1HGVA

Filamentous bacteriophage ph75
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
molecule tags Virus
source organism Bacteriophage ph75
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hgvA00
2MJZA 1IFIA 2C0WA 1NH4A 1HH0A 1IFDA 2C0XA 2CPBA 1FDMA 1IFJA 1HGVA 1HGZA 2CPSA
chains in the Genus database with same CATH superfamily
1OX3A 3RBZA 1NTMG 1VQLP 4D6TJ 3RK3E 1NTZD 4U3FE 2W6BA 2ZXEB 3V2QA 1LP1B 3S1KA 5E79H 3AE3C 3SFEC 1SQPG 2JEEA 1OVVA 2ZYDA 1M90Q 5AW1B 3KZIH 1KYOE 2GUSA 1R5SA 3V4WA 1FOSF 3AE2C 3WU2E 1N7SB 3B5NC 3L73J 2QM7A 2OYHA 3SFDC 1HTLC 1JMBA 4UB8H 4L75A 2IYOA 4YXWH 3M9QA 3H1HD 1LWUB 1SLQA 3GHGC 1NU1E 3BCCD 1K04A 3CL3D 3VP8A 1Q90D 3G71P 1E5WA 2PAJA 2CK3H 1YTZI 4UB6H 2FY8A 2A06D 5APSA 1OIPA 1J1EC 1LTJA 1L4AC 4ZKPA 1BCCJ 4U3FG 2M3EA 1HVVA 4GDOA 2YKPA 2ZXXA 4W80A 1LTGC 1KILE 1L0NE 5B5EE 2E5TA 1QL1A 4EYYQ 2YXRB 2XZRA 4OWFA 4M3LA 5KJ7C 3GHGA 2WSCJ 1RF0A 1U7MA 5AW7B 2N1TC 3A0BE 1X22A 5M1BA 2QM8A 3PLNA 5DJTB 3CXHE 2BEQD 3KPEA 1S5LE 3L74D 1SQXE 2Q1KA 3AE7C 2W6JH 5KLVE 3TSIA 2NRGA 2K1AA 1PGOA 3CCLP 4XFJA 1RH5B 2OQQA 3L73E 2FFDC 2I8DA 1SQBD 5KKZC 2YO2A 3M9BA 1AQTA 2W27A 4B86A 2KNCA 3A5TA 2KZJA 4PD4E 3RL0C 4HH2A 2IBZE 1ZW0A 2AXTE 1KZUB 2OYIA 1LTTC 2WT7A 1NHLA 3VTPC 4H0LD 1KFMA 1LT9C 1DD3A 1PP9G 4EI2A 2HG5D 1U7JA 4WY4B 5CCGD 3CC2P 3N7NA 1K05A 3FWNA 4D6TG 1M1JC 5GTIH 1FZCC 1AVYA 1BCCE 2M5AB 3GF7A 3AE4C 2AEJA 4GIFA 2K3RA 4O9BA 4BXLA 4C7NA 1HJ0A 3H1LD 2KS1B 1SQVK 1ZR2A 2W90A 3CD6P 4IOIH 1SQXG 5KLVG 5KAIH 1FC2C 3VMXA 2W8ZA 3CC7P 1YIJP 3H1HJ 1G2CA 2E76D 3L73G 1BE3D 2BCCJ 3M0DA 3T97A 3NFQA 1KC8Q 4H44D 1IO4A 1CI6B 3I5CA 2K9JA 1FZFA 2Q9IA 5APTA 2IBZG 2DW3A 1QVFO 1EQ7A 1N73A 3CCQP 2P2UA 2WWWA 1N2DC 1VPCA 1JB0J 1LTAC 3RK3B 1NTZE 2LKMA 1KB9H 4BRYB 3JSVC 1DX7A 4R4LA 5AVYB 2JWDA 4LLHA 1H0TA 1BCCG 1GL2C 2UWJE 2XKMA 3LW5J 1H8AA 3G4SP 4ZMDA 4Y99C 3L36A 3L74J 3KYQA 1NTKK 4GT1A 3C9IA 1SP4A 2E75D 2D2CD 1KQFB 4JPZB 3NXSA 2M0BA 1SFCB 2AEFA 4U7JA 4RJTA 5EFWB 1SQBJ 3D71A 4RESB 1FJKA 3JCUE 4ASWA 1LTJB 2FKWB 2A45H 1OWAA 3H25A 2IFNA 1JY2O 2V4HA 1VF5B 2QVAA 5AW8B 2VRSA 4Z1MH 3HD7B 1S5LX 3BCCE 1LP1A 1FE6A 1LWUC 3BATA 3KHUA 5H2FH 1KD1Q 2Y0CA 1M57D 1NTZG 4IFMA 3PH0A 4N6JA 2E74B 3H1KD 3B5ND 3B71A 3BRTB 1KILB 1N7SA 5AVZB 3IN6A 3H1LJ 2QJKB 1IFJA 1P84H 1AJYA 4TLFA 3OAKA 1ZRTD 3BVHA 4OGQB 4BWNA 1FDIA 3HUSA 1H89A 3PJSK 1BE3J 5C39A 2QEXP 1JO5A 2WT7B 3O6QA 3RL0g 1NWQA 1ZMEC 2V7QH 1RHZB 1IK9A 2IZ1A 1L4AD 2H7HA 2O3JA 1W2EA 1SQBE 4EDFA 3P7KA 3H1HG 5CCHC 3ZDMA 3WUTA 2WITA 3EFFK 3BCCG 1J2JB 4EIJA 1EZVI 1ZXGA 2SPZA 1VL2A 3L37A 1URQB 4LGDE 2JKVA 1SQQJ 2O1KA 2BASA 3CWBD 3L4FA 2YO3A 4RO0A 1XTGB 2A06G 5KJ7D 2N1TD 3FXEA 2L5GB 2NPSB 1USDA 3USSA 1KB9D 1BSHA 1BDDA 3CX5I 1LJ2A 2OTKE 2WPSA 1JY3P 2JDIH 2KIKA 2ZYAA 4WY4C 4JQ0D 4PV1C 2ZJSE 2J5UA 3MP7B 3KZIE 2WPRA 3EFGA 1IK7A 4DT0A 1GD2E 1DEBA 1NGMB 1OW7A 1QX8A 3CX5H 1D7MA 1R5LA 3L74G 3IR9A 3RL0D 3H6PA 3V2NA 3MZWB 2R44A 4UB8E 1EDJA 2W83C 1SQBG 3II6A 1NKNA 5APVA 5CJ4A 5APXA 2G8YA 1R8EA 4OH8B 2N9YB 2QA4P 2HR3A 1SQQK 4I2LC 3RK2C 4N78D 1SQVD 3PRJA 4JYBA 1YITP 2RMZA 4QMAA 1RF1B 3CCSP 1PIXA 3CMAP 2ZAEB 4ASVA 5KLIC 2K9YA 2JJLA 1MKMA 2XU6A 1HWTC 1Q86Q 1P84D 2OYHC 2GM4A 1L0LK 3OA7A 3H1LG 4RKUJ 4IL6E 1W2BO 5TISE 2ZYGA 4HJGH 1LNQA 1CI6A 3L75J 4ZNCA 1LGHB 1S2EA 4H13C 3FWLA 1BE3G 2I1KA 3C1LA 3FGAD 2QJYB 1L2PA 4NPDA 5GTHE 1LTJC 1LTIC 3CWBJ 1KFNA 4BRYA 1VQPP 2KLUA 5AVXB 1VF5C 1GL2D 1JUNA 2H43A 1NTKD 3VMZA 2AXCA 3WUUA 1USEA 3V2PA 2ZT9B 3HUSB 3HTKA 2BCCD 1X8YA 2QJPC 1RF0C 1HF9A 3VMYA 2KSEA 3H1KE 1QL2A 3V4QA 1NU1K 5GTIE 1SFCA 3O6QB 3H1ID 3CCVP 3NMDA 3CC4P 5CBOA 1Q82Q 1JM0A 3SSUA 2QE7H 3N4XA 2XV5A 1ZRTE 1PP9E 2B87B 5B66H 3MD0A 4JF7A 3AEDC 4D6TE 4C7RA 1L0NK 3HD7A 5KAIE 3M06A 1DEEG 3V2RA 3A2AA 2R3CA 2P67A 3VP9A 2OYIC 3S9OA 1OMIA 1OXZA 1YYCA 3VN0A 1SQVJ 2WSSH 2R32A 3VOPA 1K73Q 4XA4A 2OTLP 2IPPA 1KYOI 1KILA 3L71D 2Y0DA 3FX0A 1Z56A 1SVFA 2IX7C 3G9RA 1YHQP 3D6YA 2WMMA 2QIWA 1OVRA 2YKQA 3I55P 3IF4A 2OYOA 3AE5C 2H88C 1LTSC 2IYPA 1KB9E 3H1KG 3R4YA 4KT0J 5KAFE 1QEXA 1MZ9A 2B88A 4TT3H 1VQ9P 2JR8A 1KYOH 1EDLA 1NAFA 1SS1A 3AEAC 1OVUA 1ZP0C 2R5DA 3A7OA 2P10A 5CCHD 3M0DC 1YJ9P 5CMZA 1YTZT 2YKOA 3IAOA 2FXPA 2V7QJ 2GA1A 3AE8C 1URQA 2Q3EA 1N73C 2E76B 1X79B 2ZVOB 1X9VA 4IL6X 1FBMA 1NTKJ 3MUDA 2NPSA 2QSIA 3TNUB 4H44B 3P8CD 2HYNA 4YPCA 2LXBA 1A02F 4IFFA 4N78E 1FOSE 1HGZA 4WY4D 1SQVE 3CWBG 4GKGA 3CXHI 4PV1D 2OTJP 3MIWA 5B5EH 3A0HH 4I7ZB 3BRVB 3H1IJ 2M8RA 1W5CE 2WSEH 1YJNP 2C9NY 5APYA 4MN4C 4AUWA 3A0BH 1JY3N 1MV8A 1BGYD 1P84E 3CXHH 1CSBA 1KTMA 3P8MC 1SQQD 1S5LH 4PD4I 2IBZI 3KXDA 2FXMA 1NO4A 1ZLLA 1GU5A 3AE1C 2C0WA 2E75B 2D2CB 5CJ0A 2CPSA 1ZOYC 3RK2D 3B8EB 2Q7CA 3E1IA 3W67A 2A45G 3HTKB 3ABVC 3CCUP 4PD4H 1JMMA 5CHXA 1RF1A 3L71J 2AXTH 1PGPA 1L0LD 1YQ3C 2AEMA 2FYUJ 5BVZA 2QJYC 1NTKE 1SQVG 2B89A 1N7SC 4DZOA 4L76A 4NPFX 3MHVA 1AQ5A 2L91A 1Y9BA 3H1HE 3K5BA 1E79H 2BCCE 2N9BA 2ZT9C 3HUSC 2XNXA 1KYOD 3H1IE 1GMJA 4H13D 1N86A 1AV1A 2A06E 3Q1MA 1EC5A 1M7LA 2PRRA 4PJ0E 3H1JD 2KYVA 1VF5D 3AEGC 3RBXA 3HE5A 1RE4A 1GU4A 1NU1D 2Y9YA 1K8AQ 3L72D 1J1EB 1L4AB 3CI9A 4C46A 1N8RQ 2FYUK 1S72P 3GMAA 3HE4A 2Z5IA 4YXDC 1FZEA 4DCKA 3L74E 1NTKG 4AQRD 1KQSO 3L71E 2FXOA 1YBKA 1JY2P 2WSFH 4HYTB 3L75D 1TU3F 1L0ND 1JTHB 2YIUB 2BCCG 2B87A 2N1TB 1NKZB 1BGYJ 1OW6A 3H1IG 1MUUA 1T3UA 2KK7A 3CXHD 2KUBA 1UIXA 4K35A 1MFZA 2FFDB 3LIDA 4L73A 1DIPA 5KKZB 3JCUH 3I56P 1T8ZA 2O01N 2Q3IA 3P32A 5DJUB 3CMEP 1IJDB 2PFXA 5E79E 1PPJD 3RL0B 2Z5HA 2WPVB 2XNDH 3U59A 1L0LJ 3H1LE 1NTMK 2KXPB 3TGUD 2OARA 5AW5B 1LT9B 3V6IA 2GUVA 1GTWA 1GK6A 2WQYC 3P8CE 5CCGA 3L71G 1JCDA 1FZCB 2IDBA 2YMKA 1BE3E 2YXQB 2JWAA 1SQPK 3F89A 2WZ7A 2I1JA 1VQMP 2E42A 1HGVA 1ZV8A 2HPCB 5AVUB 2MJZA 3M0AA 1KQGB 2PGDA 3SWFA 4K3AA 4UB6E 3NTNA 4EOTA 2RN0A 1ZR4A 3H1JJ 5BU8B 1SQQE 5AW4B 3CLQA 5AVSB 1IC2A 1DH3A 3TNUA 2ZVNB 1NU1J 3RK3C 1DD4A 2C9LY 3L72J 2Y9ZA 1XTCC 5TJHA 2FBWC 3R2PA 2H89C 1S9KD 1VQNP 1RE3A 2Z4EA 1L0NJ 3Q5SA 1GL2B 1VQ6P 1SFCC 1JNMA 2RH0A 3G6EP 1PFIA 1IFPA 2WSEJ 4Y99B 1IFNA 5L8RJ 1OW8A 5AW9B 3HE5B 3L35A 3E7KA 1HH0A 1SQXJ 1S3JA 5KLVJ 1BGYG 1GW4A 3HD7C 4ZKUA 1SQQG 3SWYA 3WUVA 3HE4B 1M1KQ 1KV4A 4Y28J 2NZ2A 3WMM0 4N3YB 3AEBC 3H1JE 1Y47A 1EZVD 1KQLA 2KZIA 2XDJA 1PZQA 1PV3A 2E74C 3TGUJ 1WMKA 2YMYA 3CPWO 3GLMA 4GOEA 1N7SD 3CCJP 1KILC 2ITAA 4NPEA 1NH4A 2KOGA 2QJKC 1HJBA 3L72E 2O01H 1L0LG 1H88A 3CX5D 1LTBC 2ZT9D 3AE6C 4OGQC 2HFED 3L70D 3B5NA 3TYYA 5AW3B 1YQ4C 1AVOA 3GF3A 5AVQB 3L75E 5AW2B 3A0HE 3QH9A 2H8PD 3U1CA 2FYZA 1UIIA 2LXCB 3JC22 1JOCA 3B4SA 1RQUA 2YIUC 1SQXK 1QLED 4I1LA 5AVTB 3D70A 4IL6H 5KLVK 5CBNA 3CWBE 2FYUD 5TISH 2JP3A 5AW6B 1URQC 4H0LB 3AECC 1FDMA 2J59M 1PL5A 1L4AA 3H1JG 2KB7P 3MUDC 2NPSC 1PPJE 5GTHH 1NU1G 1J1DB 3WU2H 3CCRP 4OVNF 3OJAB 3L72G 3H32A 4W7YA 1JTHA 3TGUE 5KJ7A 1T2KC 2FYNB 1NTZJ 2WSFJ 2N1TA 3PP5A 1GW3A 4HKZH 1G1IA 1Q2NA 3L75G 1NVOA 1GDTA 1T3JA 2M3BA 2Q6QA 2J58A 1JY2N 1L0NG 2Y0EA 4PV1B 2HODB 5AVVB 2HLOA 5APUA 2FFDA 3D6ZA 1LT1A 1FU1A 1GZLA 1NTMD 1YJWP 4AYCA 3AEFC 1IZNB 1IFMA 5H2FE 3E1RA 1VDFA 1CW5A 1HUCA 1VQKP 1LT9A 2ZFCA 1M56D 1SQPD 3C8VA 1RF1C 4GODA 3Q2YA 1FDOA 4WVZA 4KHXA 1PPJG 1NYHA 3BCCJ 1Q7YQ 1M1JA 3RK2B 1FZCA 1KB9I 2IZ0A 1BDCA 2YNYA 3TGUG 3RGUA 4HB1A 3L70J 1NTZK 1VQ8P 1S9KE 4A7PA 1PGJA 4W7ZA 5APQA 2KSJA 3ITKA 5KLIB 2HPCA 2P58A 1S1CX 5KAFH 2OYHB 3PTZA 4DOJA 5AW0B 1WRGA 1S4XA 2A45I 1A02J 2K88A 3GG2A 1VQ5P 3RK3D 2WTYA 1MFTA 4U3FD 1OZHA 5K5GB 4GOFA 1AFOA 4H13B 1HBWA 1JEKA 1RE4C 4R4MA 1KORA 3BASA 1KMIZ 1FJPA 1CZQA 3B5NB 2IFMA 1EZVE 1G1JA 3M91A 1OFCX 2MKVA 1Q81Q 3TK1A 1SFCD 1GL2A 4CPGA 2WSCH 3Q5RA 3U1AA 1ZN5A 3M9HA 3W68A 5AVRB 1VQ7P 1P84I 3CX5E 3G3ZA 3GHGB 2QJPB 2QG4A 1FAVA 2E5YA 2P7JA 1RQVA 1IFIA 3L70E 5BU5A 3Q5PA 3HD7D 1IFDA 1QVGO 2G3AA 1NTMJ 3OW2O 3O8ZA 1FS0E 2KP8A 1JY3O 3EQ2A 1QGKB 5AVWB 1PGQA 1N7LA 1M8OB 1EDKA 5KTBA 3VMAA 3V5BA 1PP9D 2E74D 2R5BA 3MGNA 1BSNA 2KNCB 3QWOC 2FYUE 3CCMP 4WWIA 1KILD 2W6AA 2B9BA 1LWUA 3H32B 4D6TD 3KDPB 4YTPC 1SQPJ 4XE5B 1SQBK 3F5HA 2OYIB 3A3YB 1NOHA 2WVRA 3MTUE 2JO1A 1AA0A 4KJMA 1VQOP 1EZVG 4OGQD 4H0LC 2KLVA 4WBAA 3UIAA 2C0XA 5APWA 3VYIA 3AEEC 5CCGC 2O01J 3Q3DA 1K9MQ 1SQXD 3IFMA 4L74A 5KLVD 2RKLA 1FZAA 1JCCA 2PP6A 1J1DC 2K37A 4C7NB 3L73D 1NJIQ 3SWKA 1X0TA 3L70G 3PHLA 2OGUA 2FYNC 4I6MC 4WB4A 4PD4D 2QRXA 1URQD 4LC1A 2CPBA 2IBZD 1G2CB 4U3FJ 2E76C 1KN7A 3EWKA 3T97B 5CCHA 1M1JB 1NTME 1T6AA 2NPSD 3FXDA 2FYUG 4H44C 2K9JB 2P1JA 4PJ0H 1BCCD 1N73B 3GW6A 1NAYA 4JBZA 1T2KD 3TDKA 2O1JA 2WPQA 3KQGA 4I7ZC 1EXJA 1SQPE 1Y8AA 1FZGA 4DJGA 3TF5A 1RE3C 1EXIA 1VQ4P 3CCEP 1BGYE 3LW5H 3AE9C 3S4RA 1H0TB 4IFDK 4WY4A 5B66E 1RY3A 2HODA 2M5AA 2POHA 3H1KJ 1GK4A 2E75C 2D2CC 2R3SA 2BEZF 2KI7B 2E43A 1WT6A 2KS1A 3HRNA 1U57A 3LIEA 4JYCA 1YI2P 1EDIA 2LR2A 1FZBA 1PP9J 1L0LE 2Q5UA
chains in the Genus database with same CATH topology
3RK2D 5CCHC 3B8EB 5AW6B 1URQC 2Q7CA 2WITA 3E1IA 2A45G 1J2JB 1FDMA 3HTKB 2J59M 4EIJA 1L4AA 2W6BA 2ZXEB 3L37A 1URQB 4LGDE 2O1KA 3V2QA 2BASA 1JMMA 5CHXA 2KB7P 3L4FA 2NPSC 2YO3A 1RF1A 1XTGB 5KJ7D 1J1DB 2N1TD 5BVZA 2L5GB 2NPSB 3OJAB 2JEEA 3H32A 4W7YA 1JTHA 5AW1B 1N7SC 5KJ7A 1T2KC 2GUSA 4DZOA 2WPSA 1JY3P 1AQ5A 2N1TA 3V4WA 1FOSF 3PP5A 1GW3A 4WY4C 1N7SB 3B5NC 2QM7A 1G1IA 2OYHA 2N9BA 1HTLC 3HUSC 2WPRA 1GDTA 1T3JA 2M3BA 2XNXA 2J58A 1JY2N 3EFGA 2HODB 5AVVB 1GD2E 1DEBA 2HLOA 5APUA 1N86A 2FFDA 3IR9A 3M9QA 3RL0D 1LWUB 3H6PA 3V2NA 1FU1A 1SLQA 3GHGC 1GZLA 1M7LA 4AYCA 3CL3D 1IFMA 3VP8A 2KYVA 3II6A 1NKNA 1E5WA 2PAJA 5APVA 3HE5A 5CJ4A 1YTZI 5APXA 5APSA 1RE4A 4OH8B 1J1EC 1LTJA 1L4AC 1GU4A 4ZKPA 1VDFA 1CW5A 1HUCA 1SQQK 4I2LC 1HVVA 3RK2C 4N78D 1LT9A 2YKPA 2ZFCA 4W80A 1RF1C 1LTGC 1J1EB 4JYBA 4KHXA 1L4AB 3CI9A 4C46A 1QL1A 2FYUK 1M1JA 3HE4A 3RK2B 1FZCA 2Z5IA 1FZEA 1RF1B 2XZRA 2YNYA 4AQRD 4M3LA 5KJ7C 3GHGA 1JY2P 2WSFH 4HYTB 1RF0A 1NTZK 5AW7B 2N1TC 1S9KE 2JJLA 2QM8A 1JTHB 4W7ZA 2XU6A 1HWTC 5APQA 2OYHC 2KSJA 3KPEA 2GM4A 1L0LK 2HPCA 2N1TB 1NKZB 3OA7A 3TSIA 2OYHB 1MUUA 1T3UA 4DOJA 5AW0B 2FFDC 1CI6A 2YO2A 1WRGA 3M9BA 1LGHB 1MFZA 2A45I 1A02J 2W27A 4B86A 2FFDB 3A5TA 3LIDA 3RK3D 2WTYA 2I1KA 3RL0C 4HH2A 1T8ZA 3P32A 2Q3IA 1AFOA 1IJDB 1HBWA 1KZUB 2OYIA 1RE4C 1LTTC 1LTJC 1LTIC 2WT7A 1NHLA 3RL0B 2Z5HA 1KFNA 3U59A 3VTPC 1KFMA 3BASA 1LT9C 5AVXB 1GL2D 1JUNA 2HG5D 2H43A 4WY4B 5CCGD 1NTMK 1FJPA 1CZQA 3N7NA 2OARA 3B5NB 3VMZA 2IFMA 5AW5B 1M1JC 1G1JA 1FZCC 1LT9B 3M91A 3V2PA 2GUVA 3TK1A 3HUSB 1SFCD 1GL2A 1GTWA 3HTKA 1GK6A 3P8CE 2WSCH 4GIFA 5CCGA 1X8YA 4O9BA 1JCDA 1FZCB 1RF0C 3U1AA 4C7NA 3VMYA 1ZN5A 3M9HA 1QL2A 3V4QA 1NU1K 5AVRB 1SFCA 1SQPK 3G3ZA 3GHGB 3NMDA 1SQVK 1ZR2A 2WZ7A 1FAVA 2I1JA 2P7JA 1IFIA 5BU5A 2E42A 1HGVA 3VMXA 1ZV8A 3N4XA 2XV5A 3HD7D 1IFDA 2HPCB 1G2CA 3MD0A 5AVUB 2MJZA 4JF7A 3M0AA 3O8ZA 3M0DA 4C7RA 3T97A 3SWFA 2KP8A 1JY3O 3NTNA 3EQ2A 1L0NK 3NFQA 5AVWB 4EOTA 1ZR4A 3HD7A 1N7LA 5BU8B 3M06A 5KTBA 1IO4A 1CI6B 3I5CA 1FZFA 2Q9IA 3V5BA 5APTA 3V2RA 3A2AA 2R5BA 3MGNA 3CLQA 5AW4B 2R3CA 2P67A 1EQ7A 5AVSB 1IC2A 3VP9A 2P2UA 1N73A 3TNUA 2WWWA 1DH3A 2OYIC 1KILD 2W6AA 3RK3C 1LWUA 1N2DC 3H32B 3KDPB 1OXZA 1YYCA 3VN0A 2C9LY 1VPCA 4XE5B 2R32A 3VOPA 1SQBK 1XTCC 2OYIB 4XA4A 3A3YB 1NOHA 2IPPA 1LTAC 3RK3B 2LKMA 1KILA 3MTUE 1Z56A 3R2PA 1SVFA 2IX7C 1DX7A 5AVYB 4LLHA 2KLVA 1S9KD 4WBAA 3UIAA 1GL2C 2C0XA 5APWA 3VYIA 2XKMA 1RE3A 5CCGC 2YKQA 2Z4EA 3IFMA 1LTSC 1H8AA 1GL2B 1SFCC 4Y99C 1JNMA 1MZ9A 1FZAA 1JCCA 3L36A 2PP6A 3KYQA 1J1DC 1NTKK 4GT1A 3C9IA 1SP4A 4C7NB 1NAFA 3NXSA 1PFIA 1SFCB 4Y99B 1IFNA 5AW9B 2R5DA 3A7OA 4I6MC 4WB4A 3HE5B 3L35A 4RESB 1FJKA 1LTJB 2FKWB 5CCHD 2A45H 1URQD 1HH0A 3M0DC 2CPBA 4LC1A 1OWAA 5CMZA 2IFNA 1JY2O 1YTZT 2YKOA 1GW4A 1G2CB 3HD7C 4ZKUA 5AW8B 2VRSA 3SWYA 5CCHA 1M1JB 1URQA 3HE4B 2NPSD 3HD7B 1N73C 3WMM0 4N3YB 1X79B 1LWUC 2P1JA 3BATA 1X9VA 1FBMA 1KQLA 2XDJA 1N73B 3MUDA 2NPSA 3TNUB 2YMYA 1N7SD 3P8CD 2HYNA 1KILC 1T2KD 1A02F 4IFMA 1NH4A 4N6JA 2O1JA 2WPQA 3KQGA 2KOGA 4IFFA 4N78E 1FOSE 1HJBA 1HGZA 4WY4D 4GKGA 1FZGA 3B5ND 3BRTB 1KILB 2O01H 1RE3C 1N7SA 5AVZB 1H88A 1LTBC 3MIWA 3LW5H 1IFJA 3BRVB 2HFED 2M8RA 4IFDK 4WY4A 3B5NA 3TYYA 5AW3B 1RY3A 2HODA 5AVQB 3OAKA 3BVHA 2WSEH 5AW2B 3HUSA 2C9NY 5APYA 4AUWA 1H89A 1JY3N 1MV8A 2POHA 2H8PD 3U1CA 1CSBA 1GK4A 1JO5A 2FYZA 3P8MC 2E43A 2WT7B 1JOCA 1SQXK 1WT6A 2FXMA 1NWQA 1NO4A 3HRNA 4I1LA 1ZLLA 5AVTB 1GU5A 3LIEA 4JYCA 5KLVK 2C0WA 1IK9A 1L4AD 5CJ0A 2H7HA 1FZBA 1W2EA 3P7KA 2CPSA 2Q5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  1IFI A;  2C0W A;  1NH4 A;  1HH0 A;  1IFD A;  2C0X A;  2CPB A;  1FDM A;  1IFJ A;  1HGV A;  1HGZ A;  2CPS A; 
#chains in the Genus database with same CATH topology
 1OX3 A;  3RBZ A;  1NTM G;  1VQL P;  4D6T J;  3RK3 E;  1NTZ D;  4U3F E;  2W6B A;  2ZXE B;  3V2Q A;  1LP1 B;  3S1K A;  5E79 H;  3AE3 C;  3SFE C;  1SQP G;  2JEE A;  1OVV A;  2ZYD A;  1M90 Q;  5AW1 B;  3KZI H;  1KYO E;  2GUS A;  1R5S A;  3V4W A;  1FOS F;  3AE2 C;  3WU2 E;  1N7S B;  3B5N C;  3L73 J;  2QM7 A;  2OYH A;  3SFD C;  1HTL C;  1JMB A;  4UB8 H;  4L75 A;  2IYO A;  4YXW H;  3M9Q A;  3H1H D;  1LWU B;  1SLQ A;  3GHG C;  1NU1 E;  3BCC D;  1K04 A;  3CL3 D;  3VP8 A;  1Q90 D;  3G71 P;  1E5W A;  2PAJ A;  2CK3 H;  1YTZ I;  4UB6 H;  2FY8 A;  2A06 D;  5APS A;  1OIP A;  1J1E C;  1LTJ A;  1L4A C;  4ZKP A;  1BCC J;  4U3F G;  2M3E A;  1HVV A;  4GDO A;  2YKP A;  2ZXX A;  4W80 A;  1LTG C;  1KIL E;  1L0N E;  5B5E E;  2E5T A;  1QL1 A;  4EYY Q;  2YXR B;  2XZR A;  4OWF A;  4M3L A;  5KJ7 C;  3GHG A;  2WSC J;  1RF0 A;  1U7M A;  5AW7 B;  2N1T C;  3A0B E;  1X22 A;  5M1B A;  2QM8 A;  3PLN A;  5DJT B;  3CXH E;  2BEQ D;  3KPE A;  1S5L E;  3L74 D;  1SQX E;  2Q1K A;  3AE7 C;  2W6J H;  5KLV E;  3TSI A;  2NRG A;  2K1A A;  1PGO A;  3CCL P;  4XFJ A;  1RH5 B;  2OQQ A;  3L73 E;  2FFD C;  2I8D A;  1SQB D;  5KKZ C;  2YO2 A;  3M9B A;  1AQT A;  2W27 A;  4B86 A;  2KNC A;  3A5T A;  2KZJ A;  4PD4 E;  3RL0 C;  4HH2 A;  2IBZ E;  1ZW0 A;  2AXT E;  1KZU B;  2OYI A;  1LTT C;  2WT7 A;  1NHL A;  3VTP C;  4H0L D;  1KFM A;  1LT9 C;  1DD3 A;  1PP9 G;  4EI2 A;  2HG5 D;  1U7J A;  4WY4 B;  5CCG D;  3CC2 P;  3N7N A;  1K05 A;  3FWN A;  4D6T G;  1M1J C;  5GTI H;  1FZC C;  1AVY A;  1BCC E;  2M5A B;  3GF7 A;  3AE4 C;  2AEJ A;  4GIF A;  2K3R A;  4O9B A;  4BXL A;  4C7N A;  1HJ0 A;  3H1L D;  2KS1 B;  1SQV K;  1ZR2 A;  2W90 A;  3CD6 P;  4IOI H;  1SQX G;  5KLV G;  5KAI H;  1FC2 C;  3VMX A;  2W8Z A;  3CC7 P;  1YIJ P;  3H1H J;  1G2C A;  2E76 D;  3L73 G;  1BE3 D;  2BCC J;  3M0D A;  3T97 A;  3NFQ A;  1KC8 Q;  4H44 D;  1IO4 A;  1CI6 B;  3I5C A;  2K9J A;  1FZF A;  2Q9I A;  5APT A;  2IBZ G;  2DW3 A;  1QVF O;  1EQ7 A;  1N73 A;  3CCQ P;  2P2U A;  2WWW A;  1N2D C;  1VPC A;  1JB0 J;  1LTA C;  3RK3 B;  1NTZ E;  2LKM A;  1KB9 H;  4BRY B;  3JSV C;  1DX7 A;  4R4L A;  5AVY B;  2JWD A;  4LLH A;  1H0T A;  1BCC G;  1GL2 C;  2UWJ E;  2XKM A;  3LW5 J;  1H8A A;  3G4S P;  4ZMD A;  4Y99 C;  3L36 A;  3L74 J;  3KYQ A;  1NTK K;  4GT1 A;  3C9I A;  1SP4 A;  2E75 D;  2D2C D;  1KQF B;  4JPZ B;  3NXS A;  2M0B A;  1SFC B;  2AEF A;  4U7J A;  4RJT A;  5EFW B;  1SQB J;  3D71 A;  4RES B;  1FJK A;  3JCU E;  4ASW A;  1LTJ B;  2FKW B;  2A45 H;  1OWA A;  3H25 A;  2IFN A;  1JY2 O;  2V4H A;  1VF5 B;  2QVA A;  5AW8 B;  2VRS A;  4Z1M H;  3HD7 B;  1S5L X;  3BCC E;  1LP1 A;  1FE6 A;  1LWU C;  3BAT A;  3KHU A;  5H2F H;  1KD1 Q;  2Y0C A;  1M57 D;  1NTZ G;  4IFM A;  3PH0 A;  4N6J A;  2E74 B;  3H1K D;  3B5N D;  3B71 A;  3BRT B;  1KIL B;  1N7S A;  5AVZ B;  3IN6 A;  3H1L J;  2QJK B;  1IFJ A;  1P84 H;  1AJY A;  4TLF A;  3OAK A;  1ZRT D;  3BVH A;  4OGQ B;  4BWN A;  1FDI A;  3HUS A;  1H89 A;  3PJS K;  1BE3 J;  5C39 A;  2QEX P;  1JO5 A;  2WT7 B;  3O6Q A;  3RL0 g;  1NWQ A;  1ZME C;  2V7Q H;  1RHZ B;  1IK9 A;  2IZ1 A;  1L4A D;  2H7H A;  2O3J A;  1W2E A;  1SQB E;  4EDF A;  3P7K A;  3H1H G;  5CCH C;  3ZDM A;  3WUT A;  2WIT A;  3EFF K;  3BCC G;  1J2J B;  4EIJ A;  1EZV I;  1ZXG A;  2SPZ A;  1VL2 A;  3L37 A;  1URQ B;  4LGD E;  2JKV A;  1SQQ J;  2O1K A;  2BAS A;  3CWB D;  3L4F A;  2YO3 A;  4RO0 A;  1XTG B;  2A06 G;  5KJ7 D;  2N1T D;  3FXE A;  2L5G B;  2NPS B;  1USD A;  3USS A;  1KB9 D;  1BSH A;  1BDD A;  3CX5 I;  1LJ2 A;  2OTK E;  2WPS A;  1JY3 P;  2JDI H;  2KIK A;  2ZYA A;  4WY4 C;  4JQ0 D;  4PV1 C;  2ZJS E;  2J5U A;  3MP7 B;  3KZI E;  2WPR A;  3EFG A;  1IK7 A;  4DT0 A;  1GD2 E;  1DEB A;  1NGM B;  1OW7 A;  1QX8 A;  3CX5 H;  1D7M A;  1R5L A;  3L74 G;  3IR9 A;  3RL0 D;  3H6P A;  3V2N A;  3MZW B;  2R44 A;  4UB8 E;  1EDJ A;  2W83 C;  1SQB G;  3II6 A;  1NKN A;  5APV A;  5CJ4 A;  5APX A;  2G8Y A;  1R8E A;  4OH8 B;  2N9Y B;  2QA4 P;  2HR3 A;  1SQQ K;  4I2L C;  3RK2 C;  4N78 D;  1SQV D;  3PRJ A;  4JYB A;  1YIT P;  2RMZ A;  4QMA A;  1RF1 B;  3CCS P;  1PIX A;  3CMA P;  2ZAE B;  4ASV A;  5KLI C;  2K9Y A;  2JJL A;  1MKM A;  2XU6 A;  1HWT C;  1Q86 Q;  1P84 D;  2OYH C;  2GM4 A;  1L0L K;  3OA7 A;  3H1L G;  4RKU J;  4IL6 E;  1W2B O;  5TIS E;  2ZYG A;  4HJG H;  1LNQ A;  1CI6 A;  3L75 J;  4ZNC A;  1LGH B;  1S2E A;  4H13 C;  3FWL A;  1BE3 G;  2I1K A;  3C1L A;  3FGA D;  2QJY B;  1L2P A;  4NPD A;  5GTH E;  1LTJ C;  1LTI C;  3CWB J;  1KFN A;  4BRY A;  1VQP P;  2KLU A;  5AVX B;  1VF5 C;  1GL2 D;  1JUN A;  2H43 A;  1NTK D;  3VMZ A;  2AXC A;  3WUU A;  1USE A;  3V2P A;  2ZT9 B;  3HUS B;  3HTK A;  2BCC D;  1X8Y A;  2QJP C;  1RF0 C;  1HF9 A;  3VMY A;  2KSE A;  3H1K E;  1QL2 A;  3V4Q A;  1NU1 K;  5GTI E;  1SFC A;  3O6Q B;  3H1I D;  3CCV P;  3NMD A;  3CC4 P;  5CBO A;  1Q82 Q;  1JM0 A;  3SSU A;  2QE7 H;  3N4X A;  2XV5 A;  1ZRT E;  1PP9 E;  2B87 B;  5B66 H;  3MD0 A;  4JF7 A;  3AED C;  4D6T E;  4C7R A;  1L0N K;  3HD7 A;  5KAI E;  3M06 A;  1DEE G;  3V2R A;  3A2A A;  2R3C A;  2P67 A;  3VP9 A;  2OYI C;  3S9O A;  1OMI A;  1OXZ A;  1YYC A;  3VN0 A;  1SQV J;  2WSS H;  2R32 A;  3VOP A;  1K73 Q;  4XA4 A;  2OTL P;  2IPP A;  1KYO I;  1KIL A;  3L71 D;  2Y0D A;  3FX0 A;  1Z56 A;  1SVF A;  2IX7 C;  3G9R A;  1YHQ P;  3D6Y A;  2WMM A;  2QIW A;  1OVR A;  2YKQ A;  3I55 P;  3IF4 A;  2OYO A;  3AE5 C;  2H88 C;  1LTS C;  2IYP A;  1KB9 E;  3H1K G;  3R4Y A;  4KT0 J;  5KAF E;  1QEX A;  1MZ9 A;  2B88 A;  4TT3 H;  1VQ9 P;  2JR8 A;  1KYO H;  1EDL A;  1NAF A;  1SS1 A;  3AEA C;  1OVU A;  1ZP0 C;  2R5D A;  3A7O A;  2P10 A;  5CCH D;  3M0D C;  1YJ9 P;  5CMZ A;  1YTZ T;  2YKO A;  3IAO A;  2FXP A;  2V7Q J;  2GA1 A;  3AE8 C;  1URQ A;  2Q3E A;  1N73 C;  2E76 B;  1X79 B;  2ZVO B;  1X9V A;  4IL6 X;  1FBM A;  1NTK J;  3MUD A;  2NPS A;  2QSI A;  3TNU B;  4H44 B;  3P8C D;  2HYN A;  4YPC A;  2LXB A;  1A02 F;  4IFF A;  4N78 E;  1FOS E;  1HGZ A;  4WY4 D;  1SQV E;  3CWB G;  4GKG A;  3CXH I;  4PV1 D;  2OTJ P;  3MIW A;  5B5E H;  3A0H H;  4I7Z B;  3BRV B;  3H1I J;  2M8R A;  1W5C E;  2WSE H;  1YJN P;  2C9N Y;  5APY A;  4MN4 C;  4AUW A;  3A0B H;  1JY3 N;  1MV8 A;  1BGY D;  1P84 E;  3CXH H;  1CSB A;  1KTM A;  3P8M C;  1SQQ D;  1S5L H;  4PD4 I;  2IBZ I;  3KXD A;  2FXM A;  1NO4 A;  1ZLL A;  1GU5 A;  3AE1 C;  2C0W A;  2E75 B;  2D2C B;  5CJ0 A;  2CPS A;  1ZOY C;  3RK2 D;  3B8E B;  2Q7C A;  3E1I A;  3W67 A;  2A45 G;  3HTK B;  3ABV C;  3CCU P;  4PD4 H;  1JMM A;  5CHX A;  1RF1 A;  3L71 J;  2AXT H;  1PGP A;  1L0L D;  1YQ3 C;  2AEM A;  2FYU J;  5BVZ A;  2QJY C;  1NTK E;  1SQV G;  2B89 A;  1N7S C;  4DZO A;  4L76 A;  4NPF X;  3MHV A;  1AQ5 A;  2L91 A;  1Y9B A;  3H1H E;  3K5B A;  1E79 H;  2BCC E;  2N9B A;  2ZT9 C;  3HUS C;  2XNX A;  1KYO D;  3H1I E;  1GMJ A;  4H13 D;  1N86 A;  1AV1 A;  2A06 E;  3Q1M A;  1EC5 A;  1M7L A;  2PRR A;  4PJ0 E;  3H1J D;  2KYV A;  1VF5 D;  3AEG C;  3RBX A;  3HE5 A;  1RE4 A;  1GU4 A;  1NU1 D;  2Y9Y A;  1K8A Q;  3L72 D;  1J1E B;  1L4A B;  3CI9 A;  4C46 A;  1N8R Q;  2FYU K;  1S72 P;  3GMA A;  3HE4 A;  2Z5I A;  4YXD C;  1FZE A;  4DCK A;  3L74 E;  1NTK G;  4AQR D;  1KQS O;  3L71 E;  2FXO A;  1YBK A;  1JY2 P;  2WSF H;  4HYT B;  3L75 D;  1TU3 F;  1L0N D;  1JTH B;  2YIU B;  2BCC G;  2B87 A;  2N1T B;  1NKZ B;  1BGY J;  1OW6 A;  3H1I G;  1MUU A;  1T3U A;  2KK7 A;  3CXH D;  2KUB A;  1UIX A;  4K35 A;  1MFZ A;  2FFD B;  3LID A;  4L73 A;  1DIP A;  5KKZ B;  3JCU H;  3I56 P;  1T8Z A;  2O01 N;  2Q3I A;  3P32 A;  5DJU B;  3CME P;  1IJD B;  2PFX A;  5E79 E;  1PPJ D;  3RL0 B;  2Z5H A;  2WPV B;  2XND H;  3U59 A;  1L0L J;  3H1L E;  1NTM K;  2KXP B;  3TGU D;  2OAR A;  5AW5 B;  1LT9 B;  3V6I A;  2GUV A;  1GTW A;  1GK6 A;  2WQY C;  3P8C E;  5CCG A;  3L71 G;  1JCD A;  1FZC B;  2IDB A;  2YMK A;  1BE3 E;  2YXQ B;  2JWA A;  1SQP K;  3F89 A;  2WZ7 A;  2I1J A;  1VQM P;  2E42 A;  1HGV A;  1ZV8 A;  2HPC B;  5AVU B;  2MJZ A;  3M0A A;  1KQG B;  2PGD A;  3SWF A;  4K3A A;  4UB6 E;  3NTN A;  4EOT A;  2RN0 A;  1ZR4 A;  3H1J J;  5BU8 B;  1SQQ E;  5AW4 B;  3CLQ A;  5AVS B;  1IC2 A;  1DH3 A;  3TNU A;  2ZVN B;  1NU1 J;  3RK3 C;  1DD4 A;  2C9L Y;  3L72 J;  2Y9Z A;  1XTC C;  5TJH A;  2FBW C;  3R2P A;  2H89 C;  1S9K D;  1VQN P;  1RE3 A;  2Z4E A;  1L0N J;  3Q5S A;  1GL2 B;  1VQ6 P;  1SFC C;  1JNM A;  2RH0 A;  3G6E P;  1PFI A;  1IFP A;  2WSE J;  4Y99 B;  1IFN A;  5L8R J;  1OW8 A;  5AW9 B;  3HE5 B;  3L35 A;  3E7K A;  1HH0 A;  1SQX J;  1S3J A;  5KLV J;  1BGY G;  1GW4 A;  3HD7 C;  4ZKU A;  1SQQ G;  3SWY A;  3WUV A;  3HE4 B;  1M1K Q;  1KV4 A;  4Y28 J;  2NZ2 A;  3WMM 0;  4N3Y B;  3AEB C;  3H1J E;  1Y47 A;  1EZV D;  1KQL A;  2KZI A;  2XDJ A;  1PZQ A;  1PV3 A;  2E74 C;  3TGU J;  1WMK A;  2YMY A;  3CPW O;  3GLM A;  4GOE A;  1N7S D;  3CCJ P;  1KIL C;  2ITA A;  4NPE A;  1NH4 A;  2KOG A;  2QJK C;  1HJB A;  3L72 E;  2O01 H;  1L0L G;  1H88 A;  3CX5 D;  1LTB C;  2ZT9 D;  3AE6 C;  4OGQ C;  2HFE D;  3L70 D;  3B5N A;  3TYY A;  5AW3 B;  1YQ4 C;  1AVO A;  3GF3 A;  5AVQ B;  3L75 E;  5AW2 B;  3A0H E;  3QH9 A;  2H8P D;  3U1C A;  2FYZ A;  1UII A;  2LXC B;  3JC2 2;  1JOC A;  3B4S A;  1RQU A;  2YIU C;  1SQX K;  1QLE D;  4I1L A;  5AVT B;  3D70 A;  4IL6 H;  5KLV K;  5CBN A;  3CWB E;  2FYU D;  5TIS H;  2JP3 A;  5AW6 B;  1URQ C;  4H0L B;  3AEC C;  1FDM A;  2J59 M;  1PL5 A;  1L4A A;  3H1J G;  2KB7 P;  3MUD C;  2NPS C;  1PPJ E;  5GTH H;  1NU1 G;  1J1D B;  3WU2 H;  3CCR P;  4OVN F;  3OJA B;  3L72 G;  3H32 A;  4W7Y A;  1JTH A;  3TGU E;  5KJ7 A;  1T2K C;  2FYN B;  1NTZ J;  2WSF J;  2N1T A;  3PP5 A;  1GW3 A;  4HKZ H;  1G1I A;  1Q2N A;  3L75 G;  1NVO A;  1GDT A;  1T3J A;  2M3B A;  2Q6Q A;  2J58 A;  1JY2 N;  1L0N G;  2Y0E A;  4PV1 B;  2HOD B;  5AVV B;  2HLO A;  5APU A;  2FFD A;  3D6Z A;  1LT1 A;  1FU1 A;  1GZL A;  1NTM D;  1YJW P;  4AYC A;  3AEF C;  1IZN B;  1IFM A;  5H2F E;  3E1R A;  1VDF A;  1CW5 A;  1HUC A;  1VQK P;  1LT9 A;  2ZFC A;  1M56 D;  1SQP D;  3C8V A;  1RF1 C;  4GOD A;  3Q2Y A;  1FDO A;  4WVZ A;  4KHX A;  1PPJ G;  1NYH A;  3BCC J;  1Q7Y Q;  1M1J A;  3RK2 B;  1FZC A;  1KB9 I;  2IZ0 A;  1BDC A;  2YNY A;  3TGU G;  3RGU A;  4HB1 A;  3L70 J;  1NTZ K;  1VQ8 P;  1S9K E;  4A7P A;  1PGJ A;  4W7Z A;  5APQ A;  2KSJ A;  3ITK A;  5KLI B;  2HPC A;  2P58 A;  1S1C X;  5KAF H;  2OYH B;  3PTZ A;  4DOJ A;  5AW0 B;  1WRG A;  1S4X A;  2A45 I;  1A02 J;  2K88 A;  3GG2 A;  1VQ5 P;  3RK3 D;  2WTY A;  1MFT A;  4U3F D;  1OZH A;  5K5G B;  4GOF A;  1AFO A;  4H13 B;  1HBW A;  1JEK A;  1RE4 C;  4R4M A;  1KOR A;  3BAS A;  1KMI Z;  1FJP A;  1CZQ A;  3B5N B;  2IFM A;  1EZV E;  1G1J A;  3M91 A;  1OFC X;  2MKV A;  1Q81 Q;  3TK1 A;  1SFC D;  1GL2 A;  4CPG A;  2WSC H;  3Q5R A;  3U1A A;  1ZN5 A;  3M9H A;  3W68 A;  5AVR B;  1VQ7 P;  1P84 I;  3CX5 E;  3G3Z A;  3GHG B;  2QJP B;  2QG4 A;  1FAV A;  2E5Y A;  2P7J A;  1RQV A;  1IFI A;  3L70 E;  5BU5 A;  3Q5P A;  3HD7 D;  1IFD A;  1QVG O;  2G3A A;  1NTM J;  3OW2 O;  3O8Z A;  1FS0 E;  2KP8 A;  1JY3 O;  3EQ2 A;  1QGK B;  5AVW B;  1PGQ A;  1N7L A;  1M8O B;  1EDK A;  5KTB A;  3VMA A;  3V5B A;  1PP9 D;  2E74 D;  2R5B A;  3MGN A;  1BSN A;  2KNC B;  3QWO C;  2FYU E;  3CCM P;  4WWI A;  1KIL D;  2W6A A;  2B9B A;  1LWU A;  3H32 B;  4D6T D;  3KDP B;  4YTP C;  1SQP J;  4XE5 B;  1SQB K;  3F5H A;  2OYI B;  3A3Y B;  1NOH A;  2WVR A;  3MTU E;  2JO1 A;  1AA0 A;  4KJM A;  1VQO P;  1EZV G;  4OGQ D;  4H0L C;  2KLV A;  4WBA A;  3UIA A;  2C0X A;  5APW A;  3VYI A;  3AEE C;  5CCG C;  2O01 J;  3Q3D A;  1K9M Q;  1SQX D;  3IFM A;  4L74 A;  5KLV D;  2RKL A;  1FZA A;  1JCC A;  2PP6 A;  1J1D C;  2K37 A;  4C7N B;  3L73 D;  1NJI Q;  3SWK A;  1X0T A;  3L70 G;  3PHL A;  2OGU A;  2FYN C;  4I6M C;  4WB4 A;  4PD4 D;  2QRX A;  1URQ D;  4LC1 A;  2CPB A;  2IBZ D;  1G2C B;  4U3F J;  2E76 C;  1KN7 A;  3EWK A;  3T97 B;  5CCH A;  1M1J B;  1NTM E;  1T6A A;  2NPS D;  3FXD A;  2FYU G;  4H44 C;  2K9J B;  2P1J A;  4PJ0 H;  1BCC D;  1N73 B;  3GW6 A;  1NAY A;  4JBZ A;  1T2K D;  3TDK A;  2O1J A;  2WPQ A;  3KQG A;  4I7Z C;  1EXJ A;  1SQP E;  1Y8A A;  1FZG A;  4DJG A;  3TF5 A;  1RE3 C;  1EXI A;  1VQ4 P;  3CCE P;  1BGY E;  3LW5 H;  3AE9 C;  3S4R A;  1H0T B;  4IFD K;  4WY4 A;  5B66 E;  1RY3 A;  2HOD A;  2M5A A;  2POH A;  3H1K J;  1GK4 A;  2E75 C;  2D2C C;  2R3S A;  2BEZ F;  2KI7 B;  2E43 A;  1WT6 A;  2KS1 A;  3HRN A;  1U57 A;  3LIE A;  4JYC A;  1YI2 P;  1EDI A;  2LR2 A;  1FZB A;  1PP9 J;  1L0L E;  2Q5U A; 
#chains in the Genus database with same CATH homology
 3RK2 D;  5CCH C;  3B8E B;  5AW6 B;  1URQ C;  2Q7C A;  2WIT A;  3E1I A;  2A45 G;  1J2J B;  1FDM A;  3HTK B;  2J59 M;  4EIJ A;  1L4A A;  2W6B A;  2ZXE B;  3L37 A;  1URQ B;  4LGD E;  2O1K A;  3V2Q A;  2BAS A;  1JMM A;  5CHX A;  2KB7 P;  3L4F A;  2NPS C;  2YO3 A;  1RF1 A;  1XTG B;  5KJ7 D;  1J1D B;  2N1T D;  5BVZ A;  2L5G B;  2NPS B;  3OJA B;  2JEE A;  3H32 A;  4W7Y A;  1JTH A;  5AW1 B;  1N7S C;  5KJ7 A;  1T2K C;  2GUS A;  4DZO A;  2WPS A;  1JY3 P;  1AQ5 A;  2N1T A;  3V4W A;  1FOS F;  3PP5 A;  1GW3 A;  4WY4 C;  1N7S B;  3B5N C;  2QM7 A;  1G1I A;  2OYH A;  2N9B A;  1HTL C;  3HUS C;  2WPR A;  1GDT A;  1T3J A;  2M3B A;  2XNX A;  2J58 A;  1JY2 N;  3EFG A;  2HOD B;  5AVV B;  1GD2 E;  1DEB A;  2HLO A;  5APU A;  1N86 A;  2FFD A;  3IR9 A;  3M9Q A;  3RL0 D;  1LWU B;  3H6P A;  3V2N A;  1FU1 A;  1SLQ A;  3GHG C;  1GZL A;  1M7L A;  4AYC A;  3CL3 D;  1IFM A;  3VP8 A;  2KYV A;  3II6 A;  1NKN A;  1E5W A;  2PAJ A;  5APV A;  3HE5 A;  5CJ4 A;  1YTZ I;  5APX A;  5APS A;  1RE4 A;  4OH8 B;  1J1E C;  1LTJ A;  1L4A C;  1GU4 A;  4ZKP A;  1VDF A;  1CW5 A;  1HUC A;  1SQQ K;  4I2L C;  1HVV A;  3RK2 C;  4N78 D;  1LT9 A;  2YKP A;  2ZFC A;  4W80 A;  1RF1 C;  1LTG C;  1J1E B;  4JYB A;  4KHX A;  1L4A B;  3CI9 A;  4C46 A;  1QL1 A;  2FYU K;  1M1J A;  3HE4 A;  3RK2 B;  1FZC A;  2Z5I A;  1FZE A;  1RF1 B;  2XZR A;  2YNY A;  4AQR D;  4M3L A;  5KJ7 C;  3GHG A;  1JY2 P;  2WSF H;  4HYT B;  1RF0 A;  1NTZ K;  5AW7 B;  2N1T C;  1S9K E;  2JJL A;  2QM8 A;  1JTH B;  4W7Z A;  2XU6 A;  1HWT C;  5APQ A;  2OYH C;  2KSJ A;  3KPE A;  2GM4 A;  1L0L K;  2HPC A;  2N1T B;  1NKZ B;  3OA7 A;  3TSI A;  2OYH B;  1MUU A;  1T3U A;  4DOJ A;  5AW0 B;  2FFD C;  1CI6 A;  2YO2 A;  1WRG A;  3M9B A;  1LGH B;  1MFZ A;  2A45 I;  1A02 J;  2W27 A;  4B86 A;  2FFD B;  3A5T A;  3LID A;  3RK3 D;  2WTY A;  2I1K A;  3RL0 C;  4HH2 A;  1T8Z A;  3P32 A;  2Q3I A;  1AFO A;  1IJD B;  1HBW A;  1KZU B;  2OYI A;  1RE4 C;  1LTT C;  1LTJ C;  1LTI C;  2WT7 A;  1NHL A;  3RL0 B;  2Z5H A;  1KFN A;  3U59 A;  3VTP C;  1KFM A;  3BAS A;  1LT9 C;  5AVX B;  1GL2 D;  1JUN A;  2HG5 D;  2H43 A;  4WY4 B;  5CCG D;  1NTM K;  1FJP A;  1CZQ A;  3N7N A;  2OAR A;  3B5N B;  3VMZ A;  2IFM A;  5AW5 B;  1M1J C;  1G1J A;  1FZC C;  1LT9 B;  3M91 A;  3V2P A;  2GUV A;  3TK1 A;  3HUS B;  1SFC D;  1GL2 A;  1GTW A;  3HTK A;  1GK6 A;  3P8C E;  2WSC H;  4GIF A;  5CCG A;  1X8Y A;  4O9B A;  1JCD A;  1FZC B;  1RF0 C;  3U1A A;  4C7N A;  3VMY A;  1ZN5 A;  3M9H A;  1QL2 A;  3V4Q A;  1NU1 K;  5AVR B;  1SFC A;  1SQP K;  3G3Z A;  3GHG B;  3NMD A;  1SQV K;  1ZR2 A;  2WZ7 A;  1FAV A;  2I1J A;  2P7J A;  1IFI A;  5BU5 A;  2E42 A;  1HGV A;  3VMX A;  1ZV8 A;  3N4X A;  2XV5 A;  3HD7 D;  1IFD A;  2HPC B;  1G2C A;  3MD0 A;  5AVU B;  2MJZ A;  4JF7 A;  3M0A A;  3O8Z A;  3M0D A;  4C7R A;  3T97 A;  3SWF A;  2KP8 A;  1JY3 O;  3NTN A;  3EQ2 A;  1L0N K;  3NFQ A;  5AVW B;  4EOT A;  1ZR4 A;  3HD7 A;  1N7L A;  5BU8 B;  3M06 A;  5KTB A;  1IO4 A;  1CI6 B;  3I5C A;  1FZF A;  2Q9I A;  3V5B A;  5APT A;  3V2R A;  3A2A A;  2R5B A;  3MGN A;  3CLQ A;  5AW4 B;  2R3C A;  2P67 A;  1EQ7 A;  5AVS B;  1IC2 A;  3VP9 A;  2P2U A;  1N73 A;  3TNU A;  2WWW A;  1DH3 A;  2OYI C;  1KIL D;  2W6A A;  3RK3 C;  1LWU A;  1N2D C;  3H32 B;  3KDP B;  1OXZ A;  1YYC A;  3VN0 A;  2C9L Y;  1VPC A;  4XE5 B;  2R32 A;  3VOP A;  1SQB K;  1XTC C;  2OYI B;  4XA4 A;  3A3Y B;  1NOH A;  2IPP A;  1LTA C;  3RK3 B;  2LKM A;  1KIL A;  3MTU E;  1Z56 A;  3R2P A;  1SVF A;  2IX7 C;  1DX7 A;  5AVY B;  4LLH A;  2KLV A;  1S9K D;  4WBA A;  3UIA A;  1GL2 C;  2C0X A;  5APW A;  3VYI A;  2XKM A;  1RE3 A;  5CCG C;  2YKQ A;  2Z4E A;  3IFM A;  1LTS C;  1H8A A;  1GL2 B;  1SFC C;  4Y99 C;  1JNM A;  1MZ9 A;  1FZA A;  1JCC A;  3L36 A;  2PP6 A;  3KYQ A;  1J1D C;  1NTK K;  4GT1 A;  3C9I A;  1SP4 A;  4C7N B;  1NAF A;  3NXS A;  1PFI A;  1SFC B;  4Y99 B;  1IFN A;  5AW9 B;  2R5D A;  3A7O A;  4I6M C;  4WB4 A;  3HE5 B;  3L35 A;  4RES B;  1FJK A;  1LTJ B;  2FKW B;  5CCH D;  2A45 H;  1URQ D;  1HH0 A;  3M0D C;  2CPB A;  4LC1 A;  1OWA A;  5CMZ A;  2IFN A;  1JY2 O;  1YTZ T;  2YKO A;  1GW4 A;  1G2C B;  3HD7 C;  4ZKU A;  5AW8 B;  2VRS A;  3SWY A;  5CCH A;  1M1J B;  1URQ A;  3HE4 B;  2NPS D;  3HD7 B;  1N73 C;  3WMM 0;  4N3Y B;  1X79 B;  1LWU C;  2P1J A;  3BAT A;  1X9V A;  1FBM A;  1KQL A;  2XDJ A;  1N73 B;  3MUD A;  2NPS A;  3TNU B;  2YMY A;  1N7S D;  3P8C D;  2HYN A;  1KIL C;  1T2K D;  1A02 F;  4IFM A;  1NH4 A;  4N6J A;  2O1J A;  2WPQ A;  3KQG A;  2KOG A;  4IFF A;  4N78 E;  1FOS E;  1HJB A;  1HGZ A;  4WY4 D;  4GKG A;  1FZG A;  3B5N D;  3BRT B;  1KIL B;  2O01 H;  1RE3 C;  1N7S A;  5AVZ B;  1H88 A;  1LTB C;  3MIW A;  3LW5 H;  1IFJ A;  3BRV B;  2HFE D;  2M8R A;  4IFD K;  4WY4 A;  3B5N A;  3TYY A;  5AW3 B;  1RY3 A;  2HOD A;  5AVQ B;  3OAK A;  3BVH A;  2WSE H;  5AW2 B;  3HUS A;  2C9N Y;  5APY A;  4AUW A;  1H89 A;  1JY3 N;  1MV8 A;  2POH A;  2H8P D;  3U1C A;  1CSB A;  1GK4 A;  1JO5 A;  2FYZ A;  3P8M C;  2E43 A;  2WT7 B;  1JOC A;  1SQX K;  1WT6 A;  2FXM A;  1NWQ A;  1NO4 A;  3HRN A;  4I1L A;  1ZLL A;  5AVT B;  1GU5 A;  3LIE A;  4JYC A;  5KLV K;  2C0W A;  1IK9 A;  1L4A D;  5CJ0 A;  2H7H A;  1FZB A;  1W2E A;  3P7K A;  2CPS A;  2Q5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...