1HGVA

Filamentous bacteriophage ph75
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
source organism Bacteriophage ph75
molecule tags Virus
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hgvA00
1HGVA 2CPSA 1IFDA 1IFIA 2C0XA 1HH0A 2MJZA 2C0WA 1HGZA 1NH4A 1FDMA 2CPBA 1IFJA
chains in the Genus database with same CATH superfamily
1L0ND 1NTMG 2HPCA 3AE7C 3IAOA 2N1TC 2FYUE 2YKQA 4MN4C 3CCQP 1X79B 3N7NA 1NTMD 1NU1J 3JSVC 4Y28J 3L73E 1EDJA 2BASA 3CX5I 1G1IA 1NTMK 1KB9H 1SQBJ 2A06G 3BRVB 3H1LD 4HKZH 4GT1A 2XNDH 1YQ4C 1S5LE 2Z5IA 3AE6C 3TNUB 2Y0EA 1T3JA 1W2BO 4U3FJ 2FY8A 1UIIA 3AEAC 2B88A 1BCCE 1N7SA 2R3SA 1OW8A 3CCMP 5DJUB 3CC7P 1LT1A 4W7ZA 5KJ7D 3VYIA 3M9BA 1KYOE 2G3AA 1IFJA 1BSNA 2NPSA 1L2PA 3AE2C 3RL0C 1TU3F 4DJGA 2H43A 2W27A 3PHLA 2FFDB 3G9RA 2QJKB 1FOSE 2O01J 3GG2A 3AE5C 1T2KD 1MKMA 3M0DC 1N7SD 1AV1A 5KLVK 2ZVNB 3RBXA 1LTJA 5CBNA 1SQQG 1GW4A 1CZQA 3II6A 1M8OB 2JP3A 3HE4B 2IX7C 3H32A 3IF4A 4U3FD 4EI2A 5KAFH 3KZIH 2KK7A 5H2FH 1LP1A 1KYOI 4KT0J 1FZCB 1H0TA 2I8DA 3MUDA 3CXHI 2N1TA 3PP5A 2W8ZA 1NTKJ 1OVVA 2QEXP 1NOHA 1NTZJ 1P84E 2M3BA 2QM8A 2W83C 1IJDB 1SQPD 1ZW0A 2D2CD 3AE8C 1Q7YQ 2YIUB 4PJ0H 3OAKA 1GW3A 4AUWA 1PFIA 2R5DA 1GU5A 2OYHB 3B8EB 3B71A 3W68A 1GL2A 1OIPA 1URQB 4HJGH 1SQBG 2WPSA 3LW5H 1YBKA 2FXMA 1QL1A 5AVXB 1EZVD 2XU6A 4JYBA 5APTA 3L73G 1LWUC 1RF0A 1ZOYC 3FXDA 3AEDC 3NXSA 3CD6P 2FYUG 1Q2NA 2N9BA 3GF3A 4GDOA 2G8YA 3CC2P 3H1HE 1R5SA 2E74D 1G2CB 2JKVA 1BDDA 1N86A 3HD7A 3H1IG 2YKPA 4KJMA 3S1KA 1LGHB 3TDKA 1JCCA 4R4MA 2NPSC 1K04A 5B5EE 5GTIE 3VOPA 1IZNB 2HODA 5K5GB 3MD0A 4N78E 2IBZD 1L0LJ 1OX3A 3CLQA 2E76C 2C0WA 1JY3N 3KYQA 2ZYDA 3H1JE 4H0LD 4D6TG 3L75D 3M0AA 3I55P 3B5NC 1S2EA 2WSEH 1X8YA 3CC4P 1FS0E 3H1JJ 2OYHA 2K3RA 3HUSA 4BXLA 2QJKC 1OXZA 4L74A 1BGYE 1Y8AA 3H1KE 4UB6H 1QL2A 1FZCC 2P2UA 1CW5A 3IFMA 1KTMA 3H6PA 2A45H 4AQRD 3CPWO 2K9YA 5AVVB 3CXHE 5AW4B 1FZFA 3WMM0 1W5CE 3H1KG 3EFFK 1JMBA 2AXCA 1DH3A 2FYUD 2XDJA 3M06A 1N73B 5GTHE 1NTME 2XV5A 4N78D 5DJTB 1URQA 3V2PA 2Q3EA 2DW3A 3L74G 3C1LA 3O8ZA 4GOFA 3RGUA 3ITKA 3RL0D 2J59M 3Q5SA 2W90A 1YJ9P 4CPGA 1QVGO 4PD4I 3TGUJ 1NU1G 1NHLA 1RHZB 2QE7H 3W67A 1JNMA 2KZJA 3TSIA 2V4HA 4H44D 3FWLA 1IFNA 2O01N 2N1TB 3PH0A 5AVTB 2CPBA 5CJ4A 4K35A 3I56P 2E75C 3H1LJ 3CCSP 2M0BA 1FZCA 2J5UA 1E79H 1LP1B 1NU1K 2KI7B 2MJZA 5AW8B 3IR9A 3RK3C 4RO0A 1KB9D 1GK6A 1ZRTE 3QH9A 1KYOD 1FDMA 1ZR4A 2YKOA 5CBOA 1M1KQ 3A3YB 1SQXK 2KOGA 2NRGA 3P8MC 1KQSO 4A7PA 1L0NE 2B87A 2A45G 5KAIH 3WUTA 1VF5D 1PP9D 2BEQD 4WVZA 4ZKUA 2C9NY 1PPJE 1S72P 1OW7A 3QWOC 3S4RA 3A0BH 1J1EC 1K8AQ 2NPSB 2OTKE 2OGUA 1T6AA 3CCVP 1YTZI 3TYYA 2CK3H 2HLOA 5CHXA 4OVNF 2QG4A 1JMMA 4WBAA 1NWQA 1RF1B 1SLQA 3SWKA 5AVQB 2O3JA 3WUUA 1SQXE 3E1RA 4EOTA 1L4AC 3CX5E 3H1KJ 3AE1C 3RK2D 1RF1A 1S5LX 4OGQC 1KILC 3L74E 4WY4A 2E74B 5CJ0A 3AEBC 1FAVA 2Q1KA 1OMIA 2H89C 4YPCA 2QA4P 1A02F 2E5TA 4UB8H 3OA7A 3L74J 3H1HJ 1N7LA 2BCCG 1CI6A 2JR8A 4JPZB 2Q3IA 4TLFA 3L35A 2IBZI 1S1CX 2A06D 2K1AA 3AE3C 2Y9ZA 1IC2A 1YITP 1R8EA 1GZLA 3AECC 5AVWB 5CCHD 3GHGB 1BGYG 3AE9C 2B9BA 1NKZB 2ZT9B 2L5GB 1GD2E 2JEEA 2PAJA 1YYCA 1L0NG 2VRSA 1JUNA 1UIXA 2OYIB 2WT7B 4H13B 3Q3DA 2FXPA 3U1AA 2YO2A 2FYUJ 3MHVA 3VP8A 2SPZA 1YI2P 5AW3B 3TGUE 1H8AA 1NVOA 1E5WA 3NTNA 1SQVE 1JB0J 3E1IA 1P84D 1SFCB 1KD1Q 1PP9J 1BE3G 1JY3P 2P58A 3MTUE 5AW9B 1LNQA 1URQC 4C7NB 1RE4A 2V7QJ 2ZYGA 3L72J 3L73J 2M8RA 1USDA 3H1JD 3M9HA 5BVZA 4IL6X 1ZR2A 2QJPB 3L75E 4W80A 3S9OA 4GKGA 2I1KA 3V2QA 3P8CE 2Z5HA 3JCUH 5EFWB 2KS1B 2AEFA 4OWFA 1M1JC 1USEA 3HD7C 4Z1MH 1FU1A 1BGYD 1SQVK 3Q2YA 1KFMA 1JO5A 1ZLLA 2WSFJ 4PV1C 3FGAD 3FX0A 4H13C 4TT3H 1KORA 2B89A 1PZQA 3HUSB 4OGQB 1DEEG 2WSSH 1IFMA 3CI9A 3B5ND 2KS1A 3B4SA 3TGUD 4GOEA 1SQVD 1H89A 2BCCD 1K73Q 2WITA 1ZP0C 1BE3E 2WQYC 3CX5H 1PV3A 1SQVJ 2E75D 2R5BA 1KB9I 4RKUJ 5C39A 3VMAA 1VQ6P 3BCCE 3L70E 4LGDE 1HTLC 1PGOA 1BE3J 1MZ9A 4UB6E 3RK3E 2R3CA 2XZRA 1AQ5A 2HODB 1URQD 3OJAB 1NU1D 2IZ0A 2WSFH 3FXEA 1FE6A 2ZYAA 3A0HE 3HUSC 3D71A 3CWBG 5TJHA 2YO3A 3MGNA 5AW7B 2YXRB 4JQ0D 3CCRP 2XNXA 1L0NJ 1VQNP 1G1JA 2R44A 2M5AB 1N2DC 5CCHA 2OQQA 1G2CA 1RE3C 1ZN5A 2LXCB 3AE4C 5KLIC 1VQPP 1P84I 3KXDA 2ZXXA 3H1KD 1Q81Q 2FYNB 1SQPJ 3H1IE 2OYIA 1HF9A 1FZBA 1J1DB 3JCUE 2BCCE 3GHGA 1S4XA 3PTZA 2NZ2A 1D7MA 2H88C 1RY3A 2KP8A 2WWWA 3NMDA 4I6MC 1PP9E 1WRGA 1GL2B 1RE4C 2Q6QA 1NTZK 4GIFA 3KZIE 3RK3D 1SFCD 3L71G 3T97B 1CI6B 1AVOA 1MV8A 1KQGB 1J2JB 5AVUB 3NFQA 1J1DC 5KLVE 1JTHA 2HR3A 2AEJA 3I5CA 4WY4B 1RQUA 1FDIA 3V2NA 3V4QA 5KKZB 2ZT9C 2K9JA 1N73C 1EC5A 2O01H 3VMZA 4L73A 5APWA 5AW1B 1DX7A 4I1LA 5AVZB 3VTPC 4ASWA 2KNCA 4BRYA 3H1ID 3IN6A 3A0HH 2IZ1A 3N4XA 1AQTA 1Q90D 3HE4A 4JBZA 5E79E 2WSEJ 3V4WA 3CMEP 2C9LY 2HG5D 2WZ7A 3B5NA 2WSCH 1HJBA 1EDLA 2KB7P 3L72E 2IYPA 2HYNA 3MIWA 4L76A 2E74C 1EDKA 3B5NB 2PRRA 2KLUA 2B87B 3H1LE 1EZVI 3L73D 2P1JA 3SFDC 2ITAA 1FZGA 4LLHA 1KC8Q 1LTTC 3LIDA 3RL0g 4BRYB 1N8RQ 2WSCJ 1BCCD 1BGYJ 1RE3A 4PV1B 1JY2P 5GTIH 1SQPG 4Y99C 3WUVA 4Y99B 2E76D 3E7KA 1HWTC 5APVA 3CX5D 3CCJP 1JTHB 2NPSD 3L71D 4NPDA 1NAYA 3GMAA 4N6JA 1ZMEC 2GA1A 3LW5J 1YIJP 1FJPA 3LIEA 1L0LE 1JY2N 1U7MA 1QLED 2FYZA 2PGDA 1M57D 3BCCJ 3KDPB 2R32A 3L36A 3VMYA 3HTKA 1NGMB 4QMAA 1YHQP 5KAIE 1N73A 2P10A 4XFJA 2YMYA 5B66E 1ZXGA 1SQQD 2AEMA 2M3EA 1JCDA 3CCUP 1LTSC 3PLNA 4NPFX 4EDFA 2PP6A 3V6IA 2JWDA 1SQQK 1EQ7A 3A2AA 3C8VA 4ZNCA 1M56D 3G6EP 3KQGA 4WWIA 3CMAP 2WMMA 2BEZF 1BDCA 2OTJP 3F89A 1S9KD 1SQPE 2WPRA 5GTHH 5KJ7C 1KILA 1SQBD 3AEFC 1SVFA 1NTZD 5M1BA 1HGZA 1NH4A 1A02J 1NTMJ 4GODA 2AXTH 2W6AA 2FYUK 3VP9A 3SFEC 1EDIA 1L4AD 2FKWB 3ABVC 4HYTB 1SQVG 1NTKK 2RN0A 1NU1E 2QVAA 5L8RJ 5TISE 3EFGA 3TGUG 3Q1MA 1LTIC 1RH5B 4N3YB 1KYOH 2LXBA 4YXWH 3H25A 1BSHA 1MFTA 4IFDK 2JWAA 2KUBA 1HGVA 3D70A 4WY4C 4EIJA 4C7RA 5KKZC 3SWFA 1PGQA 3L75J 1NJIQ 3CCEP 1YTZT 1EXJA 3KHUA 2Z4EA 1VQLP 4O9BA 2E75B 4C46A 3D6ZA 5APQA 3HD7D 4AYCA 5APXA 3WU2H 5KLVJ 1HVVA 1QVFO 1GK4A 2N9YB 3CCLP 1FC2C 1NTZE 4OGQD 5B66H 2IBZE 3O6QA 1BE3D 4DCKA 1FJKA 1AA0A 4C7NA 1SQQJ 2JO1A 2BCCJ 2RH0A 4JF7A 1DD4A 1JY3O 2FBWC 1GL2D 2RKLA 1QEXA 1X9VA 1SQXJ 1GMJA 1IK9A 1MUUA 2JJLA 4PD4E 2O1JA 5AW5B 1SQBK 3TK1A 3FWNA 3GLMA 1LWUB 5BU5A 1H0TB 1JM0A 2WT7A 1RQVA 5APSA 2ZFCA 1QGKB 2GUVA 4B86A 2KSJA 1Y47A 3MP7B 3SSUA 2W6JH 3H1HG 1DEBA 1M7LA 1N7SC 1OVRA 2ZVOB 3H32B 3KPEA 2QRXA 2IFNA 1VQ9P 1BCCJ 2FXOA 3L72D 1LT9C 5APUA 1LT9B 2IYOA 4U7JA 1VQMP 1M1JA 2XKMA 4LC1A 4H44C 2YMKA 4W7YA 4H0LC 1WMKA 2D2CC 2KYVA 2E42A 1AFOA 4I2LC 1KQLA 2LR2A 3A0BE 1FDOA 1SFCC 2A45I 5APYA 1QX8A 3RBZA 1NTZG 2KIKA 1NAFA 5TISH 1X22A 2K37A 4JYCA 4YTPC 5KLVG 3V5BA 2HFED 5AVSB 3R4YA 2ZJSE 2WPVB 2Q7CA 2QJPC 1LTBC 2KZIA 3TNUA 1H88A 3L71E 2QM7A 1FZEA 1GU4A 1SS1A 2IFMA 1KB9E 1ZRTD 1R5LA 4ZMDA 1S3JA 2E5YA 1OWAA 1PP9G 2UWJE 3MUDC 1IO4A 4XE5B 1L0LD 4WB4A 3RK2B 1HH0A 2E76B 3HTKB 3GW6A 4PD4H 5BU8B 3G4SP 3Q5RA 4PV1D 1NKNA 2Y0DA 5B5EH 3BATA 1YJWP 1PPJD 1FOSF 1IFDA 1IFIA 1SQQE 2HPCB 1KFNA 1FZAA 1PGJA 3G3ZA 1T2KC 5E79H 4YXDC 2OYOA 3RK2C 1SQXD 1ZV8A 2POHA 4I7ZC 2CPSA 2ZAEB 3M9QA 1KMIZ 2P7JA 1LTAC 3GHGC 1VQKP 4D6TE 2WPQA 3L4FA 4L75A 2FYNC 4M3LA 1WT6A 4PJ0E 1HBWA 1XTGB 3HRNA 5CCGC 1BCCG 1OVUA 3L74D 1MFZA 1Y9BA 4XA4A 3L70G 3BCCG 3VN0A 2MKVA 5AVRB 4IFMA 5AVYB 4H13D 1RF1C 3BVHA 1SQPK 1VF5C 1JEKA 2WTYA 1CSBA 2D2CB 3ZDMA 2A06E 2N1TD 4U3FE 1EXIA 4H44B 2C0XA 1L4AB 5CMZA 2KLVA 1P84H 1NTKD 2L91A 3P32A 4DZOA 2IDBA 3PJSK 2IPPA 4OH8B 1XTCC 2KNCB 2QIWA 3RL0B 1AVYA 2QJYC 3RK3B 3GF7A 2K9JB 2QSIA 3D6YA 2YNYA 3G71P 1Q86Q 3VMXA 3L75G 4D6TD 1KILD 1VDFA 4HB1A 1T8ZA 1YQ3C 1S9KE 3EWKA 1VQ5P 1SQBE 3R2PA 5CCGD 2IBZG 2RMZA 1JY2O 1M1JB 3C9IA 5AW0B 3T97A 1LT9A 1U57A 5AW2B 4DOJA 4ZKPA 1EZVE 2LKMA 1KZUB 4R4LA 1PPJG 2FFDC 2K88A 3SWYA 4IL6H 1KV4A 3BRTB 3UIAA 1NTKE 2GM4A 3CL3D 2I1JA 1VF5B 3P8CD 1LWUA 1RF0C 1SP4A 1NTKG 3A7OA 3HD7B 4PD4D 3HE5A 3HE5B 1X0TA 2QJYB 2Y9YA 2M5AA 3PRJA 1VQ4P 3U59A 2KXPB 1T3UA 1EZVG 1KILE 4IFFA 5CCGA 4HH2A 3L70J 2KSEA 1NO4A 2PFXA 4NPEA 2J58A 1KQFB 2GUSA 1VQ8P 3BCCD 3L70D 1L0NK 1OW6A 4EYYQ 3AEEC 1U7JA 4I7ZB 4IOIH 3L37A 3TF5A 4BWNA 1W2EA 3CWBD 1AJYA 2O1KA 1KN7A 2AXTE 1VL2A 3L71J 3O6QB 2JDIH 4DT0A 1K9MQ 2H7HA 1VPCA 1VQOP 1VQ7P 4UB8E 3USSA 1SQXG 3CXHH 3AEGC 5KJ7A 2V7QH 3P7KA 2OYIC 1L0LK 1IFPA 3H1IJ 1LTGC 3H1HD 1YJNP 3CXHD 3A5TA 1DD3A 4U3FG 5CCHC 1S5LH 2YXQB 1L0LG 4IL6E 4WY4D 1L4AA 3WU2E 4ASVA 2OARA 3EQ2A 3V2RA 1Q82Q 3M0DA 2P67A 2W6BA 2Y0CA 1OZHA 5KTBA 2WVRA 1DIPA 1LTJC 1GL2C 1LTJB 3CWBE 4D6TJ 1LJ2A 1J1EB 2Q5UA 3Q5PA 3MZWB 3H1JG 1GTWA 1JOCA 1SFCA 1Z56A 3M91A 4H0LB 5H2FE 4RESB 5KLVD 3CWBJ 1K05A 2FFDA 1HUCA 2ZT9D 3BASA 2YIUC 1KILB 3F5HA 1FBMA 1GDTA 2OYHC 1PGPA 2H8PD 4RJTA 1M90Q 1PL5A 4KHXA 3JC22 2OTLP 1N7SB 2Q9IA 3U1CA 5KLIB 1NYHA 1IK7A 1OFCX 3H1LG 5AW6B 3OW2O 2E43A 1HJ0A 2ZXEB 1PIXA 3K5BA 5KAFE 3L72G 4K3AA
chains in the Genus database with same CATH topology
2HPCA 2N1TC 2YKQA 1X79B 3N7NA 2BASA 1G1IA 1NTMK 3BRVB 4GT1A 2Z5IA 3TNUB 1T3JA 1N7SA 4W7ZA 5KJ7D 3VYIA 3M9BA 2NPSA 3RL0C 1IFJA 2H43A 2FFDB 2W27A 1FOSE 1T2KD 3M0DC 1N7SD 5KLVK 1LTJA 3II6A 1GW4A 1CZQA 3HE4B 2IX7C 3H32A 1FZCB 3MUDA 3PP5A 2N1TA 1NOHA 2M3BA 3A5TA 2QM8A 1IJDB 3OAKA 1GW3A 4AUWA 1PFIA 2R5DA 1GU5A 2OYHB 3B8EB 1GL2A 1URQB 2WPSA 3LW5H 2FXMA 1QL1A 5AVXB 2XU6A 5APTA 4JYBA 1LWUC 1RF0A 3NXSA 2N9BA 1G2CB 1N86A 3HD7A 2YKPA 1LGHB 1JCCA 2NPSC 3VOPA 2HODA 3MD0A 4N78E 3KYQA 3CLQA 2C0WA 1JY3N 3M0AA 3B5NC 2WSEH 1X8YA 3HUSA 1OXZA 1FZCC 1QL2A 2P2UA 1CW5A 3IFMA 3H6PA 2A45H 4AQRD 5AVVB 5AW4B 1FZFA 3WMM0 1DH3A 3M06A 2XDJA 1N73B 2XV5A 4N78D 3V2PA 1URQA 3O8ZA 3RL0D 2OYHA 2J59M 1NHLA 1JNMA 3TSIA 1IFNA 2N1TB 5AVTB 2CPBA 5CJ4A 1FZCA 1NU1K 2MJZA 3RK3C 5AW8B 3IR9A 1GK6A 1FDMA 1ZR4A 2YKOA 3A3YB 1SQXK 2KOGA 3P8MC 2A45G 4ZKUA 2C9NY 1J1EC 2NPSB 1YTZI 3TYYA 2HLOA 5CHXA 1RF1B 1JMMA 4WBAA 1NWQA 1SLQA 5AVQB 4EOTA 1L4AC 3RK2D 1RF1A 4WY4A 1KILC 5CJ0A 1A02F 1FAVA 3OA7A 1N7LA 1CI6A 2Q3IA 3L35A 1IC2A 1GZLA 5AVWB 5CCHD 3GHGB 1GD2E 1NKZB 2L5GB 2JEEA 2PAJA 1YYCA 1JUNA 2VRSA 2OYIB 2WT7B 3U1AA 2YO2A 3VP8A 5AW3B 1H8AA 1E5WA 3NTNA 3E1IA 1SFCB 5AW9B 3MTUE 1JY3P 1URQC 4C7NB 1RE4A 2M8RA 5BVZA 3M9HA 1ZR2A 4W80A 4GKGA 2I1KA 3V2QA 3P8CE 2Z5HA 1M1JC 1JO5A 3HD7C 1FU1A 1SQVK 1KFMA 1ZLLA 3HUSB 3CI9A 1IFMA 3B5ND 1H89A 2WITA 2R5BA 4LGDE 1HTLC 1AQ5A 1MZ9A 2R3CA 2XZRA 2HODB 1URQD 3OJAB 2WSFH 3HUSC 2YO3A 3MGNA 5AW7B 2XNXA 1G1JA 1N2DC 5CCHA 1G2CA 1RE3C 1ZN5A 2OYIA 1FZBA 1J1DB 3GHGA 2WWWA 2KP8A 1RY3A 4I6MC 3NMDA 1WRGA 1GL2B 1RE4C 4GIFA 1NTZK 3RK3D 1SFCD 1CI6B 1MV8A 1J2JB 5AVUB 3NFQA 1J1DC 1JTHA 3V2NA 3I5CA 4WY4B 3V4QA 1N73C 2O01H 3VMZA 1DX7A 5APWA 5AW1B 4I1LA 5AVZB 3VTPC 3N4XA 3HE4A 3V4WA 2C9LY 2HG5D 2WZ7A 3B5NA 2WSCH 1HJBA 2KB7P 2HYNA 3MIWA 3B5NB 2P1JA 1FZGA 4LLHA 1LTTC 3LIDA 1RE3A 1JY2P 4Y99C 1HWTC 4Y99B 5APVA 1JTHB 2NPSD 4N6JA 1FJPA 3LIEA 1JY2N 2FYZA 3KDPB 3L36A 3VMYA 2R32A 3HTKA 1N73A 2YMYA 1JCDA 1LTSC 2PP6A 1SQQK 1EQ7A 3A2AA 3KQGA 1S9KD 2WPRA 5KJ7C 1KILA 1SVFA 1HGZA 1NH4A 1A02J 2W6AA 2FYUK 3VP9A 1L4AD 2FKWB 4HYTB 1NTKK 3EFGA 1LTIC 4N3YB 4IFDK 1HGVA 4WY4C 4EIJA 4C7RA 3SWFA 1YTZT 2Z4EA 4O9BA 4C46A 5APQA 3HD7D 4AYCA 5APXA 1HVVA 1GK4A 1FJKA 4C7NA 4JF7A 1JY3O 1GL2D 1X9VA 1IK9A 1MUUA 2JJLA 5AW5B 2O1JA 3TK1A 1SQBK 5BU5A 1LWUB 2WT7A 5APSA 2ZFCA 2GUVA 4B86A 2KSJA 3KPEA 1DEBA 1M7LA 1N7SC 3H32B 2IFNA 1LT9C 5APUA 1LT9B 1M1JA 2XKMA 4LC1A 4W7YA 2KYVA 2E42A 1AFOA 4I2LC 1KQLA 1SFCC 2A45I 5APYA 1NAFA 4JYCA 3V5BA 2HFED 5AVSB 2Q7CA 1LTBC 1H88A 3TNUA 2QM7A 1FZEA 1GU4A 2IFMA 1IO4A 1OWAA 4XE5B 3RK2B 4WB4A 5BU8B 1HH0A 3HTKB 1NKNA 3BATA 1FOSF 1IFDA 1IFIA 2HPCB 1KFNA 1FZAA 1T2KC 3G3ZA 3RK2C 1ZV8A 2POHA 2CPSA 3M9QA 2P7JA 3GHGC 1LTAC 1HBWA 2WPQA 3L4FA 4M3LA 1WT6A 1XTGB 3HRNA 5CCGC 1MFZA 4XA4A 3VN0A 1RF1C 5AVRB 4IFMA 5AVYB 3BVHA 1SQPK 2WTYA 1CSBA 2N1TD 2C0XA 1L4AB 5CMZA 2KLVA 3P32A 4DZOA 2IPPA 4OH8B 1XTCC 3RL0B 3RK3B 2YNYA 3VMXA 1KILD 1VDFA 1T8ZA 1S9KE 3R2PA 5CCGD 5AW0B 3T97A 1JY2O 1M1JB 3C9IA 1LT9A 5AW2B 4DOJA 2LKMA 1KZUB 2FFDC 3SWYA 3BRTB 3UIAA 2GM4A 3CL3D 2I1JA 3P8CD 1LWUA 1RF0C 1SP4A 3A7OA 3HD7B 3HE5A 3HE5B 3U59A 1T3UA 4IFFA 5CCGA 4HH2A 1NO4A 2J58A 2GUSA 1L0NK 3L37A 1W2EA 2O1KA 2H7HA 1VPCA 5KJ7A 3P7KA 2OYIC 1L0LK 1LTGC 5CCHC 4WY4D 1L4AA 2OARA 3EQ2A 3V2RA 3M0DA 2P67A 2W6BA 5KTBA 1LTJC 1GL2C 1LTJB 1GTWA 1J1EB 2Q5UA 1JOCA 1SFCA 1Z56A 3M91A 4ZKPA 4RESB 2FFDA 1HUCA 1GDTA 3BASA 1KILB 1FBMA 2OYHC 2H8PD 4KHXA 1N7SB 2Q9IA 3U1CA 5AW6B 2E43A 2ZXEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGV A;  2CPS A;  1IFD A;  1IFI A;  2C0X A;  1HH0 A;  2MJZ A;  2C0W A;  1HGZ A;  1NH4 A;  1FDM A;  2CPB A;  1IFJ A; 
#chains in the Genus database with same CATH topology
 1L0N D;  1NTM G;  2HPC A;  3AE7 C;  3IAO A;  2N1T C;  2FYU E;  2YKQ A;  4MN4 C;  3CCQ P;  1X79 B;  3N7N A;  1NTM D;  1NU1 J;  3JSV C;  4Y28 J;  3L73 E;  1EDJ A;  2BAS A;  3CX5 I;  1G1I A;  1NTM K;  1KB9 H;  1SQB J;  2A06 G;  3BRV B;  3H1L D;  4HKZ H;  4GT1 A;  2XND H;  1YQ4 C;  1S5L E;  2Z5I A;  3AE6 C;  3TNU B;  2Y0E A;  1T3J A;  1W2B O;  4U3F J;  2FY8 A;  1UII A;  3AEA C;  2B88 A;  1BCC E;  1N7S A;  2R3S A;  1OW8 A;  3CCM P;  5DJU B;  3CC7 P;  1LT1 A;  4W7Z A;  5KJ7 D;  3VYI A;  3M9B A;  1KYO E;  2G3A A;  1IFJ A;  1BSN A;  2NPS A;  1L2P A;  3AE2 C;  3RL0 C;  1TU3 F;  4DJG A;  2H43 A;  2W27 A;  3PHL A;  2FFD B;  3G9R A;  2QJK B;  1FOS E;  2O01 J;  3GG2 A;  3AE5 C;  1T2K D;  1MKM A;  3M0D C;  1N7S D;  1AV1 A;  5KLV K;  2ZVN B;  3RBX A;  1LTJ A;  5CBN A;  1SQQ G;  1GW4 A;  1CZQ A;  3II6 A;  1M8O B;  2JP3 A;  3HE4 B;  2IX7 C;  3H32 A;  3IF4 A;  4U3F D;  4EI2 A;  5KAF H;  3KZI H;  2KK7 A;  5H2F H;  1LP1 A;  1KYO I;  4KT0 J;  1FZC B;  1H0T A;  2I8D A;  3MUD A;  3CXH I;  2N1T A;  3PP5 A;  2W8Z A;  1NTK J;  1OVV A;  2QEX P;  1NOH A;  1NTZ J;  1P84 E;  2M3B A;  2QM8 A;  2W83 C;  1IJD B;  1SQP D;  1ZW0 A;  2D2C D;  3AE8 C;  1Q7Y Q;  2YIU B;  4PJ0 H;  3OAK A;  1GW3 A;  4AUW A;  1PFI A;  2R5D A;  1GU5 A;  2OYH B;  3B8E B;  3B71 A;  3W68 A;  1GL2 A;  1OIP A;  1URQ B;  4HJG H;  1SQB G;  2WPS A;  3LW5 H;  1YBK A;  2FXM A;  1QL1 A;  5AVX B;  1EZV D;  2XU6 A;  4JYB A;  5APT A;  3L73 G;  1LWU C;  1RF0 A;  1ZOY C;  3FXD A;  3AED C;  3NXS A;  3CD6 P;  2FYU G;  1Q2N A;  2N9B A;  3GF3 A;  4GDO A;  2G8Y A;  3CC2 P;  3H1H E;  1R5S A;  2E74 D;  1G2C B;  2JKV A;  1BDD A;  1N86 A;  3HD7 A;  3H1I G;  2YKP A;  4KJM A;  3S1K A;  1LGH B;  3TDK A;  1JCC A;  4R4M A;  2NPS C;  1K04 A;  5B5E E;  5GTI E;  3VOP A;  1IZN B;  2HOD A;  5K5G B;  3MD0 A;  4N78 E;  2IBZ D;  1L0L J;  1OX3 A;  3CLQ A;  2E76 C;  2C0W A;  1JY3 N;  3KYQ A;  2ZYD A;  3H1J E;  4H0L D;  4D6T G;  3L75 D;  3M0A A;  3I55 P;  3B5N C;  1S2E A;  2WSE H;  1X8Y A;  3CC4 P;  1FS0 E;  3H1J J;  2OYH A;  2K3R A;  3HUS A;  4BXL A;  2QJK C;  1OXZ A;  4L74 A;  1BGY E;  1Y8A A;  3H1K E;  4UB6 H;  1QL2 A;  1FZC C;  2P2U A;  1CW5 A;  3IFM A;  1KTM A;  3H6P A;  2A45 H;  4AQR D;  3CPW O;  2K9Y A;  5AVV B;  3CXH E;  5AW4 B;  1FZF A;  3WMM 0;  1W5C E;  3H1K G;  3EFF K;  1JMB A;  2AXC A;  1DH3 A;  2FYU D;  2XDJ A;  3M06 A;  1N73 B;  5GTH E;  1NTM E;  2XV5 A;  4N78 D;  5DJT B;  1URQ A;  3V2P A;  2Q3E A;  2DW3 A;  3L74 G;  3C1L A;  3O8Z A;  4GOF A;  3RGU A;  3ITK A;  3RL0 D;  2J59 M;  3Q5S A;  2W90 A;  1YJ9 P;  4CPG A;  1QVG O;  4PD4 I;  3TGU J;  1NU1 G;  1NHL A;  1RHZ B;  2QE7 H;  3W67 A;  1JNM A;  2KZJ A;  3TSI A;  2V4H A;  4H44 D;  3FWL A;  1IFN A;  2O01 N;  2N1T B;  3PH0 A;  5AVT B;  2CPB A;  5CJ4 A;  4K35 A;  3I56 P;  2E75 C;  3H1L J;  3CCS P;  2M0B A;  1FZC A;  2J5U A;  1E79 H;  1LP1 B;  1NU1 K;  2KI7 B;  2MJZ A;  5AW8 B;  3IR9 A;  3RK3 C;  4RO0 A;  1KB9 D;  1GK6 A;  1ZRT E;  3QH9 A;  1KYO D;  1FDM A;  1ZR4 A;  2YKO A;  5CBO A;  1M1K Q;  3A3Y B;  1SQX K;  2KOG A;  2NRG A;  3P8M C;  1KQS O;  4A7P A;  1L0N E;  2B87 A;  2A45 G;  5KAI H;  3WUT A;  1VF5 D;  1PP9 D;  2BEQ D;  4WVZ A;  4ZKU A;  2C9N Y;  1PPJ E;  1S72 P;  1OW7 A;  3QWO C;  3S4R A;  3A0B H;  1J1E C;  1K8A Q;  2NPS B;  2OTK E;  2OGU A;  1T6A A;  3CCV P;  1YTZ I;  3TYY A;  2CK3 H;  2HLO A;  5CHX A;  4OVN F;  2QG4 A;  1JMM A;  4WBA A;  1NWQ A;  1RF1 B;  1SLQ A;  3SWK A;  5AVQ B;  2O3J A;  3WUU A;  1SQX E;  3E1R A;  4EOT A;  1L4A C;  3CX5 E;  3H1K J;  3AE1 C;  3RK2 D;  1RF1 A;  1S5L X;  4OGQ C;  1KIL C;  3L74 E;  4WY4 A;  2E74 B;  5CJ0 A;  3AEB C;  1FAV A;  2Q1K A;  1OMI A;  2H89 C;  4YPC A;  2QA4 P;  1A02 F;  2E5T A;  4UB8 H;  3OA7 A;  3L74 J;  3H1H J;  1N7L A;  2BCC G;  1CI6 A;  2JR8 A;  4JPZ B;  2Q3I A;  4TLF A;  3L35 A;  2IBZ I;  1S1C X;  2A06 D;  2K1A A;  3AE3 C;  2Y9Z A;  1IC2 A;  1YIT P;  1R8E A;  1GZL A;  3AEC C;  5AVW B;  5CCH D;  3GHG B;  1BGY G;  3AE9 C;  2B9B A;  1NKZ B;  2ZT9 B;  2L5G B;  1GD2 E;  2JEE A;  2PAJ A;  1YYC A;  1L0N G;  2VRS A;  1JUN A;  1UIX A;  2OYI B;  2WT7 B;  4H13 B;  3Q3D A;  2FXP A;  3U1A A;  2YO2 A;  2FYU J;  3MHV A;  3VP8 A;  2SPZ A;  1YI2 P;  5AW3 B;  3TGU E;  1H8A A;  1NVO A;  1E5W A;  3NTN A;  1SQV E;  1JB0 J;  3E1I A;  1P84 D;  1SFC B;  1KD1 Q;  1PP9 J;  1BE3 G;  1JY3 P;  2P58 A;  3MTU E;  5AW9 B;  1LNQ A;  1URQ C;  4C7N B;  1RE4 A;  2V7Q J;  2ZYG A;  3L72 J;  3L73 J;  2M8R A;  1USD A;  3H1J D;  3M9H A;  5BVZ A;  4IL6 X;  1ZR2 A;  2QJP B;  3L75 E;  4W80 A;  3S9O A;  4GKG A;  2I1K A;  3V2Q A;  3P8C E;  2Z5H A;  3JCU H;  5EFW B;  2KS1 B;  2AEF A;  4OWF A;  1M1J C;  1USE A;  3HD7 C;  4Z1M H;  1FU1 A;  1BGY D;  1SQV K;  3Q2Y A;  1KFM A;  1JO5 A;  1ZLL A;  2WSF J;  4PV1 C;  3FGA D;  3FX0 A;  4H13 C;  4TT3 H;  1KOR A;  2B89 A;  1PZQ A;  3HUS B;  4OGQ B;  1DEE G;  2WSS H;  1IFM A;  3CI9 A;  3B5N D;  2KS1 A;  3B4S A;  3TGU D;  4GOE A;  1SQV D;  1H89 A;  2BCC D;  1K73 Q;  2WIT A;  1ZP0 C;  1BE3 E;  2WQY C;  3CX5 H;  1PV3 A;  1SQV J;  2E75 D;  2R5B A;  1KB9 I;  4RKU J;  5C39 A;  3VMA A;  1VQ6 P;  3BCC E;  3L70 E;  4LGD E;  1HTL C;  1PGO A;  1BE3 J;  1MZ9 A;  4UB6 E;  3RK3 E;  2R3C A;  2XZR A;  1AQ5 A;  2HOD B;  1URQ D;  3OJA B;  1NU1 D;  2IZ0 A;  2WSF H;  3FXE A;  1FE6 A;  2ZYA A;  3A0H E;  3HUS C;  3D71 A;  3CWB G;  5TJH A;  2YO3 A;  3MGN A;  5AW7 B;  2YXR B;  4JQ0 D;  3CCR P;  2XNX A;  1L0N J;  1VQN P;  1G1J A;  2R44 A;  2M5A B;  1N2D C;  5CCH A;  2OQQ A;  1G2C A;  1RE3 C;  1ZN5 A;  2LXC B;  3AE4 C;  5KLI C;  1VQP P;  1P84 I;  3KXD A;  2ZXX A;  3H1K D;  1Q81 Q;  2FYN B;  1SQP J;  3H1I E;  2OYI A;  1HF9 A;  1FZB A;  1J1D B;  3JCU E;  2BCC E;  3GHG A;  1S4X A;  3PTZ A;  2NZ2 A;  1D7M A;  2H88 C;  1RY3 A;  2KP8 A;  2WWW A;  3NMD A;  4I6M C;  1PP9 E;  1WRG A;  1GL2 B;  1RE4 C;  2Q6Q A;  1NTZ K;  4GIF A;  3KZI E;  3RK3 D;  1SFC D;  3L71 G;  3T97 B;  1CI6 B;  1AVO A;  1MV8 A;  1KQG B;  1J2J B;  5AVU B;  3NFQ A;  1J1D C;  5KLV E;  1JTH A;  2HR3 A;  2AEJ A;  3I5C A;  4WY4 B;  1RQU A;  1FDI A;  3V2N A;  3V4Q A;  5KKZ B;  2ZT9 C;  2K9J A;  1N73 C;  1EC5 A;  2O01 H;  3VMZ A;  4L73 A;  5APW A;  5AW1 B;  1DX7 A;  4I1L A;  5AVZ B;  3VTP C;  4ASW A;  2KNC A;  4BRY A;  3H1I D;  3IN6 A;  3A0H H;  2IZ1 A;  3N4X A;  1AQT A;  1Q90 D;  3HE4 A;  4JBZ A;  5E79 E;  2WSE J;  3V4W A;  3CME P;  2C9L Y;  2HG5 D;  2WZ7 A;  3B5N A;  2WSC H;  1HJB A;  1EDL A;  2KB7 P;  3L72 E;  2IYP A;  2HYN A;  3MIW A;  4L76 A;  2E74 C;  1EDK A;  3B5N B;  2PRR A;  2KLU A;  2B87 B;  3H1L E;  1EZV I;  3L73 D;  2P1J A;  3SFD C;  2ITA A;  1FZG A;  4LLH A;  1KC8 Q;  1LTT C;  3LID A;  3RL0 g;  4BRY B;  1N8R Q;  2WSC J;  1BCC D;  1BGY J;  1RE3 A;  4PV1 B;  1JY2 P;  5GTI H;  1SQP G;  4Y99 C;  3WUV A;  4Y99 B;  2E76 D;  3E7K A;  1HWT C;  5APV A;  3CX5 D;  3CCJ P;  1JTH B;  2NPS D;  3L71 D;  4NPD A;  1NAY A;  3GMA A;  4N6J A;  1ZME C;  2GA1 A;  3LW5 J;  1YIJ P;  1FJP A;  3LIE A;  1L0L E;  1JY2 N;  1U7M A;  1QLE D;  2FYZ A;  2PGD A;  1M57 D;  3BCC J;  3KDP B;  2R32 A;  3L36 A;  3VMY A;  3HTK A;  1NGM B;  4QMA A;  1YHQ P;  5KAI E;  1N73 A;  2P10 A;  4XFJ A;  2YMY A;  5B66 E;  1ZXG A;  1SQQ D;  2AEM A;  2M3E A;  1JCD A;  3CCU P;  1LTS C;  3PLN A;  4NPF X;  4EDF A;  2PP6 A;  3V6I A;  2JWD A;  1SQQ K;  1EQ7 A;  3A2A A;  3C8V A;  4ZNC A;  1M56 D;  3G6E P;  3KQG A;  4WWI A;  3CMA P;  2WMM A;  2BEZ F;  1BDC A;  2OTJ P;  3F89 A;  1S9K D;  1SQP E;  2WPR A;  5GTH H;  5KJ7 C;  1KIL A;  1SQB D;  3AEF C;  1SVF A;  1NTZ D;  5M1B A;  1HGZ A;  1NH4 A;  1A02 J;  1NTM J;  4GOD A;  2AXT H;  2W6A A;  2FYU K;  3VP9 A;  3SFE C;  1EDI A;  1L4A D;  2FKW B;  3ABV C;  4HYT B;  1SQV G;  1NTK K;  2RN0 A;  1NU1 E;  2QVA A;  5L8R J;  5TIS E;  3EFG A;  3TGU G;  3Q1M A;  1LTI C;  1RH5 B;  4N3Y B;  1KYO H;  2LXB A;  4YXW H;  3H25 A;  1BSH A;  1MFT A;  4IFD K;  2JWA A;  2KUB A;  1HGV A;  3D70 A;  4WY4 C;  4EIJ A;  4C7R A;  5KKZ C;  3SWF A;  1PGQ A;  3L75 J;  1NJI Q;  3CCE P;  1YTZ T;  1EXJ A;  3KHU A;  2Z4E A;  1VQL P;  4O9B A;  2E75 B;  4C46 A;  3D6Z A;  5APQ A;  3HD7 D;  4AYC A;  5APX A;  3WU2 H;  5KLV J;  1HVV A;  1QVF O;  1GK4 A;  2N9Y B;  3CCL P;  1FC2 C;  1NTZ E;  4OGQ D;  5B66 H;  2IBZ E;  3O6Q A;  1BE3 D;  4DCK A;  1FJK A;  1AA0 A;  4C7N A;  1SQQ J;  2JO1 A;  2BCC J;  2RH0 A;  4JF7 A;  1DD4 A;  1JY3 O;  2FBW C;  1GL2 D;  2RKL A;  1QEX A;  1X9V A;  1SQX J;  1GMJ A;  1IK9 A;  1MUU A;  2JJL A;  4PD4 E;  2O1J A;  5AW5 B;  1SQB K;  3TK1 A;  3FWN A;  3GLM A;  1LWU B;  5BU5 A;  1H0T B;  1JM0 A;  2WT7 A;  1RQV A;  5APS A;  2ZFC A;  1QGK B;  2GUV A;  4B86 A;  2KSJ A;  1Y47 A;  3MP7 B;  3SSU A;  2W6J H;  3H1H G;  1DEB A;  1M7L A;  1N7S C;  1OVR A;  2ZVO B;  3H32 B;  3KPE A;  2QRX A;  2IFN A;  1VQ9 P;  1BCC J;  2FXO A;  3L72 D;  1LT9 C;  5APU A;  1LT9 B;  2IYO A;  4U7J A;  1VQM P;  1M1J A;  2XKM A;  4LC1 A;  4H44 C;  2YMK A;  4W7Y A;  4H0L C;  1WMK A;  2D2C C;  2KYV A;  2E42 A;  1AFO A;  4I2L C;  1KQL A;  2LR2 A;  3A0B E;  1FDO A;  1SFC C;  2A45 I;  5APY A;  1QX8 A;  3RBZ A;  1NTZ G;  2KIK A;  1NAF A;  5TIS H;  1X22 A;  2K37 A;  4JYC A;  4YTP C;  5KLV G;  3V5B A;  2HFE D;  5AVS B;  3R4Y A;  2ZJS E;  2WPV B;  2Q7C A;  2QJP C;  1LTB C;  2KZI A;  3TNU A;  1H88 A;  3L71 E;  2QM7 A;  1FZE A;  1GU4 A;  1SS1 A;  2IFM A;  1KB9 E;  1ZRT D;  1R5L A;  4ZMD A;  1S3J A;  2E5Y A;  1OWA A;  1PP9 G;  2UWJ E;  3MUD C;  1IO4 A;  4XE5 B;  1L0L D;  4WB4 A;  3RK2 B;  1HH0 A;  2E76 B;  3HTK B;  3GW6 A;  4PD4 H;  5BU8 B;  3G4S P;  3Q5R A;  4PV1 D;  1NKN A;  2Y0D A;  5B5E H;  3BAT A;  1YJW P;  1PPJ D;  1FOS F;  1IFD A;  1IFI A;  1SQQ E;  2HPC B;  1KFN A;  1FZA A;  1PGJ A;  3G3Z A;  1T2K C;  5E79 H;  4YXD C;  2OYO A;  3RK2 C;  1SQX D;  1ZV8 A;  2POH A;  4I7Z C;  2CPS A;  2ZAE B;  3M9Q A;  1KMI Z;  2P7J A;  1LTA C;  3GHG C;  1VQK P;  4D6T E;  2WPQ A;  3L4F A;  4L75 A;  2FYN C;  4M3L A;  1WT6 A;  4PJ0 E;  1HBW A;  1XTG B;  3HRN A;  5CCG C;  1BCC G;  1OVU A;  3L74 D;  1MFZ A;  1Y9B A;  4XA4 A;  3L70 G;  3BCC G;  3VN0 A;  2MKV A;  5AVR B;  4IFM A;  5AVY B;  4H13 D;  1RF1 C;  3BVH A;  1SQP K;  1VF5 C;  1JEK A;  2WTY A;  1CSB A;  2D2C B;  3ZDM A;  2A06 E;  2N1T D;  4U3F E;  1EXI A;  4H44 B;  2C0X A;  1L4A B;  5CMZ A;  2KLV A;  1P84 H;  1NTK D;  2L91 A;  3P32 A;  4DZO A;  2IDB A;  3PJS K;  2IPP A;  4OH8 B;  1XTC C;  2KNC B;  2QIW A;  3RL0 B;  1AVY A;  2QJY C;  3RK3 B;  3GF7 A;  2K9J B;  2QSI A;  3D6Y A;  2YNY A;  3G71 P;  1Q86 Q;  3VMX A;  3L75 G;  4D6T D;  1KIL D;  1VDF A;  4HB1 A;  1T8Z A;  1YQ3 C;  1S9K E;  3EWK A;  1VQ5 P;  1SQB E;  3R2P A;  5CCG D;  2IBZ G;  2RMZ A;  1JY2 O;  1M1J B;  3C9I A;  5AW0 B;  3T97 A;  1LT9 A;  1U57 A;  5AW2 B;  4DOJ A;  4ZKP A;  1EZV E;  2LKM A;  1KZU B;  4R4L A;  1PPJ G;  2FFD C;  2K88 A;  3SWY A;  4IL6 H;  1KV4 A;  3BRT B;  3UIA A;  1NTK E;  2GM4 A;  3CL3 D;  2I1J A;  1VF5 B;  3P8C D;  1LWU A;  1RF0 C;  1SP4 A;  1NTK G;  3A7O A;  3HD7 B;  4PD4 D;  3HE5 A;  3HE5 B;  1X0T A;  2QJY B;  2Y9Y A;  2M5A A;  3PRJ A;  1VQ4 P;  3U59 A;  2KXP B;  1T3U A;  1EZV G;  1KIL E;  4IFF A;  5CCG A;  4HH2 A;  3L70 J;  2KSE A;  1NO4 A;  2PFX A;  4NPE A;  2J58 A;  1KQF B;  2GUS A;  1VQ8 P;  3BCC D;  3L70 D;  1L0N K;  1OW6 A;  4EYY Q;  3AEE C;  1U7J A;  4I7Z B;  4IOI H;  3L37 A;  3TF5 A;  4BWN A;  1W2E A;  3CWB D;  1AJY A;  2O1K A;  1KN7 A;  2AXT E;  1VL2 A;  3L71 J;  3O6Q B;  2JDI H;  4DT0 A;  1K9M Q;  2H7H A;  1VPC A;  1VQO P;  1VQ7 P;  4UB8 E;  3USS A;  1SQX G;  3CXH H;  3AEG C;  5KJ7 A;  2V7Q H;  3P7K A;  2OYI C;  1L0L K;  1IFP A;  3H1I J;  1LTG C;  3H1H D;  1YJN P;  3CXH D;  3A5T A;  1DD3 A;  4U3F G;  5CCH C;  1S5L H;  2YXQ B;  1L0L G;  4IL6 E;  4WY4 D;  1L4A A;  3WU2 E;  4ASV A;  2OAR A;  3EQ2 A;  3V2R A;  1Q82 Q;  3M0D A;  2P67 A;  2W6B A;  2Y0C A;  1OZH A;  5KTB A;  2WVR A;  1DIP A;  1LTJ C;  1GL2 C;  1LTJ B;  3CWB E;  4D6T J;  1LJ2 A;  1J1E B;  2Q5U A;  3Q5P A;  3MZW B;  3H1J G;  1GTW A;  1JOC A;  1SFC A;  1Z56 A;  3M91 A;  4H0L B;  5H2F E;  4RES B;  5KLV D;  3CWB J;  1K05 A;  2FFD A;  1HUC A;  2ZT9 D;  3BAS A;  2YIU C;  1KIL B;  3F5H A;  1FBM A;  1GDT A;  2OYH C;  1PGP A;  2H8P D;  4RJT A;  1M90 Q;  1PL5 A;  4KHX A;  3JC2 2;  2OTL P;  1N7S B;  2Q9I A;  3U1C A;  5KLI B;  1NYH A;  1IK7 A;  1OFC X;  3H1L G;  5AW6 B;  3OW2 O;  2E43 A;  1HJ0 A;  2ZXE B;  1PIX A;  3K5B A;  5KAF E;  3L72 G;  4K3A A; 
#chains in the Genus database with same CATH homology
 2HPC A;  2N1T C;  2YKQ A;  1X79 B;  3N7N A;  2BAS A;  1G1I A;  1NTM K;  3BRV B;  4GT1 A;  2Z5I A;  3TNU B;  1T3J A;  1N7S A;  4W7Z A;  5KJ7 D;  3VYI A;  3M9B A;  2NPS A;  3RL0 C;  1IFJ A;  2H43 A;  2FFD B;  2W27 A;  1FOS E;  1T2K D;  3M0D C;  1N7S D;  5KLV K;  1LTJ A;  3II6 A;  1GW4 A;  1CZQ A;  3HE4 B;  2IX7 C;  3H32 A;  1FZC B;  3MUD A;  3PP5 A;  2N1T A;  1NOH A;  2M3B A;  3A5T A;  2QM8 A;  1IJD B;  3OAK A;  1GW3 A;  4AUW A;  1PFI A;  2R5D A;  1GU5 A;  2OYH B;  3B8E B;  1GL2 A;  1URQ B;  2WPS A;  3LW5 H;  2FXM A;  1QL1 A;  5AVX B;  2XU6 A;  5APT A;  4JYB A;  1LWU C;  1RF0 A;  3NXS A;  2N9B A;  1G2C B;  1N86 A;  3HD7 A;  2YKP A;  1LGH B;  1JCC A;  2NPS C;  3VOP A;  2HOD A;  3MD0 A;  4N78 E;  3KYQ A;  3CLQ A;  2C0W A;  1JY3 N;  3M0A A;  3B5N C;  2WSE H;  1X8Y A;  3HUS A;  1OXZ A;  1FZC C;  1QL2 A;  2P2U A;  1CW5 A;  3IFM A;  3H6P A;  2A45 H;  4AQR D;  5AVV B;  5AW4 B;  1FZF A;  3WMM 0;  1DH3 A;  3M06 A;  2XDJ A;  1N73 B;  2XV5 A;  4N78 D;  3V2P A;  1URQ A;  3O8Z A;  3RL0 D;  2OYH A;  2J59 M;  1NHL A;  1JNM A;  3TSI A;  1IFN A;  2N1T B;  5AVT B;  2CPB A;  5CJ4 A;  1FZC A;  1NU1 K;  2MJZ A;  3RK3 C;  5AW8 B;  3IR9 A;  1GK6 A;  1FDM A;  1ZR4 A;  2YKO A;  3A3Y B;  1SQX K;  2KOG A;  3P8M C;  2A45 G;  4ZKU A;  2C9N Y;  1J1E C;  2NPS B;  1YTZ I;  3TYY A;  2HLO A;  5CHX A;  1RF1 B;  1JMM A;  4WBA A;  1NWQ A;  1SLQ A;  5AVQ B;  4EOT A;  1L4A C;  3RK2 D;  1RF1 A;  4WY4 A;  1KIL C;  5CJ0 A;  1A02 F;  1FAV A;  3OA7 A;  1N7L A;  1CI6 A;  2Q3I A;  3L35 A;  1IC2 A;  1GZL A;  5AVW B;  5CCH D;  3GHG B;  1GD2 E;  1NKZ B;  2L5G B;  2JEE A;  2PAJ A;  1YYC A;  1JUN A;  2VRS A;  2OYI B;  2WT7 B;  3U1A A;  2YO2 A;  3VP8 A;  5AW3 B;  1H8A A;  1E5W A;  3NTN A;  3E1I A;  1SFC B;  5AW9 B;  3MTU E;  1JY3 P;  1URQ C;  4C7N B;  1RE4 A;  2M8R A;  5BVZ A;  3M9H A;  1ZR2 A;  4W80 A;  4GKG A;  2I1K A;  3V2Q A;  3P8C E;  2Z5H A;  1M1J C;  1JO5 A;  3HD7 C;  1FU1 A;  1SQV K;  1KFM A;  1ZLL A;  3HUS B;  3CI9 A;  1IFM A;  3B5N D;  1H89 A;  2WIT A;  2R5B A;  4LGD E;  1HTL C;  1AQ5 A;  1MZ9 A;  2R3C A;  2XZR A;  2HOD B;  1URQ D;  3OJA B;  2WSF H;  3HUS C;  2YO3 A;  3MGN A;  5AW7 B;  2XNX A;  1G1J A;  1N2D C;  5CCH A;  1G2C A;  1RE3 C;  1ZN5 A;  2OYI A;  1FZB A;  1J1D B;  3GHG A;  2WWW A;  2KP8 A;  1RY3 A;  4I6M C;  3NMD A;  1WRG A;  1GL2 B;  1RE4 C;  4GIF A;  1NTZ K;  3RK3 D;  1SFC D;  1CI6 B;  1MV8 A;  1J2J B;  5AVU B;  3NFQ A;  1J1D C;  1JTH A;  3V2N A;  3I5C A;  4WY4 B;  3V4Q A;  1N73 C;  2O01 H;  3VMZ A;  1DX7 A;  5APW A;  5AW1 B;  4I1L A;  5AVZ B;  3VTP C;  3N4X A;  3HE4 A;  3V4W A;  2C9L Y;  2HG5 D;  2WZ7 A;  3B5N A;  2WSC H;  1HJB A;  2KB7 P;  2HYN A;  3MIW A;  3B5N B;  2P1J A;  1FZG A;  4LLH A;  1LTT C;  3LID A;  1RE3 A;  1JY2 P;  4Y99 C;  1HWT C;  4Y99 B;  5APV A;  1JTH B;  2NPS D;  4N6J A;  1FJP A;  3LIE A;  1JY2 N;  2FYZ A;  3KDP B;  3L36 A;  3VMY A;  2R32 A;  3HTK A;  1N73 A;  2YMY A;  1JCD A;  1LTS C;  2PP6 A;  1SQQ K;  1EQ7 A;  3A2A A;  3KQG A;  1S9K D;  2WPR A;  5KJ7 C;  1KIL A;  1SVF A;  1HGZ A;  1NH4 A;  1A02 J;  2W6A A;  2FYU K;  3VP9 A;  1L4A D;  2FKW B;  4HYT B;  1NTK K;  3EFG A;  1LTI C;  4N3Y B;  4IFD K;  1HGV A;  4WY4 C;  4EIJ A;  4C7R A;  3SWF A;  1YTZ T;  2Z4E A;  4O9B A;  4C46 A;  5APQ A;  3HD7 D;  4AYC A;  5APX A;  1HVV A;  1GK4 A;  1FJK A;  4C7N A;  4JF7 A;  1JY3 O;  1GL2 D;  1X9V A;  1IK9 A;  1MUU A;  2JJL A;  5AW5 B;  2O1J A;  3TK1 A;  1SQB K;  5BU5 A;  1LWU B;  2WT7 A;  5APS A;  2ZFC A;  2GUV A;  4B86 A;  2KSJ A;  3KPE A;  1DEB A;  1M7L A;  1N7S C;  3H32 B;  2IFN A;  1LT9 C;  5APU A;  1LT9 B;  1M1J A;  2XKM A;  4LC1 A;  4W7Y A;  2KYV A;  2E42 A;  1AFO A;  4I2L C;  1KQL A;  1SFC C;  2A45 I;  5APY A;  1NAF A;  4JYC A;  3V5B A;  2HFE D;  5AVS B;  2Q7C A;  1LTB C;  1H88 A;  3TNU A;  2QM7 A;  1FZE A;  1GU4 A;  2IFM A;  1IO4 A;  1OWA A;  4XE5 B;  3RK2 B;  4WB4 A;  5BU8 B;  1HH0 A;  3HTK B;  1NKN A;  3BAT A;  1FOS F;  1IFD A;  1IFI A;  2HPC B;  1KFN A;  1FZA A;  1T2K C;  3G3Z A;  3RK2 C;  1ZV8 A;  2POH A;  2CPS A;  3M9Q A;  2P7J A;  3GHG C;  1LTA C;  1HBW A;  2WPQ A;  3L4F A;  4M3L A;  1WT6 A;  1XTG B;  3HRN A;  5CCG C;  1MFZ A;  4XA4 A;  3VN0 A;  1RF1 C;  5AVR B;  4IFM A;  5AVY B;  3BVH A;  1SQP K;  2WTY A;  1CSB A;  2N1T D;  2C0X A;  1L4A B;  5CMZ A;  2KLV A;  3P32 A;  4DZO A;  2IPP A;  4OH8 B;  1XTC C;  3RL0 B;  3RK3 B;  2YNY A;  3VMX A;  1KIL D;  1VDF A;  1T8Z A;  1S9K E;  3R2P A;  5CCG D;  5AW0 B;  3T97 A;  1JY2 O;  1M1J B;  3C9I A;  1LT9 A;  5AW2 B;  4DOJ A;  2LKM A;  1KZU B;  2FFD C;  3SWY A;  3BRT B;  3UIA A;  2GM4 A;  3CL3 D;  2I1J A;  3P8C D;  1LWU A;  1RF0 C;  1SP4 A;  3A7O A;  3HD7 B;  3HE5 A;  3HE5 B;  3U59 A;  1T3U A;  4IFF A;  5CCG A;  4HH2 A;  1NO4 A;  2J58 A;  2GUS A;  1L0N K;  3L37 A;  1W2E A;  2O1K A;  2H7H A;  1VPC A;  5KJ7 A;  3P7K A;  2OYI C;  1L0L K;  1LTG C;  5CCH C;  4WY4 D;  1L4A A;  2OAR A;  3EQ2 A;  3V2R A;  3M0D A;  2P67 A;  2W6B A;  5KTB A;  1LTJ C;  1GL2 C;  1LTJ B;  1GTW A;  1J1E B;  2Q5U A;  1JOC A;  1SFC A;  1Z56 A;  3M91 A;  4ZKP A;  4RES B;  2FFD A;  1HUC A;  1GDT A;  3BAS A;  1KIL B;  1FBM A;  2OYH C;  2H8P D;  4KHX A;  1N7S B;  2Q9I A;  3U1C A;  5AW6 B;  2E43 A;  2ZXE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...