1HGVA

Filamentous bacteriophage ph75
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
46
structure length
46
Chain Sequence
b'MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
source organism Bacteriophage ph75
molecule tags Virus
total genus 11
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hgvA00
2MJZA 1HGVA 1NH4A 2CPBA 2CPSA 1HGZA 1IFDA 2C0XA 1HH0A 1IFIA 2C0WA 1FDMA 1IFJA
chains in the Genus database with same CATH superfamily
3MUDA 4M3LA 2KZIA 1LTJB 1DEBA 1RQVA 2WZ7A 2OQQA 5KAFE 1URQD 3H32A 1JMBA 1KFNA 5AW9B 5KLVJ 1KMIZ 3PRJA 1EC5A 2QM7A 4DT0A 3H1IE 3TK1A 1KZUB 1JB0J 1ZV8A 1KYOE 1FDMA 5KLVG 4RJTA 1KB9E 1P84I 2P58A 1RY3A 3AE9C 1SQPJ 1M56D 4L73A 2WT7B 1N2DC 3L70J 3MHVA 1FOSE 1BDCA 1VQ7P 3E1RA 5APSA 3HE5A 2A45G 1P84H 4N78E 1AV1A 5KAFH 5AVRB 2K9JA 1SQPG 3EFFK 3H1HJ 2R32A 1KB9I 3JSVC 3CL3D 2ZYDA 2IZ0A 3GW6A 2J5UA 4JBZA 3L73D 3TGUD 3HRNA 1L0LK 5AVQB 5TJHA 1M90Q 2VRSA 1FZBA 4C7NB 1SQVJ 4GODA 3M0AA 5EFWB 3H1LD 2JWAA 3E1IA 4ZNCA 2Q3IA 3H1HG 1KB9H 5CCHC 3A2AA 1JY2P 1J1DC 4L74A 1OXZA 1L0ND 1PPJE 1L0NK 3V2QA 1JMMA 2JEEA 2POHA 3H6PA 1GL2B 2D2CD 2FXMA 1NTKD 1HJBA 4LGDE 1NTKK 2KS1A 3M9BA 4N3YB 1SQVG 3D71A 1EXJA 1BE3D 4YXDC 4AUWA 1WMKA 1ZP0C 2RKLA 1YI2P 2E76C 3NFQA 5GTHH 2V7QJ 1KQSO 5AW2B 2KYVA 1IFNA 1W2BO 3B5ND 3CCEP 4PV1B 1KQLA 2KNCB 5KLVE 2XNXA 1IFJA 4IL6X 2SPZA 4EIJA 4JQ0D 3UIAA 4HH2A 1JTHB 3CXHI 3L71D 2O1JA 1ZW0A 5M1BA 1M8OB 4DZOA 1AQ5A 1SQPE 3AE3C 4BXLA 4UB6E 1RHZB 3TNUA 2M8RA 1VF5C 4OGQC 1YIJP 3L70E 3CXHH 3AE6C 1HTLC 1PV3A 1VQ5P 1HUCA 1YHQP 3TSIA 3I55P 1DD3A 3L73G 2Q7CA 1DH3A 4KHXA 1VQ4P 3H1LG 3CI9A 1NU1D 1NU1K 2WQYC 2OYHA 2K9YA 1SQVE 1BDDA 2FYNC 3SWFA 3KZIE 4IL6E 2BASA 2W27A 2I8DA 5KKZB 1QL1A 1SFCC 3W67A 3FXEA 1J2JB 3M9QA 1NTMK 1LWUC 4U3FE 1BE3G 5B5EE 1RQUA 3E7KA 4PV1D 2JKVA 2CK3H 2KI7B 2E74C 2WSFJ 2N9BA 1FE6A 1J1DB 1FC2C 5KJ7C 2BCCD 3RL0C 1L4AC 3P7KA 1JEKA 3L72D 1L2PA 3KPEA 1NOHA 4WY4C 1IFIA 1Z56A 2E76B 2KK7A 1NKZB 2J58A 4ZKPA 4PD4E 3SSUA 2O3JA 4JYCA 3T97A 1PGPA 2B88A 2YO2A 1J1EC 4IL6H 3B4SA 3HD7D 2RH0A 3G4SP 1S9KE 4WY4A 4GIFA 1SP4A 3L74D 1T6AA 2P10A 1N73A 5B5EH 3O6QB 1JY2O 1SQBJ 1M1JC 2IYOA 3NXSA 2WVRA 2WITA 4PD4I 4W80A 1FOSF 1G2CB 2Q9IA 2R3CA 1XTGB 1URQA 1FJKA 2OARA 1LTTC 2OTKE 2QJKC 3RK3E 2W6JH 1N7SD 1VQ9P 1LP1A 1P84D 4Y28J 2A06E 1VF5B 4OGQB 1KD1Q 1FZCC 4PD4H 2YKPA 2E75C 2OTLP 3AEAC 3ITKA 2LXBA 4QMAA 1GU5A 1MV8A 1H0TA 2ZAEB 3VMYA 3G9RA 2I1JA 2WSCH 4HJGH 4XE5B 1FZCA 1JY3N 2WPVB 2C9NY 5BU8B 3TF5A 1NTZJ 1BCCJ 2FYNB 2WPRA 2YKQA 4EI2A 1QVGO 1PGQA 2XU6A 2BCCG 1VPCA 1X79B 3L72G 2IX7C 1LWUB 3OA7A 2QSIA 2WSEJ 2FYUJ 1YBKA 3LIDA 3KQGA 3USSA 4WBAA 3RK3C 3BVHA 1N86A 1X8YA 4HB1A 2M0BA 3RL0B 1L4AB 1BGYD 2I1KA 4DJGA 1SQQE 2PP6A 2N1TC 3L74G 2W8ZA 5APWA 3BCCD 2XKMA 1OVUA 1SQBE 1S3JA 2H88C 1HGZA 1UIIA 2WSFH 2N1TA 5AVSB 4K35A 1W5CE 1YITP 1Q2NA 2YMKA 1KILB 4Y99C 4N6JA 4OVNF 2HPCB 1M1JB 3B5NA 3CXHD 1EZVD 1IFDA 3VMAA 3AEBC 1VQ6P 2IBZD 3B71A 3H1KD 3EFGA 1FU1A 3F5HA 3AE8C 2O01N 3U59A 1SQXJ 3M0DC 2L5GB 2QJKB 3MD0A 4I7ZC 3WU2H 3WUVA 1VQKP 1FZAA 1R8EA 2E75B 1YTZT 1DEEG 1NTZE 1BCCE 3CX5I 1Y47A 1ZR2A 2IPPA 3PJSK 3Q3DA 2KP8A 3QH9A 2O1KA 3R4YA 4I6MC 1HJ0A 2LKMA 5BVZA 3RL0D 4CPGA 3CCVP 2HYNA 3AEFC 4ZKUA 1AVOA 4I2LC 2XZRA 2FYUE 1KN7A 1KORA 4ASVA 3WUUA 1LT9A 2QM8A 3CX5H 3EQ2A 2ZVOB 5BU5A 3MIWA 3KDPB 1KFMA 1BGYG 2NPSD 1LTSC 4KJMA 1Q82Q 1OFCX 2BEZF 2B9BA 3BCCG 3VMXA 2ZVNB 3RK3B 3CCRP 2H43A 3ABVC 5APQA 1KILD 1NAFA 3HE4A 3CPWO 3V6IA 2PFXA 1D7MA 5APTA 4R4MA 1OVVA 1EZVG 1K73Q 1KV4A 4H44D 2IDBA 5KAIE 2IBZG 4A7PA 4H13C 2KZJA 3H1KG 3AEGC 3IR9A 3KYQA 1KYOI 4GDOA 1SQXE 3L75D 2AEJA 4Y99B 4EOTA 3HD7A 1DIPA 1RF0A 2AXTE 3HTKA 3GMAA 1HVVA 1L0LD 2WTYA 5DJTB 3M06A 2GUVA 4H0LC 2PRRA 1FS0E 2WPQA 1KYOH 2HLOA 1R5LA 1JCDA 1CZQA 4I7ZB 1VQMP 1H88A 3MTUE 4GOEA 1N7SA 3BATA 2ITAA 3KHUA 4C7RA 2B87A 5CCGD 1S72P 5AW7B 3VN0A 3P8CD 3SWYA 5AW5B 3FX0A 1RH5B 3W68A 3H32B 1ZRTE 2AXTH 3NMDA 1JM0A 3M9HA 1Q7YQ 1T3UA 1NH4A 3VP9A 4XFJA 3CMAP 3C1LA 1S4XA 1R5SA 2W6BA 2FYZA 2HODA 2K3RA 3A0BE 3WUTA 3VOPA 1USDA 1LTAC 3L73J 3TGUJ 5H2FE 3IAOA 1K04A 5APYA 4DCKA 1QX8A 3OAKA 4C46A 3H1LJ 1YJ9P 1NJIQ 3BASA 3L75G 3HE5B 2R44A 1OMIA 2OYHC 1GU4A 2NRGA 1YYCA 2K9JB 3O8ZA 3H1HE 1QGKB 1L0NJ 3AE2C 3LW5J 2A45I 1IFMA 3TGUG 1L0LG 1PP9D 1SVFA 4H13B 3CWBD 1NTKJ 2Z5HA 5TISE 1JOCA 1SQQD 1SQQK 3VTPC 1AA0A 1BE3J 1GL2D 2ZT9C 1PL5A 1OIPA 1K9MQ 5KLIC 1FDIA 2E5YA 1S2EA 2R5BA 3Q5RA 1EDIA 1M1KQ 1SQBK 2KSJA 1T2KC 3RK2C 1L0NG 2A45H 3Q1MA 3H1JD 3CCQP 1NAYA 1RE4A 4TLFA 3PTZA 3G71P 5CJ0A 1NTMD 1NTKG 2M5AA 5AVYB 2Y0CA 4UB6H 2LXCB 5AW4B 2KS1B 1MFTA 1GDTA 4GOFA 1IJDB 2PAJA 5AVZB 4YXWH 3EWKA 1Q86Q 2Y0DA 4BWNA 3CX5D 3L71J 4IFMA 2R5DA 3L37A 3PHLA 2OYIA 2IZ1A 1NHLA 1DD4A 3C9IA 1NWQA 1N73C 4BRYA 3VYIA 3KZIH 1IK7A 1GW3A 1PGOA 3L71G 3OJAB 1NTZK 2OGUA 3A7OA 1PZQA 2CPSA 1NYHA 1IO4A 1OW7A 1CI6A 2JR8A 5E79E 1URQC 2JWDA 3L73E 3TGUE 1NU1J 2FFDA 4D6TD 3TNUB 1YJWP 2YXRB 2FYUK 2IFNA 3H1LE 3CCSP 2V7QH 2NPSA 2KLUA 1FJPA 1PP9G 2IYPA 3HUSA 1PGJA 3CWBG 1KQFB 1PIXA 2YMYA 3B8EB 3U1AA 2RMZA 1NU1G 1HH0A 1Y8AA 5CBOA 2V4HA 1NTKE 1OVRA 3V4QA 1S1CX 5AW8B 1BE3E 1KILA 3D6YA 2HPCA 1OWAA 2OYHB 2GA1A 3H1JG 1FZGA 2W83C 1YQ4C 2BCCJ 3H1ID 1NTMG 5CCHD 2JDIH 3L72J 4W7YA 1SS1A 1KYOD 2ZT9B 1KB9D 3IF4A 2QJYC 5KLIB 2Y9YA 1HF9A 2E76D 2KB7P 1RE3A 4PJ0E 1SFCB 4JPZB 3S1KA 3PH0A 5APUA 3CD6P 4OH8B 4HYTB 4N78D 4ASWA 4EDFA 3L74J 1EDLA 4NPDA 4JYBA 1VQNP 4GT1A 4JF7A 1SQXK 2E74B 5B66E 4L76A 1RF1A 2D2CC 2KUBA 4Z1MH 3WMM0 3GHGA 3T97B 4RKUJ 3JCUE 4HKZH 2KOGA 1LTJA 4WY4B 1QL2A 2QRXA 1ZXGA 4YTPC 2H89C 2KIKA 1N73B 1PPJD 3B5NC 1U57A 4D6TG 1W2EA 1J1EB 5CCGA 1VF5D 4OGQD 2JO1A 3A5TA 2ZXEB 2Z5IA 2RN0A 2ZYAA 4UB8E 3Q5SA 3F89A 2QIWA 1URQB 2Y9ZA 5KTBA 1AQTA 1LP1B 3CCJP 4B86A 3GF7A 1MFZA 3SWKA 5KLVD 3II6A 5KLVK 1TU3F 2JJLA 3IFMA 2C9LY 3H1IG 2WT7A 1QEXA 4IOIH 3AE7C 5GTIE 1VQPP 1U7JA 2YNYA 2BCCE 1H0TB 2Q5UA 3U1CA 1SFCD 2H8PD 2WPSA 3L72E 1FZCB 3N4XA 2J59M 1GK6A 3TDKA 3BRTB 1LT9C 1SQPD 1VQOP 1SQPK 2E74D 3CMEP 2G3AA 4UB8H 1K8AQ 1BGYJ 3LIEA 4C7NA 3L70D 5KJ7D 2K1AA 5L8RJ 1L4AD 5AVTB 3V2NA 2QJYB 3BCCJ 3L74E 4WY4D 1VDFA 3H1HD 1M7LA 4KT0J 1GL2A 4RO0A 3QWOC 4DOJA 2PGDA 5C39A 3Q2YA 1WRGA 4PV1C 5GTIH 3A3YB 5AVVB 1SQVD 1SQVK 2QEXP 4NPFX 3R2PA 5APVA 3C8VA 3AE1C 1PPJG 2D2CB 2R3SA 1P84E 3V2PA 3KXDA 4U3FD 3H1KJ 2KNCA 1MKMA 5AVUB 2N1TB 2YKOA 1X22A 5AVWB 3JC22 4WWIA 2WSEH 1YTZI 1QVFO 2G8YA 1JY2N 3HD7C 2DW3A 1KTMA 3B5NB 1JTHA 1IK9A 1RF0C 2Z4EA 1E5WA 1VL2A 2E75D 1USEA 3S9OA 2MJZA 2HR3A 2P7JA 5AW1B 3RL0g 4PD4D 1FBMA 1GTWA 1S9KD 1IZNB 3IN6A 5GTHE 2YXQB 1N7SC 3L36A 5KKZC 3I56P 3GF3A 1JY3O 3L70G 2W6AA 1BGYE 1H8AA 5KAIH 1A02J 2MKVA 4MN4C 4K3AA 3BCCE 2KLVA 1LT9B 1MZ9A 2E43A 4AQRD 3RK3D 4U3FJ 3L4FA 2A06D 3P8MC 2GM4A 1LTBC 3D70A 5CCHA 2N1TD 3H25A 1LGHB 3V5BA 3CXHE 1WT6A 1S5LX 2QA4P 1EZVE 1MUUA 4U3FG 2JP3A 3CLQA 1HBWA 2IBZE 3HE4B 5K5GB 4IFFA 3H1KE 2QG4A 2GUSA 1T8ZA 3L75J 4O9BA 1NKNA 3MP7B 1Q90D 4XA4A 4IFDK 1CSBA 3AEEC 1OW8A 1L0LJ 2AEFA 4EYYQ 1LJ2A 5DJUB 1EZVI 2N9YB 2WSCJ 3O6QA 2IBZI 2ZYGA 3CCUP 1HGVA 2C0XA 3HD7B 4LC1A 3CC7P 1JNMA 2FXOA 3HTKB 1RE4C 1G2CA 1IFPA 2XNDH 3A0HE 5AW0B 2NZ2A 2P67A 3OW2O 2E5TA 3GLMA 5APXA 2ZFCA 1SQBD 3AECC 1OX3A 1S5LE 2Y0EA 1VQLP 3A0BH 1Y9BA 1X9VA 1ZR4A 2YO3A 2FY8A 1G1IA 1X0TA 5H2FH 1JO5A 4I1LA 2YIUC 4H0LB 2HFED 2Q1KA 1N7SB 1ZN5A 1CW5A 1EDKA 3FWNA 3K5BA 2OYIC 2B87B 1KILE 2WWWA 2A06G 1GD2E 4WVZA 3VP8A 2P2UA 2C0WA 5TISH 4L75A 1SFCA 1EXIA 3NTNA 3CC2P 3CCMP 3A0HH 1LWUA 2M3EA 3BRVB 3M91A 1ZLLA 1VQ8P 1S5LH 3SFDC 2FFDC 1YJNP 1NTZD 1BCCD 2LR2A 1FZEA 2HODB 2Q3EA 3L75E 3V4WA 5KJ7A 3Q5PA 1L4AA 2NPSC 1PFIA 1PP9J 2KXPB 1GW4A 3CWBJ 2ZJSE 1SQQJ 1L0LE 1AVYA 3HUSC 1GK4A 4H13D 1ZMEC 2FYUD 2FKWB 1GZLA 1EDJA 1KILC 2B89A 1XTCC 3H1JJ 3SFEC 2HG5D 1NTMJ 2O01J 1L0NE 4GKGA 3CC4P 1LT1A 1SQQG 1BSHA 3D6ZA 1H89A 4LLHA 2AEMA 1M1JA 1NVOA 1SQBG 4H44C 4H0LD 3P8CE 2FXPA 1NGMB 1SLQA 1E79H 3AEDC 2H7HA 1RE3C 2FBWC 1T3JA 2ZXXA 5E79H 1HWTC 2WSSH 2M5AB 2IFMA 2QJPC 2XDJA 2Q6QA 3GG2A 3RK2B 4YPCA 1RF1C 3S4RA 3AE4C 1N8RQ 3GHGC 4U7JA 3L71E 3LW5H 3ZDMA 2YIUB 1EQ7A 1LTJC 1K05A 3MZWB 1SQXD 1N7LA 2OYIB 2KSEA 1AJYA 2M3BA 1DX7A 3V2RA 4BRYB 2K88A 4D6TJ 1OW6A 3CCLP 1NTZG 1BCCG 1FZFA 5CCGC 1GMJA 4RESB 1PP9E 3RBXA 1CI6B 3CWBE 1JY3P 1UIXA 5CBNA 1KQGB 2FYUG 4OWFA 1NU1E 2BEQD 1AFOA 4TT3H 4PJ0H 2FFDB 2XV5A 3WU2E 1ZOYC 3FGAD 2OTJP 1QLED 1Q81Q 3H1IJ 2NPSB 4ZMDA 3I5CA 3H1JE 2WMMA 5CMZA 5AW6B 2K37A 1NTME 3HUSB 5B66H 1JUNA 3PLNA 4AYCA 4WB4A 2AXCA 1ZRTD 3P32A 1KC8Q 3TYYA 2ZT9D 2P1JA 5AVXB 3JCUH 4R4LA 3PP5A 2QVAA 1OZHA 2E42A 5CJ4A 2L91A 1T2KD 2OYOA 3RK2D 3CX5E 3L35A 3MGNA 2CPBA 1FAVA 1IC2A 1LTIC 4H44B 4NPEA 1NO4A 2W90A 3N7NA 4W7ZA 1A02F 3G3ZA 2QE7H 3FXDA 3RGUA 1JCCA 1GL2C 1G1JA 1FDOA 1U7MA 1YQ3C 1LNQA 3M0DA 5AW3B 1SQXG 2O01H 3MUDC 5CHXA 2QJPB 3FWLA 1BSNA 3VMZA 1RF1B 1LTGC 1M57D 2UWJE 3AE5C 3G6EP 3RBZA 4D6TE 3GHGB
chains in the Genus database with same CATH topology
3LIDA 3KQGA 3MUDA 4M3LA 5CCHA 1LTJB 3L37A 2N1TD 4WBAA 2OYIA 1LGHB 3RK3C 1NHLA 3BVHA 3C9IA 3V5BA 1N86A 1X8YA 1NWQA 1WT6A 1DEBA 1N73C 2WZ7A 3RL0B 1MUUA 3VYIA 1L4AB 1URQD 1GW3A 3CLQA 3H32A 2I1KA 1HBWA 1KFNA 3HE4B 5AW9B 2PP6A 4IFFA 2N1TC 3OJAB 1NTZK 2GUSA 1T8ZA 4O9BA 3A7OA 1NKNA 5APWA 2CPSA 4XA4A 1IO4A 4IFDK 2XKMA 1CI6A 1URQC 2QM7A 1CSBA 3TK1A 1HGZA 1KZUB 1ZV8A 2WSFH 2N1TA 2FFDA 5AVSB 3TNUB 1FDMA 2FYUK 2IFNA 1RY3A 2NPSA 1KILB 4Y99C 4N6JA 1FJPA 2HPCB 1M1JB 3B5NA 1HGVA 2C0XA 1IFDA 3HUSA 3HD7B 2WT7B 1N2DC 4LC1A 2YMYA 1JNMA 1FOSE 3B8EB 3U1AA 3HTKB 1HH0A 1RE4C 1G2CA 5APSA 3HE5A 2A45G 4N78E 3EFGA 3V4QA 5AW8B 1FU1A 1KILA 3U59A 5AVRB 5AW0B 2HPCA 1OWAA 2OYHB 2P67A 3M0DC 5APXA 2L5GB 2R32A 2ZFCA 3CL3D 1FZGA 3MD0A 5CCHD 3HRNA 1X9VA 1L0LK 4W7YA 1ZR4A 5AVQB 2YO3A 2VRSA 1FZAA 1G1IA 1FZBA 1YTZT 4C7NB 3M0AA 1JO5A 4I1LA 3E1IA 1ZR2A 2HFED 2Q3IA 1N7SB 2IPPA 1ZN5A 1CW5A 2KP8A 5CCHC 3A2AA 2O1KA 1JY2P 2OYIC 1J1DC 2KB7P 1RE3A 2WWWA 1OXZA 1SFCB 1L0NK 4I6MC 3V2QA 1JMMA 2JEEA 1GD2E 2POHA 3H6PA 1GL2B 2LKMA 2FXMA 5BVZA 3VP8A 5APUA 3RL0D 2HYNA 4OH8B 1HJBA 4ZKUA 4LGDE 1NTKK 4HYTB 3M9BA 4N3YB 4I2LC 4N78D 2P2UA 2XZRA 1LT9A 2C0WA 2QM8A 4AUWA 3EQ2A 4JYBA 4GT1A 4JF7A 1SQXK 5BU5A 3MIWA 1SFCA 3NFQA 1RF1A 3NTNA 3KDPB 1KFMA 1LWUA 5AW2B 3WMM0 2KYVA 2NPSD 3BRVB 3M91A 3GHGA 1LTSC 1IFNA 1ZLLA 3B5ND 2KOGA 1KQLA 1LTJA 2FFDC 2XNXA 3VMXA 4WY4B 1IFJA 1FZEA 3RK3B 2HODB 1QL2A 4EIJA 3V4WA 2H43A 5KJ7A 1L4AA 2NPSC 5APQA 1PFIA 1N73B 1KILD 1NAFA 1GW4A 3UIAA 3B5NC 3HE4A 1W2EA 3HUSC 1J1EB 4HH2A 1JTHB 5CCGA 1GK4A 2O1JA 2FKWB 3A5TA 2ZXEB 1GZLA 2Z5IA 4DZOA 5APTA 1KILC 1AQ5A 1XTCC 1URQB 5KTBA 2HG5D 4GKGA 3TNUA 2M8RA 4B86A 1MFZA 3IR9A 1HTLC 1H89A 1HUCA 3II6A 4LLHA 5KLVK 2JJLA 3KYQA 3TSIA 3IFMA 1M1JA 2C9LY 4Y99B 4EOTA 3HD7A 2WT7A 3P8CE 1RF0A 2Q7CA 3HTKA 1SLQA 2YNYA 4KHXA 1DH3A 2H7HA 1RE3C 1HVVA 2Q5UA 3U1CA 1SFCD 2H8PD 2WPSA 2WTYA 1FZCB 1T3JA 3CI9A 3N4XA 1NU1K 1HWTC 2OYHA 2J59M 3M06A 1GK6A 2GUVA 2WPQA 2IFMA 3SWFA 3BRTB 1LT9C 2HLOA 2BASA 1SQPK 2W27A 2XDJA 1JCDA 1CZQA 3RK2B 1QL1A 1SFCC 1RF1C 1J2JB 3M9QA 1NTMK 3LIEA 4C7NA 1LWUC 5KJ7D 1H88A 1L4AD 3GHGC 3MTUE 5AVTB 3V2NA 3LW5H 1N7SA 1EQ7A 3BATA 1LTJC 4C7RA 4WY4D 2N9BA 1VDFA 5CCGD 5AW7B 1N7LA 3VN0A 1M7LA 1J1DB 2OYIB 3P8CD 3SWYA 1GL2A 5AW5B 5KJ7C 4DOJA 2M3BA 3RL0C 1DX7A 1L4AC 3V2RA 3P7KA 1WRGA 3KPEA 3H32B 1NOHA 3NMDA 3A3YB 5AVVB 4WY4C 1IFIA 1SQVK 1FZFA 5CCGC 1Z56A 3M9HA 1NKZB 3R2PA 5APVA 4RESB 2J58A 4ZKPA 1T3UA 1NH4A 3VP9A 3T97A 4JYCA 3V2PA 1CI6B 2YO2A 1JY3P 1J1EC 3HD7D 2W6BA 1S9KE 4WY4A 5AVUB 1AFOA 2N1TB 2FFDB 2FYZA 2HODA 4GIFA 2YKOA 2XV5A 1SP4A 5AVWB 1N73A 1JY2O 3VOPA 2NPSB 1LTAC 2WSEH 1M1JC 1YTZI 3I5CA 3NXSA 1JY2N 3HD7C 3B5NB 5CMZA 1JTHA 1IK9A 5AW6B 5APYA 1RF0C 2WITA 3HUSB 1JUNA 2Z4EA 1E5WA 4AYCA 3OAKA 4C46A 4WB4A 4W80A 3P32A 1FOSF 1G2CB 3BASA 3TYYA 2Q9IA 3HE5B 2R3CA 2P1JA 2MJZA 2OYHC 5AVXB 1XTGB 1URQA 1GU4A 1FJKA 1YYCA 2OARA 3O8ZA 1LTTC 2P7JA 3PP5A 5AW1B 1N7SD 2A45I 1IFMA 2E42A 5CJ4A 1SVFA 1T2KD 3RK2D 1FBMA 2Z5HA 1GTWA 1FZCC 1JOCA 3L35A 1SQQK 3MGNA 3VTPC 1S9KD 2YKPA 1GL2D 2CPBA 1FAVA 1IC2A 2R5BA 1N7SC 1LTIC 1NO4A 3L36A 1GU5A 3N7NA 1MV8A 1SQBK 2KSJA 1T2KC 3RK2C 4W7ZA 3VMYA 2A45H 1A02F 1JY3O 3G3ZA 2I1JA 2WSCH 1RE4A 4XE5B 1FZCA 1JCCA 2W6AA 1GL2C 5CJ0A 1JY3N 2C9NY 1G1JA 5BU8B 1H8AA 5AVYB 1A02J 3M0DA 5AW3B 5AW4B 2O01H 5CHXA 2WPRA 1GDTA 2KLVA 2YKQA 1LT9B 1MZ9A 2E43A 2XU6A 4AQRD 3RK3D 1IJDB 3VMZA 2PAJA 5AVZB 1RF1B 1VPCA 1X79B 1LTGC 3L4FA 2IX7C 1LWUB 3P8MC 2GM4A 3OA7A 4IFMA 3GHGB 2R5DA 1LTBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  1HGV A;  1NH4 A;  2CPB A;  2CPS A;  1HGZ A;  1IFD A;  2C0X A;  1HH0 A;  1IFI A;  2C0W A;  1FDM A;  1IFJ A; 
#chains in the Genus database with same CATH topology
 3MUD A;  4M3L A;  2KZI A;  1LTJ B;  1DEB A;  1RQV A;  2WZ7 A;  2OQQ A;  5KAF E;  1URQ D;  3H32 A;  1JMB A;  1KFN A;  5AW9 B;  5KLV J;  1KMI Z;  3PRJ A;  1EC5 A;  2QM7 A;  4DT0 A;  3H1I E;  3TK1 A;  1KZU B;  1JB0 J;  1ZV8 A;  1KYO E;  1FDM A;  5KLV G;  4RJT A;  1KB9 E;  1P84 I;  2P58 A;  1RY3 A;  3AE9 C;  1SQP J;  1M56 D;  4L73 A;  2WT7 B;  1N2D C;  3L70 J;  3MHV A;  1FOS E;  1BDC A;  1VQ7 P;  3E1R A;  5APS A;  3HE5 A;  2A45 G;  1P84 H;  4N78 E;  1AV1 A;  5KAF H;  5AVR B;  2K9J A;  1SQP G;  3EFF K;  3H1H J;  2R32 A;  1KB9 I;  3JSV C;  3CL3 D;  2ZYD A;  2IZ0 A;  3GW6 A;  2J5U A;  4JBZ A;  3L73 D;  3TGU D;  3HRN A;  1L0L K;  5AVQ B;  5TJH A;  1M90 Q;  2VRS A;  1FZB A;  4C7N B;  1SQV J;  4GOD A;  3M0A A;  5EFW B;  3H1L D;  2JWA A;  3E1I A;  4ZNC A;  2Q3I A;  3H1H G;  1KB9 H;  5CCH C;  3A2A A;  1JY2 P;  1J1D C;  4L74 A;  1OXZ A;  1L0N D;  1PPJ E;  1L0N K;  3V2Q A;  1JMM A;  2JEE A;  2POH A;  3H6P A;  1GL2 B;  2D2C D;  2FXM A;  1NTK D;  1HJB A;  4LGD E;  1NTK K;  2KS1 A;  3M9B A;  4N3Y B;  1SQV G;  3D71 A;  1EXJ A;  1BE3 D;  4YXD C;  4AUW A;  1WMK A;  1ZP0 C;  2RKL A;  1YI2 P;  2E76 C;  3NFQ A;  5GTH H;  2V7Q J;  1KQS O;  5AW2 B;  2KYV A;  1IFN A;  1W2B O;  3B5N D;  3CCE P;  4PV1 B;  1KQL A;  2KNC B;  5KLV E;  2XNX A;  1IFJ A;  4IL6 X;  2SPZ A;  4EIJ A;  4JQ0 D;  3UIA A;  4HH2 A;  1JTH B;  3CXH I;  3L71 D;  2O1J A;  1ZW0 A;  5M1B A;  1M8O B;  4DZO A;  1AQ5 A;  1SQP E;  3AE3 C;  4BXL A;  4UB6 E;  1RHZ B;  3TNU A;  2M8R A;  1VF5 C;  4OGQ C;  1YIJ P;  3L70 E;  3CXH H;  3AE6 C;  1HTL C;  1PV3 A;  1VQ5 P;  1HUC A;  1YHQ P;  3TSI A;  3I55 P;  1DD3 A;  3L73 G;  2Q7C A;  1DH3 A;  4KHX A;  1VQ4 P;  3H1L G;  3CI9 A;  1NU1 D;  1NU1 K;  2WQY C;  2OYH A;  2K9Y A;  1SQV E;  1BDD A;  2FYN C;  3SWF A;  3KZI E;  4IL6 E;  2BAS A;  2W27 A;  2I8D A;  5KKZ B;  1QL1 A;  1SFC C;  3W67 A;  3FXE A;  1J2J B;  3M9Q A;  1NTM K;  1LWU C;  4U3F E;  1BE3 G;  5B5E E;  1RQU A;  3E7K A;  4PV1 D;  2JKV A;  2CK3 H;  2KI7 B;  2E74 C;  2WSF J;  2N9B A;  1FE6 A;  1J1D B;  1FC2 C;  5KJ7 C;  2BCC D;  3RL0 C;  1L4A C;  3P7K A;  1JEK A;  3L72 D;  1L2P A;  3KPE A;  1NOH A;  4WY4 C;  1IFI A;  1Z56 A;  2E76 B;  2KK7 A;  1NKZ B;  2J58 A;  4ZKP A;  4PD4 E;  3SSU A;  2O3J A;  4JYC A;  3T97 A;  1PGP A;  2B88 A;  2YO2 A;  1J1E C;  4IL6 H;  3B4S A;  3HD7 D;  2RH0 A;  3G4S P;  1S9K E;  4WY4 A;  4GIF A;  1SP4 A;  3L74 D;  1T6A A;  2P10 A;  1N73 A;  5B5E H;  3O6Q B;  1JY2 O;  1SQB J;  1M1J C;  2IYO A;  3NXS A;  2WVR A;  2WIT A;  4PD4 I;  4W80 A;  1FOS F;  1G2C B;  2Q9I A;  2R3C A;  1XTG B;  1URQ A;  1FJK A;  2OAR A;  1LTT C;  2OTK E;  2QJK C;  3RK3 E;  2W6J H;  1N7S D;  1VQ9 P;  1LP1 A;  1P84 D;  4Y28 J;  2A06 E;  1VF5 B;  4OGQ B;  1KD1 Q;  1FZC C;  4PD4 H;  2YKP A;  2E75 C;  2OTL P;  3AEA C;  3ITK A;  2LXB A;  4QMA A;  1GU5 A;  1MV8 A;  1H0T A;  2ZAE B;  3VMY A;  3G9R A;  2I1J A;  2WSC H;  4HJG H;  4XE5 B;  1FZC A;  1JY3 N;  2WPV B;  2C9N Y;  5BU8 B;  3TF5 A;  1NTZ J;  1BCC J;  2FYN B;  2WPR A;  2YKQ A;  4EI2 A;  1QVG O;  1PGQ A;  2XU6 A;  2BCC G;  1VPC A;  1X79 B;  3L72 G;  2IX7 C;  1LWU B;  3OA7 A;  2QSI A;  2WSE J;  2FYU J;  1YBK A;  3LID A;  3KQG A;  3USS A;  4WBA A;  3RK3 C;  3BVH A;  1N86 A;  1X8Y A;  4HB1 A;  2M0B A;  3RL0 B;  1L4A B;  1BGY D;  2I1K A;  4DJG A;  1SQQ E;  2PP6 A;  2N1T C;  3L74 G;  2W8Z A;  5APW A;  3BCC D;  2XKM A;  1OVU A;  1SQB E;  1S3J A;  2H88 C;  1HGZ A;  1UII A;  2WSF H;  2N1T A;  5AVS B;  4K35 A;  1W5C E;  1YIT P;  1Q2N A;  2YMK A;  1KIL B;  4Y99 C;  4N6J A;  4OVN F;  2HPC B;  1M1J B;  3B5N A;  3CXH D;  1EZV D;  1IFD A;  3VMA A;  3AEB C;  1VQ6 P;  2IBZ D;  3B71 A;  3H1K D;  3EFG A;  1FU1 A;  3F5H A;  3AE8 C;  2O01 N;  3U59 A;  1SQX J;  3M0D C;  2L5G B;  2QJK B;  3MD0 A;  4I7Z C;  3WU2 H;  3WUV A;  1VQK P;  1FZA A;  1R8E A;  2E75 B;  1YTZ T;  1DEE G;  1NTZ E;  1BCC E;  3CX5 I;  1Y47 A;  1ZR2 A;  2IPP A;  3PJS K;  3Q3D A;  2KP8 A;  3QH9 A;  2O1K A;  3R4Y A;  4I6M C;  1HJ0 A;  2LKM A;  5BVZ A;  3RL0 D;  4CPG A;  3CCV P;  2HYN A;  3AEF C;  4ZKU A;  1AVO A;  4I2L C;  2XZR A;  2FYU E;  1KN7 A;  1KOR A;  4ASV A;  3WUU A;  1LT9 A;  2QM8 A;  3CX5 H;  3EQ2 A;  2ZVO B;  5BU5 A;  3MIW A;  3KDP B;  1KFM A;  1BGY G;  2NPS D;  1LTS C;  4KJM A;  1Q82 Q;  1OFC X;  2BEZ F;  2B9B A;  3BCC G;  3VMX A;  2ZVN B;  3RK3 B;  3CCR P;  2H43 A;  3ABV C;  5APQ A;  1KIL D;  1NAF A;  3HE4 A;  3CPW O;  3V6I A;  2PFX A;  1D7M A;  5APT A;  4R4M A;  1OVV A;  1EZV G;  1K73 Q;  1KV4 A;  4H44 D;  2IDB A;  5KAI E;  2IBZ G;  4A7P A;  4H13 C;  2KZJ A;  3H1K G;  3AEG C;  3IR9 A;  3KYQ A;  1KYO I;  4GDO A;  1SQX E;  3L75 D;  2AEJ A;  4Y99 B;  4EOT A;  3HD7 A;  1DIP A;  1RF0 A;  2AXT E;  3HTK A;  3GMA A;  1HVV A;  1L0L D;  2WTY A;  5DJT B;  3M06 A;  2GUV A;  4H0L C;  2PRR A;  1FS0 E;  2WPQ A;  1KYO H;  2HLO A;  1R5L A;  1JCD A;  1CZQ A;  4I7Z B;  1VQM P;  1H88 A;  3MTU E;  4GOE A;  1N7S A;  3BAT A;  2ITA A;  3KHU A;  4C7R A;  2B87 A;  5CCG D;  1S72 P;  5AW7 B;  3VN0 A;  3P8C D;  3SWY A;  5AW5 B;  3FX0 A;  1RH5 B;  3W68 A;  3H32 B;  1ZRT E;  2AXT H;  3NMD A;  1JM0 A;  3M9H A;  1Q7Y Q;  1T3U A;  1NH4 A;  3VP9 A;  4XFJ A;  3CMA P;  3C1L A;  1S4X A;  1R5S A;  2W6B A;  2FYZ A;  2HOD A;  2K3R A;  3A0B E;  3WUT A;  3VOP A;  1USD A;  1LTA C;  3L73 J;  3TGU J;  5H2F E;  3IAO A;  1K04 A;  5APY A;  4DCK A;  1QX8 A;  3OAK A;  4C46 A;  3H1L J;  1YJ9 P;  1NJI Q;  3BAS A;  3L75 G;  3HE5 B;  2R44 A;  1OMI A;  2OYH C;  1GU4 A;  2NRG A;  1YYC A;  2K9J B;  3O8Z A;  3H1H E;  1QGK B;  1L0N J;  3AE2 C;  3LW5 J;  2A45 I;  1IFM A;  3TGU G;  1L0L G;  1PP9 D;  1SVF A;  4H13 B;  3CWB D;  1NTK J;  2Z5H A;  5TIS E;  1JOC A;  1SQQ D;  1SQQ K;  3VTP C;  1AA0 A;  1BE3 J;  1GL2 D;  2ZT9 C;  1PL5 A;  1OIP A;  1K9M Q;  5KLI C;  1FDI A;  2E5Y A;  1S2E A;  2R5B A;  3Q5R A;  1EDI A;  1M1K Q;  1SQB K;  2KSJ A;  1T2K C;  3RK2 C;  1L0N G;  2A45 H;  3Q1M A;  3H1J D;  3CCQ P;  1NAY A;  1RE4 A;  4TLF A;  3PTZ A;  3G71 P;  5CJ0 A;  1NTM D;  1NTK G;  2M5A A;  5AVY B;  2Y0C A;  4UB6 H;  2LXC B;  5AW4 B;  2KS1 B;  1MFT A;  1GDT A;  4GOF A;  1IJD B;  2PAJ A;  5AVZ B;  4YXW H;  3EWK A;  1Q86 Q;  2Y0D A;  4BWN A;  3CX5 D;  3L71 J;  4IFM A;  2R5D A;  3L37 A;  3PHL A;  2OYI A;  2IZ1 A;  1NHL A;  1DD4 A;  3C9I A;  1NWQ A;  1N73 C;  4BRY A;  3VYI A;  3KZI H;  1IK7 A;  1GW3 A;  1PGO A;  3L71 G;  3OJA B;  1NTZ K;  2OGU A;  3A7O A;  1PZQ A;  2CPS A;  1NYH A;  1IO4 A;  1OW7 A;  1CI6 A;  2JR8 A;  5E79 E;  1URQ C;  2JWD A;  3L73 E;  3TGU E;  1NU1 J;  2FFD A;  4D6T D;  3TNU B;  1YJW P;  2YXR B;  2FYU K;  2IFN A;  3H1L E;  3CCS P;  2V7Q H;  2NPS A;  2KLU A;  1FJP A;  1PP9 G;  2IYP A;  3HUS A;  1PGJ A;  3CWB G;  1KQF B;  1PIX A;  2YMY A;  3B8E B;  3U1A A;  2RMZ A;  1NU1 G;  1HH0 A;  1Y8A A;  5CBO A;  2V4H A;  1NTK E;  1OVR A;  3V4Q A;  1S1C X;  5AW8 B;  1BE3 E;  1KIL A;  3D6Y A;  2HPC A;  1OWA A;  2OYH B;  2GA1 A;  3H1J G;  1FZG A;  2W83 C;  1YQ4 C;  2BCC J;  3H1I D;  1NTM G;  5CCH D;  2JDI H;  3L72 J;  4W7Y A;  1SS1 A;  1KYO D;  2ZT9 B;  1KB9 D;  3IF4 A;  2QJY C;  5KLI B;  2Y9Y A;  1HF9 A;  2E76 D;  2KB7 P;  1RE3 A;  4PJ0 E;  1SFC B;  4JPZ B;  3S1K A;  3PH0 A;  5APU A;  3CD6 P;  4OH8 B;  4HYT B;  4N78 D;  4ASW A;  4EDF A;  3L74 J;  1EDL A;  4NPD A;  4JYB A;  1VQN P;  4GT1 A;  4JF7 A;  1SQX K;  2E74 B;  5B66 E;  4L76 A;  1RF1 A;  2D2C C;  2KUB A;  4Z1M H;  3WMM 0;  3GHG A;  3T97 B;  4RKU J;  3JCU E;  4HKZ H;  2KOG A;  1LTJ A;  4WY4 B;  1QL2 A;  2QRX A;  1ZXG A;  4YTP C;  2H89 C;  2KIK A;  1N73 B;  1PPJ D;  3B5N C;  1U57 A;  4D6T G;  1W2E A;  1J1E B;  5CCG A;  1VF5 D;  4OGQ D;  2JO1 A;  3A5T A;  2ZXE B;  2Z5I A;  2RN0 A;  2ZYA A;  4UB8 E;  3Q5S A;  3F89 A;  2QIW A;  1URQ B;  2Y9Z A;  5KTB A;  1AQT A;  1LP1 B;  3CCJ P;  4B86 A;  3GF7 A;  1MFZ A;  3SWK A;  5KLV D;  3II6 A;  5KLV K;  1TU3 F;  2JJL A;  3IFM A;  2C9L Y;  3H1I G;  2WT7 A;  1QEX A;  4IOI H;  3AE7 C;  5GTI E;  1VQP P;  1U7J A;  2YNY A;  2BCC E;  1H0T B;  2Q5U A;  3U1C A;  1SFC D;  2H8P D;  2WPS A;  3L72 E;  1FZC B;  3N4X A;  2J59 M;  1GK6 A;  3TDK A;  3BRT B;  1LT9 C;  1SQP D;  1VQO P;  1SQP K;  2E74 D;  3CME P;  2G3A A;  4UB8 H;  1K8A Q;  1BGY J;  3LIE A;  4C7N A;  3L70 D;  5KJ7 D;  2K1A A;  5L8R J;  1L4A D;  5AVT B;  3V2N A;  2QJY B;  3BCC J;  3L74 E;  4WY4 D;  1VDF A;  3H1H D;  1M7L A;  4KT0 J;  1GL2 A;  4RO0 A;  3QWO C;  4DOJ A;  2PGD A;  5C39 A;  3Q2Y A;  1WRG A;  4PV1 C;  5GTI H;  3A3Y B;  5AVV B;  1SQV D;  1SQV K;  2QEX P;  4NPF X;  3R2P A;  5APV A;  3C8V A;  3AE1 C;  1PPJ G;  2D2C B;  2R3S A;  1P84 E;  3V2P A;  3KXD A;  4U3F D;  3H1K J;  2KNC A;  1MKM A;  5AVU B;  2N1T B;  2YKO A;  1X22 A;  5AVW B;  3JC2 2;  4WWI A;  2WSE H;  1YTZ I;  1QVF O;  2G8Y A;  1JY2 N;  3HD7 C;  2DW3 A;  1KTM A;  3B5N B;  1JTH A;  1IK9 A;  1RF0 C;  2Z4E A;  1E5W A;  1VL2 A;  2E75 D;  1USE A;  3S9O A;  2MJZ A;  2HR3 A;  2P7J A;  5AW1 B;  3RL0 g;  4PD4 D;  1FBM A;  1GTW A;  1S9K D;  1IZN B;  3IN6 A;  5GTH E;  2YXQ B;  1N7S C;  3L36 A;  5KKZ C;  3I56 P;  3GF3 A;  1JY3 O;  3L70 G;  2W6A A;  1BGY E;  1H8A A;  5KAI H;  1A02 J;  2MKV A;  4MN4 C;  4K3A A;  3BCC E;  2KLV A;  1LT9 B;  1MZ9 A;  2E43 A;  4AQR D;  3RK3 D;  4U3F J;  3L4F A;  2A06 D;  3P8M C;  2GM4 A;  1LTB C;  3D70 A;  5CCH A;  2N1T D;  3H25 A;  1LGH B;  3V5B A;  3CXH E;  1WT6 A;  1S5L X;  2QA4 P;  1EZV E;  1MUU A;  4U3F G;  2JP3 A;  3CLQ A;  1HBW A;  2IBZ E;  3HE4 B;  5K5G B;  4IFF A;  3H1K E;  2QG4 A;  2GUS A;  1T8Z A;  3L75 J;  4O9B A;  1NKN A;  3MP7 B;  1Q90 D;  4XA4 A;  4IFD K;  1CSB A;  3AEE C;  1OW8 A;  1L0L J;  2AEF A;  4EYY Q;  1LJ2 A;  5DJU B;  1EZV I;  2N9Y B;  2WSC J;  3O6Q A;  2IBZ I;  2ZYG A;  3CCU P;  1HGV A;  2C0X A;  3HD7 B;  4LC1 A;  3CC7 P;  1JNM A;  2FXO A;  3HTK B;  1RE4 C;  1G2C A;  1IFP A;  2XND H;  3A0H E;  5AW0 B;  2NZ2 A;  2P67 A;  3OW2 O;  2E5T A;  3GLM A;  5APX A;  2ZFC A;  1SQB D;  3AEC C;  1OX3 A;  1S5L E;  2Y0E A;  1VQL P;  3A0B H;  1Y9B A;  1X9V A;  1ZR4 A;  2YO3 A;  2FY8 A;  1G1I A;  1X0T A;  5H2F H;  1JO5 A;  4I1L A;  2YIU C;  4H0L B;  2HFE D;  2Q1K A;  1N7S B;  1ZN5 A;  1CW5 A;  1EDK A;  3FWN A;  3K5B A;  2OYI C;  2B87 B;  1KIL E;  2WWW A;  2A06 G;  1GD2 E;  4WVZ A;  3VP8 A;  2P2U A;  2C0W A;  5TIS H;  4L75 A;  1SFC A;  1EXI A;  3NTN A;  3CC2 P;  3CCM P;  3A0H H;  1LWU A;  2M3E A;  3BRV B;  3M91 A;  1ZLL A;  1VQ8 P;  1S5L H;  3SFD C;  2FFD C;  1YJN P;  1NTZ D;  1BCC D;  2LR2 A;  1FZE A;  2HOD B;  2Q3E A;  3L75 E;  3V4W A;  5KJ7 A;  3Q5P A;  1L4A A;  2NPS C;  1PFI A;  1PP9 J;  2KXP B;  1GW4 A;  3CWB J;  2ZJS E;  1SQQ J;  1L0L E;  1AVY A;  3HUS C;  1GK4 A;  4H13 D;  1ZME C;  2FYU D;  2FKW B;  1GZL A;  1EDJ A;  1KIL C;  2B89 A;  1XTC C;  3H1J J;  3SFE C;  2HG5 D;  1NTM J;  2O01 J;  1L0N E;  4GKG A;  3CC4 P;  1LT1 A;  1SQQ G;  1BSH A;  3D6Z A;  1H89 A;  4LLH A;  2AEM A;  1M1J A;  1NVO A;  1SQB G;  4H44 C;  4H0L D;  3P8C E;  2FXP A;  1NGM B;  1SLQ A;  1E79 H;  3AED C;  2H7H A;  1RE3 C;  2FBW C;  1T3J A;  2ZXX A;  5E79 H;  1HWT C;  2WSS H;  2M5A B;  2IFM A;  2QJP C;  2XDJ A;  2Q6Q A;  3GG2 A;  3RK2 B;  4YPC A;  1RF1 C;  3S4R A;  3AE4 C;  1N8R Q;  3GHG C;  4U7J A;  3L71 E;  3LW5 H;  3ZDM A;  2YIU B;  1EQ7 A;  1LTJ C;  1K05 A;  3MZW B;  1SQX D;  1N7L A;  2OYI B;  2KSE A;  1AJY A;  2M3B A;  1DX7 A;  3V2R A;  4BRY B;  2K88 A;  4D6T J;  1OW6 A;  3CCL P;  1NTZ G;  1BCC G;  1FZF A;  5CCG C;  1GMJ A;  4RES B;  1PP9 E;  3RBX A;  1CI6 B;  3CWB E;  1JY3 P;  1UIX A;  5CBN A;  1KQG B;  2FYU G;  4OWF A;  1NU1 E;  2BEQ D;  1AFO A;  4TT3 H;  4PJ0 H;  2FFD B;  2XV5 A;  3WU2 E;  1ZOY C;  3FGA D;  2OTJ P;  1QLE D;  1Q81 Q;  3H1I J;  2NPS B;  4ZMD A;  3I5C A;  3H1J E;  2WMM A;  5CMZ A;  5AW6 B;  2K37 A;  1NTM E;  3HUS B;  5B66 H;  1JUN A;  3PLN A;  4AYC A;  4WB4 A;  2AXC A;  1ZRT D;  3P32 A;  1KC8 Q;  3TYY A;  2ZT9 D;  2P1J A;  5AVX B;  3JCU H;  4R4L A;  3PP5 A;  2QVA A;  1OZH A;  2E42 A;  5CJ4 A;  2L91 A;  1T2K D;  2OYO A;  3RK2 D;  3CX5 E;  3L35 A;  3MGN A;  2CPB A;  1FAV A;  1IC2 A;  1LTI C;  4H44 B;  4NPE A;  1NO4 A;  2W90 A;  3N7N A;  4W7Z A;  1A02 F;  3G3Z A;  2QE7 H;  3FXD A;  3RGU A;  1JCC A;  1GL2 C;  1G1J A;  1FDO A;  1U7M A;  1YQ3 C;  1LNQ A;  3M0D A;  5AW3 B;  1SQX G;  2O01 H;  3MUD C;  5CHX A;  2QJP B;  3FWL A;  1BSN A;  3VMZ A;  1RF1 B;  1LTG C;  1M57 D;  2UWJ E;  3AE5 C;  3G6E P;  3RBZ A;  4D6T E;  3GHG B; 
#chains in the Genus database with same CATH homology
 3LID A;  3KQG A;  3MUD A;  4M3L A;  5CCH A;  1LTJ B;  3L37 A;  2N1T D;  4WBA A;  2OYI A;  1LGH B;  3RK3 C;  1NHL A;  3BVH A;  3C9I A;  3V5B A;  1N86 A;  1X8Y A;  1NWQ A;  1WT6 A;  1DEB A;  1N73 C;  2WZ7 A;  3RL0 B;  1MUU A;  3VYI A;  1L4A B;  1URQ D;  1GW3 A;  3CLQ A;  3H32 A;  2I1K A;  1HBW A;  1KFN A;  3HE4 B;  5AW9 B;  2PP6 A;  4IFF A;  2N1T C;  3OJA B;  1NTZ K;  2GUS A;  1T8Z A;  4O9B A;  3A7O A;  1NKN A;  5APW A;  2CPS A;  4XA4 A;  1IO4 A;  4IFD K;  2XKM A;  1CI6 A;  1URQ C;  2QM7 A;  1CSB A;  3TK1 A;  1HGZ A;  1KZU B;  1ZV8 A;  2WSF H;  2N1T A;  2FFD A;  5AVS B;  3TNU B;  1FDM A;  2FYU K;  2IFN A;  1RY3 A;  2NPS A;  1KIL B;  4Y99 C;  4N6J A;  1FJP A;  2HPC B;  1M1J B;  3B5N A;  1HGV A;  2C0X A;  1IFD A;  3HUS A;  3HD7 B;  2WT7 B;  1N2D C;  4LC1 A;  2YMY A;  1JNM A;  1FOS E;  3B8E B;  3U1A A;  3HTK B;  1HH0 A;  1RE4 C;  1G2C A;  5APS A;  3HE5 A;  2A45 G;  4N78 E;  3EFG A;  3V4Q A;  5AW8 B;  1FU1 A;  1KIL A;  3U59 A;  5AVR B;  5AW0 B;  2HPC A;  1OWA A;  2OYH B;  2P67 A;  3M0D C;  5APX A;  2L5G B;  2R32 A;  2ZFC A;  3CL3 D;  1FZG A;  3MD0 A;  5CCH D;  3HRN A;  1X9V A;  1L0L K;  4W7Y A;  1ZR4 A;  5AVQ B;  2YO3 A;  2VRS A;  1FZA A;  1G1I A;  1FZB A;  1YTZ T;  4C7N B;  3M0A A;  1JO5 A;  4I1L A;  3E1I A;  1ZR2 A;  2HFE D;  2Q3I A;  1N7S B;  2IPP A;  1ZN5 A;  1CW5 A;  2KP8 A;  5CCH C;  3A2A A;  2O1K A;  1JY2 P;  2OYI C;  1J1D C;  2KB7 P;  1RE3 A;  2WWW A;  1OXZ A;  1SFC B;  1L0N K;  4I6M C;  3V2Q A;  1JMM A;  2JEE A;  1GD2 E;  2POH A;  3H6P A;  1GL2 B;  2LKM A;  2FXM A;  5BVZ A;  3VP8 A;  5APU A;  3RL0 D;  2HYN A;  4OH8 B;  1HJB A;  4ZKU A;  4LGD E;  1NTK K;  4HYT B;  3M9B A;  4N3Y B;  4I2L C;  4N78 D;  2P2U A;  2XZR A;  1LT9 A;  2C0W A;  2QM8 A;  4AUW A;  3EQ2 A;  4JYB A;  4GT1 A;  4JF7 A;  1SQX K;  5BU5 A;  3MIW A;  1SFC A;  3NFQ A;  1RF1 A;  3NTN A;  3KDP B;  1KFM A;  1LWU A;  5AW2 B;  3WMM 0;  2KYV A;  2NPS D;  3BRV B;  3M91 A;  3GHG A;  1LTS C;  1IFN A;  1ZLL A;  3B5N D;  2KOG A;  1KQL A;  1LTJ A;  2FFD C;  2XNX A;  3VMX A;  4WY4 B;  1IFJ A;  1FZE A;  3RK3 B;  2HOD B;  1QL2 A;  4EIJ A;  3V4W A;  2H43 A;  5KJ7 A;  1L4A A;  2NPS C;  5APQ A;  1PFI A;  1N73 B;  1KIL D;  1NAF A;  1GW4 A;  3UIA A;  3B5N C;  3HE4 A;  1W2E A;  3HUS C;  1J1E B;  4HH2 A;  1JTH B;  5CCG A;  1GK4 A;  2O1J A;  2FKW B;  3A5T A;  2ZXE B;  1GZL A;  2Z5I A;  4DZO A;  5APT A;  1KIL C;  1AQ5 A;  1XTC C;  1URQ B;  5KTB A;  2HG5 D;  4GKG A;  3TNU A;  2M8R A;  4B86 A;  1MFZ A;  3IR9 A;  1HTL C;  1H89 A;  1HUC A;  3II6 A;  4LLH A;  5KLV K;  2JJL A;  3KYQ A;  3TSI A;  3IFM A;  1M1J A;  2C9L Y;  4Y99 B;  4EOT A;  3HD7 A;  2WT7 A;  3P8C E;  1RF0 A;  2Q7C A;  3HTK A;  1SLQ A;  2YNY A;  4KHX A;  1DH3 A;  2H7H A;  1RE3 C;  1HVV A;  2Q5U A;  3U1C A;  1SFC D;  2H8P D;  2WPS A;  2WTY A;  1FZC B;  1T3J A;  3CI9 A;  3N4X A;  1NU1 K;  1HWT C;  2OYH A;  2J59 M;  3M06 A;  1GK6 A;  2GUV A;  2WPQ A;  2IFM A;  3SWF A;  3BRT B;  1LT9 C;  2HLO A;  2BAS A;  1SQP K;  2W27 A;  2XDJ A;  1JCD A;  1CZQ A;  3RK2 B;  1QL1 A;  1SFC C;  1RF1 C;  1J2J B;  3M9Q A;  1NTM K;  3LIE A;  4C7N A;  1LWU C;  5KJ7 D;  1H88 A;  1L4A D;  3GHG C;  3MTU E;  5AVT B;  3V2N A;  3LW5 H;  1N7S A;  1EQ7 A;  3BAT A;  1LTJ C;  4C7R A;  4WY4 D;  2N9B A;  1VDF A;  5CCG D;  5AW7 B;  1N7L A;  3VN0 A;  1M7L A;  1J1D B;  2OYI B;  3P8C D;  3SWY A;  1GL2 A;  5AW5 B;  5KJ7 C;  4DOJ A;  2M3B A;  3RL0 C;  1DX7 A;  1L4A C;  3V2R A;  3P7K A;  1WRG A;  3KPE A;  3H32 B;  1NOH A;  3NMD A;  3A3Y B;  5AVV B;  4WY4 C;  1IFI A;  1SQV K;  1FZF A;  5CCG C;  1Z56 A;  3M9H A;  1NKZ B;  3R2P A;  5APV A;  4RES B;  2J58 A;  4ZKP A;  1T3U A;  1NH4 A;  3VP9 A;  3T97 A;  4JYC A;  3V2P A;  1CI6 B;  2YO2 A;  1JY3 P;  1J1E C;  3HD7 D;  2W6B A;  1S9K E;  4WY4 A;  5AVU B;  1AFO A;  2N1T B;  2FFD B;  2FYZ A;  2HOD A;  4GIF A;  2YKO A;  2XV5 A;  1SP4 A;  5AVW B;  1N73 A;  1JY2 O;  3VOP A;  2NPS B;  1LTA C;  2WSE H;  1M1J C;  1YTZ I;  3I5C A;  3NXS A;  1JY2 N;  3HD7 C;  3B5N B;  5CMZ A;  1JTH A;  1IK9 A;  5AW6 B;  5APY A;  1RF0 C;  2WIT A;  3HUS B;  1JUN A;  2Z4E A;  1E5W A;  4AYC A;  3OAK A;  4C46 A;  4WB4 A;  4W80 A;  3P32 A;  1FOS F;  1G2C B;  3BAS A;  3TYY A;  2Q9I A;  3HE5 B;  2R3C A;  2P1J A;  2MJZ A;  2OYH C;  5AVX B;  1XTG B;  1URQ A;  1GU4 A;  1FJK A;  1YYC A;  2OAR A;  3O8Z A;  1LTT C;  2P7J A;  3PP5 A;  5AW1 B;  1N7S D;  2A45 I;  1IFM A;  2E42 A;  5CJ4 A;  1SVF A;  1T2K D;  3RK2 D;  1FBM A;  2Z5H A;  1GTW A;  1FZC C;  1JOC A;  3L35 A;  1SQQ K;  3MGN A;  3VTP C;  1S9K D;  2YKP A;  1GL2 D;  2CPB A;  1FAV A;  1IC2 A;  2R5B A;  1N7S C;  1LTI C;  1NO4 A;  3L36 A;  1GU5 A;  3N7N A;  1MV8 A;  1SQB K;  2KSJ A;  1T2K C;  3RK2 C;  4W7Z A;  3VMY A;  2A45 H;  1A02 F;  1JY3 O;  3G3Z A;  2I1J A;  2WSC H;  1RE4 A;  4XE5 B;  1FZC A;  1JCC A;  2W6A A;  1GL2 C;  5CJ0 A;  1JY3 N;  2C9N Y;  1G1J A;  5BU8 B;  1H8A A;  5AVY B;  1A02 J;  3M0D A;  5AW3 B;  5AW4 B;  2O01 H;  5CHX A;  2WPR A;  1GDT A;  2KLV A;  2YKQ A;  1LT9 B;  1MZ9 A;  2E43 A;  2XU6 A;  4AQR D;  3RK3 D;  1IJD B;  3VMZ A;  2PAJ A;  5AVZ B;  1RF1 B;  1VPC A;  1X79 B;  1LTG C;  3L4F A;  2IX7 C;  1LWU B;  3P8M C;  2GM4 A;  3OA7 A;  4IFM A;  3GHG B;  2R5D A;  1LTB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...