1HG8A

Endopolygalacturonase from the phytopathogenic fungus fusarium moniliforme
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
b'DPCSVTEYSGLATAVSSCKNIVLNGFQVPTGKQLDLSSLQNDSTVTFKGTTTFATTADNDFNPIVISGSNITITGASGHVIDGNGQAYWDGKGSNSNSNQKPDHFIVVQKTTGNSKITNLNIQNWPVHCFDITGSSQLTISGLILDNRAGDKPNAKSGSLPAAHNTDGFDISSSDHVTLDNNHVYNQDDCVAVTSGTNIVVSNMYCSGGHGLSIGSVGGKSDNVVDGVQFLSSQVVNSQNGCRIKSNSGATGTINNVTYQNIALTNISTYGVDVQQDYLNGGPTGKPTNGVKISNIKFIKVTGTVASSAQDWFILCGDGSCSGFTFSGNAITGGGKTSSCNYPTNTCPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Structural Requirements of Endopolygalacturonase for the Interaction with Pgip (Polygalacturonase-Inhibiting Protein)
pubmed doi rcsb
source organism Fusarium moniliforme
molecule tags Hydrolase
total genus 133
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1hg8A00
4I84A 1BN8A 1KTWA 1JTAA 4XLEA 1JRGA 4W8TA 1RU4A 4XORA 4YZ0A 1KCCA 3UW0A 4OJLA 2VBKA 3VSTA 2ODLA 2NT9A 3VSVA 3WWGA 1K5CA 4HWVA 4OJOA 3VMVA 4XLCA 3KRGA 4XLHA 3FY3A 2PYGA 2O17A 4YZXA 4XNFA 1O8LA 4YEJA 4XR6A 2NSTA 1DBOA 3B8YA 4MXNA 4XONA 1PE9A 4NK8A 4XN0A 2O04A 2UVFA 3T9GA 4U49A 4XL9A 4XQFA 4U4BA 1OGOX 4XLFA 1O8IA 1QJVA 2X6YA 3GQ9A 4W8SA 1EE6A 1PLUA 1O8DA 4XMYA 2UVEA 4XOTA 3VSUA 2X6WA 1XG2A 1GQ8A 1HG8A 1OFMA 2X3HA 3VMWA 2PECA 5AMVA 2NTQA 1KCDA 2QXZA 5C1EA 2INVA 4XLAA 2EWEA 2O0VA 2QX3A 3ZSCA 3GRHA 1AIRA 3LMWA 2VBMA 2O1DA 3ZPPA 3JURA 3SUCA 1O8FA 4Z03A 1X0CA 2VJIA 4OJ5A 4URRA 1VBLA 1O8JA 3EQOA 3GQAA 1DBGA 4OZYA 2NZMA 3B90A 2X85A 2VJJA 2BSPA 4XOPA 5C1CA 1O8MA 4EW9A 4W8RA 1O8GA 1H80A 1OOCA 4XN3A 1OGMX 3GQ8A 2NSPA 4YZAA 2NTBA 1IA5A 3GQ7A 4OZZA 1PXZA 1O8HA 2Z8GA 4XM3A 2X6XA 4XKVA 4PMHA 4Z06A 1IB4A 4YELA 4AVZA 2NTPA 1IDJA 1RMGA 3EQNA 2QY1A 1O8KA 1NHCA 1WMRA 2PYHA 4C2LA 2INUA 1OFLA 2IQ7A 2VBEA 4Z05A 1CZFA 4YZQA 4NK6A 4OJ6A 4MR0A 2O0WA 4W8QA 1O8EA 2NT6A 1BHEA 1IDKA 4XKWA 1QCXA 1RWRA 1O88A 4OJPA 3B4NA
chains in the Genus database with same CATH superfamily
4I84A 1BN8A 2W7ZA 3AK5A 1KTWA 1JTAA 1LLWA 2VFQA 3LYCA 1JRGA 1QRCA 1RU4A 4W8TA 1TYUA 4XLEA 2J8IA 4XORA 3UW0A 4YZ0A 4OJLA 2VBKA 2VFOA 3VSTA 2ODLA 2QYUA 5JMCB 2NT9A 3VSVA 3WWGA 1K5CA 4HWVA 4OJOA 3VMVA 1DABA 4XLCA 3KRGA 2XTWA 1EA0A 1TYVA 4XLHA 1QRBA 3FY3A 2PYGA 2O17A 4YZXA 4XNFA 3SZEA 3H09A 1O8LA 3NB2A 3N90A 4YEJA 4XR6A 3LJYA 2NSTA 4JRAC 1DBOA 3B8YA 4MXNA 4XONA 1PE9A 4NK8A 4XN0A 4KH3A 3TH0A 2BX6A 2BM7A 2O04A 2UVFA 2VFNA 3T9GA 2XTXA 1EZGA 4U49A 4XL9A 1LLZA 4YCQA 2B0RA 4OPWA 4XQFA 4U4BA 1OGOX 2J8KA 3ML3A 4XLFA 2XT2A 3N6ZA 1O8IA 1QJVA 3JX8A 2BM6A 1QA3A 2X6YA 3SYJA 3GQ9A 4W8SA 1EE6A 1HF2A 1PLUA 1O8DA 4XMYA 2UVEA 4XOTA 3VSUA 2X6WA 1XG2A 1GQ8A 1OFDA 1HG8A 4YFOA 1KQ5A 1OFMA 2BM5A 2X3HA 2VFMA 5DNSA 3VMWA 2PECA 5AMVA 2NTQA 1KCDA 1QQ1A 2QXZA 2YUHA 5C1EA 4YDTA 2INVA 4XLAA 2EWEA 2O0VA 2QX3A 3P4GA 3ZSCA 2V5IA 2IOUG 2O6WA 3GRHA 1AIRA 1TYXA 3LMWA 2VBMA 2O1DA 3ZPPA 1CLWA 3JURA 3SUCA 1O8FA 4OM9A 4Z03A 1X0CA 2VJIA 4OJ5A 4URRA 1VBLA 3SQVA 1O8JA 3EQOA 2XC1A 3GQAA 1DBGA 4OZYA 2NZMA 2QZAA 3B90A 1K4ZA 3PSSA 2X85A 3NAWA 2VJJA 2BSPA 4XOPA 1OFEA 5C1CA 1L1IA 1O8MA 4EW9A 4W8RA 2XT4A 1O8GA 1H80A 1OOCA 4XN3A 1OGMX 3GQ8A 2NSPA 4YZAA 2NTBA 1IA5A 3GQ7A 4OZZA 1WXRA 1PXZA 1O8HA 1TYWA 2Z8GA 2XTYA 4XM3A 2X6XA 4XKVA 4PMHA 4Z06A 1IB4A 4YELA 4AVZA 3PSZA 2NTPA 1IDJA 1RMGA 3EQNA 2QY1A 4YC5A 1O8KA 3RIQA 1NHCA 2BM4A 1WMRA 2PYHA 2F3LA 2INUA 1OFLA 4C2LA 2IQ7A 4YEIA 4V02C 1KCCA 1QA1A 2VBEA 4Z05A 1K8FA 3SY2A 1CZFA 3PETA 4NK6A 4OJ6A 4YZQA 2VFPA 4MR0A 2O0WA 4W8QA 1O8EA 2NT6A 1TSPA 3DU1X 1BHEA 1QA2A 1IDKA 5JLVC 4XKWA 1QCXA 1RWRA 1O88A 4OJPA 3BH7B 3B4NA 3BH6B 2G0YA 1LM1A
chains in the Genus database with same CATH topology
4I84A 1BN8A 1KTWA 1JTAA 4XLEA 1JRGA 4W8TA 1RU4A 4XORA 4YZ0A 1KCCA 3UW0A 4OJLA 2VBKA 3VSTA 2ODLA 2NT9A 3VSVA 3WWGA 1K5CA 4HWVA 4OJOA 3VMVA 4XLCA 3KRGA 4XLHA 3FY3A 2PYGA 2O17A 4YZXA 4XNFA 1O8LA 4YEJA 4XR6A 2NSTA 1DBOA 3B8YA 4MXNA 4XONA 1PE9A 4NK8A 4XN0A 2O04A 2UVFA 3T9GA 4U49A 4XL9A 4XQFA 4U4BA 1OGOX 4XLFA 1O8IA 1QJVA 2X6YA 3GQ9A 4W8SA 1EE6A 1PLUA 1O8DA 4XMYA 2UVEA 4XOTA 3VSUA 2X6WA 1XG2A 1GQ8A 1HG8A 1OFMA 2X3HA 3VMWA 2PECA 5AMVA 2NTQA 1KCDA 2QXZA 5C1EA 2INVA 4XLAA 2EWEA 2O0VA 2QX3A 3ZSCA 3GRHA 1AIRA 3LMWA 2VBMA 2O1DA 3ZPPA 3JURA 3SUCA 1O8FA 4Z03A 1X0CA 2VJIA 4OJ5A 4URRA 1VBLA 1O8JA 3EQOA 3GQAA 1DBGA 4OZYA 2NZMA 3B90A 2X85A 2VJJA 2BSPA 4XOPA 5C1CA 1O8MA 4EW9A 4W8RA 1O8GA 1H80A 1OOCA 4XN3A 1OGMX 3GQ8A 2NSPA 4YZAA 2NTBA 1IA5A 3GQ7A 4OZZA 1PXZA 1O8HA 2Z8GA 4XM3A 2X6XA 4XKVA 4PMHA 4Z06A 1IB4A 4YELA 4AVZA 2NTPA 1IDJA 1RMGA 3EQNA 2QY1A 1O8KA 1NHCA 1WMRA 2PYHA 4C2LA 2INUA 1OFLA 2IQ7A 2VBEA 4Z05A 1CZFA 4YZQA 4NK6A 4OJ6A 4MR0A 2O0WA 4W8QA 1O8EA 2NT6A 1BHEA 1IDKA 4XKWA 1QCXA 1RWRA 1O88A 4OJPA 3B4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I84 A;  1BN8 A;  1KTW A;  1JTA A;  4XLE A;  1JRG A;  4W8T A;  1RU4 A;  4XOR A;  4YZ0 A;  1KCC A;  3UW0 A;  4OJL A;  2VBK A;  3VST A;  2ODL A;  2NT9 A;  3VSV A;  3WWG A;  1K5C A;  4HWV A;  4OJO A;  3VMV A;  4XLC A;  3KRG A;  4XLH A;  3FY3 A;  2PYG A;  2O17 A;  4YZX A;  4XNF A;  1O8L A;  4YEJ A;  4XR6 A;  2NST A;  1DBO A;  3B8Y A;  4MXN A;  4XON A;  1PE9 A;  4NK8 A;  4XN0 A;  2O04 A;  2UVF A;  3T9G A;  4U49 A;  4XL9 A;  4XQF A;  4U4B A;  1OGO X;  4XLF A;  1O8I A;  1QJV A;  2X6Y A;  3GQ9 A;  4W8S A;  1EE6 A;  1PLU A;  1O8D A;  4XMY A;  2UVE A;  4XOT A;  3VSU A;  2X6W A;  1XG2 A;  1GQ8 A;  1HG8 A;  1OFM A;  2X3H A;  3VMW A;  2PEC A;  5AMV A;  2NTQ A;  1KCD A;  2QXZ A;  5C1E A;  2INV A;  4XLA A;  2EWE A;  2O0V A;  2QX3 A;  3ZSC A;  3GRH A;  1AIR A;  3LMW A;  2VBM A;  2O1D A;  3ZPP A;  3JUR A;  3SUC A;  1O8F A;  4Z03 A;  1X0C A;  2VJI A;  4OJ5 A;  4URR A;  1VBL A;  1O8J A;  3EQO A;  3GQA A;  1DBG A;  4OZY A;  2NZM A;  3B90 A;  2X85 A;  2VJJ A;  2BSP A;  4XOP A;  5C1C A;  1O8M A;  4EW9 A;  4W8R A;  1O8G A;  1H80 A;  1OOC A;  4XN3 A;  1OGM X;  3GQ8 A;  2NSP A;  4YZA A;  2NTB A;  1IA5 A;  3GQ7 A;  4OZZ A;  1PXZ A;  1O8H A;  2Z8G A;  4XM3 A;  2X6X A;  4XKV A;  4PMH A;  4Z06 A;  1IB4 A;  4YEL A;  4AVZ A;  2NTP A;  1IDJ A;  1RMG A;  3EQN A;  2QY1 A;  1O8K A;  1NHC A;  1WMR A;  2PYH A;  4C2L A;  2INU A;  1OFL A;  2IQ7 A;  2VBE A;  4Z05 A;  1CZF A;  4YZQ A;  4NK6 A;  4OJ6 A;  4MR0 A;  2O0W A;  4W8Q A;  1O8E A;  2NT6 A;  1BHE A;  1IDK A;  4XKW A;  1QCX A;  1RWR A;  1O88 A;  4OJP A;  3B4N A; 
#chains in the Genus database with same CATH topology
 4I84 A;  1BN8 A;  2W7Z A;  3AK5 A;  1KTW A;  1JTA A;  1LLW A;  2VFQ A;  3LYC A;  1JRG A;  1QRC A;  1RU4 A;  4W8T A;  1TYU A;  4XLE A;  2J8I A;  4XOR A;  3UW0 A;  4YZ0 A;  4OJL A;  2VBK A;  2VFO A;  3VST A;  2ODL A;  2QYU A;  5JMC B;  2NT9 A;  3VSV A;  3WWG A;  1K5C A;  4HWV A;  4OJO A;  3VMV A;  1DAB A;  4XLC A;  3KRG A;  2XTW A;  1EA0 A;  1TYV A;  4XLH A;  1QRB A;  3FY3 A;  2PYG A;  2O17 A;  4YZX A;  4XNF A;  3SZE A;  3H09 A;  1O8L A;  3NB2 A;  3N90 A;  4YEJ A;  4XR6 A;  3LJY A;  2NST A;  4JRA C;  1DBO A;  3B8Y A;  4MXN A;  4XON A;  1PE9 A;  4NK8 A;  4XN0 A;  4KH3 A;  3TH0 A;  2BX6 A;  2BM7 A;  2O04 A;  2UVF A;  2VFN A;  3T9G A;  2XTX A;  1EZG A;  4U49 A;  4XL9 A;  1LLZ A;  4YCQ A;  2B0R A;  4OPW A;  4XQF A;  4U4B A;  1OGO X;  2J8K A;  3ML3 A;  4XLF A;  2XT2 A;  3N6Z A;  1O8I A;  1QJV A;  3JX8 A;  2BM6 A;  1QA3 A;  2X6Y A;  3SYJ A;  3GQ9 A;  4W8S A;  1EE6 A;  1HF2 A;  1PLU A;  1O8D A;  4XMY A;  2UVE A;  4XOT A;  3VSU A;  2X6W A;  1XG2 A;  1GQ8 A;  1OFD A;  1HG8 A;  4YFO A;  1KQ5 A;  1OFM A;  2BM5 A;  2X3H A;  2VFM A;  5DNS A;  3VMW A;  2PEC A;  5AMV A;  2NTQ A;  1KCD A;  1QQ1 A;  2QXZ A;  2YUH A;  5C1E A;  4YDT A;  2INV A;  4XLA A;  2EWE A;  2O0V A;  2QX3 A;  3P4G A;  3ZSC A;  2V5I A;  2IOU G;  2O6W A;  3GRH A;  1AIR A;  1TYX A;  3LMW A;  2VBM A;  2O1D A;  3ZPP A;  1CLW A;  3JUR A;  3SUC A;  1O8F A;  4OM9 A;  4Z03 A;  1X0C A;  2VJI A;  4OJ5 A;  4URR A;  1VBL A;  3SQV A;  1O8J A;  3EQO A;  2XC1 A;  3GQA A;  1DBG A;  4OZY A;  2NZM A;  2QZA A;  3B90 A;  1K4Z A;  3PSS A;  2X85 A;  3NAW A;  2VJJ A;  2BSP A;  4XOP A;  1OFE A;  5C1C A;  1L1I A;  1O8M A;  4EW9 A;  4W8R A;  2XT4 A;  1O8G A;  1H80 A;  1OOC A;  4XN3 A;  1OGM X;  3GQ8 A;  2NSP A;  4YZA A;  2NTB A;  1IA5 A;  3GQ7 A;  4OZZ A;  1WXR A;  1PXZ A;  1O8H A;  1TYW A;  2Z8G A;  2XTY A;  4XM3 A;  2X6X A;  4XKV A;  4PMH A;  4Z06 A;  1IB4 A;  4YEL A;  4AVZ A;  3PSZ A;  2NTP A;  1IDJ A;  1RMG A;  3EQN A;  2QY1 A;  4YC5 A;  1O8K A;  3RIQ A;  1NHC A;  2BM4 A;  1WMR A;  2PYH A;  2F3L A;  2INU A;  1OFL A;  4C2L A;  2IQ7 A;  4YEI A;  4V02 C;  1KCC A;  1QA1 A;  2VBE A;  4Z05 A;  1K8F A;  3SY2 A;  1CZF A;  3PET A;  4NK6 A;  4OJ6 A;  4YZQ A;  2VFP A;  4MR0 A;  2O0W A;  4W8Q A;  1O8E A;  2NT6 A;  1TSP A;  3DU1 X;  1BHE A;  1QA2 A;  1IDK A;  5JLV C;  4XKW A;  1QCX A;  1RWR A;  1O88 A;  4OJP A;  3BH7 B;  3B4N A;  3BH6 B;  2G0Y A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 4I84 A;  1BN8 A;  1KTW A;  1JTA A;  4XLE A;  1JRG A;  4W8T A;  1RU4 A;  4XOR A;  4YZ0 A;  1KCC A;  3UW0 A;  4OJL A;  2VBK A;  3VST A;  2ODL A;  2NT9 A;  3VSV A;  3WWG A;  1K5C A;  4HWV A;  4OJO A;  3VMV A;  4XLC A;  3KRG A;  4XLH A;  3FY3 A;  2PYG A;  2O17 A;  4YZX A;  4XNF A;  1O8L A;  4YEJ A;  4XR6 A;  2NST A;  1DBO A;  3B8Y A;  4MXN A;  4XON A;  1PE9 A;  4NK8 A;  4XN0 A;  2O04 A;  2UVF A;  3T9G A;  4U49 A;  4XL9 A;  4XQF A;  4U4B A;  1OGO X;  4XLF A;  1O8I A;  1QJV A;  2X6Y A;  3GQ9 A;  4W8S A;  1EE6 A;  1PLU A;  1O8D A;  4XMY A;  2UVE A;  4XOT A;  3VSU A;  2X6W A;  1XG2 A;  1GQ8 A;  1HG8 A;  1OFM A;  2X3H A;  3VMW A;  2PEC A;  5AMV A;  2NTQ A;  1KCD A;  2QXZ A;  5C1E A;  2INV A;  4XLA A;  2EWE A;  2O0V A;  2QX3 A;  3ZSC A;  3GRH A;  1AIR A;  3LMW A;  2VBM A;  2O1D A;  3ZPP A;  3JUR A;  3SUC A;  1O8F A;  4Z03 A;  1X0C A;  2VJI A;  4OJ5 A;  4URR A;  1VBL A;  1O8J A;  3EQO A;  3GQA A;  1DBG A;  4OZY A;  2NZM A;  3B90 A;  2X85 A;  2VJJ A;  2BSP A;  4XOP A;  5C1C A;  1O8M A;  4EW9 A;  4W8R A;  1O8G A;  1H80 A;  1OOC A;  4XN3 A;  1OGM X;  3GQ8 A;  2NSP A;  4YZA A;  2NTB A;  1IA5 A;  3GQ7 A;  4OZZ A;  1PXZ A;  1O8H A;  2Z8G A;  4XM3 A;  2X6X A;  4XKV A;  4PMH A;  4Z06 A;  1IB4 A;  4YEL A;  4AVZ A;  2NTP A;  1IDJ A;  1RMG A;  3EQN A;  2QY1 A;  1O8K A;  1NHC A;  1WMR A;  2PYH A;  4C2L A;  2INU A;  1OFL A;  2IQ7 A;  2VBE A;  4Z05 A;  1CZF A;  4YZQ A;  4NK6 A;  4OJ6 A;  4MR0 A;  2O0W A;  4W8Q A;  1O8E A;  2NT6 A;  1BHE A;  1IDK A;  4XKW A;  1QCX A;  1RWR A;  1O88 A;  4OJP A;  3B4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...