1HG8A

Endopolygalacturonase from the phytopathogenic fungus fusarium moniliforme
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
DPCSVTEYSGLATAVSSCKNIVLNGFQVPTGKQLDLSSLQNDSTVTFKGTTTFATTADNDFNPIVISGSNITITGASGHVIDGNGQAYWDGKGSNSNSNQKPDHFIVVQKTTGNSKITNLNIQNWPVHCFDITGSSQLTISGLILDNRAGDKPNAKSGSLPAAHNTDGFDISSSDHVTLDNNHVYNQDDCVAVTSGTNIVVSNMYCSGGHGLSIGSVGGKSDNVVDGVQFLSSQVVNSQNGCRIKSNSGATGTINNVTYQNIALTNISTYGVDVQQDYLNGGPTGKPTNGVKISNIKFIKVTGTVASSAQDWFILCGDGSCSGFTFSGNAITGGGKTSSCNYPTNTCPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
publication title Structural Requirements of Endopolygalacturonase for the Interaction with Pgip (Polygalacturonase-Inhibiting Protein)
pubmed doi rcsb
source organism Fusarium moniliforme
molecule tags Hydrolase
total genus 133
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1hg8A00
4XLCA 1BN8A 4YZ0A 1H80A 4XN0A 3VSVA 3VMWA 4YZQA 4EW9A 5C1CA 2PECA 1KTWA 1RWRA 4OZYA 4OJ5A 3EQOA 1O8FA 2PYGA 4PMHA 1O8DA 4YZXA 4AVZA 3VSUA 2NSTA 1K5CA 3B4NA 1O8IA 1O8EA 4XORA 2INVA 4Z06A 3VSTA 2X85A 1PXZA 4U4BA 3KRGA 2NTPA 1O8MA 1DBOA 4XOPA 2NSPA 1EE6A 2O1DA 3LMWA 4XM3A 4YZAA 1RMGA 3SUCA 3EQNA 2O04A 1O8GA 2X6XA 5AMVA 1OFLA 2EWEA 2NT9A 3GQ7A 4W8RA 1GQ8A 1CZFA 1NHCA 4XLFA 2QX3A 3JURA 4URRA 1IA5A 4XKWA 4NK8A 1BHEA 1OFMA 2IQ7A 4U49A 3GQ9A 1RU4A 2ODLA 2X3HA 4XNFA 4OJOA 1VBLA 4NK6A 3T9GA 2UVEA 1XG2A 1JRGA 2UVFA 1OGMX 2VBKA 1WMRA 4MR0A 1PE9A 4Z05A 5C1EA 2NT6A 4XLHA 4YELA 1QCXA 1AIRA 1O8JA 3VMVA 2Z8GA 3B8YA 4I84A 4OJPA 1IDKA 4HWVA 4OZZA 3WWGA 4MXNA 1O88A 2VJJA 3GQAA 4XLAA 4YEJA 2NTBA 4W8QA 4XKVA 1KCDA 1O8LA 1IDJA 4XQFA 1IB4A 1O8KA 4OJ6A 2X6WA 3ZSCA 1X0CA 2NZMA 2O0WA 2O17A 1HG8A 2O0VA 4OJLA 4XL9A 1KCCA 1JTAA 2BSPA 1PLUA 4XLEA 3GQ8A 2NTQA 2VBMA 2X6YA 4W8TA 4XR6A 2VBEA 4W8SA 3UW0A 4XN3A 1O8HA 2PYHA 3ZPPA 4XONA 1OGOX 3B90A 2INUA 1QJVA 1DBGA 3GRHA 4Z03A 4XOTA 1OOCA 4C2LA 2QXZA 2QY1A 3FY3A 2VJIA 4XMYA
chains in the Genus database with same CATH superfamily
3NB2A 4XLCA 1BN8A 3BH7B 4YZ0A 2YUHA 1H80A 3RIQA 3H09A 4XN0A 3VSVA 1QQ1A 3VMWA 1WXRA 2O6WA 1TYUA 2QYUA 4YZQA 4EW9A 3SZEA 5C1CA 2PECA 1QA3A 1KTWA 1RWRA 1QA1A 4OZYA 4YDTA 4OJ5A 2BM7A 3EQOA 1O8FA 1TYXA 2PYGA 3DU1X 4PMHA 1O8DA 4YZXA 2XT2A 3VSUA 4AVZA 2NSTA 1K5CA 2VFMA 2V5IA 2XT4A 3B4NA 1O8IA 1DABA 1O8EA 2IOUG 2XTYA 4XORA 4YCQA 1TYVA 2INVA 4Z06A 3VSTA 1LLWA 1PXZA 2X85A 4U4BA 5JMCB 3KRGA 2NTPA 1O8MA 2J8KA 5DNSA 1DBOA 4XOPA 2NSPA 1EE6A 2O1DA 3LMWA 4XM3A 4YZAA 3SYJA 1RMGA 2B0RA 3SUCA 3EQNA 2O04A 1O8GA 4OM9A 2XTXA 1L1IA 2X6XA 5AMVA 1OFLA 2EWEA 2NT9A 3GQ7A 4W8RA 1GQ8A 1CZFA 5JLVC 1NHCA 2QZAA 4XLFA 2QX3A 3JURA 4URRA 1IA5A 4XKWA 4NK8A 1BHEA 1OFMA 4OPWA 2IQ7A 4U49A 1HF2A 3GQ9A 1EA0A 1RU4A 2F3LA 3BH6B 2ODLA 2X3HA 4XNFA 4OJOA 4YEIA 1QA2A 1VBLA 4NK6A 3T9GA 2UVEA 1XG2A 1CLWA 1JRGA 2XTWA 2UVFA 1OGMX 2VBKA 1WMRA 3ML3A 4MR0A 3SY2A 3PSSA 1PE9A 4Z05A 4YC5A 5C1EA 2NT6A 4XLHA 4YELA 1QCXA 4YFOA 1AIRA 1O8JA 2VFQA 3VMVA 2Z8GA 3B8YA 2G0YA 4I84A 1IDKA 2W7ZA 3LYCA 4OJPA 3AK5A 4HWVA 4OZZA 2XC1A 3SQVA 1K4ZA 3WWGA 3N90A 4MXNA 1O88A 2VJJA 3GQAA 2VFNA 3NAWA 3P4GA 4KH3A 4XLAA 4YEJA 2BX6A 2NTBA 3N6ZA 4W8QA 4XKVA 1KCDA 1EZGA 1QRBA 1O8LA 1IDJA 4XQFA 1IB4A 1OFDA 1O8KA 1LLZA 4OJ6A 2X6WA 2VFOA 3ZSCA 1X0CA 2NZMA 3JX8A 2O0WA 2O17A 1HG8A 2O0VA 4OJLA 2BM6A 4XL9A 1KCCA 2VFPA 1JTAA 2BSPA 1OFEA 2J8IA 1PLUA 4XLEA 1K8FA 1QRCA 3GQ8A 3PETA 2NTQA 2VBMA 2X6YA 4W8TA 4JRAC 4XR6A 2VBEA 1KQ5A 4W8SA 2BM4A 1TSPA 4XN3A 3UW0A 1O8HA 2PYHA 3ZPPA 4XONA 1OGOX 1TYWA 2INUA 3B90A 1QJVA 1DBGA 1LM1A 3TH0A 4V02C 3GRHA 3LJYA 3PSZA 4XOTA 4Z03A 1OOCA 4C2LA 2QXZA 2QY1A 3FY3A 2VJIA 2BM5A 4XMYA
chains in the Genus database with same CATH topology
4XLCA 1BN8A 4YZ0A 1H80A 4XN0A 3VSVA 3VMWA 4YZQA 4EW9A 5C1CA 2PECA 1KTWA 1RWRA 4OZYA 4OJ5A 3EQOA 1O8FA 2PYGA 4PMHA 1O8DA 4YZXA 4AVZA 3VSUA 2NSTA 1K5CA 3B4NA 1O8IA 1O8EA 4XORA 2INVA 4Z06A 3VSTA 2X85A 1PXZA 4U4BA 3KRGA 2NTPA 1O8MA 1DBOA 4XOPA 2NSPA 1EE6A 2O1DA 3LMWA 4XM3A 4YZAA 1RMGA 3SUCA 3EQNA 2O04A 1O8GA 2X6XA 5AMVA 1OFLA 2EWEA 2NT9A 3GQ7A 4W8RA 1GQ8A 1CZFA 1NHCA 4XLFA 2QX3A 3JURA 4URRA 1IA5A 4XKWA 4NK8A 1BHEA 1OFMA 2IQ7A 4U49A 3GQ9A 1RU4A 2ODLA 2X3HA 4XNFA 4OJOA 1VBLA 4NK6A 3T9GA 2UVEA 1XG2A 1JRGA 2UVFA 1OGMX 2VBKA 1WMRA 4MR0A 1PE9A 4Z05A 5C1EA 2NT6A 4XLHA 4YELA 1QCXA 1AIRA 1O8JA 3VMVA 2Z8GA 3B8YA 4I84A 4OJPA 1IDKA 4HWVA 4OZZA 3WWGA 4MXNA 1O88A 2VJJA 3GQAA 4XLAA 4YEJA 2NTBA 4W8QA 4XKVA 1KCDA 1O8LA 1IDJA 4XQFA 1IB4A 1O8KA 4OJ6A 2X6WA 3ZSCA 1X0CA 2NZMA 2O0WA 2O17A 1HG8A 2O0VA 4OJLA 4XL9A 1KCCA 1JTAA 2BSPA 1PLUA 4XLEA 3GQ8A 2NTQA 2VBMA 2X6YA 4W8TA 4XR6A 2VBEA 4W8SA 3UW0A 4XN3A 1O8HA 2PYHA 3ZPPA 4XONA 1OGOX 3B90A 2INUA 1QJVA 1DBGA 3GRHA 4Z03A 4XOTA 1OOCA 4C2LA 2QXZA 2QY1A 3FY3A 2VJIA 4XMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XLC A;  1BN8 A;  4YZ0 A;  1H80 A;  4XN0 A;  3VSV A;  3VMW A;  4YZQ A;  4EW9 A;  5C1C A;  2PEC A;  1KTW A;  1RWR A;  4OZY A;  4OJ5 A;  3EQO A;  1O8F A;  2PYG A;  4PMH A;  1O8D A;  4YZX A;  4AVZ A;  3VSU A;  2NST A;  1K5C A;  3B4N A;  1O8I A;  1O8E A;  4XOR A;  2INV A;  4Z06 A;  3VST A;  2X85 A;  1PXZ A;  4U4B A;  3KRG A;  2NTP A;  1O8M A;  1DBO A;  4XOP A;  2NSP A;  1EE6 A;  2O1D A;  3LMW A;  4XM3 A;  4YZA A;  1RMG A;  3SUC A;  3EQN A;  2O04 A;  1O8G A;  2X6X A;  5AMV A;  1OFL A;  2EWE A;  2NT9 A;  3GQ7 A;  4W8R A;  1GQ8 A;  1CZF A;  1NHC A;  4XLF A;  2QX3 A;  3JUR A;  4URR A;  1IA5 A;  4XKW A;  4NK8 A;  1BHE A;  1OFM A;  2IQ7 A;  4U49 A;  3GQ9 A;  1RU4 A;  2ODL A;  2X3H A;  4XNF A;  4OJO A;  1VBL A;  4NK6 A;  3T9G A;  2UVE A;  1XG2 A;  1JRG A;  2UVF A;  1OGM X;  2VBK A;  1WMR A;  4MR0 A;  1PE9 A;  4Z05 A;  5C1E A;  2NT6 A;  4XLH A;  4YEL A;  1QCX A;  1AIR A;  1O8J A;  3VMV A;  2Z8G A;  3B8Y A;  4I84 A;  4OJP A;  1IDK A;  4HWV A;  4OZZ A;  3WWG A;  4MXN A;  1O88 A;  2VJJ A;  3GQA A;  4XLA A;  4YEJ A;  2NTB A;  4W8Q A;  4XKV A;  1KCD A;  1O8L A;  1IDJ A;  4XQF A;  1IB4 A;  1O8K A;  4OJ6 A;  2X6W A;  3ZSC A;  1X0C A;  2NZM A;  2O0W A;  2O17 A;  1HG8 A;  2O0V A;  4OJL A;  4XL9 A;  1KCC A;  1JTA A;  2BSP A;  1PLU A;  4XLE A;  3GQ8 A;  2NTQ A;  2VBM A;  2X6Y A;  4W8T A;  4XR6 A;  2VBE A;  4W8S A;  3UW0 A;  4XN3 A;  1O8H A;  2PYH A;  3ZPP A;  4XON A;  1OGO X;  3B90 A;  2INU A;  1QJV A;  1DBG A;  3GRH A;  4Z03 A;  4XOT A;  1OOC A;  4C2L A;  2QXZ A;  2QY1 A;  3FY3 A;  2VJI A;  4XMY A; 
#chains in the Genus database with same CATH topology
 3NB2 A;  4XLC A;  1BN8 A;  3BH7 B;  4YZ0 A;  2YUH A;  1H80 A;  3RIQ A;  3H09 A;  4XN0 A;  3VSV A;  1QQ1 A;  3VMW A;  1WXR A;  2O6W A;  1TYU A;  2QYU A;  4YZQ A;  4EW9 A;  3SZE A;  5C1C A;  2PEC A;  1QA3 A;  1KTW A;  1RWR A;  1QA1 A;  4OZY A;  4YDT A;  4OJ5 A;  2BM7 A;  3EQO A;  1O8F A;  1TYX A;  2PYG A;  3DU1 X;  4PMH A;  1O8D A;  4YZX A;  2XT2 A;  3VSU A;  4AVZ A;  2NST A;  1K5C A;  2VFM A;  2V5I A;  2XT4 A;  3B4N A;  1O8I A;  1DAB A;  1O8E A;  2IOU G;  2XTY A;  4XOR A;  4YCQ A;  1TYV A;  2INV A;  4Z06 A;  3VST A;  1LLW A;  1PXZ A;  2X85 A;  4U4B A;  5JMC B;  3KRG A;  2NTP A;  1O8M A;  2J8K A;  5DNS A;  1DBO A;  4XOP A;  2NSP A;  1EE6 A;  2O1D A;  3LMW A;  4XM3 A;  4YZA A;  3SYJ A;  1RMG A;  2B0R A;  3SUC A;  3EQN A;  2O04 A;  1O8G A;  4OM9 A;  2XTX A;  1L1I A;  2X6X A;  5AMV A;  1OFL A;  2EWE A;  2NT9 A;  3GQ7 A;  4W8R A;  1GQ8 A;  1CZF A;  5JLV C;  1NHC A;  2QZA A;  4XLF A;  2QX3 A;  3JUR A;  4URR A;  1IA5 A;  4XKW A;  4NK8 A;  1BHE A;  1OFM A;  4OPW A;  2IQ7 A;  4U49 A;  1HF2 A;  3GQ9 A;  1EA0 A;  1RU4 A;  2F3L A;  3BH6 B;  2ODL A;  2X3H A;  4XNF A;  4OJO A;  4YEI A;  1QA2 A;  1VBL A;  4NK6 A;  3T9G A;  2UVE A;  1XG2 A;  1CLW A;  1JRG A;  2XTW A;  2UVF A;  1OGM X;  2VBK A;  1WMR A;  3ML3 A;  4MR0 A;  3SY2 A;  3PSS A;  1PE9 A;  4Z05 A;  4YC5 A;  5C1E A;  2NT6 A;  4XLH A;  4YEL A;  1QCX A;  4YFO A;  1AIR A;  1O8J A;  2VFQ A;  3VMV A;  2Z8G A;  3B8Y A;  2G0Y A;  4I84 A;  1IDK A;  2W7Z A;  3LYC A;  4OJP A;  3AK5 A;  4HWV A;  4OZZ A;  2XC1 A;  3SQV A;  1K4Z A;  3WWG A;  3N90 A;  4MXN A;  1O88 A;  2VJJ A;  3GQA A;  2VFN A;  3NAW A;  3P4G A;  4KH3 A;  4XLA A;  4YEJ A;  2BX6 A;  2NTB A;  3N6Z A;  4W8Q A;  4XKV A;  1KCD A;  1EZG A;  1QRB A;  1O8L A;  1IDJ A;  4XQF A;  1IB4 A;  1OFD A;  1O8K A;  1LLZ A;  4OJ6 A;  2X6W A;  2VFO A;  3ZSC A;  1X0C A;  2NZM A;  3JX8 A;  2O0W A;  2O17 A;  1HG8 A;  2O0V A;  4OJL A;  2BM6 A;  4XL9 A;  1KCC A;  2VFP A;  1JTA A;  2BSP A;  1OFE A;  2J8I A;  1PLU A;  4XLE A;  1K8F A;  1QRC A;  3GQ8 A;  3PET A;  2NTQ A;  2VBM A;  2X6Y A;  4W8T A;  4JRA C;  4XR6 A;  2VBE A;  1KQ5 A;  4W8S A;  2BM4 A;  1TSP A;  4XN3 A;  3UW0 A;  1O8H A;  2PYH A;  3ZPP A;  4XON A;  1OGO X;  1TYW A;  2INU A;  3B90 A;  1QJV A;  1DBG A;  1LM1 A;  3TH0 A;  4V02 C;  3GRH A;  3LJY A;  3PSZ A;  4XOT A;  4Z03 A;  1OOC A;  4C2L A;  2QXZ A;  2QY1 A;  3FY3 A;  2VJI A;  2BM5 A;  4XMY A; 
#chains in the Genus database with same CATH homology
 4XLC A;  1BN8 A;  4YZ0 A;  1H80 A;  4XN0 A;  3VSV A;  3VMW A;  4YZQ A;  4EW9 A;  5C1C A;  2PEC A;  1KTW A;  1RWR A;  4OZY A;  4OJ5 A;  3EQO A;  1O8F A;  2PYG A;  4PMH A;  1O8D A;  4YZX A;  4AVZ A;  3VSU A;  2NST A;  1K5C A;  3B4N A;  1O8I A;  1O8E A;  4XOR A;  2INV A;  4Z06 A;  3VST A;  2X85 A;  1PXZ A;  4U4B A;  3KRG A;  2NTP A;  1O8M A;  1DBO A;  4XOP A;  2NSP A;  1EE6 A;  2O1D A;  3LMW A;  4XM3 A;  4YZA A;  1RMG A;  3SUC A;  3EQN A;  2O04 A;  1O8G A;  2X6X A;  5AMV A;  1OFL A;  2EWE A;  2NT9 A;  3GQ7 A;  4W8R A;  1GQ8 A;  1CZF A;  1NHC A;  4XLF A;  2QX3 A;  3JUR A;  4URR A;  1IA5 A;  4XKW A;  4NK8 A;  1BHE A;  1OFM A;  2IQ7 A;  4U49 A;  3GQ9 A;  1RU4 A;  2ODL A;  2X3H A;  4XNF A;  4OJO A;  1VBL A;  4NK6 A;  3T9G A;  2UVE A;  1XG2 A;  1JRG A;  2UVF A;  1OGM X;  2VBK A;  1WMR A;  4MR0 A;  1PE9 A;  4Z05 A;  5C1E A;  2NT6 A;  4XLH A;  4YEL A;  1QCX A;  1AIR A;  1O8J A;  3VMV A;  2Z8G A;  3B8Y A;  4I84 A;  4OJP A;  1IDK A;  4HWV A;  4OZZ A;  3WWG A;  4MXN A;  1O88 A;  2VJJ A;  3GQA A;  4XLA A;  4YEJ A;  2NTB A;  4W8Q A;  4XKV A;  1KCD A;  1O8L A;  1IDJ A;  4XQF A;  1IB4 A;  1O8K A;  4OJ6 A;  2X6W A;  3ZSC A;  1X0C A;  2NZM A;  2O0W A;  2O17 A;  1HG8 A;  2O0V A;  4OJL A;  4XL9 A;  1KCC A;  1JTA A;  2BSP A;  1PLU A;  4XLE A;  3GQ8 A;  2NTQ A;  2VBM A;  2X6Y A;  4W8T A;  4XR6 A;  2VBE A;  4W8S A;  3UW0 A;  4XN3 A;  1O8H A;  2PYH A;  3ZPP A;  4XON A;  1OGO X;  3B90 A;  2INU A;  1QJV A;  1DBG A;  3GRH A;  4Z03 A;  4XOT A;  1OOC A;  4C2L A;  2QXZ A;  2QY1 A;  3FY3 A;  2VJI A;  4XMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...