1HG8A

Endopolygalacturonase from the phytopathogenic fungus fusarium moniliforme
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
349
structure length
349
Chain Sequence
b'DPCSVTEYSGLATAVSSCKNIVLNGFQVPTGKQLDLSSLQNDSTVTFKGTTTFATTADNDFNPIVISGSNITITGASGHVIDGNGQAYWDGKGSNSNSNQKPDHFIVVQKTTGNSKITNLNIQNWPVHCFDITGSSQLTISGLILDNRAGDKPNAKSGSLPAAHNTDGFDISSSDHVTLDNNHVYNQDDCVAVTSGTNIVVSNMYCSGGHGLSIGSVGGKSDNVVDGVQFLSSQVVNSQNGCRIKSNSGATGTINNVTYQNIALTNISTYGVDVQQDYLNGGPTGKPTNGVKISNIKFIKVTGTVASSAQDWFILCGDGSCSGFTFSGNAITGGGKTSSCNYPTNTCPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOPOLYGALACTURONASE
molecule tags Hydrolase
source organism Fusarium moniliforme
publication title Structural Requirements of Endopolygalacturonase for the Interaction with Pgip (Polygalacturonase-Inhibiting Protein)
pubmed doi rcsb
total genus 133
structure length 349
sequence length 349
ec nomenclature ec 3.2.1.15: Endo-polygalacturonase.
pdb deposition date 2000-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00295 Glyco_hydro_28 Glycosyl hydrolases family 28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 1hg8A00
4XM3A 2VBEA 4OJ6A 2VBMA 1IB4A 1NHCA 3VSTA 1OOCA 4XORA 3VMWA 2UVEA 3JURA 2O04A 3VMVA 4Z03A 4W8SA 3VSUA 3T9GA 1JTAA 2Z8GA 4EW9A 4XNFA 1IDKA 5C1EA 4NK6A 4W8TA 1KCDA 1KCCA 2NT9A 4XN3A 3WWGA 4XLCA 1AIRA 1EE6A 1DBOA 4OJOA 1JRGA 2X3HA 4Z05A 2VJIA 2NZMA 4XKWA 2X85A 3ZPPA 2BSPA 2QY1A 4W8RA 1PLUA 1XG2A 2ODLA 1VBLA 4Z06A 4W8QA 4AVZA 3SUCA 1O8IA 2NTQA 3LMWA 1O88A 3B90A 3FY3A 1RMGA 1QJVA 1RU4A 2NSPA 4OZZA 3EQNA 1KTWA 2INVA 4NK8A 2INUA 1X0CA 1PE9A 4PMHA 1K5CA 4YZ0A 1IDJA 4XKVA 4XLFA 2QX3A 3UW0A 3GQ8A 3EQOA 4XLEA 4URRA 2NT6A 3GQAA 2NTBA 1O8LA 2NTPA 1QCXA 4I84A 4HWVA 1O8KA 1IA5A 1OGMX 4XR6A 4YELA 4XONA 2EWEA 4OJPA 1RWRA 4XMYA 2O0WA 4XLHA 4XL9A 4OJLA 1CZFA 4XN0A 2VJJA 2IQ7A 1OGOX 1HG8A 4XOPA 1O8FA 3B8YA 1O8DA 1BN8A 1GQ8A 3GQ7A 4XOTA 1PXZA 2O1DA 4YZQA 3VSVA 4OJ5A 1O8EA 2NSTA 4U49A 1O8MA 1BHEA 2O0VA 2O17A 4OZYA 2X6XA 3GQ9A 2UVFA 4MR0A 3ZSCA 3GRHA 2VBKA 1OFMA 4XLAA 3KRGA 1OFLA 2X6YA 2X6WA 3B4NA 4U4BA 4C2LA 1O8GA 2PYGA 5C1CA 1O8HA 4MXNA 4YZXA 2QXZA 5AMVA 2PECA 1O8JA 1DBGA 4YZAA 1WMRA 1H80A 4XQFA 4YEJA 2PYHA
chains in the Genus database with same CATH superfamily
4XM3A 5JLVC 2VBEA 2BM4A 4OJ6A 2VBMA 1IB4A 4YC5A 2J8KA 1NHCA 3VSTA 1OOCA 2IOUG 4XORA 1QA2A 3LYCA 3VMWA 2UVEA 3JURA 1WXRA 2O04A 3VMVA 2VFMA 2VFNA 4V02C 4Z03A 4W8SA 4YFOA 3VSUA 1TSPA 3NB2A 1JTAA 1LM1A 2Z8GA 3T9GA 3ML3A 3PETA 4EW9A 4XNFA 1IDKA 5C1EA 4NK6A 4W8TA 1KCDA 1KCCA 2BM7A 2NT9A 1KQ5A 4XN3A 1QA1A 3WWGA 3SY2A 4XLCA 1AIRA 3TH0A 1EE6A 1DBOA 4OJOA 1JRGA 2X3HA 2G0YA 2VJIA 1LLZA 4Z05A 4AVZA 2NZMA 4XKWA 2X85A 3N6ZA 3ZPPA 2BSPA 4OPWA 2QY1A 4W8RA 1PLUA 1OFEA 3P4GA 1XG2A 2ODLA 1VBLA 3BH7B 2PYHA 4OM9A 4W8QA 1O8IA 4Z06A 2NTQA 3SUCA 1QQ1A 3LMWA 1O88A 3B90A 3FY3A 3RIQA 1RMGA 1QJVA 2W7ZA 1RU4A 3DU1X 4YEIA 3NAWA 2NSPA 2XTWA 4OZZA 3EQNA 5JMCB 1KTWA 1OFDA 2XTXA 4KH3A 2INVA 4NK8A 3SQVA 1X0CA 1PE9A 2QYUA 4PMHA 1K5CA 4YCQA 4YZ0A 1IDJA 4XKVA 4YDTA 2V5IA 1K8FA 2VFQA 1EZGA 4XLFA 1TYVA 2QX3A 3UW0A 3GQ8A 3EQOA 4XLEA 4JRAC 4URRA 2NT6A 2B0RA 3GQAA 3H09A 2NTBA 2F3LA 1O8LA 2NTPA 1QCXA 4I84A 4HWVA 1O8KA 2O6WA 1IA5A 1OGMX 1HF2A 4XR6A 1QRCA 4YELA 4XONA 2EWEA 4OJPA 1RWRA 4XMYA 2O0WA 4XLHA 4XL9A 4OJLA 1CZFA 4XN0A 2VJJA 1TYWA 2XC1A 2IQ7A 1OGOX 3JX8A 1HG8A 4XOPA 1EA0A 2BM5A 3PSZA 1O8FA 2BX6A 3B8YA 1O8DA 1K4ZA 1BN8A 1GQ8A 1DABA 3GQ7A 4XOTA 1PXZA 2O1DA 2XTYA 4YZQA 3VSVA 4OJ5A 1O8EA 2NSTA 4U49A 1O8MA 2VFOA 1BHEA 2O0VA 2QZAA 3PSSA 2J8IA 2O17A 2YUHA 1CLWA 2X6XA 4OZYA 1L1IA 3GQ9A 3N90A 1TYXA 2UVFA 4MR0A 3ZSCA 3GRHA 5DNSA 3SZEA 3AK5A 2VBKA 1OFMA 4XLAA 3KRGA 3SYJA 1OFLA 2X6YA 2X6WA 3B4NA 4U4BA 4C2LA 1O8GA 2PYGA 5C1CA 1O8HA 4MXNA 4YZXA 1TYUA 2QXZA 2VFPA 2XT4A 5AMVA 2PECA 1O8JA 1DBGA 1QRBA 4YZAA 2BM6A 2XT2A 3BH6B 1WMRA 1H80A 3LJYA 1LLWA 4XQFA 4YEJA 1QA3A 2INUA
chains in the Genus database with same CATH topology
4XM3A 2VBEA 4OJ6A 2VBMA 1IB4A 1NHCA 3VSTA 1OOCA 4XORA 3VMWA 2UVEA 3JURA 2O04A 3VMVA 4Z03A 4W8SA 3VSUA 3T9GA 1JTAA 2Z8GA 4EW9A 4XNFA 1IDKA 5C1EA 4NK6A 4W8TA 1KCDA 1KCCA 2NT9A 4XN3A 3WWGA 4XLCA 1AIRA 1EE6A 1DBOA 4OJOA 1JRGA 2X3HA 4Z05A 2VJIA 2NZMA 4XKWA 2X85A 3ZPPA 2BSPA 2QY1A 4W8RA 1PLUA 1XG2A 2ODLA 1VBLA 4Z06A 4W8QA 4AVZA 3SUCA 1O8IA 2NTQA 3LMWA 1O88A 3B90A 3FY3A 1RMGA 1QJVA 1RU4A 2NSPA 4OZZA 3EQNA 1KTWA 2INVA 4NK8A 2INUA 1X0CA 1PE9A 4PMHA 1K5CA 4YZ0A 1IDJA 4XKVA 4XLFA 2QX3A 3UW0A 3GQ8A 3EQOA 4XLEA 4URRA 2NT6A 3GQAA 2NTBA 1O8LA 2NTPA 1QCXA 4I84A 4HWVA 1O8KA 1IA5A 1OGMX 4XR6A 4YELA 4XONA 2EWEA 4OJPA 1RWRA 4XMYA 2O0WA 4XLHA 4XL9A 4OJLA 1CZFA 4XN0A 2VJJA 2IQ7A 1OGOX 1HG8A 4XOPA 1O8FA 3B8YA 1O8DA 1BN8A 1GQ8A 3GQ7A 4XOTA 1PXZA 2O1DA 4YZQA 3VSVA 4OJ5A 1O8EA 2NSTA 4U49A 1O8MA 1BHEA 2O0VA 2O17A 4OZYA 2X6XA 3GQ9A 2UVFA 4MR0A 3ZSCA 3GRHA 2VBKA 1OFMA 4XLAA 3KRGA 1OFLA 2X6YA 2X6WA 3B4NA 4U4BA 4C2LA 1O8GA 2PYGA 5C1CA 1O8HA 4MXNA 4YZXA 2QXZA 5AMVA 2PECA 1O8JA 1DBGA 4YZAA 1WMRA 1H80A 4XQFA 4YEJA 2PYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XM3 A;  2VBE A;  4OJ6 A;  2VBM A;  1IB4 A;  1NHC A;  3VST A;  1OOC A;  4XOR A;  3VMW A;  2UVE A;  3JUR A;  2O04 A;  3VMV A;  4Z03 A;  4W8S A;  3VSU A;  3T9G A;  1JTA A;  2Z8G A;  4EW9 A;  4XNF A;  1IDK A;  5C1E A;  4NK6 A;  4W8T A;  1KCD A;  1KCC A;  2NT9 A;  4XN3 A;  3WWG A;  4XLC A;  1AIR A;  1EE6 A;  1DBO A;  4OJO A;  1JRG A;  2X3H A;  4Z05 A;  2VJI A;  2NZM A;  4XKW A;  2X85 A;  3ZPP A;  2BSP A;  2QY1 A;  4W8R A;  1PLU A;  1XG2 A;  2ODL A;  1VBL A;  4Z06 A;  4W8Q A;  4AVZ A;  3SUC A;  1O8I A;  2NTQ A;  3LMW A;  1O88 A;  3B90 A;  3FY3 A;  1RMG A;  1QJV A;  1RU4 A;  2NSP A;  4OZZ A;  3EQN A;  1KTW A;  2INV A;  4NK8 A;  2INU A;  1X0C A;  1PE9 A;  4PMH A;  1K5C A;  4YZ0 A;  1IDJ A;  4XKV A;  4XLF A;  2QX3 A;  3UW0 A;  3GQ8 A;  3EQO A;  4XLE A;  4URR A;  2NT6 A;  3GQA A;  2NTB A;  1O8L A;  2NTP A;  1QCX A;  4I84 A;  4HWV A;  1O8K A;  1IA5 A;  1OGM X;  4XR6 A;  4YEL A;  4XON A;  2EWE A;  4OJP A;  1RWR A;  4XMY A;  2O0W A;  4XLH A;  4XL9 A;  4OJL A;  1CZF A;  4XN0 A;  2VJJ A;  2IQ7 A;  1OGO X;  1HG8 A;  4XOP A;  1O8F A;  3B8Y A;  1O8D A;  1BN8 A;  1GQ8 A;  3GQ7 A;  4XOT A;  1PXZ A;  2O1D A;  4YZQ A;  3VSV A;  4OJ5 A;  1O8E A;  2NST A;  4U49 A;  1O8M A;  1BHE A;  2O0V A;  2O17 A;  4OZY A;  2X6X A;  3GQ9 A;  2UVF A;  4MR0 A;  3ZSC A;  3GRH A;  2VBK A;  1OFM A;  4XLA A;  3KRG A;  1OFL A;  2X6Y A;  2X6W A;  3B4N A;  4U4B A;  4C2L A;  1O8G A;  2PYG A;  5C1C A;  1O8H A;  4MXN A;  4YZX A;  2QXZ A;  5AMV A;  2PEC A;  1O8J A;  1DBG A;  4YZA A;  1WMR A;  1H80 A;  4XQF A;  4YEJ A;  2PYH A; 
#chains in the Genus database with same CATH topology
 4XM3 A;  5JLV C;  2VBE A;  2BM4 A;  4OJ6 A;  2VBM A;  1IB4 A;  4YC5 A;  2J8K A;  1NHC A;  3VST A;  1OOC A;  2IOU G;  4XOR A;  1QA2 A;  3LYC A;  3VMW A;  2UVE A;  3JUR A;  1WXR A;  2O04 A;  3VMV A;  2VFM A;  2VFN A;  4V02 C;  4Z03 A;  4W8S A;  4YFO A;  3VSU A;  1TSP A;  3NB2 A;  1JTA A;  1LM1 A;  2Z8G A;  3T9G A;  3ML3 A;  3PET A;  4EW9 A;  4XNF A;  1IDK A;  5C1E A;  4NK6 A;  4W8T A;  1KCD A;  1KCC A;  2BM7 A;  2NT9 A;  1KQ5 A;  4XN3 A;  1QA1 A;  3WWG A;  3SY2 A;  4XLC A;  1AIR A;  3TH0 A;  1EE6 A;  1DBO A;  4OJO A;  1JRG A;  2X3H A;  2G0Y A;  2VJI A;  1LLZ A;  4Z05 A;  4AVZ A;  2NZM A;  4XKW A;  2X85 A;  3N6Z A;  3ZPP A;  2BSP A;  4OPW A;  2QY1 A;  4W8R A;  1PLU A;  1OFE A;  3P4G A;  1XG2 A;  2ODL A;  1VBL A;  3BH7 B;  2PYH A;  4OM9 A;  4W8Q A;  1O8I A;  4Z06 A;  2NTQ A;  3SUC A;  1QQ1 A;  3LMW A;  1O88 A;  3B90 A;  3FY3 A;  3RIQ A;  1RMG A;  1QJV A;  2W7Z A;  1RU4 A;  3DU1 X;  4YEI A;  3NAW A;  2NSP A;  2XTW A;  4OZZ A;  3EQN A;  5JMC B;  1KTW A;  1OFD A;  2XTX A;  4KH3 A;  2INV A;  4NK8 A;  3SQV A;  1X0C A;  1PE9 A;  2QYU A;  4PMH A;  1K5C A;  4YCQ A;  4YZ0 A;  1IDJ A;  4XKV A;  4YDT A;  2V5I A;  1K8F A;  2VFQ A;  1EZG A;  4XLF A;  1TYV A;  2QX3 A;  3UW0 A;  3GQ8 A;  3EQO A;  4XLE A;  4JRA C;  4URR A;  2NT6 A;  2B0R A;  3GQA A;  3H09 A;  2NTB A;  2F3L A;  1O8L A;  2NTP A;  1QCX A;  4I84 A;  4HWV A;  1O8K A;  2O6W A;  1IA5 A;  1OGM X;  1HF2 A;  4XR6 A;  1QRC A;  4YEL A;  4XON A;  2EWE A;  4OJP A;  1RWR A;  4XMY A;  2O0W A;  4XLH A;  4XL9 A;  4OJL A;  1CZF A;  4XN0 A;  2VJJ A;  1TYW A;  2XC1 A;  2IQ7 A;  1OGO X;  3JX8 A;  1HG8 A;  4XOP A;  1EA0 A;  2BM5 A;  3PSZ A;  1O8F A;  2BX6 A;  3B8Y A;  1O8D A;  1K4Z A;  1BN8 A;  1GQ8 A;  1DAB A;  3GQ7 A;  4XOT A;  1PXZ A;  2O1D A;  2XTY A;  4YZQ A;  3VSV A;  4OJ5 A;  1O8E A;  2NST A;  4U49 A;  1O8M A;  2VFO A;  1BHE A;  2O0V A;  2QZA A;  3PSS A;  2J8I A;  2O17 A;  2YUH A;  1CLW A;  2X6X A;  4OZY A;  1L1I A;  3GQ9 A;  3N90 A;  1TYX A;  2UVF A;  4MR0 A;  3ZSC A;  3GRH A;  5DNS A;  3SZE A;  3AK5 A;  2VBK A;  1OFM A;  4XLA A;  3KRG A;  3SYJ A;  1OFL A;  2X6Y A;  2X6W A;  3B4N A;  4U4B A;  4C2L A;  1O8G A;  2PYG A;  5C1C A;  1O8H A;  4MXN A;  4YZX A;  1TYU A;  2QXZ A;  2VFP A;  2XT4 A;  5AMV A;  2PEC A;  1O8J A;  1DBG A;  1QRB A;  4YZA A;  2BM6 A;  2XT2 A;  3BH6 B;  1WMR A;  1H80 A;  3LJY A;  1LLW A;  4XQF A;  4YEJ A;  1QA3 A;  2INU A; 
#chains in the Genus database with same CATH homology
 4XM3 A;  2VBE A;  4OJ6 A;  2VBM A;  1IB4 A;  1NHC A;  3VST A;  1OOC A;  4XOR A;  3VMW A;  2UVE A;  3JUR A;  2O04 A;  3VMV A;  4Z03 A;  4W8S A;  3VSU A;  3T9G A;  1JTA A;  2Z8G A;  4EW9 A;  4XNF A;  1IDK A;  5C1E A;  4NK6 A;  4W8T A;  1KCD A;  1KCC A;  2NT9 A;  4XN3 A;  3WWG A;  4XLC A;  1AIR A;  1EE6 A;  1DBO A;  4OJO A;  1JRG A;  2X3H A;  4Z05 A;  2VJI A;  2NZM A;  4XKW A;  2X85 A;  3ZPP A;  2BSP A;  2QY1 A;  4W8R A;  1PLU A;  1XG2 A;  2ODL A;  1VBL A;  4Z06 A;  4W8Q A;  4AVZ A;  3SUC A;  1O8I A;  2NTQ A;  3LMW A;  1O88 A;  3B90 A;  3FY3 A;  1RMG A;  1QJV A;  1RU4 A;  2NSP A;  4OZZ A;  3EQN A;  1KTW A;  2INV A;  4NK8 A;  2INU A;  1X0C A;  1PE9 A;  4PMH A;  1K5C A;  4YZ0 A;  1IDJ A;  4XKV A;  4XLF A;  2QX3 A;  3UW0 A;  3GQ8 A;  3EQO A;  4XLE A;  4URR A;  2NT6 A;  3GQA A;  2NTB A;  1O8L A;  2NTP A;  1QCX A;  4I84 A;  4HWV A;  1O8K A;  1IA5 A;  1OGM X;  4XR6 A;  4YEL A;  4XON A;  2EWE A;  4OJP A;  1RWR A;  4XMY A;  2O0W A;  4XLH A;  4XL9 A;  4OJL A;  1CZF A;  4XN0 A;  2VJJ A;  2IQ7 A;  1OGO X;  1HG8 A;  4XOP A;  1O8F A;  3B8Y A;  1O8D A;  1BN8 A;  1GQ8 A;  3GQ7 A;  4XOT A;  1PXZ A;  2O1D A;  4YZQ A;  3VSV A;  4OJ5 A;  1O8E A;  2NST A;  4U49 A;  1O8M A;  1BHE A;  2O0V A;  2O17 A;  4OZY A;  2X6X A;  3GQ9 A;  2UVF A;  4MR0 A;  3ZSC A;  3GRH A;  2VBK A;  1OFM A;  4XLA A;  3KRG A;  1OFL A;  2X6Y A;  2X6W A;  3B4N A;  4U4B A;  4C2L A;  1O8G A;  2PYG A;  5C1C A;  1O8H A;  4MXN A;  4YZX A;  2QXZ A;  5AMV A;  2PEC A;  1O8J A;  1DBG A;  4YZA A;  1WMR A;  1H80 A;  4XQF A;  4YEJ A;  2PYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...