A;  2MAW A;  1OED E;  4ZZC A;  3W15 B;  1S64 A;  1A17 A;  2HH7 A;  2H6I A;  5AQI B;  2LXM A;  4JI3 T;  3ASF A;  1K8K G;  1YMP A;  3C5R A;  3BG0 B;  3SS1 A;  3NZQ A;  2P9S G;  3E08 A;  3PUX F;  4I17 A;  3PUQ A;  1SE7 A;  5CJ5 A;  2JJ9 A;  5G55 A;  3NRX A;  2XM1 A;  5HI7 A;  3RSE G;  3TXN A;  4YTM A;  2PJQ A;  4WYV A;  3U64 A;  1IBL T;  4NUU A;  4LF4 T;  2KM4 A;  3HKC E;  2E9X C;  2XQ0 A;  1QYM A;  2VGX A;  4U7E B;  2HR2 A;  1JNR A;  3AG3 E;  4A3V A;  3TXM A;  4BET A;  2A2F X;  2JRK A;  5CB4 E;  4DO0 A;  4NXN T;  5LP0 A;  3T5V A;  2X38 A;  4ZHQ E;  3DST A;  2YKS A;  5LYJ E;  3L17 A;  4UWF A;  5KDM C;  4GPM A;  3WAK A;  4V1A v;  2WQ6 A;  1N0R A;  2IC6 A;  2CG3 A;  4GML A;  3L39 A;  2H7V C;  2VVN A;  3AA1 B;  3G06 A;  5EIL A;  1TN7 A;  4FJO A;  4GMR A;  4ERR A;  2HO1 A;  2J09 A;  3LKU A;  1QLB A;  3OYX A;  1NEK A;  3UUB A;  5B1B E;  3UQ7 A;  3AE8 A;  3CK9 A;  5M4Y A;  2IOS A;  4GB9 A;  3GA8 A;  3Q7A A;  1UCU A;  3FUE A;  2RPA A;  3K1S A;  3FBZ A;  3DTO A;  4HFH A;  2LAH A;  3JYS A;  1RW2 A;  2QVA A;  2XAF B;  3KV4 A;  3CK7 A;  1Y6I A;  1AP7 A;  2GW1 A;  3LDQ B;  4GYR A;  4XZ4 A;  2ACX A;  4BSZ B;  1UGO A;  3V5U A;  3PUZ F;  3PUY F;  3RI5 A;  1AJ3 A;  4PS7 A;  2AWI A;  2WXH A;  4A1S A;  2V26 A;  4ZI2 D;  2XQ6 A;  4U8Y D;  2LM2 A;  3UT7 A;  4PUC A;  1VOM A;  3LSV A;  3D9H A;  3PDY A;  3T1H T;  2J4D A;  1OWM A;  2WXL A;  3LY9 A;  3O1I A;  3AB3 B;  5KNH D;  3N9L A;  1KEY A;  4TUU A;  1GQE A;  1VRB A;  2P9B A;  1FT1 A;  3FUK A;  1MMN A;  2BG9 B;  3MA5 A;  2X9H A;  2DBA A;  3ZXS A;  2VKH A;  2CWY A;  4KXK B;  3UU6 A;  4DR7 T;  3ANW A;  3SBT B;  4EZK A;  1EYH A;  4U07 A;  1K1B A;  3D9M A;  2ION A;  5D2M C;  5AQB A;  4HI9 A;  3DEP A;  2NW7 A;  4KP3 C;  4O6F A;  5EK2 A;  1RZ4 A;  4A55 A;  1B7T A;  4DV6 T;  3DEO A;  3W9F A;  2QA7 A;  2UXB T;  4QXC B;  4C9B B;  2Q9Q A;  2XZT G;  2GK9 A;  1BI7 B;  2XZE A;  4X1I E;  5FYM A;  3D9J A;  4U0Z A;  4YDY A;  4UF0 A;  1SHZ C;  4YDO A;  4X5T A;  2G0U A;  3Q75 A;  3J5P A;  3EDV A;  3AXJ A;  3HIZ A;  2K48 A;  4A56 A;  2J49 A;  2NOX A;  1QUU A;  1H19 A;  3LK3 B;  1O5M A;  4G11 A;  3ISM C;  3NZP A;  4ISS A;  4O4J E;  4G25 A;  3O4X E;  5HEJ A;  2XRY A;  4RG6 A;  3EU5 A;  1YA0 A;  2LNI A;  5AAR A;  3Q5E A;  2KWI B;  3Q5D A;  3EHN A;  2V7J A;  3UUM A;  2H6H A;  4HFC A;  3ASN E;  3SO8 A;  2R17 C;  2BS3 A;  5FP3 A;  3AVS A;  1IXV A;  5LHI B;  4JHR A;  3RYH E;  2WXP A;  3RPU A;  3LPZ A;  4YFS A;  5AQJ B;  3ZU7 B;  2AXZ A;  3GZS A;  3L9T A;  1MIV A;  4LF6 T;  3PUJ A;  3ZFW A;  4DLO A;  1OED B;  3APC A;  3SWH A;  3RIB A;  5J90 A;  3V2X A;  2N1G A;  2YDS A;  3N9Q A;  1UOH A;  5J2U E;  3RIF A;  4COF A;  2W61 A;  4K0K T;  3UU4 A;  3EUH A;  3EDU A;  3PEU B;  1XMQ T;  3CST A;  5FIN A;  2BS2 A;  3CX7 B;  3FEX A;  3KDS E;  2HN2 A;  2WXJ A;  4WW0 A;  5LGT B;  2LOS A;  3VU7 H;  2I1J A;  3PE0 A;  2V8S E;  4TXR A;  4QFV A;  4DBR A;  4L1B A;  3UTK A;  5AQP B;  3FTS A;  3F57 A;  2KBX A;  5ENQ D;  3N71 A;  2WPV A;  3JXI A;  3VRA A;  4EBA A;  2IIU A;  2YDQ A;  1IBM T;  4X64 T;  2KCL A;  2VQ2 A;  4ILH B;  1OWL A;  2VYI A;  4O4I E;  3TG5 A;  4LG6 A;  3ZVV A;  2P9I G;  2FUL A;  2KCV A;  3ONK A;  4DRX E;  2DZO A;  4H9S E;  1D0X A;  1LD7 A;  5EKQ D;  5F3J A;  3IHV A;  5FXW A;  1ZP0 A;  2VKD A;  3CX6 B;  3FZF B;  4BT8 A;  4A5X A;  3L3P A;  5AQS B;  4JYA T;  4XI9 A;  2ETA A;  4DX5 D;  2ZIS A;  4GPK A;  1SA5 A;  3PUV F;  4QQI A;  5ENN A;  5KJN A;  2DVW A;  2EIJ E;  4H9Q C;  2ACZ A;  2WXN A;  4WND A;  3BQL A;  2CLY B;  3Q4A B;  5LMN T;  5ENO D;  3TWV A;  5C3J A;  4YSX A;  3N9O A;  3CVP A;  3C72 A;  2WXR A;  1LVF A;  5FZS A;  2J4G A;  3MX3 A;  4I1O B;  3E34 A;  4UQY A;  3HA4 A;  4DR2 T;  3LDZ A;  4YDE A;  1U3C A;  3HG0 D;  3FFL A;  5IYZ E;  2XY8 B;  5EX0 A;  3CVQ A;  3ULQ A;  2FO7 A;  3EU9 A;  3U66 A;  4LFC T;  1OED A;  2YEV C;  4TXQ A;  1IHG A;  2BVL A;  1BR1 A;  2IEJ A;  1W09 A;  3UUN A;  2V5Q C;  2BKK B;  3WG7 E;  5B1A E;  4BES A;  2CBJ A;  3KVA A;  4IHJ E;  1MMG A;  3T9K A;  5FVK A;  2PQR A;  4O2B E;  3AEC A;  3TWQ A;  2CXD A;  2WDR A;  2M6B A;  3OYZ A;  4U33 A;  4HFD A;  3GZ2 A;  5EYP F;  3C50 A;  4YHJ A;  4Y6W A;  1E7V A;  4ZOL E;  3UM1 A;  2NYJ A;  3NB2 A;  4WBN E;  2WZI A;  4YVQ C;  2XZD G;  2Y3A A;  1WCR A;  2KAT A;  1KFY A;  4B3R T;  1X5B A;  3N2G E;  1XDP A;  4PK4 A;  2BG9 C;  3ENE A;  3KFW X;  3I5P A;  4WWP A;  3OVU A;  3ZST A;  3FZK B;  1HS6 A;  3JCF A;  2R5S A;  2R59 A;  4U95 D;  3MJX A;  1UUS A;  2ZM0 A;  4G2V A;  2IF4 A;  2LM9 A;  3HXB A;  5ENR D;  2KMF A;  1QQE A;  3LJ3 A;  4PJM A;  3SD5 A;  3AAE B;  3LYA A;  5FY1 A;  5LHG B;  2Y48 B;  4FLH A;  4B8C B;  2W2U A;  4B3T T;  3K8P C;  2R2L A;  4XIF A;  1XNF A;  4O1P A;  3VHL A;  1E8W A;  5LCW J;  3ZPO A;  4EPZ A;  4ATZ D;  2X6J A;  4JHJ A;  3GN5 B;  1TYQ G;  3QAR A;  4JD2 G;  4AKH A;  3JC6 D;  4DV1 T;  4DI3 A;  2MBG A;  4AKR B;  3OTO T;  4U31 A;  3WI3 A;  1HE8 A;  2AVP A;  1E8X A;  4O2A E;  2IAK A;  2DZN A;  3D9N A;  2AXD S;  4HWD A;  4X1K E;  3RGL A;  3CR3 A;  4GTM A;  4LF9 T;  5KXJ A;  3KAE A;  5C2T A;  5A1L A;  2XS8 A;  1FJG T;  3X1D A;  3IEG A;  1EZ3 A;  3M65 A;  3ZCI A;  3AEG A;  1OWN A;  4L23 A;  3TGO A;  4HWI B;  4KUM B;  3I3N A;  4FU3 A;  5A23 A;  4I43 A;  1JWF A;  3ABK E;  3P50 A;  2XAG B;  2UUA T;  1V54 E;  2P9U G;  3B7R L;  1JCQ A;  3RIU C;  3SHF A;  3QK6 A;  1DNP A;  5JR9 B;  3PH0 C;  3SFZ A;  1OED C;  2JPF A;  1HZ4 A;  4GTQ A;  2J9Q A;  2LSG A;  4B8A A;  3AE2 A;  3AG1 E;  3S7B A;  2ETB A;  2X0L B;  3ZSS A;  3FTZ A;  3FU5 A;  2NXP A;  4GTT A;  4HFG A;  4H63 V;  5AQN B;  3G2U A;  1HCI A;  4H9P C;  5HYA A;  1Z3Y A;  3FXD B;  2QZA A;  5EK4 A;  2ES0 A;  4LEU A;  3ONX A;  2VL0 A;  4DR5 T;  2ZGG A;  4ANW A;  4ILB A;  3LJC A;  4DUI A;  4DUY T;  1DU2 A;  3FBL A;  5C8Y E;  1IZN B;  3V2O A;  4C48 B;  3UU5 A;  3RKV A;  3B5M A;  2LOP A;  3CLJ A;  5CER B;  2H7O A;  3TL5 A;  2V7M A;  4L7T A;  4ADZ A;  4EHM A;  1HS7 A;  1MIY A;  3IEE A;  3BQK A;  1YQ4 A;  3E33 A;  1HNW T;  1WG0 A;  3WXX A;  5T4Y A;  3MJW A;  4GA1 A;  4HRN A;  4N5C A;  3AEE A;  3X2Q E;  3VKH A;  3OXL A;  5DQW A;  4JI0 T;  5FMN A;  5BW8 C;  3HXC A;  3ZYK A;  5LG4 A;  3UIP C;  2VJ8 A;  4AY5 A;  1TEZ A;  3UPV A;  2XEE A;  3L8R A;  2LSU A;  4IDN A;  2QRX A;  4O4H E;  3ASO E;  3T5X A;  1EPU A;  2J47 A;  4HEA A;  1P5Q A;  5FZR A;  2WCA A;  3SY2 A;  2LT3 A;  3AS5 A;  3P1U A;  4YDW A;  2CLY C;  2J8S D;  1H2V C;  2X67 A;  3H3A A;  4U2Y A;  4AXP A;  5LXT E;  4AY6 A;  5AQH B;  1WFD A;  4FI5 A;  4LNB A;  4JI6 T;  1OWA A;  3ZRH A;  4PFO A;  2LKH A;  2QY7 A;  3AJI A;  3P4S A;  2ZMA A;  3ML8 A;  3NZS A;  3FTY A;  5AAO A;  1MNE A;  3B7S A;  4NRH B;  2C5K T;  4HB5 A;  3D0T A;  2OLT A;  3DSX A;  3EVY A;  2X6I A;  4Y6C A;  2F8Y A;  3IV0 A;  2V1D B;  2WU2 A;  2EIN E;  4AQF A;  4F6R D;  4N2Q A;  4OAU C;  4B6X A;  4JI8 T;  2ZM2 A;  4U2Z A;  2VSN A;  1DCE A;  4XAX B;  1TJC A;  2J08 A;  2LO6 A;  3PZ4 A;  4GYO A;  5EDS A;  5FL1 A;  2X0H A;  1BR2 A;  4YTN A;  3UTM A;  4GYS A;  2XHE A;  3CV0 A;  2WZH A;  4G1T A;  4TRQ A;  3AE5 A;  3ONL A;  1W9R A;  3ONJ A;  1YW0 A;  2W0G A;  1H6O A;  5BXU A;  4IE5 A;  2VGX B;  2V5C A;  5LOZ A;  3TWS A;  1EF1 C;  1UJJ A;  3TLW A;  1JPL A;  5DJQ C;  1INZ A;  4QX7 B;  4JV5 T;  5LX8 A;  2XQY A;  3IF8 B;  1SA4 A;  1D9S A;  5AQA A;  5HXE A;  3RIA A;  1J5E T;  4X1Y E;  3QB5 K;  1KNZ A;  3QNK A;  1N54 A;  2C2L A;  2ZU6 B;  4HGA A;  2L9Q A;  5FL0 A;  2DHR A;  3HL6 A;  5C2Y A;  1GW6 A;  4N39 A;  4A97 A;  2IOL A;  4XI0 A;  4IDQ A;  1N32 T;  3L22 A;  4TUM A;  4DX6 D;  3P4W A;  3DXM G;  3H3M A;  3LG7 A;  4A1G A;  1KPS B;  4OYK A;  2B76 A;  3I9W A;  3DPD A;  3FHE A;  4K5B A;  5HEU A;  2BUG A;  3CVY A;  4E85 A;  4E7S A;  5L3B B;  2QC9 A;  2LSI A;  1N36 T;  1QBQ A;  4ILA A;  3AS4 A;  3O4Z A;  3CVU A;  2GRM A;  3NBX X;  4AJW A;  2OVF A;  4RQI A;  1J1J A;  3AE1 A;  1HG5 A;  4PFP A;  3ZYM A;  4HS2 A;  3FY4 A;  4YND A;  1SQM A;  3MAC A;  2CM0 A;  4IDP A;  3TWR A;  1JUQ A;  4L2Y A;  2PBI A;  3DSV A;  4H9R C;  4ZS3 A;  5J2T E;  2WXI A;  1TNY A;  4AXH A;  4IRE A;  2XCC A;  3U3I A;  2BBJ A;  3B57 A;  2P9P G;  1H6P A;  2SPC A;  5ABH A;  1WAO 1;  3H37 A;  5JR9 C;  5FXZ A;  2XPZ A;  4GZ3 A;  4GK0 E;  3ANW B;  4BTA A;  4AQF C;  1OY3 D;  3QWP A;  4L0R A;  4CN6 A;  2W67 A;  2BF0 X;  3O1J A;  1Z8U A;  2WSS V;  4GTO A;  2ODU A;  3TWW A;  2MYS A;  5A6C A;  1NZN A;  2FBW A;  5H6Q B;  2XQ5 A;  4IE6 A;  3T8O A;  2OVB A;  2Q9Q B;  2JQH A;  3E4B A;  3V31 A;  3U4T A;  3LFM A;  3NOG D;  2KZT A;  1H6K A;  3SZ7 A;  4LFB T;  3CQC B;  3ABL E;  3BU8 A;  4OYJ A;  3HHM A;  3MV3 B;  3ONL C;  2JQQ A;  4UF0 B;  1TN8 A;  2IHR 1;  2MPK A;  1KT1 A;  3FUI A;  2VL8 A;  3RO3 A;  3RRU A;  1CHU A;  4I9C A;  3QWV A;  4F8H A;  4ACK A;  3AXJ B;  2A3D A;  2ZLY A;  1HXI A;  3I4G A;  2UXX B;  1A5E A;  1S35 A;  1YD8 G;  1D1A A;  2XAH B;  3RLF F;  1AWC B;  4YSY A;  3C3Q A;  3AG4 E;  2OA5 A;  3PEV B;  3C3R A;  3M3Z B;  5FTP A;  1H0A A;  3W9G A;  1MIW A;  4JEH A;  4EGW A;  3K3Q C;  5HAX A;  2BBH A;  3SFX A;  5JDN A;  2CHX A;  1UW4 B;  2IU1 A;  2NTY A;  4YSZ A;  4KBQ A;  4C0M A;  3LK2 B;  2EHO A;  3O1H A;  3QWW A;  5CGM A;  4CDN A;  3TLT A;  4ILI A;  4GKK T;  1N4P A;  5CCL A;  4M7C A;  3S7D A;  5KX5 E;  4EBA G;  4A98 A;  2ILR A;  1D0Z A;  3AVR A;  3RU0 A;  2KSR A;  4AIF A;  4H63 H;  5ARF A;  5L3C B;  4NIQ A;  5JJ6 A;  4PH4 B;  1UX5 A;  2H3R A;  3ZC0 A;  4GA0 A;  1FPP A;  4ABN A;  2PQN A;  1N95 A;  3MV2 B;  3UUX A;  5FXX A;  1MQS A;  2XSB A;  4BAY B;  4ZHB A;  4J2C A;  4LMK A;  3RYF E;  2E2E A;  5DQV A;  3E32 A;  3GYZ A;  2L3L A;  2XAQ B;  3MGB A;  4P0B A;  2BS4 A;  4K5A B;  4L2L A;  2Z6E A;  2WXK A;  2LSK A;  4PJL A;  4UV9 B;  3QC1 A;  4LF7 T;  1G3N B;  2XS1 A;  2VUR A;  3AE9 A;  3UT4 A;  4KMO A;  2V5F A;  4JA7 A;  1HU3 A;  1D8D A;  2P2C P;  3L08 A;  1N9A A;  3T8K A;  2Y1L E;  3EIJ A;  3FTX A;  4NUR A;  4WNF A;  4UUC A;  3AA6 B;  1TJF A;  3CVV A;  3AE4 A;  4MFR A;  4CI2 B;  3LY8 A;  5CMY A;  2IW5 B;  4LER A;  2PM7 A;  4HNA D;  4IL9 A;  1XNR T;  2HHH T;  4QXB B;  2HM8 A;  4YVO A;  3NWI A;  2HPL A;  2D5U A;  2N9D A;  4HI8 A;  4WNG A;  3Q9N C;  4UR9 A;  3PUG A;  3NVO A;  4UWH A;  3AU5 A;  5JRE A;  5G05 C;  3RQW A;  4GA2 A;  3AE3 A;  5FIO A;  4DR3 T;  5LG3 A;  2CHO A;  2PTF A;  3GW4 A;  4CCA A;  2PZI A;  3EDT B;  2ODV A;  3PUK A;  3LCA A;  4D10 C;  2NSZ A;  5KJM A;  3HKE E;  3VTY A;  3BK9 A;  4I55 E;  4U8V D;  2FJA A;  3ZMZ B;  1N52 A;  3ZT7 A;  3FU0 A;  3UX4 A;  5FQ4 A;  2DL1 A;  4A63 B;  4HE8 A;  4UVC B;  2WMO A;  3ZYL A;  4BTB A;  5FNV E;  5LFA A;  3EHM A;  1EDU A;  2CG2 A;  3ZMU B;  3ASH A;  3PUR A;  4OK0 A;  3ZJ1 A;  3HI2 A;  2I2O A;  2CXF A;  5L47 A;  4LML A;  4IN3 B;  3RQU A;  2F0Y A;  4QWN B;  4TV9 E;  3OJA A;  3IHR A;  5JJT A;  4PS3 A;  5BXO A;  1N4Q A;  4DV4 T;  3JQ0 A;  4LRZ A;  3ZC1 A;  4U8H A;  3C64 A;  1E1H B;  2XPI A;  5BPP A;  2RA1 A;  2VGE A;  4AIU A;  1TN6 A;  2L9B A;  4NXM T;  1D8E A;  1N4S A;  4LF5 T;  4LSZ E;  4HRM B;  3R7R A;  3CWZ B;  4TWF A;  2XQA A;  3AS8 A;  2JIW A;  2DYS E;  5HXH A;  3EHR A;  5AQL B;  4DV7 T;  2BDE A;  3EIQ C;  4QKN A;  3B7T A;  4DR4 T;  3PV0 F;  4GYW A;  4MLP A;  4BJN A;  5JDQ A;  5AIJ A;  3BUA A;  1MX4 A;  2HN1 A;  2VWA A;  2AE9 A;  4DMW A;  4ANU A;  2PFV A;  4DPR A;  3EI0 A;  3ETU A;  1ELK A;  5CCM A;  5AFU L;  5IUX A;  5DIZ A;  1ZV4 X;  5HXR A;  3IHY A;  5CRU A;  5AEN A;  1LVK A;  4JI7 T;  1OCZ E;  5ENT D;  1N4R A;  1O3X A;  4GIW A;  3RO2 A;  2X3M A;  5JDL A;  3RC8 A;  3FU6 A;  4IL4 A;  2Q9Q C;  3Q78 A;  4U7I A;  3URZ A;  5F5W A;  4IRU A;  1UN8 A;  3CQX C;  3RKO A;  2P9N G;  2A9U A;  2LSJ A;  4U72 A;  2I1K A;  4FHK A;  4HOU A;  4AEZ C;  5LBM A;  3MKQ A;  2ZM6 T;  5HRY A;  3UIO C;  2QGS A;  5HCM A;  3UI2 A;  4MBQ A;  4AQG A;  4CI3 B;  2VB6 A;  1G73 A;  4OVV A;  3TAX A;  4AM9 A;  2VTB A;  2W62 A;  2BED A;  3ZPJ A;  3MZK B;  5CMW A;  1MX2 A;  1Y64 B;  1ZEE A;  1ZKE A;  5FWQ A;  2XGO A;  4K0R A;  3WAJ A;  1S70 B;  4N3C A;  5AQG B;  3UMV A;  4YJ3 E;  3QAQ A;  3LXU X;  2LLY A;  1E8Z A;  3PE4 A;  4URK A;  5DAB A;  4I43 B;  2V7I A;  5EZY E;  4JL0 A;  3DSW A;  2K5B B;  4PW8 A;  5HEG A;  4F7A A;  2MOW A;  4HLL A;  2W66 A;  4CXW A;  3UKU G;  4I2W A;  3KV6 A;  3ULE G;  3EHQ A;  1W3B A;  3B95 A;  3KBU A;  2IQC A;  2WWU A;  4G26 A;  5A7D B;  4HWH A;  3C4W A;  4HFB A;  3CHQ A;  5EK3 A;  4GYY A;  4YT0 A;  3IBE A;  2E5L T;  1X81 A;  3HYM B;  3CX8 B;  1Z3X A;  1IKN D;  2XRZ A;  1J5W A;  3MEK A;  3QKY A;  3E37 A;  2WXG A;  2K9A A;  2JAB A;  3UKR G;  4GZ5 A;  5T3R A;  2NTX A;  4UEM A;  1E96 B;  3CVN A;  4ILC A;  4YXD A;  4XE0 A;  4U63 A;  2UY1 A;  3CHS A;  2FO1 E;  3KEA A;  3LY7 A;  2WBL A;  4JEU A;  2WDQ A;  2WXQ A;  4UXN B;  4EZ4 A;  4EEC A;  2V4H C;  3ZW3 A;  3NZU A;  3QB5 A;  5L3G B;  1YKE B;  3ZEF A;  4Q25 A;  4CXY A;  4HXI A;  1NP7 A;  2QYJ A;  3PE3 A;  4KT6 B;  3RK6 A;  4EIW A;  1OXZ A;  5AJD A;  1O1S A;  2MRI A;  2X9W A;  5IY5 E;  3OTN A;  4IUL A;  2CHN A;  2M63 A;  2HE0 A;  3TLS A;  4U96 D;  1N94 A;  4FUL A;  1NI1 A;  2YIN A;  4KI0 F;  4TX5 A;  2B6C A;  2C0S A;  4HWC A;  5LGN B;  3I9Y A;  3UT5 E;  2A4Z A;  3FZH B;  2OND A;  2FI7 A;  4JB8 P;  2L6J A;  1KNR A;  4Q96 A;  5BV0 A;  2P58 C;  5FT9 A;  1LD8 A;  3Q79 A;  4DND A;  1KT0 A;  3ZMT B;  2V5D A;  3Q5X A;  4BY6 A;  4E7Z A;  3R9M A;  2FEZ A;  3LVR E;  3CVL A;  3AAI A;  5HWY A;  4UI9 C;  2X0Y A;  3C4Z A;  4CI1 B;  3JUE A;  2Y69 E;  2XTL A;  4YTP A;  1H7C A;  3GMI A;  2D2S A;  4UVA B;  2A72 A;  4H7Y A;  1TNB A;  4NPP A;  4CT0 A;  5KBA A;  3CML A;  4YJ2 E;  4DJA A;  4C91 A;  3U9W A;  1DC2 A;  3I0Q A;  4HFI A;  3HKB E;  3S2A A;  3RYC E;  2DCP A;  2XPY A;  1KK7 A;  1YKH B;  5LGU B;  3SGH A;  2F8X K;  3N2O A;  1IJ6 A;  2MTQ A;  2WM9 A;  2X51 A;  3KV9 A;  3CVW A;  2FJE A;  4DR6 T;  1UN9 A;  3G2V A;  5AQ7 A;  4XEI G;  2X6F A;  2WXF A;  4LFA T;  4KZC A;  2XHE B;  2L8K A;  4I50 E;  2E9X D;  1KNP A;  3ZN1 B;  4ZS2 A;  3SBS A;  4KZ0 A;  1US7 B;  3DXK G;  3L6A A;  2F4V T;  2EIK E;  3ZXP A;  3P4R A;  2UXC T;  4QX8 B;  4RSY A;  4X66 T;  3AED A;  3D9O A;  4JVS A;  4N5Q A;  3TG4 A;  2YDR A;  2PM6 A;  2D0T A;  5FQ8 A;  3I0O A;  3FU3 A;  4PNI A;  1VCS A;  4J7W A;  3GWH A;  3TLU A;  5LA6 E;  2I6H A;  1W0B A;  2RP4 A;  5FVL A;  4EOZ B;  4I9E A;  1KZP A;  2VVS A;  4DK5 A;  4ZFH A;  4BX9 A;  2KZ7 B;  1BD8 A;  4CGV A;  5CEC B;  3DSS A;  4WNE A;  3TWX A;  2XQ4 A;  2OV8 A;  3ZHE A;  1U4Q A;  5L2L A;  3G2S A;  4RVB A;  3AEB A;  1MND A;  4G8K A;  5HS0 A;  5HKP A;  3ML9 A;  4J6I A;  3MA9 A;  2P9K G;  2BKN A;  3PTR B;  2L6B A;  5BNW A;  4HKA A;  4MHC A;  5LHH B;  5AJL A;  4IT4 A;  4OX9 T;  3ZUV B;  2R6G F;  3CGH A;  4IYP A;  2EIL E;  5AQF B;  1FIO A;  2RKK A;  4O4L E;  4QXH B;  3NF1 A;  4O8S A;  5JH7 E;  3ZT6 A;  5JHB A;  1UX4 A;  3BQO A;  2B1E A;  5H7P A;  4XBF B;  4GAA A;  3RKG A;  3F2E A;  1HO8 A;  3UXG A;  3RYI E;  1HG2 A;  4B94 A;  3MKR A;  5EN5 D;  3APD A;  4OFZ A;  4P0A A;  2ZXW E;  4UV8 B;  5LP6 E;  2B0O E;  4TZ4 C;  2Y4U A;  3LBX A;  5BR8 T;  4UI9 K;  5EIB E;  4F53 A;  4EB6 E;  5LNK A;  2V7K A;  3P8C D;  3CIR A;  5EYL A;  4AIS A;  2YNQ A;  2MHK A;  2VKJ A;  3IA3 A;  5BV1 A;  4PAG A;  2YHE A;  4IDO A;  3P4P A;  3N9N A;  4J8E A;  4DV3 T;  1N11 A;  2LXL A;  5AQQ B;  1FCH A;  2XQ3 A;  5JRC A;  2AXU A;  3QJZ A;  2JQ9 A;  1R8I A;  5BT1 A;  3ESL A;  3PDN A;  4HTE A;  2NW8 A;  3AEF A;  5ABE A;  3O48 A;  1M7K A;  4K03 A;  3FB2 A;  2E9X A;  2DLR A;  1FMV A;  2VAS A;  2KZT B;  3FUN A;  2J62 A;  4HOS A;  3VR9 A;  2IO3 C;  2GRO B;  2BG9 E;  4GU5 A;  2BTD A;  4DID B;  1N33 T;  3N9P A;  3J7Y q;  4Q69 A;  5CFB A;  1OCR E;  1O1R A;  5AQT B;  4ME2 A;  5JA4 D;  1SW6 A;  5H6R B;  5TAO A;  5JQG E;  4UWL A;  5AQO B;  2AW6 A;  4P1N A;  2Y4T A;  5KNG A;  2FBN A;  3PRZ A;  2YHC A;  1IHB A;  3AG2 E;  2RFM A;  3EAM A;  4CXX A;  4BT9 A;  3K9I A;  3KS2 A;  4JEH B;  3PJA A;  2CMR A;  3IXE A;  1HH8 A;  3Q5M A;  1QNF A;  4FJY A;  1LF8 A;  1UJK A;  4G24 A;  4X8Q A;  1E2A A;  4I1M A;  3CHP A;  3MZL B;  3PZ1 A;  1N0Q A;  4WAF A;  5HCJ A;  1ZBP A;  3HKD E;  2EHO B;  3HXD A;  5E76 A;  2X68 A;  5HEO A;  3C4X A;  1BU9 A;  2YQ8 A;  4JPS A;  1ZHC A;  4LMJ A;  4FAD A;  2XJ7 A;  2GRP B;  3KBT A;  2KC7 A;  5ANR A;  3FP3 A;  2AXV A;  1WM5 A;  4V3I A;  1D0Y A;  4G23 A;  5IHY A;  2KXP B;  1TNZ A;  2C5I T;  1WRD A;  3SF4 A;  3DP7 A;  3UUX B;  3CPZ A;  2P9L G;  3RJV A;  1S94 A;  5J08 A;  2W00 A;  2XQ7 A;  4GZD A;  3Q73 A;  4ANV A;  4EZH A;  3OPC A;  5G05 J;  3CIA A;  4DMV A;  2I59 A;  3VLF A;  5G2N A;  1D1C A;  3NRY A;  1Y8M A;  5JDF A;  5KWD A;  2X6H A;  3CKB A;  2DCF A;  3E22 E;  2WMN A;  2V8S V;  5CHE E;  1BR0 A;  4I6G A;  5AQU B;  4DX7 D;  4EZJ A;  3RX6 A;  3NKZ A;  2VSX E;  3FHN A;  4I4T E;  3RHW A;  1IAP A;  1HF8 A;  2JQK A;  4JHK A;  2X66 A;  2WAU A;  2Y8D A;  1U2V G;  5JTG A;  2CHZ A;  4FC8 A;  3KD7 A;  2BKO A;  4CGW A;  5M72 A;  3CHM A;  3Q47 B;  1HX1 B;  4F1P A;  2Q9Q D;  2YN6 A;  3LK4 2;  4TV3 A;  2V6Y A;  4OHF A;  5CEA A;  2GGF A;  3QOU A;  3CQG B;  1DVP A;  2WY2 A;  3HVE B;  2H6G A;  2XCB A;  5FY7 A;  3U3W A;  4BER A; 
#chains in the Genus database with same CATH homology
 1V9D A;  1U3D A;  2KT9 A;  4I1A A;  2LSV A;  3FUJ A;  4TUY E;  5E75 A;  4N78 D;  2WXM A;  1B89 A;  4TV8 E;  2VK9 A;  5FZQ A;  4L5G A;  2JMH A;  2NP9 A;  3RRM B;  3E0Z A;  4A3T A;  5HXS A;  5L3E B;  4HOQ A;  3T8M A;  2NW9 A;  1E7U A;  4AVX A;  2CWO A;  5HQ8 A;  4WUY A;  2KND A;  2LAI A;  2YK0 A;  2I9C A;  3OBV E;  4PS8 A;  3FTV A;  3BG1 B;  2LEH A;  3AAA B;  3FWV A;  4NUV A;  3FUH A;  3CKD A;  3DJB A;  3PUA A;  3A5X A;  1SA0 E;  1NA0 A;  4NAC A;  3U78 A;  2VGY A;  2CXL A;  3ASG A;  3D3M A;  2CA5 A;  4ILG A;  4UIG A;  3PRE A;  5ETW A;  2RG8 A;  3FUL A;  3CHR A;  2UXN B;  1WYB A;  4P29 A;  2Y6X A;  5HXC A;  4F6R C;  3Q15 A;  4AKI A;  4XKC A;  3P7I A;  4LUN U;  4JW1 A;  2YU2 A;  2NWB A;  1OWO A;  5G04 J;  4RG9 A;  1VDY A;  4JLE A;  1IJ5 A;  3HVE A;  2WVI A;  4U0U A;  3D9K A;  3OKQ A;  2LSY A;  1KLX A;  3N5L A;  1XGW A;  2VSO E;  5DBK A;  1G8X A;  4ANJ A;  4IE0 A;  3MKQ B;  4XKB A;  3GZ1 A;  4C0E A;  3FUM A;  3MXZ A;  5JJ7 A;  2Q7F A;  3KEZ A;  4CRW A;  4IE7 A;  2OOE A;  2L0I A;  3MKD A;  1Z6T A;  2VTB B;  3CK8 A;  1U5P A;  4HN9 A;  1HFA A;  4CQI A;  4I2Z A;  3IKO B;  4JUY A;  4JC8 A;  1IQR A;  2EHO C;  2DNX A;  4UEL A;  3PNT B;  4U04 A;  3VLE A;  4KMC A;  4BA9 A;  2EQX A;  2J07 A;  5JVD E;  4IDZ A;  1HTJ F;  2X9X A;  5GON E;  2N2N A;  5L3D B;  2XAS B;  5C1D A;  4H9N C;  3ETV A;  5LJN A;  4GCO A;  4ZI3 C;  4ANX A;  2CEA A;  4AP2 A;  1PY1 A;  4MRU A;  3KV5 A;  4J0U A;  4YLH A;  3FTU A;  4BSX A;  3UFE A;  3UT8 A;  5LCY A;  3PUS A;  4UQZ A;  2W63 A;  2HPJ A;  4CEM A;  3NQP A;  2C0L A;  2IFU A;  2E0I A;  4HOR A;  3LVQ E;  2JMK A;  5BMV E;  4OVU A;  3RC3 A;  3CHO A;  4XZC A;  2UY1 B;  5D0O D;  1NAF A;  3ZN0 B;  2DWK A;  3ESK A;  4JEU B;  4NQ0 A;  2YU1 A;  2CCQ A;  3AA0 B;  1WR6 A;  3ZEF B;  3Q49 B;  3QC9 A;  3FTW A;  3QDN A;  3PVL A;  4UI9 J;  2LJL A;  3MCX A;  2VSY A;  3APF A;  4IST A;  1H2U A;  1T98 A;  5BUZ A;  2ZM8 A;  4HLE A;  4JZY A;  1D1B A;  1ZU2 A;  3TJP A;  4APO A;  4KYO B;  1FVH A;  3PNL B;  2KIN B;  4HVB A;  4TN7 B;  2CFZ A;  4EZL A;  4AV7 A;  3RRN B;  3L09 A;  3D9L A;  3OAW A;  3FH5 A;  5ANL A;  4XX5 A;  4Q94 A;  5G04 C;  4H7X A;  3B13 A;  3C51 A;  3EJN A;  3FH7 A;  3ZGQ A;  4BX8 A;  3FUF A;  4DVD A;  3CVX A;  4F1S A;  2DIW A;  3FUD A;  4WNK A;  4IE4 A;  3V5S A;  4C90 A;  1L5J A;  4G2A A;  3PZD A;  5LJM A;  3SOL A;  2CFU A;  3FDH A;  2KCK A;  4MLK A;  2X6K A;  1IYG A;  4CDM A;  2GRL A;  4KVM A;  3BEE A;  1UG3 A;  5KMG P;  5KJL A;  3C98 B;  3RH3 A;  5JDH A;  1ELW A;  2KWH A;  4H9O C;  2XEV A;  4J8F A;  3SNX A;  4ZI2 C;  4X20 E;  2LHR A;  2V7L A;  3FH8 A;  4UVB B;  3R7Q A;  3D9P A;  2C5J A;  3MK7 C;  4GMJ A;  3B7U X;  2BVM A;  3VTX A;  3Q5W A;  3HR0 A;  4JA9 A;  4I6E A;  5JDG A;  4UQX A;  4FJZ A;  1FVF A;  4PJN A;  4WWN A;  4W9R A;  3MYV A;  4PK5 A;  3CKC A;  3G2W A;  2VKO A;  3KVB A;  3R6N A;  3I1A A;  3ZHE B;  1BPO A;  3CEQ A;  4AKG A;  5FJY A;  4CDR A;  4AI6 A;  1WLX A;  2IC9 A;  1BR4 A;  2XGS A;  3AU4 A;  1NA3 A;  4J8S A;  4BWR A;  2PG8 A;  4GZ6 A;  4M1P A;  4APF A;  5ARG A;  2XAJ B;  2CHW A;  4AOF A;  5D0Q D;  1MMA A;  5L3F B;  4BJM A;  2XUE A;  3PS6 A;  3S7J A;  4KBM B;  5KCM A;  3PU8 A;  3R84 B;  2DWG A;  5FQ7 A;  3LBX B;  4EAH A;  1H2T C;  3C98 A;  1QSD A;  5T8I A;  4K0U A;  1FEW A;  1Z0P A;  4MKT A;  2QFC A;  3ZN3 A;  5JRC B;  3ZIM A;  2PL2 A;  3JQ1 A;  4JXT A;  1JWG A;  4IGU A;  2XGM A;  3ZYQ A;  4EYY R;  5JHA A;  2E9X B;  1SZ9 A;  5E0O A;  5KJK A;  4Z8X A;  4G63 A;  4OYS A;  3S4U A;  4PK6 A;  3QUJ A;  5F8P A;  4GOU A;  3P2B A;  2BZB A;  3N2K E;  2X9Y A;  4FP7 A;  5FXV A;  1CUN A;  3I4R B;  1S0P A;  1LKX A;  4GK5 E;  3UUL A;  4B0Z A;  2WXO A;  2M67 A;  3PU3 A;  3FXE B;  3HDX A;  2D0U A;  1X79 A;  1WYC A;  2FF4 A;  4N3B A;  4KVO A;  3GN5 A;  2L0T B;  1OWP A;  4FA6 A;  3JCK C;  4EXT A;  3AA7 B;  4FLB A;  2CE7 A;  4ASK A;  2E8I A;  1PC2 A;  2HYZ A;  3RRC A;  2UWJ G;  3D9I A;  1MHQ A;  4MAL A;  5EX3 A;  2RD0 A;  2C0M A;  3OXF A;  4PDX A;  4MS6 A;  3L54 A;  3L16 A;  3N9M A;  2KLQ A;  4ATG A;  3ZMV B;  2WB2 A;  4WWO A;  1FMW A;  3TKL B;  4I6J A;  3SRZ A;  4UWK A;  2WQ7 A;  2A5U A;  3QB2 A;  1IQU A;  5JDM A;  5CA1 E;  5LCW C;  2J1D G;  1NWM X;  5JR9 A;  1E90 A;  1WY6 A;  4U74 A;  3ZCJ A;  1SZA A;  4GCN A;  3J9X 1;  3Q9D A;  3IBP A;  2DI4 A;  4ZI7 E;  3BQI A;  1QZ2 A;  5LBQ B;  4N2S A;  3LS8 A;  4DBQ A;  2JEK A;  2LHN A;  4ACL A;  4BFR A;  3ZMS B;  2V0P A;  4E6H A;  2J4B A;  3G2T A;  4WBO A;  3ZJ2 A;  3K3O A;  4EYU A;  5ADX L;  4EQF A;  4J8D A;  4U0S A;  3K3N A;  4AKL A;  2V4L A;  4P09 A;  2WQH A;  3R9A B;  4DI4 A;  4DLQ A;  2JLB A;  4B89 A;  1HX8 A;  3ZLI A;  4HOT A;  4CZZ B;  1OUV A;  3OXG A;  4UWG A;  5CA0 E;  4GZC A;  4F3V A;  4PJJ A;  2IJG X;  3UQ3 A;  2K24 A;  1LRZ A;  4L9I A;  4R7L A;  2EHO D;  1E8Y A;  5FQ6 A;  3DBS A;  3RRW A;  3CVR A;  3KIN B;  3SI5 A;  3JC6 C;  1MMD A;  2LE8 A;  2MOZ A;  5LOV E;  4N3A A;  3CSF A;  4FHJ A;  3S7F A;  3FEY A;  3Q2M A;  3O9X A;  1PAQ A;  2NC9 A;  4QHO A;  4ZI3 D;  3LEW A;  5J1G A;  1ELR A;  4LCT A;  4IIJ E;  4CT4 A;  3VLD A;  3VKG A;  4ILU A;  5FY0 A;  3QK0 A;  4M3O A;  3ASD A;  3F31 A;  3L13 A;  4HFV A;  3JUI A;  5HWX A;  5AYW D;  3W15 B;  1A17 A;  2HH7 A;  3ASF A;  3BG0 B;  3SS1 A;  3NZQ A;  3E08 A;  4I17 A;  3PUQ A;  2JJ9 A;  5G55 A;  3NRX A;  5HI7 A;  3TXN A;  2PJQ A;  3U64 A;  4NUU A;  2KM4 A;  3HKC E;  2E9X C;  2XQ0 A;  2VGX A;  2HR2 A;  4A3V A;  3TXM A;  2A2F X;  2JRK A;  5CB4 E;  4DO0 A;  5LP0 A;  3T5V A;  2X38 A;  4ZHQ E;  3L17 A;  5LYJ E;  4UWF A;  5KDM C;  3WAK A;  4V1A v;  2WQ6 A;  2IC6 A;  2CG3 A;  4GML A;  2H7V C;  3AA1 B;  4FJO A;  4ERR A;  2HO1 A;  2J09 A;  3LKU A;  3OYX A;  3CK9 A;  5M4Y A;  2IOS A;  4GB9 A;  3GA8 A;  1UCU A;  3FUE A;  2LAH A;  3JYS A;  3FBZ A;  3DTO A;  2XAF B;  3KV4 A;  3CK7 A;  1Y6I A;  2GW1 A;  4GYR A;  4XZ4 A;  2ACX A;  3V5U A;  1AJ3 A;  4PS7 A;  2AWI A;  2WXH A;  4A1S A;  2V26 A;  4ZI2 D;  3UT7 A;  4PUC A;  1VOM A;  3PDY A;  2J4D A;  1OWM A;  2WXL A;  3LY9 A;  3O1I A;  3AB3 B;  3N9L A;  4TUU A;  1VRB A;  2P9B A;  3FUK A;  1MMN A;  3MA5 A;  2X9H A;  2DBA A;  3ZXS A;  2VKH A;  2CWY A;  4KXK B;  4EZK A;  3ANW A;  3SBT B;  1EYH A;  4U07 A;  3D9M A;  2ION A;  2NW7 A;  4KP3 C;  4O6F A;  5EK2 A;  4A55 A;  1B7T A;  2QA7 A;  4QXC B;  4C9B B;  2Q9Q A;  2GK9 A;  4X1I E;  5FYM A;  3D9J A;  4U0Z A;  4UF0 A;  1SHZ C;  2G0U A;  3EDV A;  3HIZ A;  2K48 A;  4A56 A;  2J49 A;  2NOX A;  1QUU A;  1H19 A;  3LK3 B;  4G11 A;  3NZP A;  4ISS A;  4O4J E;  4G25 A;  3O4X E;  2XRY A;  4RG6 A;  1YA0 A;  2LNI A;  2KWI B;  3EHN A;  2V7J A;  3UUM A;  2R17 C;  5FP3 A;  3AVS A;  5LHI B;  4JHR A;  3RYH E;  2WXP A;  3RPU A;  3LPZ A;  4YFS A;  2AXZ A;  3GZS A;  1MIV A;  3PUJ A;  3ZFW A;  4DLO A;  3APC A;  3SWH A;  3RIB A;  5J90 A;  2N1G A;  3N9Q A;  5J2U E;  2W61 A;  3EUH A;  3EDU A;  3PEU B;  3CST A;  3CX7 B;  3FEX A;  3KDS E;  2WXJ A;  4WW0 A;  5LGT B;  2LOS A;  3VU7 H;  2I1J A;  3PE0 A;  2V8S E;  4QFV A;  4DBR A;  4L1B A;  3UTK A;  3FTS A;  3F57 A;  3N71 A;  2WPV A;  4EBA A;  2KCL A;  2VQ2 A;  3TG5 A;  4ILH B;  1OWL A;  2VYI A;  4O4I E;  3ZVV A;  2FUL A;  2KCV A;  3ONK A;  4H9S E;  1D0X A;  5EKQ D;  5F3J A;  3IHV A;  5FXW A;  2VKD A;  3CX6 B;  4BT8 A;  3L3P A;  4XI9 A;  4GPK A;  5ENN A;  5KJN A;  4H9Q C;  2WXN A;  4WND A;  3BQL A;  2CLY B;  3Q4A B;  3N9O A;  3CVP A;  2WXR A;  1LVF A;  5FZS A;  3MX3 A;  4I1O B;  4UQY A;  3HA4 A;  3LDZ A;  1U3C A;  3FFL A;  5IYZ E;  5EX0 A;  3CVQ A;  3ULQ A;  2FO7 A;  3U66 A;  2YEV C;  1IHG A;  2BVL A;  1BR1 A;  3UUN A;  3KVA A;  4IHJ E;  1MMG A;  2PQR A;  4O2B E;  2CXD A;  3OYZ A;  3GZ2 A;  3C50 A;  4YHJ A;  4Y6W A;  1E7V A;  4ZOL E;  4WBN E;  4YVQ C;  2Y3A A;  2KAT A;  1X5B A;  3N2G E;  4PK4 A;  3ENE A;  3KFW X;  3I5P A;  4WWP A;  1HS6 A;  2R5S A;  2R59 A;  3MJX A;  4G2V A;  2ZM0 A;  2IF4 A;  2LM9 A;  2KMF A;  1QQE A;  3LJ3 A;  4PJM A;  3SD5 A;  3AAE B;  3LYA A;  5FY1 A;  5LHG B;  2Y48 B;  4FLH A;  4B8C B;  3K8P C;  4XIF A;  1XNF A;  3VHL A;  1E8W A;  5LCW J;  3ZPO A;  4EPZ A;  2X6J A;  4JHJ A;  3GN5 B;  3QAR A;  4AKH A;  3JC6 D;  4DI3 A;  2MBG A;  4AKR B;  3WI3 A;  1HE8 A;  2AVP A;  1E8X A;  4O2A E;  2IAK A;  3D9N A;  4X1K E;  3CR3 A;  3KAE A;  5A1L A;  3IEG A;  1EZ3 A;  3M65 A;  3ZCI A;  1OWN A;  4L23 A;  3TGO A;  4KUM B;  3I3N A;  4FU3 A;  5A23 A;  4I43 A;  1JWF A;  2XAG B;  3B7R L;  3SHF A;  3QK6 A;  1DNP A;  5JR9 B;  3PH0 C;  3SFZ A;  2JPF A;  1HZ4 A;  2J9Q A;  2LSG A;  4B8A A;  3S7B A;  2X0L B;  3FTZ A;  3FU5 A;  2NXP A;  4HFG A;  4H63 V;  3G2U A;  1HCI A;  4H9P C;  5HYA A;  1Z3Y A;  3FXD B;  5EK4 A;  2ES0 A;  4LEU A;  3ONX A;  4ANW A;  3LJC A;  3FBL A;  5C8Y E;  1IZN B;  3RKV A;  2LOP A;  3CLJ A;  2H7O A;  3TL5 A;  2V7M A;  4L7T A;  4ADZ A;  1HS7 A;  1MIY A;  3IEE A;  3BQK A;  3WXX A;  5T4Y A;  3MJW A;  4GA1 A;  4N5C A;  3VKH A;  3OXL A;  5DQW A;  5FMN A;  5BW8 C;  4AY5 A;  3ZYK A;  5LG4 A;  2VJ8 A;  1TEZ A;  3UPV A;  2LSU A;  4O4H E;  3T5X A;  1EPU A;  4HEA A;  1P5Q A;  5FZR A;  2LT3 A;  3AS5 A;  3P1U A;  2CLY C;  1H2V C;  2X67 A;  3H3A A;  5LXT E;  4AXP A;  4AY6 A;  4FI5 A;  1OWA A;  3ZRH A;  4PFO A;  2QY7 A;  2ZMA A;  3ML8 A;  3NZS A;  3FTY A;  1MNE A;  3B7S A;  4NRH B;  2C5K T;  3D0T A;  3EVY A;  2X6I A;  4Y6C A;  3IV0 A;  2V1D B;  4AQF A;  4N2Q A;  4B6X A;  2ZM2 A;  2VSN A;  4XAX B;  1TJC A;  2J08 A;  2LO6 A;  4GYO A;  5EDS A;  1BR2 A;  4GYS A;  2XHE A;  3CV0 A;  4G1T A;  4TRQ A;  3ONL A;  1YW0 A;  2W0G A;  4IE5 A;  2VGX B;  5LOZ A;  1EF1 C;  1UJJ A;  1JPL A;  5DJQ C;  1INZ A;  4QX7 B;  5LX8 A;  2XQY A;  3IF8 B;  5HXE A;  4X1Y E;  1KNZ A;  3QNK A;  1N54 A;  2C2L A;  2ZU6 B;  4HGA A;  2L9Q A;  2DHR A;  3HL6 A;  5C2Y A;  1GW6 A;  4N39 A;  2IOL A;  4XI0 A;  3L22 A;  4A1G A;  3LG7 A;  4OYK A;  3I9W A;  3DPD A;  3FHE A;  2BUG A;  3CVY A;  4E85 A;  4E7S A;  5L3B B;  2LSI A;  3AS4 A;  3O4Z A;  3CVU A;  2GRM A;  3NBX X;  4AJW A;  2OVF A;  1HG5 A;  4PFP A;  3ZYM A;  4HS2 A;  3FY4 A;  4YND A;  1SQM A;  3MAC A;  2CM0 A;  1JUQ A;  4L2Y A;  2PBI A;  4H9R C;  4ZS3 A;  5J2T E;  2WXI A;  4AXH A;  2XCC A;  3U3I A;  3B57 A;  2SPC A;  1WAO 1;  3H37 A;  5JR9 C;  5FXZ A;  2XPZ A;  4GZ3 A;  4GK0 E;  3ANW B;  4BTA A;  4AQF C;  3QWP A;  4L0R A;  2BF0 X;  3O1J A;  2WSS V;  2ODU A;  2MYS A;  5A6C A;  1NZN A;  5H6Q B;  4IE6 A;  3T8O A;  2OVB A;  2Q9Q B;  3E4B A;  3U4T A;  3LFM A;  3SZ7 A;  2KZT A;  1H6K A;  3CQC B;  3HHM A;  4OYJ A;  3MV3 B;  2JQQ A;  4UF0 B;  3FUI A;  1KT1 A;  2VL8 A;  3RO3 A;  3RRU A;  4I9C A;  3QWV A;  4ACK A;  2A3D A;  2ZLY A;  1HXI A;  3I4G A;  2UXX B;  1S35 A;  1YD8 G;  1D1A A;  2XAH B;  2OA5 A;  3PEV B;  5FTP A;  1H0A A;  1MIW A;  4JEH A;  3K3Q C;  5HAX A;  5JDN A;  2CHX A;  1UW4 B;  2IU1 A;  2NTY A;  4KBQ A;  4C0M A;  3LK2 B;  2EHO A;  3O1H A;  3QWW A;  4CDN A;  4ILI A;  5CCL A;  3S7D A;  5KX5 E;  4EBA G;  2ILR A;  1D0Z A;  3AVR A;  3RU0 A;  4AIF A;  4H63 H;  5ARF A;  5L3C B;  5JJ6 A;  4PH4 B;  1UX5 A;  2H3R A;  3ZC0 A;  4GA0 A;  4ABN A;  2PQN A;  3MV2 B;  3UUX A;  5FXX A;  1MQS A;  4BAY B;  4J2C A;  3RYF E;  2E2E A;  5DQV A;  3GYZ A;  2L3L A;  2XAQ B;  3MGB A;  4P0B A;  4L2L A;  2Z6E A;  2WXK A;  2LSK A;  4PJL A;  4UV9 B;  3QC1 A;  3UT4 A;  4KMO A;  2V5F A;  4JA7 A;  1HU3 A;  3L08 A;  3EIJ A;  3FTX A;  4NUR A;  4WNF A;  3AA6 B;  1TJF A;  3CVV A;  4MFR A;  4CI2 B;  3LY8 A;  5CMY A;  2IW5 B;  4LER A;  2PM7 A;  4QXB B;  2HM8 A;  4YVO A;  2HPL A;  2D5U A;  2N9D A;  4WNG A;  3PUG A;  4UWH A;  3AU5 A;  5JRE A;  5G05 C;  4GA2 A;  3GW4 A;  4CCA A;  2PZI A;  3EDT B;  2ODV A;  3PUK A;  3LCA A;  4D10 C;  2NSZ A;  5KJM A;  3HKE E;  3VTY A;  3BK9 A;  4I55 E;  3ZMZ B;  1N52 A;  3FU0 A;  3UX4 A;  5FQ4 A;  4HE8 A;  4UVC B;  2WMO A;  3ZYL A;  4BTB A;  5FNV E;  5LFA A;  3EHM A;  1EDU A;  2CG2 A;  3ZMU B;  3ASH A;  3PUR A;  4OK0 A;  3ZJ1 A;  3HI2 A;  2I2O A;  2CXF A;  4IN3 B;  4QWN B;  4TV9 E;  3OJA A;  3IHR A;  5JJT A;  4PS3 A;  3JQ0 A;  4LRZ A;  3ZC1 A;  4U8H A;  3C64 A;  1E1H B;  2XPI A;  5BPP A;  2RA1 A;  2L9B A;  3R7R A;  3CWZ B;  3AS8 A;  5HXH A;  2BDE A;  3EIQ C;  4QKN A;  3B7T A;  4GYW A;  4MLP A;  4BJN A;  5JDQ A;  5AIJ A;  2VWA A;  4DMW A;  4ANU A;  2PFV A;  4DPR A;  3ETU A;  1ELK A;  5CCM A;  5AFU L;  5DIZ A;  1ZV4 X;  5HXR A;  3IHY A;  5AEN A;  1LVK A;  1O3X A;  4GIW A;  3RO2 A;  2X3M A;  5JDL A;  3RC8 A;  3FU6 A;  2Q9Q C;  3URZ A;  4IRU A;  1UN8 A;  3CQX C;  3RKO A;  2LSJ A;  4U72 A;  2I1K A;  4FHK A;  4HOU A;  4AEZ C;  5LBM A;  3MKQ A;  2QGS A;  4MBQ A;  4AQG A;  4CI3 B;  2VB6 A;  1G73 A;  4OVV A;  3TAX A;  4AM9 A;  2VTB A;  2W62 A;  3ZPJ A;  3MZK B;  5CMW A;  1Y64 B;  1ZEE A;  1ZKE A;  5FWQ A;  2XGO A;  4K0R A;  3WAJ A;  4N3C A;  3UMV A;  4YJ3 E;  3QAQ A;  3LXU X;  1E8Z A;  3PE4 A;  4URK A;  5DAB A;  4I43 B;  2V7I A;  5EZY E;  4JL0 A;  2K5B B;  4PW8 A;  4F7A A;  2MOW A;  4CXW A;  4I2W A;  3KV6 A;  1W3B A;  3KBU A;  2IQC A;  2WWU A;  4G26 A;  5A7D B;  3C4W A;  3CHQ A;  5EK3 A;  4GYY A;  3IBE A;  3HYM B;  3CX8 B;  1Z3X A;  2XRZ A;  3MEK A;  3QKY A;  2WXG A;  2K9A A;  4GZ5 A;  5T3R A;  2NTX A;  4UEM A;  1E96 B;  3CVN A;  4XE0 A;  4U63 A;  2UY1 A;  3CHS A;  3LY7 A;  2WBL A;  4JEU A;  2WXQ A;  4UXN B;  4EZ4 A;  4EEC A;  3ZW3 A;  3NZU A;  5L3G B;  1YKE B;  3ZEF A;  4CXY A;  4HXI A;  1NP7 A;  3PE3 A;  4KT6 B;  3RK6 A;  4EIW A;  1OXZ A;  5AJD A;  2MRI A;  2X9W A;  3OTN A;  4IUL A;  2M63 A;  4FUL A;  2YIN A;  4TX5 A;  2C0S A;  5LGN B;  3I9Y A;  3UT5 E;  2A4Z A;  2OND A;  2FI7 A;  2L6J A;  4Q96 A;  5BV0 A;  2P58 C;  5FT9 A;  4DND A;  1KT0 A;  3ZMT B;  3Q5X A;  4BY6 A;  4E7Z A;  2FEZ A;  3LVR E;  3CVL A;  3AAI A;  5HWY A;  4UI9 C;  3C4Z A;  4CI1 B;  2XTL A;  1H7C A;  3GMI A;  2D2S A;  4UVA B;  2A72 A;  4H7Y A;  4CT0 A;  3CML A;  4YJ2 E;  4DJA A;  4C91 A;  3U9W A;  3I0Q A;  3HKB E;  3S2A A;  3RYC E;  2XPY A;  2DCP A;  1KK7 A;  1YKH B;  5LGU B;  3SGH A;  3N2O A;  1IJ6 A;  2MTQ A;  2WM9 A;  2X51 A;  3KV9 A;  3CVW A;  1UN9 A;  3G2V A;  2X6F A;  2WXF A;  4KZC A;  2XHE B;  2L8K A;  4I50 E;  2E9X D;  3ZN1 B;  4ZS2 A;  3SBS A;  4KZ0 A;  1US7 B;  3L6A A;  4QX8 B;  4RSY A;  3D9O A;  4JVS A;  3TG4 A;  2PM6 A;  2D0T A;  5FQ8 A;  3I0O A;  3FU3 A;  4PNI A;  3GWH A;  5LA6 E;  2RP4 A;  2I6H A;  4EOZ B;  4I9E A;  4DK5 A;  4BX9 A;  2KZ7 B;  4CGV A;  4WNE A;  2OV8 A;  3ZHE A;  1U4Q A;  5L2L A;  3G2S A;  4RVB A;  1MND A;  3ML9 A;  4J6I A;  3MA9 A;  3PTR B;  5BNW A;  4HKA A;  4MHC A;  5LHH B;  5AJL A;  3CGH A;  4IYP A;  1FIO A;  4O4L E;  4QXH B;  3NF1 A;  4O8S A;  5JH7 E;  5JHB A;  1UX4 A;  2B1E A;  4XBF B;  4GAA A;  3F2E A;  1HO8 A;  3RYI E;  1HG2 A;  4B94 A;  3MKR A;  3APD A;  4OFZ A;  4P0A A;  4UV8 B;  5LP6 E;  4TZ4 C;  2Y4U A;  3LBX A;  4UI9 K;  4F53 A;  4EB6 E;  5LNK A;  2V7K A;  3P8C D;  2YNQ A;  2MHK A;  2VKJ A;  5BV1 A;  4PAG A;  2YHE A;  3N9N A;  4J8E A;  1FCH A;  5JRC A;  2AXU A;  3QJZ A;  5BT1 A;  3ESL A;  3PDN A;  4HTE A;  2NW8 A;  3O48 A;  4K03 A;  3FB2 A;  2E9X A;  2DLR A;  1FMV A;  2VAS A;  2KZT B;  3FUN A;  4HOS A;  4GU5 A;  2BTD A;  3N9P A;  3J7Y q;  4Q69 A;  4ME2 A;  5H6R B;  5TAO A;  5JQG E;  4UWL A;  2AW6 A;  2Y4T A;  2FBN A;  3PRZ A;  2YHC A;  4BT9 A;  4CXX A;  3K9I A;  3KS2 A;  4JEH B;  2CMR A;  1HH8 A;  3Q5M A;  1QNF A;  4FJY A;  1LF8 A;  1UJK A;  4G24 A;  4I1M A;  3CHP A;  3MZL B;  4WAF A;  1ZBP A;  3HKD E;  2EHO B;  5E76 A;  2X68 A;  3C4X A;  2YQ8 A;  4JPS A;  1ZHC A;  4FAD A;  3KBT A;  2KC7 A;  5ANR A;  3FP3 A;  2AXV A;  1WM5 A;  4V3I A;  1D0Y A;  4G23 A;  5IHY A;  2KXP B;  2C5I T;  1WRD A;  3SF4 A;  3DP7 A;  3UUX B;  3CPZ A;  3RJV A;  1S94 A;  5J08 A;  2W00 A;  4GZD A;  4ANV A;  4EZH A;  5G05 J;  3CIA A;  4DMV A;  2I59 A;  3VLF A;  5G2N A;  1D1C A;  3NRY A;  1Y8M A;  5JDF A;  2X6H A;  3CKB A;  2DCF A;  3E22 E;  2WMN A;  5CHE E;  1BR0 A;  4I6G A;  4EZJ A;  3RX6 A;  2VSX E;  3FHN A;  4I4T E;  1IAP A;  1HF8 A;  4JHK A;  2X66 A;  2WAU A;  2Y8D A;  2CHZ A;  4FC8 A;  3KD7 A;  4CGW A;  5M72 A;  3CHM A;  3Q47 B;  2Q9Q D;  3LK4 2;  4TV3 A;  4OHF A;  2GGF A;  3QOU A;  3CQG B;  1DVP A;  3HVE B;  2XCB A;  5FY7 A;  3U3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...