1HGVA

Filamentous bacteriophage ph75
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
source organism Bacteriophage ph75
molecule tags Virus
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hgvA00
2C0XA 1IFIA 1IFDA 1IFJA 1HGVA 2CPSA 1HGZA 1NH4A 2CPBA 1HH0A 2C0WA 1FDMA 2MJZA
chains in the Genus database with same CATH superfamily
2KSEA 2N1TB 3D6YA 4HH2A 2O01N 3G6EP 2ZVNB 1WMKA 5GTIH 3RK3E 1SQBD 2KNCA 1OVVA 1GDTA 3IN6A 1VF5D 1RQUA 4H44D 2KP8A 3RK3C 3VMZA 4I2LC 1QVGO 1NTMG 2GA1A 2Q9IA 2WVRA 2K9JA 3V5BA 2KXPB 5AW1B 3BASA 3CC4P 4DZOA 3P7KA 1HH0A 2FY8A 4Y99C 3CPWO 4GIFA 4C46A 3M9BA 1BDCA 1T8ZA 2B88A 2KSJA 1E79H 3LIDA 2KZJA 5AW3B 2KZIA 3H1KD 2MJZA 1J1DB 4NPDA 1JY2O 2W8ZA 3TK1A 2RMZA 2OYIC 2M5AA 2WMMA 2RKLA 2Y0DA 5CJ4A 2E76B 3B5NB 1QLED 4JPZB 1LTJC 1M8OB 4QMAA 1FZAA 2KI7B 1PFIA 3FWLA 2O01H 2D2CB 4N3YB 1T3JA 1RE4C 2IFNA 1UIIA 3L70G 5C39A 1L0NK 2XDJA 2FYUJ 2E76D 3AEBC 5AVQB 2WT7A 3B5ND 2Z5HA 3TSIA 1AQ5A 3CC7P 4H44C 3TF5A 5AW4B 4LGDE 3BATA 1N2DC 2D2CD 1BGYG 3M9QA 1R8EA 4DOJA 1AVYA 3V6IA 2YMYA 1JY3O 1NWQA 4C7NA 1IJDB 3AE6C 2N1TC 2QG4A 5GTHE 4CPGA 3H1IG 1ZRTD 1M56D 2WQYC 1N73C 5KLIB 3H1KE 1FE6A 3FGAD 2FYUD 2OGUA 1NAYA 1EDJA 1L4AA 1AA0A 5APSA 1E5WA 2C0XA 1KQGB 3CX5I 1JTHA 5H2FE 4YXDC 1BCCG 1FC2C 2B89A 1RH5B 2IDBA 1HWTC 1EXJA 1NTZK 2HPCA 3VP8A 1P84I 3WMM0 1JB0J 2WITA 2AEFA 3PJSK 2OYOA 2PFXA 3I5CA 1Q86Q 1Y9BA 1J1DC 1A02F 3IFMA 2R5DA 1LWUA 1X22A 2QM8A 1YTZT 3TDKA 1ZV8A 3D70A 1LTJA 3M0AA 4Y28J 2ZYDA 2OTJP 1CI6B 2E5YA 3EFGA 2FYNB 3B5NC 2ZT9B 1YIJP 2IBZE 1NU1G 1QEXA 5AVXB 4M3LA 3TYYA 1FDIA 4N6JA 2AXCA 3QH9A 3Q3DA 2K9YA 3M91A 3V4WA 2KNCB 1YYCA 3AE9C 3AE3C 4GDOA 1AFOA 3L37A 1ZRTE 3VN0A 2IBZI 3HTKA 1NTKK 4I7ZB 1W2EA 3H1LJ 2FYUE 2KK7A 1AV1A 5AVYB 1ZLLA 5B66E 1S5LX 4WY4A 1KORA 5KLVK 1CW5A 2K9JB 2SPZA 2RN0A 3RGUA 2I8DA 3A3YB 1VQLP 1DX7A 2QJYB 3RL0D 4ZKPA 4GOFA 5KAIH 1WRGA 4ZKUA 2H88C 2YIUB 4R4MA 2KYVA 3NXSA 1NTZJ 4BWNA 5KAIE 1KTMA 5KKZC 1TU3F 1FZGA 2Y0CA 4HB1A 4ASVA 4C7RA 5KLIC 3H1KG 3VP9A 4RJTA 2M5AB 3H1LD 3L75G 1JNMA 2M0BA 4PJ0H 2WTYA 5APUA 3JCUH 2W6AA 3P8CD 5B5EE 4ZNCA 4U3FJ 1M1KQ 1FOSE 2VRSA 1G2CA 2JP3A 3G4SP 3LIEA 1KYOD 4HYTB 3KHUA 1LP1A 3KDPB 1YQ4C 1NTZD 3I55P 2JDIH 2ITAA 1GD2E 1K8AQ 1UIXA 1L0NE 2HFED 2WT7B 3A5TA 1NYHA 3BCCJ 1KILE 1IZNB 1X9VA 2KLVA 2QIWA 5TISH 4W7ZA 2FYNC 2ZT9C 3L4FA 1EZVD 2IBZG 1Y47A 2A06D 1NH4A 1SQBK 1LGHB 1MV8A 4C7NB 2L5GB 3F5HA 2QJPC 1NKNA 4KHXA 5BU5A 3KPEA 3USSA 5APWA 1RF0C 1LTIC 2G8YA 2W90A 2HG5D 3Q1MA 2YKPA 2E74B 1BE3J 4I7ZC 2WZ7A 4YTPC 3BCCD 3H6PA 2BCCE 1L4AB 3H1LE 3TGUJ 1IO4A 1USDA 3HRNA 1NAFA 1JTHB 1S3JA 3UIAA 4JYBA 5KLVD 3CC2P 3P8CE 2QRXA 1HUCA 3MP7B 1VPCA 1S5LH 1DH3A 3KZIH 2HPCB 1KYOE 1FS0E 1L0LG 3CXHE 1DIPA 3C9IA 1NTZE 1ZR4A 1S5LE 2OYIB 1L4AD 2FFDA 1BE3D 2LXCB 2JWDA 1LTJB 3H25A 3FX0A 3TGUD 1PGPA 3CXHI 1KD1Q 2DW3A 1JY2N 5AVVB 3OAKA 2IFMA 1EZVE 5AVSB 3CCVP 3O6QA 2H7HA 2A06E 1RQVA 3GW6A 1FDMA 2N9BA 3HE5A 2Y9ZA 3M0DA 2FYZA 1LTAC 1VQOP 2K88A 2XV5A 4U7JA 1KN7A 4NPEA 2GUVA 3E7KA 3SFDC 2J58A 4HKZH 3HTKB 3ZDMA 1T6AA 1H0TA 3WU2H 3LW5J 1KB9E 3S1KA 1L0NG 1MZ9A 1FZBA 4PD4H 1ZMEC 1MFTA 3BCCE 1NTKE 4RKUJ 4WY4B 4D6TE 3QWOC 3CCLP 1ZP0C 2XKMA 1SQQG 1M90Q 2Q5UA 2XZRA 5KLVE 4EIJA 5KJ7A 1KB9I 2KB7P 2WPSA 3CMEP 2HYNA 1SQXK 1RE3C 2KUBA 3D71A 1Q2NA 1RF0A 1N73B 1SP4A 2FYUK 1OMIA 1T3UA 1Q90D 5GTIE 2M3EA 4IFDK 1YHQP 2E74C 1ZR2A 3AE8C 1SFCA 3JC22 1BE3E 2YO2A 2PP6A 2BCCG 1L4AC 2BEQD 2E5TA 1SQPJ 1GU4A 3TGUE 3BRVB 2N1TD 2H89C 3H1JJ 1FOSF 4AUWA 3K5BA 3L74G 1G2CB 1FZFA 3GLMA 1YI2P 2Y9YA 1GMJA 5CJ0A 2JO1A 1PPJG 2MKVA 1IFIA 2I1JA 2IX7C 1ZXGA 3PTZA 2W27A 3L71G 2B9BA 1YJWP 1VQKP 3L36A 2QSIA 3M9HA 1IFMA 4OWFA 1LWUC 1R5SA 5KTBA 1GK4A 2H43A 1SQPD 2NZ2A 3H1JD 3G3ZA 5CCGA 3L72J 5AVUB 3OA7A 1VQ4P 1PP9J 2IPPA 2J5UA 1GTWA 1GL2A 1SQXJ 1SQBE 4IFMA 4IOIH 3CCQP 3LW5H 1FZEA 3SWKA 5APQA 1IC2A 1S9KD 1VQMP 1FJKA 1HF9A 1NTKG 1R5LA 3CWBG 4OGQB 4WY4C 4D6TG 1NHLA 3C8VA 4L76A 1RE3A 3L72D 4JBZA 5KLVG 1YJ9P 4XA4A 1LT1A 1M1JA 1PP9D 1VQPP 5KKZB 1OVRA 2FXPA 1SQXD 1Q7YQ 3CMAP 1YBKA 2M3BA 2CPBA 3HE4A 3CCRP 3OW2O 1LT9A 3EWKA 3NTNA 2FFDB 3AEDC 2KLUA 2WPQA 4L73A 4OGQD 1WT6A 1ZW0A 1LTBC 1FU1A 3G71P 3WUTA 1KMIZ 2Y0EA 5CCHA 1SQPE 1OIPA 3B4SA 2Q3IA 4HJGH 3KQGA 3AE2C 3H1JE 3H32A 3O6QB 4Z1MH 3IF4A 3L73J 1NOHA 3H1HJ 4GOEA 3HE5B 3G9RA 3GHGA 1DEEG 3W68A 1K73Q 3HUSA 3BRTB 1H0TB 1Q82Q 2FKWB 4WB4A 1VQNP 3AE4C 1S9KE 3MIWA 3A7OA 2YKQA 2KS1A 1VQ5P 1SQVJ 3C1LA 2QJPB 3CCJP 3L72E 1SQQJ 3L73D 1K04A 1PP9E 3H1HD 4OVNF 4UB8H 1X79B 1SQBG 1SQXE 4IL6H 3NFQA 5TJHA 3EFFK 2A45H 3TNUA 1HBWA 2ZT9D 1SFCB 4LC1A 4UB8E 2JKVA 1FBMA 1S1CX 1FZCA 1PL5A 4JF7A 1NTMJ 4OGQC 1EQ7A 3AEFC 2E75B 3MHVA 1N7SA 1SQVD 4GT1A 4W7YA 2FBWC 3CCEP 3HD7A 4XFJA 1YTZI 3L74J 2AEJA 3EQ2A 1SFCD 1OW8A 3SWYA 1M57D 2JR8A 3P32A 2QE7H 3PLNA 3WUUA 1SLQA 2FFDC 1AQTA 4UB6H 2M8RA 5AVWB 2G3AA 1CZQA 2W6BA 1NTMD 1YQ3C 5AW9B 4PJ0E 4UB6E 3JCUE 4DT0A 4WVZA 2ZJSE 4RESB 1LNQA 3V2QA 1D7MA 1GL2B 1KC8Q 1VQ7P 3H1HE 3M0DC 2QEXP 3L70J 2IYPA 3T97A 2GM4A 3NMDA 2JEEA 4WBAA 1HVVA 2WSSH 3CCMP 2ZFCA 1G1JA 3CD6P 3MTUE 2OARA 5CCGD 5DJTB 2QM7A 1FDOA 5BU8B 2P67A 4U3FD 1FJPA 5E79H 5TISE 1KFNA 1BGYJ 1GL2D 2C9NY 1M1JB 5KJ7C 2ZXXA 2WSEJ 3AEEC 2HODA 1DEBA 3U59A 2NRGA 3L70D 1XTGB 2O1KA 3HE4B 3H1IJ 2OYHC 1LT9B 2FYUG 2QVAA 1SFCC 1Q81Q 2Q1KA 4ASWA 4L75A 1KQLA 4H0LB 4RO0A 4LLHA 4PD4D 2ZYAA 3RK2C 3AE1C 4JYCA 4NPFX 4YXWH 2N9YB 1EXIA 1OZHA 2E75C 1BGYD 1BCCJ 3H32B 3PH0A 4BRYA 2V7QJ 1K9MQ 4IFFA 2R32A 2E74D 2CPSA 4BXLA 2Q3EA 3GHGB 3KZIE 5CMZA 1N8RQ 1DD4A 3S4RA 3HUSB 4YPCA 3H1ID 3P8MC 2ZXEB 2E43A 1LWUB 3A0HH 4GODA 1SQPK 4H0LD 1KYOI 5CCHD 2K1AA 2W83C 2O1JA 3E1IA 3F89A 3A0HE 4K35A 5AW7B 1GK6A 1IK7A 2LXBA 2NPSA 3CLQA 5M1BA 4U3FE 3U1CA 2KS1B 2W6JH 1NU1J 2CK3H 5CCGC 1BCCD 1JM0A 3VMAA 3AECC 1GL2C 2BASA 2WPRA 3L70E 1EZVI 4WWIA 2WWWA 3V2RA 3WU2E 1FZCB 2FXMA 4PD4E 4W80A 2K37A 1JOCA 1N7SB 1KILA 1GW3A 2WSEH 1NU1D 3GF7A 1BGYE 1USEA 1OWAA 1M1JC 3HD7B 3CCSP 1J1EB 2AEMA 2OYHA 1HGVA 3PHLA 3MUDA 1BSHA 1PGOA 4WY4D 3CL3D 2YKOA 1JY3N 3VMXA 3H1IE 1L2PA 1LT9C 3H1KJ 1LTTC 3H1LG 4N78D 1U7JA 5DJUB 2PRRA 3L75J 2YXRB 1VQ8P 4H0LC 3AEAC 1QVFO 1N7SD 2I1KA 5CCHC 1AVOA 3U1AA 2R5BA 2V7QH 4EOTA 2WSCJ 2WPVB 3HD7D 4DCKA 2E42A 1EC5A 2KIKA 1LP1B 4MN4C 1BCCE 1IFNA 1URQA 2B87A 1OW6A 2YMKA 1L0LK 3A0BH 1NTZG 3RL0g 4EI2A 4OH8B 3GHGC 3VYIA 3T97B 1VDFA 3Q5SA 1M7LA 3HUSC 1PIXA 1JCDA 3A0BE 3CX5D 2P58A 3L75D 2POHA 2IYOA 4IL6X 1SS1A 1P84D 1EZVG 2IZ0A 4U3FG 2A06G 3B8EB 1NU1E 2YXQB 2C0WA 3IR9A 1N86A 4I6MC 2HODB 3WUVA 1HTLC 1SVFA 1EDKA 1QGKB 2WSFJ 4PV1C 1RF1C 3ABVC 3BCCG 1KQSO 4N78E 5KAFH 1ZN5A 1IFDA 3SFEC 3W67A 1SQVK 1FZCC 1Y8AA 2XNDH 1OXZA 1VF5C 1AJYA 1SQQK 5KAFE 2IZ1A 4AYCA 1NJIQ 3Q5PA 4BRYB 2JJLA 1N7SC 2IBZD 2P1JA 2QJKB 2OQQA 1KZUB 3HD7C 5GTHH 1J1EC 3CX5H 3R2PA 1L0LJ 2UWJE 1NVOA 3E1RA 5AW5B 1XTCC 1NO4A 3CX5E 1BE3G 2P7JA 1NTMK 2LKMA 1OX3A 3GF3A 1P84H 3TGUG 1VL2A 3L75E 3V2NA 2WSCH 2NPSB 5H2FH 1OFCX 2OTKE 3S9OA 1P84E 3R4YA 2HR3A 2AXTH 1T2KD 1BDDA 4K3AA 2JWAA 2ZAEB 3B71A 1JEKA 1L0LD 1VQ9P 2AXTE 5EFWB 3CCUP 4H13B 2Z4EA 3AE7C 4XE5B 2OYIA 1GZLA 3GG2A 1L0NJ 1PGQA 2J59M 2NPSD 1PZQA 5AW6B 5AW8B 3PRJA 1JO5A 5AVTB 2BEZF 3SSUA 2E76C 1NGMB 3N7NA 1KILB 3N4XA 1KFMA 5CBNA 4GKGA 2WSFH 1RE4A 1W5CE 3MGNA 4H13D 2OYHB 2D2CC 5CHXA 1YITP 1RF1A 1PV3A 2GUSA 3RL0B 1EDLA 4IL6E 1K05A 2P10A 1H88A 5B66H 1U7MA 4KJMA 3RK2B 3JSVC 1L0ND 1G1IA 1OW7A 2BCCJ 5KJ7D 1KILD 1DD3A 4A7PA 1HJBA 3FWNA 1H8AA 1SQQD 2O3JA 2A45I 1URQB 2B87B 1LJ2A 2K3RA 2QJKC 2N1TA 1IFPA 1T2KC 1L0LE 3Q2YA 1N73A 3A2AA 5AVZB 3RK2D 3L71J 2E75D 4ZMDA 4L74A 3VTPC 2BCCD 1SQPG 2C9LY 5B5EH 4DJGA 2NPSC 3O8ZA 1URQD 3H1JG 1H89A 2QA4P 3L73E 3L35A 5BVZA 3L74D 3FXDA 2HLOA 1LTSC 1ZOYC 1FAVA 1PPJD 4KT0J 3CXHD 4JQ0D 4H13C 5APVA 3L71D 5APYA 3GMAA 3II6A 1EDIA 1MUUA 1A02J 1QL2A 1NU1K 1GU5A 1NTKJ 3CWBJ 3B5NA 1JMMA 4D6TJ 3FXEA 1SQVE 4O9BA 3L72G 2ZVOB 1KILC 1SQQE 5E79E 1PP9G 5KLVJ 1CSBA 2H8PD 4EYYQ 1SQXG 3RBZA 3AEGC 3VMYA 3MUDC 2FXOA 2P2UA 1VQ6P 2R3SA 3CI9A 3RL0C 3KXDA 4TT3H 1W2BO 3RK3B 4B86A 1JCCA 2A45G 2PAJA 2XU6A 2ZYGA 1KB9D 1JMBA 2R3CA 1NTME 3D6ZA 3ITKA 1NTKD 3CWBD 1HJ0A 4D6TD 1QX8A 1N7LA 5L8RJ 1JY2P 1KYOH 4Y99B 3PP5A 1URQC 2XNXA 3L74E 3IAOA 1RHZB 3CXHH 2V4HA 2QJYC 2LR2A 2Q7CA 5APXA 1RY3A 1X8YA 1IK9A 1NKZB 1BSNA 3RK3D 1KV4A 1PPJE 2YIUC 1S2EA 1HGZA 1PGJA 2YO3A 3MZWB 4TLFA 3RBXA 3L71E 1MFZA 1OVUA 2Z5IA 1X0TA 1YJNP 1JUNA 5AW0B 2R44A 3L73G 1KQFB 4I1LA 3H1HG 2O01J 4PV1B 1IFJA 1RF1B 3TNUB 1SQBJ 2RH0A 3VOPA 1S4XA 1LTGC 1KB9H 3M06A 3SWFA 3Q5RA 2OTLP 3BVHA 5CBOA 4EDFA 1VF5B 3OJAB 4AQRD 3I56P 1MKMA 4H44B 5AVRB 2YNYA 1JY3P 3AE5C 1CI6A 3KYQA 1GW4A 5AW2B 1S72P 3CWBE 3V4QA 2KOGA 1Z56A 5APTA 1J2JB 2Q6QA 4R4LA 5K5GB 1SQVG 2L91A 2PGDA 1QL1A 4PV1D 3MD0A 3V2PA 1U57A 4PD4I
chains in the Genus database with same CATH topology
1LTIC 4AYCA 2N1TB 2HG5D 1FZCA 2YKPA 4HH2A 2JJLA 1N7SC 4JF7A 1EQ7A 2P1JA 2WZ7A 3H6PA 1GDTA 1L4AB 1KZUB 3HD7C 1IO4A 1J1EC 2KP8A 1N7SA 4GT1A 3HRNA 1NAFA 3R2PA 3RK3C 3VMZA 4W7YA 1JTHB 3HD7A 5AW5B 4I2LC 3UIAA 1YTZI 4JYBA 3P8CE 1XTCC 1NO4A 1HUCA 2P7JA 1NTMK 2LKMA 2Q9IA 3EQ2A 1SFCD 1VPCA 3V5BA 1DH3A 2HPCB 3SWYA 5AW1B 3BASA 4DZOA 3P7KA 1HH0A 3V2NA 2WSCH 3P32A 3C9IA 1SLQA 2FFDC 2NPSB 1ZR4A 4Y99C 2OYIB 4GIFA 4C46A 2M8RA 3M9BA 5AVWB 1T8ZA 1L4AD 1CZQA 2W6BA 2FFDA 2KSJA 3LIDA 1T2KD 5AW9B 5AW3B 1LTJB 2MJZA 1J1DB 1JY2O 4RESB 3TK1A 2OYIC 3V2QA 1JY2N 2Z4EA 5AVVB 1GL2B 3OAKA 5CJ4A 2IFMA 3B5NB 5AVSB 4XE5B 3M0DC 2OYIA 1GZLA 2H7HA 1LTJC 3T97A 2J59M 2NPSD 1FZAA 1FDMA 2GM4A 1PFIA 3NMDA 2JEEA 4WBAA 5AW6B 2N9BA 3HE5A 1HVVA 2O01H 3M0DA 5AW8B 2FYZA 1LTAC 1JO5A 5AVTB 2XV5A 4N3YB 2ZFCA 1G1JA 2GUVA 1T3JA 2J58A 3MTUE 2OARA 3N7NA 3HTKB 1KILB 1RE4C 3N4XA 2IFNA 5CCGD 2QM7A 5BU8B 1KFMA 1MZ9A 2P67A 1FZBA 1L0NK 4GKGA 1FJPA 2XDJA 1KFNA 2WSFH 1RE4A 3MGNA 2OYHB 4WY4B 5CHXA 1GL2D 2C9NY 1M1JB 5KJ7C 5AVQB 2WT7A 1RF1A 2GUSA 3B5ND 3RL0B 2Z5HA 3TSIA 2XKMA 1AQ5A 2HODA 2Q5UA 2XZRA 5AW4B 1DEBA 4EIJA 5KJ7A 4LGDE 3U59A 3BATA 2KB7P 1N2DC 1XTGB 2O1KA 2WPSA 1H88A 3RK2B 2HYNA 3HE4B 1SQXK 2OYHC 1RE3C 1G1IA 3M9QA 5KJ7D 1LT9B 1RF0A 1N73B 1SP4A 2FYUK 1KILD 4DOJA 1SFCC 1T3UA 2YMYA 1HJBA 1JY3O 1KQLA 4C7NA 4LLHA 1NWQA 1H8AA 1IJDB 2N1TC 4IFDK 2A45I 1ZR2A 1SFCA 3RK2C 1URQB 4JYCA 2YO2A 2PP6A 1N73C 1L4AC 2N1TA 3H32B 1GU4A 1T2KC 3BRVB 2N1TD 4IFFA 2R32A 1N73A 1FOSF 2CPSA 1L4AA 4AUWA 3A2AA 5AVZB 3RK2D 5APSA 1E5WA 3GHGB 2C0XA 5CMZA 1G2CB 1FZFA 3HUSB 1JTHA 3P8MC 2ZXEB 5CJ0A 2E43A 1LWUB 3VTPC 2C9LY 1SQPK 1IFIA 2I1JA 2IX7C 2W27A 1HWTC 5CCHD 2NPSC 3O8ZA 1URQD 1NTZK 2O1JA 3E1IA 2HPCA 1H89A 3L36A 3L35A 5AW7B 1GK6A 3VP8A 3WMM0 5BVZA 2NPSA 3CLQA 3M9HA 1IFMA 1LWUC 2WITA 3U1CA 2HLOA 3I5CA 5KTBA 5CCGC 1GK4A 1LTSC 2H43A 1J1DC 1FAVA 1A02F 3IFMA 2R5DA 1LWUA 2QM8A 1YTZT 1ZV8A 1LTJA 3M0AA 3G3ZA 1GL2C 5CCGA 1CI6B 5APVA 2BASA 5AVUB 3EFGA 5APYA 3OA7A 3B5NC 3II6A 2WPRA 1MUUA 1A02J 2IPPA 1QL2A 2WWWA 1GTWA 1GL2A 1NU1K 1GU5A 5AVXB 3V2RA 3B5NA 4IFMA 4M3LA 1JMMA 3LW5H 3TYYA 1FZEA 4O9BA 4N6JA 1FZCB 2FXMA 1KILC 3M91A 3V4WA 5APQA 1CSBA 1YYCA 1IC2A 2H8PD 4W80A 1AFOA 3L37A 1S9KD 1FJKA 1JOCA 3VN0A 1N7SB 1KILA 1GW3A 2WSEH 3HTKA 1NTKK 3VMYA 4WY4C 1W2EA 1OWAA 2P2UA 1M1JC 1NHLA 5AVYB 3CI9A 3HD7B 3RL0C 1J1EB 1ZLLA 2OYHA 1HGVA 1RE3A 3RK3B 4WY4A 4B86A 3MUDA 1JCCA 2A45G 2PAJA 4XA4A 5KLVK 2XU6A 1M1JA 1CW5A 4WY4D 3CL3D 2R3CA 2YKOA 3A3YB 1JY3N 3VMXA 1DX7A 1LT9C 3RL0D 4ZKPA 1LTTC 4N78D 1WRGA 2M3BA 2CPBA 3HE4A 4ZKUA 1N7LA 2KYVA 3NXSA 1LT9A 3NTNA 2FFDB 1JY2P 1N7SD 2WPQA 2I1KA 5CCHC 3U1AA 4Y99B 2R5BA 3PP5A 1URQC 1WT6A 2XNXA 1FZGA 4EOTA 1LTBC 1FU1A 2Q7CA 3HD7D 5APXA 1RY3A 1X8YA 4C7RA 1IK9A 3VP9A 1NKZB 2E42A 5CCHA 3RK3D 1IFNA 1URQA 1HGZA 2Q3IA 1JNMA 1L0LK 3KQGA 2YO3A 3H32A 4OH8B 2WTYA 5APUA 3GHGC 3VYIA 1MFZA 1VDFA 1NOHA 1M7LA 2Z5IA 3HUSC 2W6AA 1JCDA 3P8CD 1JUNA 3HE5B 1FOSE 3GHGA 5AW0B 2VRSA 1G2CA 3HUSA 3LIEA 4HYTB 3BRTB 2FKWB 4WB4A 2POHA 3KDPB 1GD2E 4I1LA 1S9KE 1IFJA 3MIWA 3B8EB 2HFED 2WT7B 3TNUB 3A5TA 1RF1B 3A7OA 2YKQA 2C0WA 3IR9A 3VOPA 1N86A 4I6MC 1LTGC 3M06A 2HODB 3SWFA 1X9VA 2KLVA 1HTLC 1SVFA 4W7ZA 3BVHA 3OJAB 4AQRD 5AVRB 3L4FA 2YNYA 1JY3P 1RF1C 1CI6A 3KYQA 1X79B 1GW4A 1NH4A 5AW2B 1SQBK 1LGHB 1MV8A 3NFQA 4N78E 3V4QA 2A45H 2KOGA 1Z56A 1ZN5A 5APTA 1IFDA 1J2JB 4C7NB 2L5GB 1SQVK 1FZCC 3TNUA 1NKNA 1OXZA 4KHXA 1HBWA 1SFCB 4LC1A 1QL1A 5BU5A 3KPEA 1SQQK 3MD0A 3V2PA 5APWA 1FBMA 1RF0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0X A;  1IFI A;  1IFD A;  1IFJ A;  1HGV A;  2CPS A;  1HGZ A;  1NH4 A;  2CPB A;  1HH0 A;  2C0W A;  1FDM A;  2MJZ A; 
#chains in the Genus database with same CATH topology
 2KSE A;  2N1T B;  3D6Y A;  4HH2 A;  2O01 N;  3G6E P;  2ZVN B;  1WMK A;  5GTI H;  3RK3 E;  1SQB D;  2KNC A;  1OVV A;  1GDT A;  3IN6 A;  1VF5 D;  1RQU A;  4H44 D;  2KP8 A;  3RK3 C;  3VMZ A;  4I2L C;  1QVG O;  1NTM G;  2GA1 A;  2Q9I A;  2WVR A;  2K9J A;  3V5B A;  2KXP B;  5AW1 B;  3BAS A;  3CC4 P;  4DZO A;  3P7K A;  1HH0 A;  2FY8 A;  4Y99 C;  3CPW O;  4GIF A;  4C46 A;  3M9B A;  1BDC A;  1T8Z A;  2B88 A;  2KSJ A;  1E79 H;  3LID A;  2KZJ A;  5AW3 B;  2KZI A;  3H1K D;  2MJZ A;  1J1D B;  4NPD A;  1JY2 O;  2W8Z A;  3TK1 A;  2RMZ A;  2OYI C;  2M5A A;  2WMM A;  2RKL A;  2Y0D A;  5CJ4 A;  2E76 B;  3B5N B;  1QLE D;  4JPZ B;  1LTJ C;  1M8O B;  4QMA A;  1FZA A;  2KI7 B;  1PFI A;  3FWL A;  2O01 H;  2D2C B;  4N3Y B;  1T3J A;  1RE4 C;  2IFN A;  1UII A;  3L70 G;  5C39 A;  1L0N K;  2XDJ A;  2FYU J;  2E76 D;  3AEB C;  5AVQ B;  2WT7 A;  3B5N D;  2Z5H A;  3TSI A;  1AQ5 A;  3CC7 P;  4H44 C;  3TF5 A;  5AW4 B;  4LGD E;  3BAT A;  1N2D C;  2D2C D;  1BGY G;  3M9Q A;  1R8E A;  4DOJ A;  1AVY A;  3V6I A;  2YMY A;  1JY3 O;  1NWQ A;  4C7N A;  1IJD B;  3AE6 C;  2N1T C;  2QG4 A;  5GTH E;  4CPG A;  3H1I G;  1ZRT D;  1M56 D;  2WQY C;  1N73 C;  5KLI B;  3H1K E;  1FE6 A;  3FGA D;  2FYU D;  2OGU A;  1NAY A;  1EDJ A;  1L4A A;  1AA0 A;  5APS A;  1E5W A;  2C0X A;  1KQG B;  3CX5 I;  1JTH A;  5H2F E;  4YXD C;  1BCC G;  1FC2 C;  2B89 A;  1RH5 B;  2IDB A;  1HWT C;  1EXJ A;  1NTZ K;  2HPC A;  3VP8 A;  1P84 I;  3WMM 0;  1JB0 J;  2WIT A;  2AEF A;  3PJS K;  2OYO A;  2PFX A;  3I5C A;  1Q86 Q;  1Y9B A;  1J1D C;  1A02 F;  3IFM A;  2R5D A;  1LWU A;  1X22 A;  2QM8 A;  1YTZ T;  3TDK A;  1ZV8 A;  3D70 A;  1LTJ A;  3M0A A;  4Y28 J;  2ZYD A;  2OTJ P;  1CI6 B;  2E5Y A;  3EFG A;  2FYN B;  3B5N C;  2ZT9 B;  1YIJ P;  2IBZ E;  1NU1 G;  1QEX A;  5AVX B;  4M3L A;  3TYY A;  1FDI A;  4N6J A;  2AXC A;  3QH9 A;  3Q3D A;  2K9Y A;  3M91 A;  3V4W A;  2KNC B;  1YYC A;  3AE9 C;  3AE3 C;  4GDO A;  1AFO A;  3L37 A;  1ZRT E;  3VN0 A;  2IBZ I;  3HTK A;  1NTK K;  4I7Z B;  1W2E A;  3H1L J;  2FYU E;  2KK7 A;  1AV1 A;  5AVY B;  1ZLL A;  5B66 E;  1S5L X;  4WY4 A;  1KOR A;  5KLV K;  1CW5 A;  2K9J B;  2SPZ A;  2RN0 A;  3RGU A;  2I8D A;  3A3Y B;  1VQL P;  1DX7 A;  2QJY B;  3RL0 D;  4ZKP A;  4GOF A;  5KAI H;  1WRG A;  4ZKU A;  2H88 C;  2YIU B;  4R4M A;  2KYV A;  3NXS A;  1NTZ J;  4BWN A;  5KAI E;  1KTM A;  5KKZ C;  1TU3 F;  1FZG A;  2Y0C A;  4HB1 A;  4ASV A;  4C7R A;  5KLI C;  3H1K G;  3VP9 A;  4RJT A;  2M5A B;  3H1L D;  3L75 G;  1JNM A;  2M0B A;  4PJ0 H;  2WTY A;  5APU A;  3JCU H;  2W6A A;  3P8C D;  5B5E E;  4ZNC A;  4U3F J;  1M1K Q;  1FOS E;  2VRS A;  1G2C A;  2JP3 A;  3G4S P;  3LIE A;  1KYO D;  4HYT B;  3KHU A;  1LP1 A;  3KDP B;  1YQ4 C;  1NTZ D;  3I55 P;  2JDI H;  2ITA A;  1GD2 E;  1K8A Q;  1UIX A;  1L0N E;  2HFE D;  2WT7 B;  3A5T A;  1NYH A;  3BCC J;  1KIL E;  1IZN B;  1X9V A;  2KLV A;  2QIW A;  5TIS H;  4W7Z A;  2FYN C;  2ZT9 C;  3L4F A;  1EZV D;  2IBZ G;  1Y47 A;  2A06 D;  1NH4 A;  1SQB K;  1LGH B;  1MV8 A;  4C7N B;  2L5G B;  3F5H A;  2QJP C;  1NKN A;  4KHX A;  5BU5 A;  3KPE A;  3USS A;  5APW A;  1RF0 C;  1LTI C;  2G8Y A;  2W90 A;  2HG5 D;  3Q1M A;  2YKP A;  2E74 B;  1BE3 J;  4I7Z C;  2WZ7 A;  4YTP C;  3BCC D;  3H6P A;  2BCC E;  1L4A B;  3H1L E;  3TGU J;  1IO4 A;  1USD A;  3HRN A;  1NAF A;  1JTH B;  1S3J A;  3UIA A;  4JYB A;  5KLV D;  3CC2 P;  3P8C E;  2QRX A;  1HUC A;  3MP7 B;  1VPC A;  1S5L H;  1DH3 A;  3KZI H;  2HPC B;  1KYO E;  1FS0 E;  1L0L G;  3CXH E;  1DIP A;  3C9I A;  1NTZ E;  1ZR4 A;  1S5L E;  2OYI B;  1L4A D;  2FFD A;  1BE3 D;  2LXC B;  2JWD A;  1LTJ B;  3H25 A;  3FX0 A;  3TGU D;  1PGP A;  3CXH I;  1KD1 Q;  2DW3 A;  1JY2 N;  5AVV B;  3OAK A;  2IFM A;  1EZV E;  5AVS B;  3CCV P;  3O6Q A;  2H7H A;  2A06 E;  1RQV A;  3GW6 A;  1FDM A;  2N9B A;  3HE5 A;  2Y9Z A;  3M0D A;  2FYZ A;  1LTA C;  1VQO P;  2K88 A;  2XV5 A;  4U7J A;  1KN7 A;  4NPE A;  2GUV A;  3E7K A;  3SFD C;  2J58 A;  4HKZ H;  3HTK B;  3ZDM A;  1T6A A;  1H0T A;  3WU2 H;  3LW5 J;  1KB9 E;  3S1K A;  1L0N G;  1MZ9 A;  1FZB A;  4PD4 H;  1ZME C;  1MFT A;  3BCC E;  1NTK E;  4RKU J;  4WY4 B;  4D6T E;  3QWO C;  3CCL P;  1ZP0 C;  2XKM A;  1SQQ G;  1M90 Q;  2Q5U A;  2XZR A;  5KLV E;  4EIJ A;  5KJ7 A;  1KB9 I;  2KB7 P;  2WPS A;  3CME P;  2HYN A;  1SQX K;  1RE3 C;  2KUB A;  3D71 A;  1Q2N A;  1RF0 A;  1N73 B;  1SP4 A;  2FYU K;  1OMI A;  1T3U A;  1Q90 D;  5GTI E;  2M3E A;  4IFD K;  1YHQ P;  2E74 C;  1ZR2 A;  3AE8 C;  1SFC A;  3JC2 2;  1BE3 E;  2YO2 A;  2PP6 A;  2BCC G;  1L4A C;  2BEQ D;  2E5T A;  1SQP J;  1GU4 A;  3TGU E;  3BRV B;  2N1T D;  2H89 C;  3H1J J;  1FOS F;  4AUW A;  3K5B A;  3L74 G;  1G2C B;  1FZF A;  3GLM A;  1YI2 P;  2Y9Y A;  1GMJ A;  5CJ0 A;  2JO1 A;  1PPJ G;  2MKV A;  1IFI A;  2I1J A;  2IX7 C;  1ZXG A;  3PTZ A;  2W27 A;  3L71 G;  2B9B A;  1YJW P;  1VQK P;  3L36 A;  2QSI A;  3M9H A;  1IFM A;  4OWF A;  1LWU C;  1R5S A;  5KTB A;  1GK4 A;  2H43 A;  1SQP D;  2NZ2 A;  3H1J D;  3G3Z A;  5CCG A;  3L72 J;  5AVU B;  3OA7 A;  1VQ4 P;  1PP9 J;  2IPP A;  2J5U A;  1GTW A;  1GL2 A;  1SQX J;  1SQB E;  4IFM A;  4IOI H;  3CCQ P;  3LW5 H;  1FZE A;  3SWK A;  5APQ A;  1IC2 A;  1S9K D;  1VQM P;  1FJK A;  1HF9 A;  1NTK G;  1R5L A;  3CWB G;  4OGQ B;  4WY4 C;  4D6T G;  1NHL A;  3C8V A;  4L76 A;  1RE3 A;  3L72 D;  4JBZ A;  5KLV G;  1YJ9 P;  4XA4 A;  1LT1 A;  1M1J A;  1PP9 D;  1VQP P;  5KKZ B;  1OVR A;  2FXP A;  1SQX D;  1Q7Y Q;  3CMA P;  1YBK A;  2M3B A;  2CPB A;  3HE4 A;  3CCR P;  3OW2 O;  1LT9 A;  3EWK A;  3NTN A;  2FFD B;  3AED C;  2KLU A;  2WPQ A;  4L73 A;  4OGQ D;  1WT6 A;  1ZW0 A;  1LTB C;  1FU1 A;  3G71 P;  3WUT A;  1KMI Z;  2Y0E A;  5CCH A;  1SQP E;  1OIP A;  3B4S A;  2Q3I A;  4HJG H;  3KQG A;  3AE2 C;  3H1J E;  3H32 A;  3O6Q B;  4Z1M H;  3IF4 A;  3L73 J;  1NOH A;  3H1H J;  4GOE A;  3HE5 B;  3G9R A;  3GHG A;  1DEE G;  3W68 A;  1K73 Q;  3HUS A;  3BRT B;  1H0T B;  1Q82 Q;  2FKW B;  4WB4 A;  1VQN P;  3AE4 C;  1S9K E;  3MIW A;  3A7O A;  2YKQ A;  2KS1 A;  1VQ5 P;  1SQV J;  3C1L A;  2QJP B;  3CCJ P;  3L72 E;  1SQQ J;  3L73 D;  1K04 A;  1PP9 E;  3H1H D;  4OVN F;  4UB8 H;  1X79 B;  1SQB G;  1SQX E;  4IL6 H;  3NFQ A;  5TJH A;  3EFF K;  2A45 H;  3TNU A;  1HBW A;  2ZT9 D;  1SFC B;  4LC1 A;  4UB8 E;  2JKV A;  1FBM A;  1S1C X;  1FZC A;  1PL5 A;  4JF7 A;  1NTM J;  4OGQ C;  1EQ7 A;  3AEF C;  2E75 B;  3MHV A;  1N7S A;  1SQV D;  4GT1 A;  4W7Y A;  2FBW C;  3CCE P;  3HD7 A;  4XFJ A;  1YTZ I;  3L74 J;  2AEJ A;  3EQ2 A;  1SFC D;  1OW8 A;  3SWY A;  1M57 D;  2JR8 A;  3P32 A;  2QE7 H;  3PLN A;  3WUU A;  1SLQ A;  2FFD C;  1AQT A;  4UB6 H;  2M8R A;  5AVW B;  2G3A A;  1CZQ A;  2W6B A;  1NTM D;  1YQ3 C;  5AW9 B;  4PJ0 E;  4UB6 E;  3JCU E;  4DT0 A;  4WVZ A;  2ZJS E;  4RES B;  1LNQ A;  3V2Q A;  1D7M A;  1GL2 B;  1KC8 Q;  1VQ7 P;  3H1H E;  3M0D C;  2QEX P;  3L70 J;  2IYP A;  3T97 A;  2GM4 A;  3NMD A;  2JEE A;  4WBA A;  1HVV A;  2WSS H;  3CCM P;  2ZFC A;  1G1J A;  3CD6 P;  3MTU E;  2OAR A;  5CCG D;  5DJT B;  2QM7 A;  1FDO A;  5BU8 B;  2P67 A;  4U3F D;  1FJP A;  5E79 H;  5TIS E;  1KFN A;  1BGY J;  1GL2 D;  2C9N Y;  1M1J B;  5KJ7 C;  2ZXX A;  2WSE J;  3AEE C;  2HOD A;  1DEB A;  3U59 A;  2NRG A;  3L70 D;  1XTG B;  2O1K A;  3HE4 B;  3H1I J;  2OYH C;  1LT9 B;  2FYU G;  2QVA A;  1SFC C;  1Q81 Q;  2Q1K A;  4ASW A;  4L75 A;  1KQL A;  4H0L B;  4RO0 A;  4LLH A;  4PD4 D;  2ZYA A;  3RK2 C;  3AE1 C;  4JYC A;  4NPF X;  4YXW H;  2N9Y B;  1EXI A;  1OZH A;  2E75 C;  1BGY D;  1BCC J;  3H32 B;  3PH0 A;  4BRY A;  2V7Q J;  1K9M Q;  4IFF A;  2R32 A;  2E74 D;  2CPS A;  4BXL A;  2Q3E A;  3GHG B;  3KZI E;  5CMZ A;  1N8R Q;  1DD4 A;  3S4R A;  3HUS B;  4YPC A;  3H1I D;  3P8M C;  2ZXE B;  2E43 A;  1LWU B;  3A0H H;  4GOD A;  1SQP K;  4H0L D;  1KYO I;  5CCH D;  2K1A A;  2W83 C;  2O1J A;  3E1I A;  3F89 A;  3A0H E;  4K35 A;  5AW7 B;  1GK6 A;  1IK7 A;  2LXB A;  2NPS A;  3CLQ A;  5M1B A;  4U3F E;  3U1C A;  2KS1 B;  2W6J H;  1NU1 J;  2CK3 H;  5CCG C;  1BCC D;  1JM0 A;  3VMA A;  3AEC C;  1GL2 C;  2BAS A;  2WPR A;  3L70 E;  1EZV I;  4WWI A;  2WWW A;  3V2R A;  3WU2 E;  1FZC B;  2FXM A;  4PD4 E;  4W80 A;  2K37 A;  1JOC A;  1N7S B;  1KIL A;  1GW3 A;  2WSE H;  1NU1 D;  3GF7 A;  1BGY E;  1USE A;  1OWA A;  1M1J C;  3HD7 B;  3CCS P;  1J1E B;  2AEM A;  2OYH A;  1HGV A;  3PHL A;  3MUD A;  1BSH A;  1PGO A;  4WY4 D;  3CL3 D;  2YKO A;  1JY3 N;  3VMX A;  3H1I E;  1L2P A;  1LT9 C;  3H1K J;  1LTT C;  3H1L G;  4N78 D;  1U7J A;  5DJU B;  2PRR A;  3L75 J;  2YXR B;  1VQ8 P;  4H0L C;  3AEA C;  1QVF O;  1N7S D;  2I1K A;  5CCH C;  1AVO A;  3U1A A;  2R5B A;  2V7Q H;  4EOT A;  2WSC J;  2WPV B;  3HD7 D;  4DCK A;  2E42 A;  1EC5 A;  2KIK A;  1LP1 B;  4MN4 C;  1BCC E;  1IFN A;  1URQ A;  2B87 A;  1OW6 A;  2YMK A;  1L0L K;  3A0B H;  1NTZ G;  3RL0 g;  4EI2 A;  4OH8 B;  3GHG C;  3VYI A;  3T97 B;  1VDF A;  3Q5S A;  1M7L A;  3HUS C;  1PIX A;  1JCD A;  3A0B E;  3CX5 D;  2P58 A;  3L75 D;  2POH A;  2IYO A;  4IL6 X;  1SS1 A;  1P84 D;  1EZV G;  2IZ0 A;  4U3F G;  2A06 G;  3B8E B;  1NU1 E;  2YXQ B;  2C0W A;  3IR9 A;  1N86 A;  4I6M C;  2HOD B;  3WUV A;  1HTL C;  1SVF A;  1EDK A;  1QGK B;  2WSF J;  4PV1 C;  1RF1 C;  3ABV C;  3BCC G;  1KQS O;  4N78 E;  5KAF H;  1ZN5 A;  1IFD A;  3SFE C;  3W67 A;  1SQV K;  1FZC C;  1Y8A A;  2XND H;  1OXZ A;  1VF5 C;  1AJY A;  1SQQ K;  5KAF E;  2IZ1 A;  4AYC A;  1NJI Q;  3Q5P A;  4BRY B;  2JJL A;  1N7S C;  2IBZ D;  2P1J A;  2QJK B;  2OQQ A;  1KZU B;  3HD7 C;  5GTH H;  1J1E C;  3CX5 H;  3R2P A;  1L0L J;  2UWJ E;  1NVO A;  3E1R A;  5AW5 B;  1XTC C;  1NO4 A;  3CX5 E;  1BE3 G;  2P7J A;  1NTM K;  2LKM A;  1OX3 A;  3GF3 A;  1P84 H;  3TGU G;  1VL2 A;  3L75 E;  3V2N A;  2WSC H;  2NPS B;  5H2F H;  1OFC X;  2OTK E;  3S9O A;  1P84 E;  3R4Y A;  2HR3 A;  2AXT H;  1T2K D;  1BDD A;  4K3A A;  2JWA A;  2ZAE B;  3B71 A;  1JEK A;  1L0L D;  1VQ9 P;  2AXT E;  5EFW B;  3CCU P;  4H13 B;  2Z4E A;  3AE7 C;  4XE5 B;  2OYI A;  1GZL A;  3GG2 A;  1L0N J;  1PGQ A;  2J59 M;  2NPS D;  1PZQ A;  5AW6 B;  5AW8 B;  3PRJ A;  1JO5 A;  5AVT B;  2BEZ F;  3SSU A;  2E76 C;  1NGM B;  3N7N A;  1KIL B;  3N4X A;  1KFM A;  5CBN A;  4GKG A;  2WSF H;  1RE4 A;  1W5C E;  3MGN A;  4H13 D;  2OYH B;  2D2C C;  5CHX A;  1YIT P;  1RF1 A;  1PV3 A;  2GUS A;  3RL0 B;  1EDL A;  4IL6 E;  1K05 A;  2P10 A;  1H88 A;  5B66 H;  1U7M A;  4KJM A;  3RK2 B;  3JSV C;  1L0N D;  1G1I A;  1OW7 A;  2BCC J;  5KJ7 D;  1KIL D;  1DD3 A;  4A7P A;  1HJB A;  3FWN A;  1H8A A;  1SQQ D;  2O3J A;  2A45 I;  1URQ B;  2B87 B;  1LJ2 A;  2K3R A;  2QJK C;  2N1T A;  1IFP A;  1T2K C;  1L0L E;  3Q2Y A;  1N73 A;  3A2A A;  5AVZ B;  3RK2 D;  3L71 J;  2E75 D;  4ZMD A;  4L74 A;  3VTP C;  2BCC D;  1SQP G;  2C9L Y;  5B5E H;  4DJG A;  2NPS C;  3O8Z A;  1URQ D;  3H1J G;  1H89 A;  2QA4 P;  3L73 E;  3L35 A;  5BVZ A;  3L74 D;  3FXD A;  2HLO A;  1LTS C;  1ZOY C;  1FAV A;  1PPJ D;  4KT0 J;  3CXH D;  4JQ0 D;  4H13 C;  5APV A;  3L71 D;  5APY A;  3GMA A;  3II6 A;  1EDI A;  1MUU A;  1A02 J;  1QL2 A;  1NU1 K;  1GU5 A;  1NTK J;  3CWB J;  3B5N A;  1JMM A;  4D6T J;  3FXE A;  1SQV E;  4O9B A;  3L72 G;  2ZVO B;  1KIL C;  1SQQ E;  5E79 E;  1PP9 G;  5KLV J;  1CSB A;  2H8P D;  4EYY Q;  1SQX G;  3RBZ A;  3AEG C;  3VMY A;  3MUD C;  2FXO A;  2P2U A;  1VQ6 P;  2R3S A;  3CI9 A;  3RL0 C;  3KXD A;  4TT3 H;  1W2B O;  3RK3 B;  4B86 A;  1JCC A;  2A45 G;  2PAJ A;  2XU6 A;  2ZYG A;  1KB9 D;  1JMB A;  2R3C A;  1NTM E;  3D6Z A;  3ITK A;  1NTK D;  3CWB D;  1HJ0 A;  4D6T D;  1QX8 A;  1N7L A;  5L8R J;  1JY2 P;  1KYO H;  4Y99 B;  3PP5 A;  1URQ C;  2XNX A;  3L74 E;  3IAO A;  1RHZ B;  3CXH H;  2V4H A;  2QJY C;  2LR2 A;  2Q7C A;  5APX A;  1RY3 A;  1X8Y A;  1IK9 A;  1NKZ B;  1BSN A;  3RK3 D;  1KV4 A;  1PPJ E;  2YIU C;  1S2E A;  1HGZ A;  1PGJ A;  2YO3 A;  3MZW B;  4TLF A;  3RBX A;  3L71 E;  1MFZ A;  1OVU A;  2Z5I A;  1X0T A;  1YJN P;  1JUN A;  5AW0 B;  2R44 A;  3L73 G;  1KQF B;  4I1L A;  3H1H G;  2O01 J;  4PV1 B;  1IFJ A;  1RF1 B;  3TNU B;  1SQB J;  2RH0 A;  3VOP A;  1S4X A;  1LTG C;  1KB9 H;  3M06 A;  3SWF A;  3Q5R A;  2OTL P;  3BVH A;  5CBO A;  4EDF A;  1VF5 B;  3OJA B;  4AQR D;  3I56 P;  1MKM A;  4H44 B;  5AVR B;  2YNY A;  1JY3 P;  3AE5 C;  1CI6 A;  3KYQ A;  1GW4 A;  5AW2 B;  1S72 P;  3CWB E;  3V4Q A;  2KOG A;  1Z56 A;  5APT A;  1J2J B;  2Q6Q A;  4R4L A;  5K5G B;  1SQV G;  2L91 A;  2PGD A;  1QL1 A;  4PV1 D;  3MD0 A;  3V2P A;  1U57 A;  4PD4 I; 
#chains in the Genus database with same CATH homology
 1LTI C;  4AYC A;  2N1T B;  2HG5 D;  1FZC A;  2YKP A;  4HH2 A;  2JJL A;  1N7S C;  4JF7 A;  1EQ7 A;  2P1J A;  2WZ7 A;  3H6P A;  1GDT A;  1L4A B;  1KZU B;  3HD7 C;  1IO4 A;  1J1E C;  2KP8 A;  1N7S A;  4GT1 A;  3HRN A;  1NAF A;  3R2P A;  3RK3 C;  3VMZ A;  4W7Y A;  1JTH B;  3HD7 A;  5AW5 B;  4I2L C;  3UIA A;  1YTZ I;  4JYB A;  3P8C E;  1XTC C;  1NO4 A;  1HUC A;  2P7J A;  1NTM K;  2LKM A;  2Q9I A;  3EQ2 A;  1SFC D;  1VPC A;  3V5B A;  1DH3 A;  2HPC B;  3SWY A;  5AW1 B;  3BAS A;  4DZO A;  3P7K A;  1HH0 A;  3V2N A;  2WSC H;  3P32 A;  3C9I A;  1SLQ A;  2FFD C;  2NPS B;  1ZR4 A;  4Y99 C;  2OYI B;  4GIF A;  4C46 A;  2M8R A;  3M9B A;  5AVW B;  1T8Z A;  1L4A D;  1CZQ A;  2W6B A;  2FFD A;  2KSJ A;  3LID A;  1T2K D;  5AW9 B;  5AW3 B;  1LTJ B;  2MJZ A;  1J1D B;  1JY2 O;  4RES B;  3TK1 A;  2OYI C;  3V2Q A;  1JY2 N;  2Z4E A;  5AVV B;  1GL2 B;  3OAK A;  5CJ4 A;  2IFM A;  3B5N B;  5AVS B;  4XE5 B;  3M0D C;  2OYI A;  1GZL A;  2H7H A;  1LTJ C;  3T97 A;  2J59 M;  2NPS D;  1FZA A;  1FDM A;  2GM4 A;  1PFI A;  3NMD A;  2JEE A;  4WBA A;  5AW6 B;  2N9B A;  3HE5 A;  1HVV A;  2O01 H;  3M0D A;  5AW8 B;  2FYZ A;  1LTA C;  1JO5 A;  5AVT B;  2XV5 A;  4N3Y B;  2ZFC A;  1G1J A;  2GUV A;  1T3J A;  2J58 A;  3MTU E;  2OAR A;  3N7N A;  3HTK B;  1KIL B;  1RE4 C;  3N4X A;  2IFN A;  5CCG D;  2QM7 A;  5BU8 B;  1KFM A;  1MZ9 A;  2P67 A;  1FZB A;  1L0N K;  4GKG A;  1FJP A;  2XDJ A;  1KFN A;  2WSF H;  1RE4 A;  3MGN A;  2OYH B;  4WY4 B;  5CHX A;  1GL2 D;  2C9N Y;  1M1J B;  5KJ7 C;  5AVQ B;  2WT7 A;  1RF1 A;  2GUS A;  3B5N D;  3RL0 B;  2Z5H A;  3TSI A;  2XKM A;  1AQ5 A;  2HOD A;  2Q5U A;  2XZR A;  5AW4 B;  1DEB A;  4EIJ A;  5KJ7 A;  4LGD E;  3U59 A;  3BAT A;  2KB7 P;  1N2D C;  1XTG B;  2O1K A;  2WPS A;  1H88 A;  3RK2 B;  2HYN A;  3HE4 B;  1SQX K;  2OYH C;  1RE3 C;  1G1I A;  3M9Q A;  5KJ7 D;  1LT9 B;  1RF0 A;  1N73 B;  1SP4 A;  2FYU K;  1KIL D;  4DOJ A;  1SFC C;  1T3U A;  2YMY A;  1HJB A;  1JY3 O;  1KQL A;  4C7N A;  4LLH A;  1NWQ A;  1H8A A;  1IJD B;  2N1T C;  4IFD K;  2A45 I;  1ZR2 A;  1SFC A;  3RK2 C;  1URQ B;  4JYC A;  2YO2 A;  2PP6 A;  1N73 C;  1L4A C;  2N1T A;  3H32 B;  1GU4 A;  1T2K C;  3BRV B;  2N1T D;  4IFF A;  2R32 A;  1N73 A;  1FOS F;  2CPS A;  1L4A A;  4AUW A;  3A2A A;  5AVZ B;  3RK2 D;  5APS A;  1E5W A;  3GHG B;  2C0X A;  5CMZ A;  1G2C B;  1FZF A;  3HUS B;  1JTH A;  3P8M C;  2ZXE B;  5CJ0 A;  2E43 A;  1LWU B;  3VTP C;  2C9L Y;  1SQP K;  1IFI A;  2I1J A;  2IX7 C;  2W27 A;  1HWT C;  5CCH D;  2NPS C;  3O8Z A;  1URQ D;  1NTZ K;  2O1J A;  3E1I A;  2HPC A;  1H89 A;  3L36 A;  3L35 A;  5AW7 B;  1GK6 A;  3VP8 A;  3WMM 0;  5BVZ A;  2NPS A;  3CLQ A;  3M9H A;  1IFM A;  1LWU C;  2WIT A;  3U1C A;  2HLO A;  3I5C A;  5KTB A;  5CCG C;  1GK4 A;  1LTS C;  2H43 A;  1J1D C;  1FAV A;  1A02 F;  3IFM A;  2R5D A;  1LWU A;  2QM8 A;  1YTZ T;  1ZV8 A;  1LTJ A;  3M0A A;  3G3Z A;  1GL2 C;  5CCG A;  1CI6 B;  5APV A;  2BAS A;  5AVU B;  3EFG A;  5APY A;  3OA7 A;  3B5N C;  3II6 A;  2WPR A;  1MUU A;  1A02 J;  2IPP A;  1QL2 A;  2WWW A;  1GTW A;  1GL2 A;  1NU1 K;  1GU5 A;  5AVX B;  3V2R A;  3B5N A;  4IFM A;  4M3L A;  1JMM A;  3LW5 H;  3TYY A;  1FZE A;  4O9B A;  4N6J A;  1FZC B;  2FXM A;  1KIL C;  3M91 A;  3V4W A;  5APQ A;  1CSB A;  1YYC A;  1IC2 A;  2H8P D;  4W80 A;  1AFO A;  3L37 A;  1S9K D;  1FJK A;  1JOC A;  3VN0 A;  1N7S B;  1KIL A;  1GW3 A;  2WSE H;  3HTK A;  1NTK K;  3VMY A;  4WY4 C;  1W2E A;  1OWA A;  2P2U A;  1M1J C;  1NHL A;  5AVY B;  3CI9 A;  3HD7 B;  3RL0 C;  1J1E B;  1ZLL A;  2OYH A;  1HGV A;  1RE3 A;  3RK3 B;  4WY4 A;  4B86 A;  3MUD A;  1JCC A;  2A45 G;  2PAJ A;  4XA4 A;  5KLV K;  2XU6 A;  1M1J A;  1CW5 A;  4WY4 D;  3CL3 D;  2R3C A;  2YKO A;  3A3Y B;  1JY3 N;  3VMX A;  1DX7 A;  1LT9 C;  3RL0 D;  4ZKP A;  1LTT C;  4N78 D;  1WRG A;  2M3B A;  2CPB A;  3HE4 A;  4ZKU A;  1N7L A;  2KYV A;  3NXS A;  1LT9 A;  3NTN A;  2FFD B;  1JY2 P;  1N7S D;  2WPQ A;  2I1K A;  5CCH C;  3U1A A;  4Y99 B;  2R5B A;  3PP5 A;  1URQ C;  1WT6 A;  2XNX A;  1FZG A;  4EOT A;  1LTB C;  1FU1 A;  2Q7C A;  3HD7 D;  5APX A;  1RY3 A;  1X8Y A;  4C7R A;  1IK9 A;  3VP9 A;  1NKZ B;  2E42 A;  5CCH A;  3RK3 D;  1IFN A;  1URQ A;  1HGZ A;  2Q3I A;  1JNM A;  1L0L K;  3KQG A;  2YO3 A;  3H32 A;  4OH8 B;  2WTY A;  5APU A;  3GHG C;  3VYI A;  1MFZ A;  1VDF A;  1NOH A;  1M7L A;  2Z5I A;  3HUS C;  2W6A A;  1JCD A;  3P8C D;  1JUN A;  3HE5 B;  1FOS E;  3GHG A;  5AW0 B;  2VRS A;  1G2C A;  3HUS A;  3LIE A;  4HYT B;  3BRT B;  2FKW B;  4WB4 A;  2POH A;  3KDP B;  1GD2 E;  4I1L A;  1S9K E;  1IFJ A;  3MIW A;  3B8E B;  2HFE D;  2WT7 B;  3TNU B;  3A5T A;  1RF1 B;  3A7O A;  2YKQ A;  2C0W A;  3IR9 A;  3VOP A;  1N86 A;  4I6M C;  1LTG C;  3M06 A;  2HOD B;  3SWF A;  1X9V A;  2KLV A;  1HTL C;  1SVF A;  4W7Z A;  3BVH A;  3OJA B;  4AQR D;  5AVR B;  3L4F A;  2YNY A;  1JY3 P;  1RF1 C;  1CI6 A;  3KYQ A;  1X79 B;  1GW4 A;  1NH4 A;  5AW2 B;  1SQB K;  1LGH B;  1MV8 A;  3NFQ A;  4N78 E;  3V4Q A;  2A45 H;  2KOG A;  1Z56 A;  1ZN5 A;  5APT A;  1IFD A;  1J2J B;  4C7N B;  2L5G B;  1SQV K;  1FZC C;  3TNU A;  1NKN A;  1OXZ A;  4KHX A;  1HBW A;  1SFC B;  4LC1 A;  1QL1 A;  5BU5 A;  3KPE A;  1SQQ K;  3MD0 A;  3V2P A;  5APW A;  1FBM A;  1RF0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...