1HG8A

Endopolygalacturonase from the phytopathogenic fungus fusarium moniliforme
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
DPCSVTEYSGLATAVSSCKNIVLNGFQVPTGKQLDLSSLQNDSTVTFKGTTTFATTADNDFNPIVISGSNITITGASGHVIDGNGQAYWDGKGSNSNSNQKPDHFIVVQKTTGNSKITNLNIQNWPVHCFDITGSSQLTISGLILDNRAGDKPNAKSGSLPAAHNTDGFDISSSDHVTLDNNHVYNQDDCVAVTSGTNIVVSNMYCSGGHGLSIGSVGGKSDNVVDGVQFLSSQVVNSQNGCRIKSNSGATGTINNVTYQNIALTNISTYGVDVQQDYLNGGPTGKPTNGVKISNIKFIKVTGTVASSAQDWFILCGDGSCSGFTFSGNAITGGGKTSSCNYPTNTCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Requirements of Endopolygalacturonase for the Interaction with Pgip (Polygalacturonase-Inhibiting Protein)
pubmed doi rcsb
source organism Fusarium moniliforme
molecule tags Hydrolase
molecule keywords ENDOPOLYGALACTURONASE
total genus 133
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1hg8A00
2Z8GA 3EQNA 4Z03A 3ZSCA 1H80A 2O04A 1NHCA 1OOCA 3FY3A 2NSPA 3GQ7A 2O0WA 1RMGA 3VSUA 3VMWA 4PMHA 4XLFA 3VSVA 4XOTA 4XKWA 2INUA 2INVA 4HWVA 2VBMA 2QY1A 1O8KA 3WWGA 4XM3A 4Z05A 1AIRA 4NK6A 4C2LA 2PECA 2NTQA 1OGMX 4W8QA 1O8MA 3B90A 4URRA 4U4BA 4XLEA 4OJPA 4XR6A 1DBGA 3T9GA 1KCDA 1QCXA 4YEJA 1PE9A 2IQ7A 4W8SA 2NTPA 3VMVA 1O8JA 3ZPPA 3LMWA 2NTBA 4YZXA 1PXZA 2UVEA 4OJ6A 5C1CA 4XL9A 2X6YA 4OZYA 4U49A 4XN3A 2NSTA 4MR0A 1EE6A 1O8HA 1HG8A 4AVZA 1O8IA 2PYGA 4YZQA 4XKVA 4I84A 1OFLA 2VJJA 4OJOA 1JRGA 2X6XA 2ODLA 1QJVA 4YELA 2VBKA 1JTAA 2PYHA 1X0CA 1IDKA 1BHEA 3B4NA 2EWEA 4W8RA 4OJLA 4EW9A 1DBOA 1PLUA 5AMVA 1O8FA 1O8LA 4XLAA 2UVFA 4XLHA 1GQ8A 1RU4A 2NT9A 3GRHA 2VJIA 4NK8A 4Z06A 3SUCA 1RWRA 3UW0A 2X3HA 2X6WA 1CZFA 3JURA 4OJ5A 1O8EA 1OGOX 2NZMA 1WMRA 3VSTA 2QX3A 4XLCA 5C1EA 4MXNA 1O8GA 4XQFA 1K5CA 2O1DA 4XNFA 3GQAA 1O8DA 2BSPA 2NT6A 1KCCA 4OZZA 4YZ0A 3GQ9A 1IDJA 3KRGA 2O17A 3GQ8A 1IB4A 2QXZA 2X85A 2O0VA 4XN0A 4XONA 3B8YA 4W8TA 4XOPA 4YZAA 1KTWA 4XMYA 1IA5A 4XORA 1XG2A 1BN8A 1O88A 1OFMA 2VBEA 1VBLA 3EQOA
chains in the Genus database with same CATH superfamily
2Z8GA 3EQNA 3N90A 4Z03A 3ZSCA 1H80A 2YUHA 1TSPA 2O04A 3TH0A 1OOCA 3FY3A 2NSPA 3GQ7A 4YC5A 1NHCA 1QA3A 2O0WA 1RMGA 3SQVA 3VSUA 2XTWA 3VMWA 4PMHA 4XLFA 4KH3A 1L1IA 2VFQA 3VSVA 4XOTA 4XKWA 3SZEA 2B0RA 2INUA 2INVA 4HWVA 2VBMA 2QY1A 1O8KA 2W7ZA 3BH7B 3WWGA 4XM3A 1WXRA 4Z05A 1AIRA 3LJYA 4NK6A 4C2LA 2PECA 2NTQA 1OGMX 4W8QA 1O8MA 2QYUA 2IOUG 3B90A 4URRA 4U4BA 1LLWA 4XLEA 4OJPA 4XR6A 3AK5A 1KQ5A 1DBGA 3T9GA 1K4ZA 1KCDA 1QCXA 4YDTA 4YEJA 3P4GA 4YFOA 3NB2A 5DNSA 2QZAA 1PE9A 2IQ7A 4W8SA 3DU1X 2NTPA 3RIQA 3VMVA 3H09A 2XTXA 3PETA 3ML3A 1O8JA 4V02C 2F3LA 3JX8A 3ZPPA 3LMWA 4YCQA 2NTBA 4YZXA 1PXZA 2J8KA 2UVEA 2VFMA 4OJ6A 2X6YA 4XL9A 5C1CA 4OZYA 4U49A 3SYJA 3SY2A 4XN3A 2NSTA 4MR0A 2VFPA 1EE6A 1O8HA 1HG8A 1TYUA 1O8IA 4AVZA 2PYGA 1HF2A 5JLVC 3LYCA 4JRAC 4YZQA 1QA1A 3PSSA 4XKVA 2V5IA 4I84A 1DABA 1TYVA 1OFLA 2VJJA 4OJOA 1JRGA 2X6XA 2ODLA 1QJVA 2XC1A 1LM1A 4YELA 2VBKA 1JTAA 2PYHA 1X0CA 1IDKA 1BHEA 2XTYA 5JMCB 3B4NA 2O6WA 2EWEA 4W8RA 4OJLA 4EW9A 1DBOA 1PLUA 5AMVA 1O8FA 1CLWA 2BM7A 2XT4A 4OM9A 1O8LA 4XLAA 3NAWA 2UVFA 4XLHA 1GQ8A 1RU4A 2NT9A 3GRHA 1EA0A 3N6ZA 1QA2A 2VJIA 2BM6A 4NK8A 1QRCA 1RWRA 1K8FA 4Z06A 3SUCA 3UW0A 1OFDA 1LLZA 2VFNA 2X3HA 2X6WA 3PSZA 1CZFA 3JURA 4OJ5A 1O8EA 1QQ1A 1OGOX 2G0YA 2NZMA 2BM4A 1EZGA 1WMRA 3VSTA 2QX3A 4XLCA 5C1EA 4MXNA 1O8GA 4XQFA 1K5CA 2O1DA 4XNFA 3GQAA 1O8DA 2BSPA 2NT6A 2XT2A 2VFOA 1IB4A 4OZZA 1KCCA 4YZ0A 3GQ9A 1IDJA 3KRGA 2O17A 3GQ8A 4YEIA 1TYWA 2QXZA 2O0VA 2X85A 4XN0A 3B8YA 1TYXA 4W8TA 4XONA 1KTWA 4XOPA 4YZAA 2J8IA 2BX6A 4XMYA 4OPWA 1IA5A 3BH6B 1OFEA 4XORA 1XG2A 1BN8A 1O88A 1OFMA 1QRBA 1VBLA 2VBEA 3EQOA 2BM5A
chains in the Genus database with same CATH topology
2Z8GA 3EQNA 4Z03A 3ZSCA 1H80A 2O04A 1NHCA 1OOCA 3FY3A 2NSPA 3GQ7A 2O0WA 1RMGA 3VSUA 3VMWA 4PMHA 4XLFA 3VSVA 4XOTA 4XKWA 2INUA 2INVA 4HWVA 2VBMA 2QY1A 1O8KA 3WWGA 4XM3A 4Z05A 1AIRA 4NK6A 4C2LA 2PECA 2NTQA 1OGMX 4W8QA 1O8MA 3B90A 4URRA 4U4BA 4XLEA 4OJPA 4XR6A 1DBGA 3T9GA 1KCDA 1QCXA 4YEJA 1PE9A 2IQ7A 4W8SA 2NTPA 3VMVA 1O8JA 3ZPPA 3LMWA 2NTBA 4YZXA 1PXZA 2UVEA 4OJ6A 5C1CA 4XL9A 2X6YA 4OZYA 4U49A 4XN3A 2NSTA 4MR0A 1EE6A 1O8HA 1HG8A 4AVZA 1O8IA 2PYGA 4YZQA 4XKVA 4I84A 1OFLA 2VJJA 4OJOA 1JRGA 2X6XA 2ODLA 1QJVA 4YELA 2VBKA 1JTAA 2PYHA 1X0CA 1IDKA 1BHEA 3B4NA 2EWEA 4W8RA 4OJLA 4EW9A 1DBOA 1PLUA 5AMVA 1O8FA 1O8LA 4XLAA 2UVFA 4XLHA 1GQ8A 1RU4A 2NT9A 3GRHA 2VJIA 4NK8A 4Z06A 3SUCA 1RWRA 3UW0A 2X3HA 2X6WA 1CZFA 3JURA 4OJ5A 1O8EA 1OGOX 2NZMA 1WMRA 3VSTA 2QX3A 4XLCA 5C1EA 4MXNA 1O8GA 4XQFA 1K5CA 2O1DA 4XNFA 3GQAA 1O8DA 2BSPA 2NT6A 1KCCA 4OZZA 4YZ0A 3GQ9A 1IDJA 3KRGA 2O17A 3GQ8A 1IB4A 2QXZA 2X85A 2O0VA 4XN0A 4XONA 3B8YA 4W8TA 4XOPA 4YZAA 1KTWA 4XMYA 1IA5A 4XORA 1XG2A 1BN8A 1O88A 1OFMA 2VBEA 1VBLA 3EQOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z8G A;  3EQN A;  4Z03 A;  3ZSC A;  1H80 A;  2O04 A;  1NHC A;  1OOC A;  3FY3 A;  2NSP A;  3GQ7 A;  2O0W A;  1RMG A;  3VSU A;  3VMW A;  4PMH A;  4XLF A;  3VSV A;  4XOT A;  4XKW A;  2INU A;  2INV A;  4HWV A;  2VBM A;  2QY1 A;  1O8K A;  3WWG A;  4XM3 A;  4Z05 A;  1AIR A;  4NK6 A;  4C2L A;  2PEC A;  2NTQ A;  1OGM X;  4W8Q A;  1O8M A;  3B90 A;  4URR A;  4U4B A;  4XLE A;  4OJP A;  4XR6 A;  1DBG A;  3T9G A;  1KCD A;  1QCX A;  4YEJ A;  1PE9 A;  2IQ7 A;  4W8S A;  2NTP A;  3VMV A;  1O8J A;  3ZPP A;  3LMW A;  2NTB A;  4YZX A;  1PXZ A;  2UVE A;  4OJ6 A;  5C1C A;  4XL9 A;  2X6Y A;  4OZY A;  4U49 A;  4XN3 A;  2NST A;  4MR0 A;  1EE6 A;  1O8H A;  1HG8 A;  4AVZ A;  1O8I A;  2PYG A;  4YZQ A;  4XKV A;  4I84 A;  1OFL A;  2VJJ A;  4OJO A;  1JRG A;  2X6X A;  2ODL A;  1QJV A;  4YEL A;  2VBK A;  1JTA A;  2PYH A;  1X0C A;  1IDK A;  1BHE A;  3B4N A;  2EWE A;  4W8R A;  4OJL A;  4EW9 A;  1DBO A;  1PLU A;  5AMV A;  1O8F A;  1O8L A;  4XLA A;  2UVF A;  4XLH A;  1GQ8 A;  1RU4 A;  2NT9 A;  3GRH A;  2VJI A;  4NK8 A;  4Z06 A;  3SUC A;  1RWR A;  3UW0 A;  2X3H A;  2X6W A;  1CZF A;  3JUR A;  4OJ5 A;  1O8E A;  1OGO X;  2NZM A;  1WMR A;  3VST A;  2QX3 A;  4XLC A;  5C1E A;  4MXN A;  1O8G A;  4XQF A;  1K5C A;  2O1D A;  4XNF A;  3GQA A;  1O8D A;  2BSP A;  2NT6 A;  1KCC A;  4OZZ A;  4YZ0 A;  3GQ9 A;  1IDJ A;  3KRG A;  2O17 A;  3GQ8 A;  1IB4 A;  2QXZ A;  2X85 A;  2O0V A;  4XN0 A;  4XON A;  3B8Y A;  4W8T A;  4XOP A;  4YZA A;  1KTW A;  4XMY A;  1IA5 A;  4XOR A;  1XG2 A;  1BN8 A;  1O88 A;  1OFM A;  2VBE A;  1VBL A;  3EQO A; 
#chains in the Genus database with same CATH topology
 2Z8G A;  3EQN A;  3N90 A;  4Z03 A;  3ZSC A;  1H80 A;  2YUH A;  1TSP A;  2O04 A;  3TH0 A;  1OOC A;  3FY3 A;  2NSP A;  3GQ7 A;  4YC5 A;  1NHC A;  1QA3 A;  2O0W A;  1RMG A;  3SQV A;  3VSU A;  2XTW A;  3VMW A;  4PMH A;  4XLF A;  4KH3 A;  1L1I A;  2VFQ A;  3VSV A;  4XOT A;  4XKW A;  3SZE A;  2B0R A;  2INU A;  2INV A;  4HWV A;  2VBM A;  2QY1 A;  1O8K A;  2W7Z A;  3BH7 B;  3WWG A;  4XM3 A;  1WXR A;  4Z05 A;  1AIR A;  3LJY A;  4NK6 A;  4C2L A;  2PEC A;  2NTQ A;  1OGM X;  4W8Q A;  1O8M A;  2QYU A;  2IOU G;  3B90 A;  4URR A;  4U4B A;  1LLW A;  4XLE A;  4OJP A;  4XR6 A;  3AK5 A;  1KQ5 A;  1DBG A;  3T9G A;  1K4Z A;  1KCD A;  1QCX A;  4YDT A;  4YEJ A;  3P4G A;  4YFO A;  3NB2 A;  5DNS A;  2QZA A;  1PE9 A;  2IQ7 A;  4W8S A;  3DU1 X;  2NTP A;  3RIQ A;  3VMV A;  3H09 A;  2XTX A;  3PET A;  3ML3 A;  1O8J A;  4V02 C;  2F3L A;  3JX8 A;  3ZPP A;  3LMW A;  4YCQ A;  2NTB A;  4YZX A;  1PXZ A;  2J8K A;  2UVE A;  2VFM A;  4OJ6 A;  2X6Y A;  4XL9 A;  5C1C A;  4OZY A;  4U49 A;  3SYJ A;  3SY2 A;  4XN3 A;  2NST A;  4MR0 A;  2VFP A;  1EE6 A;  1O8H A;  1HG8 A;  1TYU A;  1O8I A;  4AVZ A;  2PYG A;  1HF2 A;  5JLV C;  3LYC A;  4JRA C;  4YZQ A;  1QA1 A;  3PSS A;  4XKV A;  2V5I A;  4I84 A;  1DAB A;  1TYV A;  1OFL A;  2VJJ A;  4OJO A;  1JRG A;  2X6X A;  2ODL A;  1QJV A;  2XC1 A;  1LM1 A;  4YEL A;  2VBK A;  1JTA A;  2PYH A;  1X0C A;  1IDK A;  1BHE A;  2XTY A;  5JMC B;  3B4N A;  2O6W A;  2EWE A;  4W8R A;  4OJL A;  4EW9 A;  1DBO A;  1PLU A;  5AMV A;  1O8F A;  1CLW A;  2BM7 A;  2XT4 A;  4OM9 A;  1O8L A;  4XLA A;  3NAW A;  2UVF A;  4XLH A;  1GQ8 A;  1RU4 A;  2NT9 A;  3GRH A;  1EA0 A;  3N6Z A;  1QA2 A;  2VJI A;  2BM6 A;  4NK8 A;  1QRC A;  1RWR A;  1K8F A;  4Z06 A;  3SUC A;  3UW0 A;  1OFD A;  1LLZ A;  2VFN A;  2X3H A;  2X6W A;  3PSZ A;  1CZF A;  3JUR A;  4OJ5 A;  1O8E A;  1QQ1 A;  1OGO X;  2G0Y A;  2NZM A;  2BM4 A;  1EZG A;  1WMR A;  3VST A;  2QX3 A;  4XLC A;  5C1E A;  4MXN A;  1O8G A;  4XQF A;  1K5C A;  2O1D A;  4XNF A;  3GQA A;  1O8D A;  2BSP A;  2NT6 A;  2XT2 A;  2VFO A;  1IB4 A;  4OZZ A;  1KCC A;  4YZ0 A;  3GQ9 A;  1IDJ A;  3KRG A;  2O17 A;  3GQ8 A;  4YEI A;  1TYW A;  2QXZ A;  2O0V A;  2X85 A;  4XN0 A;  3B8Y A;  1TYX A;  4W8T A;  4XON A;  1KTW A;  4XOP A;  4YZA A;  2J8I A;  2BX6 A;  4XMY A;  4OPW A;  1IA5 A;  3BH6 B;  1OFE A;  4XOR A;  1XG2 A;  1BN8 A;  1O88 A;  1OFM A;  1QRB A;  1VBL A;  2VBE A;  3EQO A;  2BM5 A; 
#chains in the Genus database with same CATH homology
 2Z8G A;  3EQN A;  4Z03 A;  3ZSC A;  1H80 A;  2O04 A;  1NHC A;  1OOC A;  3FY3 A;  2NSP A;  3GQ7 A;  2O0W A;  1RMG A;  3VSU A;  3VMW A;  4PMH A;  4XLF A;  3VSV A;  4XOT A;  4XKW A;  2INU A;  2INV A;  4HWV A;  2VBM A;  2QY1 A;  1O8K A;  3WWG A;  4XM3 A;  4Z05 A;  1AIR A;  4NK6 A;  4C2L A;  2PEC A;  2NTQ A;  1OGM X;  4W8Q A;  1O8M A;  3B90 A;  4URR A;  4U4B A;  4XLE A;  4OJP A;  4XR6 A;  1DBG A;  3T9G A;  1KCD A;  1QCX A;  4YEJ A;  1PE9 A;  2IQ7 A;  4W8S A;  2NTP A;  3VMV A;  1O8J A;  3ZPP A;  3LMW A;  2NTB A;  4YZX A;  1PXZ A;  2UVE A;  4OJ6 A;  5C1C A;  4XL9 A;  2X6Y A;  4OZY A;  4U49 A;  4XN3 A;  2NST A;  4MR0 A;  1EE6 A;  1O8H A;  1HG8 A;  4AVZ A;  1O8I A;  2PYG A;  4YZQ A;  4XKV A;  4I84 A;  1OFL A;  2VJJ A;  4OJO A;  1JRG A;  2X6X A;  2ODL A;  1QJV A;  4YEL A;  2VBK A;  1JTA A;  2PYH A;  1X0C A;  1IDK A;  1BHE A;  3B4N A;  2EWE A;  4W8R A;  4OJL A;  4EW9 A;  1DBO A;  1PLU A;  5AMV A;  1O8F A;  1O8L A;  4XLA A;  2UVF A;  4XLH A;  1GQ8 A;  1RU4 A;  2NT9 A;  3GRH A;  2VJI A;  4NK8 A;  4Z06 A;  3SUC A;  1RWR A;  3UW0 A;  2X3H A;  2X6W A;  1CZF A;  3JUR A;  4OJ5 A;  1O8E A;  1OGO X;  2NZM A;  1WMR A;  3VST A;  2QX3 A;  4XLC A;  5C1E A;  4MXN A;  1O8G A;  4XQF A;  1K5C A;  2O1D A;  4XNF A;  3GQA A;  1O8D A;  2BSP A;  2NT6 A;  1KCC A;  4OZZ A;  4YZ0 A;  3GQ9 A;  1IDJ A;  3KRG A;  2O17 A;  3GQ8 A;  1IB4 A;  2QXZ A;  2X85 A;  2O0V A;  4XN0 A;  4XON A;  3B8Y A;  4W8T A;  4XOP A;  4YZA A;  1KTW A;  4XMY A;  1IA5 A;  4XOR A;  1XG2 A;  1BN8 A;  1O88 A;  1OFM A;  2VBE A;  1VBL A;  3EQO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...