1HG8A

Endopolygalacturonase from the phytopathogenic fungus fusarium moniliforme
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
DPCSVTEYSGLATAVSSCKNIVLNGFQVPTGKQLDLSSLQNDSTVTFKGTTTFATTADNDFNPIVISGSNITITGASGHVIDGNGQAYWDGKGSNSNSNQKPDHFIVVQKTTGNSKITNLNIQNWPVHCFDITGSSQLTISGLILDNRAGDKPNAKSGSLPAAHNTDGFDISSSDHVTLDNNHVYNQDDCVAVTSGTNIVVSNMYCSGGHGLSIGSVGGKSDNVVDGVQFLSSQVVNSQNGCRIKSNSGATGTINNVTYQNIALTNISTYGVDVQQDYLNGGPTGKPTNGVKISNIKFIKVTGTVASSAQDWFILCGDGSCSGFTFSGNAITGGGKTSSCNYPTNTCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Requirements of Endopolygalacturonase for the Interaction with Pgip (Polygalacturonase-Inhibiting Protein)
pubmed doi rcsb
source organism Fusarium moniliforme
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
total genus 133
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1hg8A00
1O8MA 1HG8A 4NK6A 4XKWA 1O8KA 4XN0A 4XLFA 4AVZA 1EE6A 1O8FA 1OGMX 1QJVA 4XMYA 3GQAA 2X3HA 3VMWA 1O8EA 4U49A 1QCXA 4OZZA 2INUA 3VSUA 4XLAA 3SUCA 4OJ6A 1PE9A 4MR0A 4Z03A 3B90A 1OFMA 1O8LA 5C1EA 3GRHA 4YZXA 4OJPA 4XL9A 3WWGA 1BHEA 2QXZA 2IQ7A 2QY1A 1K5CA 2O17A 1O8HA 2NT9A 2UVFA 1RWRA 1VBLA 2INVA 2QX3A 4YELA 1OFLA 2Z8GA 2BSPA 3VSTA 4XONA 1DBOA 4XQFA 1BN8A 4U4BA 3B8YA 3GQ7A 1KTWA 2NTQA 4XNFA 4W8QA 3EQOA 4XOTA 1IA5A 4W8SA 1WMRA 4XOPA 3KRGA 1KCCA 4XKVA 2VBMA 3B4NA 1XG2A 1JRGA 3JURA 3VMVA 1JTAA 4YZQA 4OJOA 3GQ8A 1O8JA 2NZMA 4HWVA 4PMHA 4Z06A 1H80A 1IB4A 4XN3A 4XORA 4YZAA 5AMVA 2ODLA 2VJJA 2NSPA 3FY3A 2O04A 2O0WA 2O1DA 4XLHA 1O88A 1IDKA 3T9GA 4W8RA 4W8TA 2O0VA 4XM3A 1OGOX 1O8GA 4OJLA 4XLCA 4EW9A 1DBGA 1GQ8A 4YEJA 2UVEA 1CZFA 1O8IA 1PLUA 1X0CA 4C2LA 1RU4A 1IDJA 2PYHA 1NHCA 2PECA 4YZ0A 1KCDA 2NTPA 3LMWA 4OZYA 2VBEA 3EQNA 3VSVA 1RMGA 2X6YA 3GQ9A 4URRA 1PXZA 2X85A 1OOCA 2NSTA 4NK8A 4XR6A 1O8DA 2NTBA 3UW0A 2VBKA 2NT6A 1AIRA 2X6WA 4OJ5A 4MXNA 2X6XA 4XLEA 4I84A 2EWEA 2VJIA 3ZSCA 4Z05A 3ZPPA 2PYGA 5C1CA
chains in the Genus database with same CATH superfamily
1O8MA 4OM9A 1TSPA 2BM7A 1HG8A 4NK6A 4XKWA 1O8KA 4XN0A 4XLFA 4AVZA 1EE6A 1O8FA 1QA1A 2BM6A 1QA2A 1OGMX 1QJVA 3RIQA 4XMYA 3SQVA 3GQAA 1HF2A 1QQ1A 2X3HA 3VMWA 1TYVA 2O6WA 1TYWA 2XTYA 3BH7B 5JMCB 1O8EA 4U49A 4YC5A 1QCXA 4OZZA 4YCQA 3SYJA 2INUA 2B0RA 4JRAC 4XLAA 4KH3A 3SUCA 3VSUA 4OJ6A 1PE9A 4MR0A 4Z03A 1QRBA 3B90A 4YEIA 4YDTA 1OFMA 1K4ZA 1O8LA 5C1EA 3GRHA 4YZXA 4OJPA 4XL9A 3ML3A 3WWGA 1BHEA 2IQ7A 2QXZA 2QY1A 4YFOA 1K5CA 2O17A 1O8HA 2NT9A 2UVFA 5DNSA 1RWRA 3PSZA 1TYXA 1VBLA 3NB2A 3JX8A 2INVA 2QX3A 4YELA 1OFLA 2Z8GA 2BSPA 3VSTA 4XONA 1DBOA 3TH0A 4XQFA 1CLWA 2XTWA 1BN8A 4U4BA 3B8YA 3GQ7A 3LYCA 1KTWA 2NTQA 2W7ZA 4XNFA 3SZEA 1L1IA 4W8QA 3EQOA 4XOTA 1IA5A 3BH6B 1TYUA 3PETA 1WMRA 4W8SA 4XOPA 3AK5A 3KRGA 1KCCA 4XKVA 2VBMA 3B4NA 1XG2A 1JRGA 3JURA 3VMVA 1JTAA 4YZQA 3P4GA 4OJOA 1OFDA 2J8KA 1WXRA 2YUHA 3N90A 2XT4A 3GQ8A 1O8JA 2NZMA 4HWVA 4PMHA 4Z06A 1OFEA 1H80A 2XTXA 3PSSA 1IB4A 4XN3A 4XORA 1EA0A 3NAWA 4YZAA 2ODLA 2VJJA 2NSPA 3FY3A 5AMVA 1EZGA 1LLZA 2O04A 2VFQA 2O0WA 2QYUA 2O1DA 1K8FA 4XLHA 1O88A 1IDKA 3T9GA 1KQ5A 2VFOA 4W8RA 4W8TA 2O0VA 2BM5A 4XM3A 2F3LA 3N6ZA 1OGOX 3LJYA 1O8GA 4OJLA 4XLCA 2BM4A 1DBGA 1GQ8A 4YEJA 4EW9A 2G0YA 2UVEA 1CZFA 1O8IA 1PLUA 1X0CA 4C2LA 5JLVC 1RU4A 1IDJA 2PYHA 2IOUG 1NHCA 3H09A 2XT2A 3DU1X 1QRCA 1QA3A 4V02C 2PECA 1LM1A 2VFPA 4YZ0A 2NTPA 3LMWA 4OZYA 1KCDA 2VBEA 2V5IA 2XC1A 3EQNA 3VSVA 1RMGA 2X6YA 3GQ9A 4URRA 1PXZA 2J8IA 2X85A 2NSTA 1OOCA 4NK8A 4XR6A 1O8DA 2NTBA 3UW0A 3SY2A 2VBKA 2NT6A 1AIRA 2X6WA 4OJ5A 2VFMA 4MXNA 2X6XA 1DABA 4XLEA 4I84A 2EWEA 2VJIA 3ZSCA 1LLWA 2QZAA 2VFNA 4Z05A 4OPWA 3ZPPA 2PYGA 5C1CA 2BX6A
chains in the Genus database with same CATH topology
1O8MA 1HG8A 4NK6A 4XKWA 1O8KA 4XN0A 4XLFA 4AVZA 1EE6A 1O8FA 1OGMX 1QJVA 4XMYA 3GQAA 2X3HA 3VMWA 1O8EA 4U49A 1QCXA 4OZZA 2INUA 3VSUA 4XLAA 3SUCA 4OJ6A 1PE9A 4MR0A 4Z03A 3B90A 1OFMA 1O8LA 5C1EA 3GRHA 4YZXA 4OJPA 4XL9A 3WWGA 1BHEA 2QXZA 2IQ7A 2QY1A 1K5CA 2O17A 1O8HA 2NT9A 2UVFA 1RWRA 1VBLA 2INVA 2QX3A 4YELA 1OFLA 2Z8GA 2BSPA 3VSTA 4XONA 1DBOA 4XQFA 1BN8A 4U4BA 3B8YA 3GQ7A 1KTWA 2NTQA 4XNFA 4W8QA 3EQOA 4XOTA 1IA5A 4W8SA 1WMRA 4XOPA 3KRGA 1KCCA 4XKVA 2VBMA 3B4NA 1XG2A 1JRGA 3JURA 3VMVA 1JTAA 4YZQA 4OJOA 3GQ8A 1O8JA 2NZMA 4HWVA 4PMHA 4Z06A 1H80A 1IB4A 4XN3A 4XORA 4YZAA 5AMVA 2ODLA 2VJJA 2NSPA 3FY3A 2O04A 2O0WA 2O1DA 4XLHA 1O88A 1IDKA 3T9GA 4W8RA 4W8TA 2O0VA 4XM3A 1OGOX 1O8GA 4OJLA 4XLCA 4EW9A 1DBGA 1GQ8A 4YEJA 2UVEA 1CZFA 1O8IA 1PLUA 1X0CA 4C2LA 1RU4A 1IDJA 2PYHA 1NHCA 2PECA 4YZ0A 1KCDA 2NTPA 3LMWA 4OZYA 2VBEA 3EQNA 3VSVA 1RMGA 2X6YA 3GQ9A 4URRA 1PXZA 2X85A 1OOCA 2NSTA 4NK8A 4XR6A 1O8DA 2NTBA 3UW0A 2VBKA 2NT6A 1AIRA 2X6WA 4OJ5A 4MXNA 2X6XA 4XLEA 4I84A 2EWEA 2VJIA 3ZSCA 4Z05A 3ZPPA 2PYGA 5C1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8M A;  1HG8 A;  4NK6 A;  4XKW A;  1O8K A;  4XN0 A;  4XLF A;  4AVZ A;  1EE6 A;  1O8F A;  1OGM X;  1QJV A;  4XMY A;  3GQA A;  2X3H A;  3VMW A;  1O8E A;  4U49 A;  1QCX A;  4OZZ A;  2INU A;  3VSU A;  4XLA A;  3SUC A;  4OJ6 A;  1PE9 A;  4MR0 A;  4Z03 A;  3B90 A;  1OFM A;  1O8L A;  5C1E A;  3GRH A;  4YZX A;  4OJP A;  4XL9 A;  3WWG A;  1BHE A;  2QXZ A;  2IQ7 A;  2QY1 A;  1K5C A;  2O17 A;  1O8H A;  2NT9 A;  2UVF A;  1RWR A;  1VBL A;  2INV A;  2QX3 A;  4YEL A;  1OFL A;  2Z8G A;  2BSP A;  3VST A;  4XON A;  1DBO A;  4XQF A;  1BN8 A;  4U4B A;  3B8Y A;  3GQ7 A;  1KTW A;  2NTQ A;  4XNF A;  4W8Q A;  3EQO A;  4XOT A;  1IA5 A;  4W8S A;  1WMR A;  4XOP A;  3KRG A;  1KCC A;  4XKV A;  2VBM A;  3B4N A;  1XG2 A;  1JRG A;  3JUR A;  3VMV A;  1JTA A;  4YZQ A;  4OJO A;  3GQ8 A;  1O8J A;  2NZM A;  4HWV A;  4PMH A;  4Z06 A;  1H80 A;  1IB4 A;  4XN3 A;  4XOR A;  4YZA A;  5AMV A;  2ODL A;  2VJJ A;  2NSP A;  3FY3 A;  2O04 A;  2O0W A;  2O1D A;  4XLH A;  1O88 A;  1IDK A;  3T9G A;  4W8R A;  4W8T A;  2O0V A;  4XM3 A;  1OGO X;  1O8G A;  4OJL A;  4XLC A;  4EW9 A;  1DBG A;  1GQ8 A;  4YEJ A;  2UVE A;  1CZF A;  1O8I A;  1PLU A;  1X0C A;  4C2L A;  1RU4 A;  1IDJ A;  2PYH A;  1NHC A;  2PEC A;  4YZ0 A;  1KCD A;  2NTP A;  3LMW A;  4OZY A;  2VBE A;  3EQN A;  3VSV A;  1RMG A;  2X6Y A;  3GQ9 A;  4URR A;  1PXZ A;  2X85 A;  1OOC A;  2NST A;  4NK8 A;  4XR6 A;  1O8D A;  2NTB A;  3UW0 A;  2VBK A;  2NT6 A;  1AIR A;  2X6W A;  4OJ5 A;  4MXN A;  2X6X A;  4XLE A;  4I84 A;  2EWE A;  2VJI A;  3ZSC A;  4Z05 A;  3ZPP A;  2PYG A;  5C1C A; 
#chains in the Genus database with same CATH topology
 1O8M A;  4OM9 A;  1TSP A;  2BM7 A;  1HG8 A;  4NK6 A;  4XKW A;  1O8K A;  4XN0 A;  4XLF A;  4AVZ A;  1EE6 A;  1O8F A;  1QA1 A;  2BM6 A;  1QA2 A;  1OGM X;  1QJV A;  3RIQ A;  4XMY A;  3SQV A;  3GQA A;  1HF2 A;  1QQ1 A;  2X3H A;  3VMW A;  1TYV A;  2O6W A;  1TYW A;  2XTY A;  3BH7 B;  5JMC B;  1O8E A;  4U49 A;  4YC5 A;  1QCX A;  4OZZ A;  4YCQ A;  3SYJ A;  2INU A;  2B0R A;  4JRA C;  4XLA A;  4KH3 A;  3SUC A;  3VSU A;  4OJ6 A;  1PE9 A;  4MR0 A;  4Z03 A;  1QRB A;  3B90 A;  4YEI A;  4YDT A;  1OFM A;  1K4Z A;  1O8L A;  5C1E A;  3GRH A;  4YZX A;  4OJP A;  4XL9 A;  3ML3 A;  3WWG A;  1BHE A;  2IQ7 A;  2QXZ A;  2QY1 A;  4YFO A;  1K5C A;  2O17 A;  1O8H A;  2NT9 A;  2UVF A;  5DNS A;  1RWR A;  3PSZ A;  1TYX A;  1VBL A;  3NB2 A;  3JX8 A;  2INV A;  2QX3 A;  4YEL A;  1OFL A;  2Z8G A;  2BSP A;  3VST A;  4XON A;  1DBO A;  3TH0 A;  4XQF A;  1CLW A;  2XTW A;  1BN8 A;  4U4B A;  3B8Y A;  3GQ7 A;  3LYC A;  1KTW A;  2NTQ A;  2W7Z A;  4XNF A;  3SZE A;  1L1I A;  4W8Q A;  3EQO A;  4XOT A;  1IA5 A;  3BH6 B;  1TYU A;  3PET A;  1WMR A;  4W8S A;  4XOP A;  3AK5 A;  3KRG A;  1KCC A;  4XKV A;  2VBM A;  3B4N A;  1XG2 A;  1JRG A;  3JUR A;  3VMV A;  1JTA A;  4YZQ A;  3P4G A;  4OJO A;  1OFD A;  2J8K A;  1WXR A;  2YUH A;  3N90 A;  2XT4 A;  3GQ8 A;  1O8J A;  2NZM A;  4HWV A;  4PMH A;  4Z06 A;  1OFE A;  1H80 A;  2XTX A;  3PSS A;  1IB4 A;  4XN3 A;  4XOR A;  1EA0 A;  3NAW A;  4YZA A;  2ODL A;  2VJJ A;  2NSP A;  3FY3 A;  5AMV A;  1EZG A;  1LLZ A;  2O04 A;  2VFQ A;  2O0W A;  2QYU A;  2O1D A;  1K8F A;  4XLH A;  1O88 A;  1IDK A;  3T9G A;  1KQ5 A;  2VFO A;  4W8R A;  4W8T A;  2O0V A;  2BM5 A;  4XM3 A;  2F3L A;  3N6Z A;  1OGO X;  3LJY A;  1O8G A;  4OJL A;  4XLC A;  2BM4 A;  1DBG A;  1GQ8 A;  4YEJ A;  4EW9 A;  2G0Y A;  2UVE A;  1CZF A;  1O8I A;  1PLU A;  1X0C A;  4C2L A;  5JLV C;  1RU4 A;  1IDJ A;  2PYH A;  2IOU G;  1NHC A;  3H09 A;  2XT2 A;  3DU1 X;  1QRC A;  1QA3 A;  4V02 C;  2PEC A;  1LM1 A;  2VFP A;  4YZ0 A;  2NTP A;  3LMW A;  4OZY A;  1KCD A;  2VBE A;  2V5I A;  2XC1 A;  3EQN A;  3VSV A;  1RMG A;  2X6Y A;  3GQ9 A;  4URR A;  1PXZ A;  2J8I A;  2X85 A;  2NST A;  1OOC A;  4NK8 A;  4XR6 A;  1O8D A;  2NTB A;  3UW0 A;  3SY2 A;  2VBK A;  2NT6 A;  1AIR A;  2X6W A;  4OJ5 A;  2VFM A;  4MXN A;  2X6X A;  1DAB A;  4XLE A;  4I84 A;  2EWE A;  2VJI A;  3ZSC A;  1LLW A;  2QZA A;  2VFN A;  4Z05 A;  4OPW A;  3ZPP A;  2PYG A;  5C1C A;  2BX6 A; 
#chains in the Genus database with same CATH homology
 1O8M A;  1HG8 A;  4NK6 A;  4XKW A;  1O8K A;  4XN0 A;  4XLF A;  4AVZ A;  1EE6 A;  1O8F A;  1OGM X;  1QJV A;  4XMY A;  3GQA A;  2X3H A;  3VMW A;  1O8E A;  4U49 A;  1QCX A;  4OZZ A;  2INU A;  3VSU A;  4XLA A;  3SUC A;  4OJ6 A;  1PE9 A;  4MR0 A;  4Z03 A;  3B90 A;  1OFM A;  1O8L A;  5C1E A;  3GRH A;  4YZX A;  4OJP A;  4XL9 A;  3WWG A;  1BHE A;  2QXZ A;  2IQ7 A;  2QY1 A;  1K5C A;  2O17 A;  1O8H A;  2NT9 A;  2UVF A;  1RWR A;  1VBL A;  2INV A;  2QX3 A;  4YEL A;  1OFL A;  2Z8G A;  2BSP A;  3VST A;  4XON A;  1DBO A;  4XQF A;  1BN8 A;  4U4B A;  3B8Y A;  3GQ7 A;  1KTW A;  2NTQ A;  4XNF A;  4W8Q A;  3EQO A;  4XOT A;  1IA5 A;  4W8S A;  1WMR A;  4XOP A;  3KRG A;  1KCC A;  4XKV A;  2VBM A;  3B4N A;  1XG2 A;  1JRG A;  3JUR A;  3VMV A;  1JTA A;  4YZQ A;  4OJO A;  3GQ8 A;  1O8J A;  2NZM A;  4HWV A;  4PMH A;  4Z06 A;  1H80 A;  1IB4 A;  4XN3 A;  4XOR A;  4YZA A;  5AMV A;  2ODL A;  2VJJ A;  2NSP A;  3FY3 A;  2O04 A;  2O0W A;  2O1D A;  4XLH A;  1O88 A;  1IDK A;  3T9G A;  4W8R A;  4W8T A;  2O0V A;  4XM3 A;  1OGO X;  1O8G A;  4OJL A;  4XLC A;  4EW9 A;  1DBG A;  1GQ8 A;  4YEJ A;  2UVE A;  1CZF A;  1O8I A;  1PLU A;  1X0C A;  4C2L A;  1RU4 A;  1IDJ A;  2PYH A;  1NHC A;  2PEC A;  4YZ0 A;  1KCD A;  2NTP A;  3LMW A;  4OZY A;  2VBE A;  3EQN A;  3VSV A;  1RMG A;  2X6Y A;  3GQ9 A;  4URR A;  1PXZ A;  2X85 A;  1OOC A;  2NST A;  4NK8 A;  4XR6 A;  1O8D A;  2NTB A;  3UW0 A;  2VBK A;  2NT6 A;  1AIR A;  2X6W A;  4OJ5 A;  4MXN A;  2X6X A;  4XLE A;  4I84 A;  2EWE A;  2VJI A;  3ZSC A;  4Z05 A;  3ZPP A;  2PYG A;  5C1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...