1HGZA

Filamentous bacteriophage ph75
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
source organism Bacteriophage ph75
molecule tags Virus
total genus 12
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hgzA00
1IFIA 1HGZA 1FDMA 1NH4A 2CPBA 2C0XA 1HH0A 1HGVA 2C0WA 2CPSA 2MJZA 1IFJA 1IFDA
chains in the Genus database with same CATH superfamily
1XTGB 3HE4A 1FJKA 2L5GB 4H13D 5KAIE 4ZNCA 4GKGA 2WSSH 5AW3B 3A3YB 1BCCJ 4EI2A 1J1EC 3CX5H 5DJTB 3H1HE 4GIFA 3F89A 1PP9G 3TDKA 3HTKA 1CI6A 2JWAA 3AEAC 2FFDB 2KXPB 4IFMA 3HRNA 1FOSF 5TJHA 1EXJA 1YITP 3S1KA 2OYIA 1NTZJ 1OIPA 2R5BA 4HJGH 3SWKA 1FZCC 3OA7A 5AW2B 1GU4A 4R4LA 2RN0A 1BSNA 1BE3E 1RY3A 1J1DB 2J59M 3RBZA 2E75B 3KYQA 3B5NC 4NPDA 3H1JJ 5AW1B 1NOHA 4KHXA 1QL2A 1IFNA 1JY3P 2M5AA 1PGOA 1KB9D 2N1TA 5CCHD 3H1IJ 4BRYB 1YJ9P 3D71A 3E1RA 1YHQP 5AW6B 3CCRP 3L72J 1ZRTE 2O01H 1LTGC 2KB7P 1GL2D 3D6ZA 1AQ5A 5APYA 4GT1A 5APQA 5CCGC 1TU3F 1LTJC 2Q1KA 1R8EA 3L75D 4L73A 2Q3EA 3USSA 4U3FG 3L37A 3AE3C 1NTKD 1S1CX 1HTLC 1T3JA 2OGUA 1EDJA 1K05A 1SQXK 3RK3D 2A06D 2HODB 1BCCE 3BCCD 1IFIA 3MUDA 1T8ZA 1SQBG 3HD7A 1RH5B 1SQVJ 1PPJE 1SS1A 1T2KD 1LP1A 2E75D 4K3AA 3M0AA 2DW3A 1FAVA 1NO4A 1RQVA 2A06G 1VPCA 3AECC 1A02F 4I6MC 1XTCC 4GDOA 3CMAP 1SLQA 1PL5A 2K9JA 1NTZE 2QG4A 5BU8B 3U59A 4PD4E 2Q9IA 2Q3IA 4OGQB 2KUBA 1KQLA 5AVSB 1FZEA 1N73C 3A5TA 2Q6QA 4Z1MH 1M57D 1QX8A 3H1HD 4I2LC 1PP9J 3PP5A 3QWOC 3RL0B 4WY4B 1ZW0A 2CPBA 5AVWB 1FJPA 1L4AB 3RK2C 3M0DA 1RF0C 3H1IE 4WVZA 4ASVA 1HGVA 2QE7H 3CXHI 1EDKA 2ZYGA 3HE4B 3TGUJ 3CI9A 1RF1C 4PD4I 1KC8Q 2WPRA 3PJSK 5CHXA 5B5EH 1JO5A 2SPZA 1IZNB 1ZR4A 4YTPC 4AQRD 4C46A 3V4WA 1NTMG 2KZJA 4PV1B 2E76C 2YKQA 4JYBA 1SQBK 4KT0J 1L0ND 2OYHA 3M9QA 1N2DC 2LR2A 3HTKB 1NWQA 4HB1A 4C7NA 2ZJSE 1OVVA 1S5LH 1SFCC 1BE3G 2KYVA 1SQPK 1EZVD 4OH8B 1Q7YQ 5CCHA 3H1LD 5L8RJ 1KN7A 2Z4EA 1ZP0C 1KZUB 1KFMA 3KQGA 1AVOA 4DJGA 3CC7P 3AEDC 3RL0D 2G8YA 4U3FJ 4WY4D 1L4AD 3GHGC 2E74B 1QEXA 3H25A 3LW5J 2BCCG 2QEXP 4L74A 1LTTC 2JO1A 1MFTA 1NKZB 2FYNC 3JCUH 2XDJA 1L0LG 1YJNP 1KILE 2FXPA 2QJKB 1PV3A 2FFDA 1BCCD 1SQBJ 5AVUB 1GZLA 2G3AA 3KZIH 1SQXE 2B9BA 3IR9A 1YJWP 2H7HA 1PZQA 1KFNA 1PP9E 4RKUJ 2D2CC 3CMEP 1PPJD 2A45G 2BEQD 2IZ1A 3BATA 1M7LA 4DOJA 1JNMA 2E43A 1JTHB 1MFZA 1YYCA 3G6EP 3O6QB 5KAIH 2K88A 1RE4A 2YIUC 1NTZD 4M3LA 3TGUE 5BU5A 1JEKA 1X79B 4H0LD 1NTMK 2OYIC 1QVFO 4W7YA 4PD4D 1FZAA 1T3UA 4BRYA 3VMXA 5BVZA 1S5LX 3NFQA 3WU2E 2QSIA 3H1JD 2MJZA 2E74D 1YBKA 2PP6A 5AW8B 1N86A 3H1ID 3R4YA 2YO3A 1X22A 1VQ8P 3RBXA 4MN4C 3R2PA 2N1TD 2QIWA 3WUUA 1Q81Q 1KILB 2K9JB 1NVOA 3L72D 1URQC 4B86A 2Q5UA 1HJ0A 1Q2NA 1AJYA 1OZHA 3GMAA 4O9BA 1PGPA 2KIKA 1BGYE 2H89C 4RO0A 1NTMJ 4TLFA 4U3FE 1GTWA 1L0LK 1MKMA 2Z5HA 3S4RA 3FGAD 5KLIB 1N7SC 5CBNA 3TF5A 2RKLA 2YO2A 3EFFK 1BE3J 4Y28J 1VQ9P 3CC4P 1SQBE 2W6AA 2M0BA 4HH2A 1QGKB 4N78E 3WMM0 4XE5B 3G4SP 4K35A 1SQVD 1ZXGA 4D6TG 1J1EB 1SQPE 3C8VA 1QL1A 2PGDA 2JEEA 2R5DA 2HYNA 1HBWA 3HD7D 3FXDA 2QJYC 1JY2P 2ZYAA 1A02J 3VP9A 1FOSE 2AEMA 4QMAA 2BCCJ 2GUSA 3SWYA 3GF7A 3L71E 3RL0g 1L0LJ 4WY4A 1L4AA 3CCMP 3IFMA 4JYCA 4UB8E 2C0WA 5E79E 4I7ZC 3E1IA 2C9LY 1FZCB 1K04A 2R32A 1LWUB 2R3CA 1PP9D 1Q86Q 4YXWH 4RJTA 3B5NB 4HYTB 2IYOA 3HUSB 2ZFCA 3JSVC 1SQXG 1JY2N 2PAJA 2WQYC 1FDOA 3P7KA 4PD4H 3TGUD 1IO4A 1W2BO 5AVYB 1UIXA 1EC5A 1HF9A 2QM8A 3JC22 3CC2P 1NTME 3RGUA 2P7JA 1QLED 5TISE 2OQQA 1LTJB 4U7JA 5CJ4A 4N3YB 5KKZC 3NXSA 3TGUG 1FZBA 5APTA 2OYHC 1JMMA 1HUCA 1H8AA 3H1KE 5AVQB 2OARA 2IPPA 1DD3A 4EIJA 3AE6C 2NPSA 2MKVA 3GF3A 5CCHC 3M91A 1VQNP 3H6PA 4W80A 1CSBA 5B66E 4U3FD 1E79H 2OYOA 4WWIA 2E5YA 2BCCE 2KZIA 1GL2C 1RE3C 4OWFA 2I1JA 1L0LE 1CW5A 1IK9A 4YXDC 2W27A 4NPEA 1SQBD 4GOFA 3L73G 1JTHA 2IBZE 2WZ7A 1BDDA 1BGYG 1DIPA 3O6QA 4D6TJ 2H88C 4N78D 1DX7A 2ZT9B 2FXOA 2V4HA 1T6AA 1N73B 1M1JB 1USDA 3RK3C 1GD2E 3IAOA 1ZMEC 1VQOP 1K9MQ 3EWKA 2QA4P 3A0BE 5EFWB 3CPWO 3AE7C 3G3ZA 2L91A 3RK2B 1KYOE 2HR3A 1J1DC 2XKMA 2XNDH 1T2KC 2E75C 3PLNA 2ZAEB 2AEJA 1X8YA 1SQPG 5KLVK 1LNQA 2KS1B 2JKVA 5AW4B 1OFCX 3CWBG 1VF5B 3CXHE 2IBZI 1X9VA 1IFMA 2E5TA 1NH4A 5AW9B 1LT9B 1KILA 2R3SA 3AEFC 2A45I 2R44A 3N4XA 3L71G 3B71A 3CCVP 3EQ2A 4H44B 3I5CA 1VQMP 2KOGA 3PHLA 2Y0DA 1FBMA 1SQXJ 1KYOI 2ZVOB 1SFCB 2IZ0A 4I1LA 2P2UA 2Q7CA 1GU5A 1FZFA 2C9NY 2GUVA 1LTIC 5GTIE 3PH0A 4JQ0D 2ZT9D 2K3RA 2Y0EA 2IYPA 3WU2H 1NTMD 3KXDA 5KLVJ 3UIAA 3K5BA 3CLQA 3TYYA 2Y9ZA 1KQFB 2P67A 3G9RA 1BE3D 2WVRA 2B89A 1U7JA 4TT3H 3I56P 1R5SA 2H8PD 1Y9BA 4D6TE 3V2QA 4DZOA 1P84E 1VF5D 4L75A 4PJ0E 5KAFE 5APVA 1JM0A 2AEFA 1K8AQ 2UWJE 4ZMDA 1LTBC 1FZCA 3LW5H 1LWUA 4OGQD 2BCCD 1SP4A 4H44D 3AE9C 3H1KG 5CMZA 1ZRTD 3CCUP 1L0LD 5AVXB 2O01N 3B5NA 3FXEA 3RL0C 3L73J 4WY4C 2YIUB 1L4AC 1BGYJ 1PGQA 2QJPB 3Q1MA 2IFMA 3HUSA 1NHLA 1VQLP 1P84I 3CL3D 2NPSB 2V7QH 4Y99C 1VQ4P 5APWA 2WT7B 5KJ7D 1ZR2A 3VYIA 4GOEA 2IBZG 1KYOD 2WSCH 3TSIA 1LTJA 3TNUB 2W90A 1SQPJ 2B87B 4UB8H 1NAYA 1LT1A 1VL2A 2JR8A 5E79H 4PV1D 2V7QJ 3M9BA 3CWBJ 1H88A 1URQB 3CXHD 1NU1K 5KLVE 2OTJP 4H0LC 1Z56A 1L2PA 1G1IA 1VQPP 1S4XA 4CPGA 3L71J 2WSCJ 3A0HE 3V2PA 2XZRA 1FDMA 3L70G 4AYCA 2ZXXA 1N7SB 3F5HA 3CCLP 1PGJA 3D70A 2JDIH 1CZQA 3MIWA 2K37A 5AW0B 2HPCB 2E74C 3D6YA 1M1KQ 2O3JA 1MV8A 1OVRA 5AW5B 4IL6E 3WUVA 2C0XA 3T97B 2N9YB 2NPSD 2N1TC 5TISH 3IF4A 1OW8A 2JJLA 2QJYB 3P8MC 2P10A 1JCCA 1NU1J 2AXTE 1N73A 1M1JA 2J5UA 3L73E 2I8DA 1OW6A 2IFNA 1RF0A 4D6TD 1EDIA 4I7ZB 4N6JA 3V5BA 1KB9E 1ZN5A 3M06A 2KS1A 5B66H 1KQGB 5GTHE 1DH3A 1FC2C 4DT0A 1RF1A 4W7ZA 3BASA 3C9IA 3H1KJ 1AFOA 1SQQG 1LT9A 3MUDC 3L74G 1JUNA 2WMMA 2XU6A 3KHUA 4LC1A 4ZKUA 3HD7C 1FS0E 1GW4A 2FY8A 3L75E 3CWBE 2FYUG 3KPEA 1G2CB 1YI2P 2A45H 2LXCB 3VMAA 4BXLA 1SFCA 1KB9I 2Y9YA 3RK3E 1IFDA 3BCCE 3A0BH 1LJ2A 3Q5RA 1KILD 1S72P 3V4QA 2Z5IA 1KYOH 1LTAC 1PIXA 1WMKA 1SQXD 5KTBA 4H13C 5KJ7A 1KMIZ 3B4SA 3NTNA 1WT6A 4BWNA 4KJMA 2I1KA 1JMBA 3SSUA 3MP7B 2BASA 3MTUE 3CXHH 1KD1Q 3M0DC 3HE5B 3V6IA 5KLVD 4WB4A 3Q5PA 1MUUA 1NU1E 3I55P 3L70J 2E42A 1S9KE 2KNCB 1GL2B 3WUTA 5DJUB 2J58A 3ZDMA 3LIEA 1Y8AA 1JY3O 1VQ6P 3MHVA 5KLVG 1VQKP 2KK7A 3AE4C 3SWFA 1AQTA 1N7LA 1HVVA 1EDLA 5GTIH 1SQQK 1OMIA 3FX0A 4ZKPA 4EYYQ 1IK7A 3RK3B 3O8ZA 1ZOYC 2YMYA 1Y47A 3PTZA 3AEGC 2WPSA 2FYUK 1RHZB 4UB6E 2M8RA 1LWUC 1Q90D 3MD0A 1LGHB 2WT7A 2P1JA 3BRTB 3L73D 2XNXA 2WITA 3AE5C 1BGYD 1J2JB 4DCKA 5H2FE 3II6A 1VDFA 3B5ND 4XFJA 1P84H 1AVYA 2BEZF 4AUWA 1L0NE 3OAKA 5KAFH 2VRSA 4PJ0H 5APSA 3HUSC 3TNUA 2B87A 2PFXA 3Q3DA 2KP8A 1SQVK 1WRGA 1EZVE 1H0TB 1URQA 2YMKA 2H43A 1SQQJ 3H1LE 3L74J 1N8RQ 2FFDC 3ABVC 1MZ9A 1SQPD 1GDTA 3CCEP 3CCJP 5CCGD 3CWBD 2FYUJ 2IDBA 1JCDA 2QM7A 1N7SA 3VP8A 3P8CE 2WSEH 1IFPA 3U1AA 1HJBA 3A2AA 1BSHA 2O01J 2POHA 2HPCA 5AVTB 3VN0A 3L71D 3Q5SA 1IJDB 1RE4C 3L70E 3QH9A 1AA0A 1HH0A 3L36A 2W8ZA 3V2NA 5AVZB 1JY3N 1EZVI 3L75G 1M8OB 3T97A 4EDFA 1RF1B 1LTSC 1OX3A 1NTKG 3CCQP 2WSEJ 1KTMA 5CJ0A 4OVNF 3OJAB 2E76B 3BCCG 2QRXA 1NGMB 2JWDA 1IC2A 3CX5E 1VQ5P 2W83C 2JP3A 2FBWC 2WWWA 5M1BA 3A0HH 1FU1A 1FZGA 1NU1D 3ITKA 4R4MA 1S9KD 3CD6P 2ZT9C 2ZYDA 4GODA 1GW3A 2IX7C 3PRJA 1M1JC 3BVHA 1BDCA 2KLUA 3H1JE 2LKMA 4JF7A 2K9YA 2XV5A 3GG2A 3H32B 2FXMA 3FWNA 4IL6H 3W67A 1NU1G 3RK2D 3GHGB 1GK4A 3VMYA 2YKPA 3GW6A 1OVUA 2YNYA 2FKWB 3CX5I 4Y99B 1SQQE 2FYNB 3L74E 3H1HG 1G2CA 5AW7B 3L72E 3H1KD 1VF5C 4WBAA 1UIIA 1YQ3C 2AXTH 1LT9C 2YXQB 4IOIH 2FYUE 1X0TA 2WPQA 1K73Q 2D2CB 4OGQC 4H44C 1OXZA 2E76D 3FWLA 1KB9H 2YKOA 3VOPA 1CI6B 1W5CE 3IN6A 2W6JH 2N9BA 1ZLLA 3L4FA 1NTKK 3E7KA 5GTHH 3VMZA 1SFCD 3P32A 4H0LB 5CBOA 1OW7A 3HE5A 2IBZD 2OYIB 1JOCA 1SQVE 5APUA 1KV4A 2RMZA 1L0NG 1HWTC 1EQ7A 2ITAA 5KJ7C 2P58A 1M56D 1KQSO 5AVRB 2KNCA 1GL2A 1RE3A 3V2RA 1EZVG 3VTPC 2K1AA 3P8CD 2PRRA 2LXBA 3H1LG 3S9OA 1DEBA 1D7MA 5CCGA 2KSEA 1IFJA 2M5AB 1USEA 3MGNA 4PV1C 2N1TB 3L70D 2ZXEB 2KI7B 3L75J 4IL6X 3L35A 5C39A 1NTKJ 3N7NA 3BRVB 2D2CD 2KLVA 2RH0A 1E5WA 1R5LA 1DEEG 3BCCJ 3GLMA 4RESB 3TK1A 1YTZI 1BCCG 1U57A 3U1CA 1QVGO 5AVVB 3CX5D 3G71P 2QJPC 3AEBC 1PPJG 1YTZT 3AE2C 2HLOA 1AV1A 1FDIA 1KORA 2WPVB 2B88A 1OWAA 3LIDA 1S3JA 2NPSC 2W6BA 1H0TA 3OW2O 2QVAA 2QJKC 3HD7B 2YXRB 2HG5D 2OTLP 2CPSA 4A7PA 1EXIA 2ZVNB 1HGZA 1NTZG 2AXCA 2OTKE 1LP1B 2CK3H 1NJIQ 3C1LA 4ASWA 1SVFA 4JBZA 5B5EE 1L0NK 3H1HJ 3SFDC 2FYZA 2KSJA 1SQQD 3L74D 1GK6A 1ZV8A 3H1JG 3M9HA 2GA1A 4UB6H 1JY2O 1P84D 2NRGA 1URQD 4LGDE 4L76A 3A7OA 1S2EA 2HODA 4IFDK 1Q82Q 4H13B 1S5LE 2HFED 3H1IG 2FYUD 5H2FH 2M3BA 1DD4A 1JB0J 1NYHA 3Q2YA 1NAFA 3L72G 1FE6A 1N7SD 3CCSP 2GM4A 2NZ2A 3SFEC 4HKZH 1YIJP 1GMJA 1M90Q 1U7MA 2O1JA 3KDPB 1W2EA 2WTYA 3AEEC 1PFIA 1NTKE 4EOTA 1L0NJ 2WSFH 4JPZB 2Y0CA 3AE1C 3EFGA 1NKNA 3AE8C 2A06E 4XA4A 3JCUE 1KILC 4IFFA 2O1KA 5KKZB 3W68A 1RQUA 3KZIE 3H1LJ 4C7RA 1YQ4C 5APXA 5K5GB 1VQ7P 4LLHA 1G1JA 1SQVG 3H32A 2OYHB 4NPFX 2WSFJ 4C7NB 3NMDA 5KLIC 2M3EA 3GHGA 1NTZK 3B8EB 4YPCA 1H89A 3MZWB
chains in the Genus database with same CATH topology
1XTGB 1JCDA 2QM7A 1N7SA 3HE4A 1FJKA 2L5GB 3VP8A 4GKGA 3P8CE 2PP6A 1LTBC 2WSEH 5AW8B 1N86A 3U1AA 1HJBA 5AW3B 1FZCA 3A2AA 3A3YB 2YO3A 3LW5H 2POHA 1LWUA 1SP4A 5AVTB 3VN0A 2HPCA 1J1EC 3R2PA 1IJDB 2N1TD 5CMZA 1RE4C 1HH0A 3L36A 1KILB 3V2NA 5AVXB 5AVZB 1JY3N 1URQC 4B86A 3B5NA 4GIFA 3T97A 2Q5UA 3RL0C 4WY4C 1RF1B 1L4AC 1LTSC 3HTKA 1CI6A 4O9BA 2IFMA 3HUSA 1NHLA 5CJ0A 1GTWA 2FFDB 1L0LK 4IFMA 3HRNA 1FOSF 2Z5HA 3OJAB 3CL3D 2NPSB 4Y99C 1N7SC 5APWA 2OYIA 2WT7B 5KJ7D 1ZR2A 2YO2A 1IC2A 3VYIA 2R5BA 1FZCC 3OA7A 5AW2B 1GU4A 2WWWA 2W6AA 1FU1A 1RY3A 2WSCH 3TSIA 1FZGA 1LTJA 1J1DB 4HH2A 2J59M 4N78E 3WMM0 3TNUB 1S9KD 4XE5B 3KYQA 1GW3A 2IX7C 3B5NC 1J1EB 1M1JC 3BVHA 3M9BA 5AW1B 1QL1A 1NOHA 4KHXA 2JEEA 2LKMA 1QL2A 2R5DA 2HYNA 1IFNA 1H88A 3HD7D 4JF7A 1JY3P 1HBWA 1URQB 2XV5A 1JY2P 1NU1K 3H32B 2N1TA 5CCHD 2FXMA 1A02J 3VP9A 1FOSE 1Z56A 1G1IA 2GUSA 3RK2D 3GHGB 1GK4A 3VMYA 2YKPA 3SWYA 2YNYA 3V2PA 2FKWB 2XZRA 5AW6B 1FDMA 4WY4A 2O01H 1LTGC 1L4AA 2KB7P 4Y99B 1GL2D 4AYCA 1N7SB 5AW7B 3IFMA 1G2CA 4JYCA 1AQ5A 5APYA 2C0WA 4WBAA 4GT1A 5APQA 3E1IA 5CCGC 2C9LY 1FZCB 1LTJC 2R32A 1LT9C 1CZQA 3MIWA 1LWUB 5AW0B 2HPCB 2R3CA 1MV8A 2WPQA 5AW5B 3L37A 1HTLC 1T3JA 3B5NB 2C0XA 1OXZA 2NPSD 2N1TC 1SQXK 2YKOA 3RK3D 4HYTB 3VOPA 2HODB 1CI6B 2JJLA 3P8MC 2N9BA 1IFIA 3MUDA 1ZLLA 1T8ZA 3HUSB 2ZFCA 1JCCA 3L4FA 1JY2N 2PAJA 1NTKK 1N73A 3VMZA 1SFCD 1M1JA 3P7KA 3P32A 3HD7A 1IO4A 5AVYB 3HE5A 2OYIB 1T2KD 1JOCA 2QM8A 3M0AA 1FAVA 1NO4A 5APUA 2IFNA 1HWTC 1RF0A 1VPCA 2P7JA 1EQ7A 1A02F 4N6JA 5KJ7C 4I6MC 3V5BA 1XTCC 1LTJB 1SLQA 1ZN5A 5AVRB 1GL2A 1RE3A 5CJ4A 3M06A 4N3YB 3V2RA 3NXSA 3VTPC 3U59A 5BU8B 1FZBA 1DH3A 3P8CD 5APTA 2OYHC 1JMMA 2Q9IA 1DEBA 1RF1A 5CCGA 4W7ZA 3BASA 3C9IA 2Q3IA 1HUCA 1AFOA 1IFJA 1LT9A 3MGNA 1KQLA 2N1TB 1H8AA 1JUNA 5AVSB 2XU6A 1FZEA 4LC1A 4ZKUA 1N73C 2ZXEB 3A5TA 3HD7C 5AVQB 2OARA 2IPPA 3L35A 1GW4A 4I2LC 4EIJA 3PP5A 2NPSA 5CCHC 3M91A 3RL0B 3H6PA 4WY4B 4W80A 2CPBA 3KPEA 5AVWB 1CSBA 1L4AB 1FJPA 3N7NA 3RK2C 1G2CB 3M0DA 1RF0C 3BRVB 2KLVA 2A45H 1HGVA 1SFCA 1E5WA 4RESB 3TK1A 1GL2C 1RE3C 1YTZI 3U1CA 1IFDA 2I1JA 3HE4B 1KILD 1CW5A 5AVVB 3V4QA 1IK9A 3CI9A 2Z5IA 1RF1C 2W27A 2WPRA 1LTAC 5CHXA 1JTHA 5KTBA 1JO5A 1YTZT 2WZ7A 1ZR4A 2HLOA 5KJ7A 4AQRD 4C46A 3NTNA 1WT6A 3V4WA 4N78D 1DX7A 1OWAA 3LIDA 2I1KA 2NPSC 2W6BA 2YKQA 1N73B 1M1JB 4JYBA 2BASA 3MTUE 3RK3C 3HD7B 1GD2E 1SQBK 2HG5D 2OYHA 3M9QA 2CPSA 1N2DC 3HTKB 3M0DC 3HE5B 1NWQA 1HGZA 4C7NA 4WB4A 1SFCC 1MUUA 3G3ZA 3RK2B 2KYVA 1SQPK 1SVFA 4OH8B 1J1DC 2XKMA 1T2KC 2E42A 1S9KE 1L0NK 5CCHA 1X8YA 1GL2B 2FYZA 5KLVK 2KSJA 2Z4EA 1GK6A 1ZV8A 5AW4B 3M9HA 1KZUB 1KFMA 2J58A 3LIEA 3KQGA 1JY3O 1JY2O 1URQD 4LGDE 1X9VA 1IFMA 1NH4A 3RL0D 3SWFA 3A7OA 5AW9B 1LT9B 4WY4D 2HODA 1N7LA 1HVVA 1L4AD 1KILA 4IFDK 2HFED 3GHGC 2A45I 1SQQK 3N4XA 2M3BA 1LTTC 1NKZB 3EQ2A 4ZKPA 2XDJA 1NAFA 3I5CA 3RK3B 3O8ZA 2YMYA 1N7SD 2KOGA 2GM4A 2FFDA 1FBMA 2WPSA 2FYUK 5AVUB 1GZLA 2M8RA 1SFCB 1LWUC 3MD0A 4I1LA 3IR9A 2P2UA 2Q7CA 2H7HA 1LGHB 1KFNA 2O1JA 3KDPB 1GU5A 2WT7A 2P1JA 1FZFA 2C9NY 2GUVA 3BRTB 1LTIC 2XNXA 1W2EA 2WTYA 1PFIA 2WITA 2A45G 1J2JB 4EOTA 3BATA 1M7LA 2WSFH 3II6A 4DOJA 1VDFA 3B5ND 1JNMA 4AUWA 3EFGA 2E43A 1NKNA 3OAKA 1JTHB 2VRSA 4XA4A 3UIAA 1KILC 5APSA 1MFZA 3CLQA 4IFFA 3TYYA 1YYCA 3HUSC 3TNUA 2O1KA 1RE4A 2KP8A 1SQVK 1WRGA 4M3LA 5BU5A 1X79B 4C7RA 5APXA 2P67A 1NTMK 1URQA 2H43A 2OYIC 4LLHA 1G1JA 4W7YA 1FZAA 3H32A 2OYHB 2FFDC 1T3UA 4C7NB 3VMXA 5BVZA 3NMDA 2H8PD 3GHGA 1MZ9A 3NFQA 3V2QA 1NTZK 4DZOA 3B8EB 1H89A 2MJZA 1GDTA 5CCGD 5APVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFI A;  1HGZ A;  1FDM A;  1NH4 A;  2CPB A;  2C0X A;  1HH0 A;  1HGV A;  2C0W A;  2CPS A;  2MJZ A;  1IFJ A;  1IFD A; 
#chains in the Genus database with same CATH topology
 1XTG B;  3HE4 A;  1FJK A;  2L5G B;  4H13 D;  5KAI E;  4ZNC A;  4GKG A;  2WSS H;  5AW3 B;  3A3Y B;  1BCC J;  4EI2 A;  1J1E C;  3CX5 H;  5DJT B;  3H1H E;  4GIF A;  3F89 A;  1PP9 G;  3TDK A;  3HTK A;  1CI6 A;  2JWA A;  3AEA C;  2FFD B;  2KXP B;  4IFM A;  3HRN A;  1FOS F;  5TJH A;  1EXJ A;  1YIT P;  3S1K A;  2OYI A;  1NTZ J;  1OIP A;  2R5B A;  4HJG H;  3SWK A;  1FZC C;  3OA7 A;  5AW2 B;  1GU4 A;  4R4L A;  2RN0 A;  1BSN A;  1BE3 E;  1RY3 A;  1J1D B;  2J59 M;  3RBZ A;  2E75 B;  3KYQ A;  3B5N C;  4NPD A;  3H1J J;  5AW1 B;  1NOH A;  4KHX A;  1QL2 A;  1IFN A;  1JY3 P;  2M5A A;  1PGO A;  1KB9 D;  2N1T A;  5CCH D;  3H1I J;  4BRY B;  1YJ9 P;  3D71 A;  3E1R A;  1YHQ P;  5AW6 B;  3CCR P;  3L72 J;  1ZRT E;  2O01 H;  1LTG C;  2KB7 P;  1GL2 D;  3D6Z A;  1AQ5 A;  5APY A;  4GT1 A;  5APQ A;  5CCG C;  1TU3 F;  1LTJ C;  2Q1K A;  1R8E A;  3L75 D;  4L73 A;  2Q3E A;  3USS A;  4U3F G;  3L37 A;  3AE3 C;  1NTK D;  1S1C X;  1HTL C;  1T3J A;  2OGU A;  1EDJ A;  1K05 A;  1SQX K;  3RK3 D;  2A06 D;  2HOD B;  1BCC E;  3BCC D;  1IFI A;  3MUD A;  1T8Z A;  1SQB G;  3HD7 A;  1RH5 B;  1SQV J;  1PPJ E;  1SS1 A;  1T2K D;  1LP1 A;  2E75 D;  4K3A A;  3M0A A;  2DW3 A;  1FAV A;  1NO4 A;  1RQV A;  2A06 G;  1VPC A;  3AEC C;  1A02 F;  4I6M C;  1XTC C;  4GDO A;  3CMA P;  1SLQ A;  1PL5 A;  2K9J A;  1NTZ E;  2QG4 A;  5BU8 B;  3U59 A;  4PD4 E;  2Q9I A;  2Q3I A;  4OGQ B;  2KUB A;  1KQL A;  5AVS B;  1FZE A;  1N73 C;  3A5T A;  2Q6Q A;  4Z1M H;  1M57 D;  1QX8 A;  3H1H D;  4I2L C;  1PP9 J;  3PP5 A;  3QWO C;  3RL0 B;  4WY4 B;  1ZW0 A;  2CPB A;  5AVW B;  1FJP A;  1L4A B;  3RK2 C;  3M0D A;  1RF0 C;  3H1I E;  4WVZ A;  4ASV A;  1HGV A;  2QE7 H;  3CXH I;  1EDK A;  2ZYG A;  3HE4 B;  3TGU J;  3CI9 A;  1RF1 C;  4PD4 I;  1KC8 Q;  2WPR A;  3PJS K;  5CHX A;  5B5E H;  1JO5 A;  2SPZ A;  1IZN B;  1ZR4 A;  4YTP C;  4AQR D;  4C46 A;  3V4W A;  1NTM G;  2KZJ A;  4PV1 B;  2E76 C;  2YKQ A;  4JYB A;  1SQB K;  4KT0 J;  1L0N D;  2OYH A;  3M9Q A;  1N2D C;  2LR2 A;  3HTK B;  1NWQ A;  4HB1 A;  4C7N A;  2ZJS E;  1OVV A;  1S5L H;  1SFC C;  1BE3 G;  2KYV A;  1SQP K;  1EZV D;  4OH8 B;  1Q7Y Q;  5CCH A;  3H1L D;  5L8R J;  1KN7 A;  2Z4E A;  1ZP0 C;  1KZU B;  1KFM A;  3KQG A;  1AVO A;  4DJG A;  3CC7 P;  3AED C;  3RL0 D;  2G8Y A;  4U3F J;  4WY4 D;  1L4A D;  3GHG C;  2E74 B;  1QEX A;  3H25 A;  3LW5 J;  2BCC G;  2QEX P;  4L74 A;  1LTT C;  2JO1 A;  1MFT A;  1NKZ B;  2FYN C;  3JCU H;  2XDJ A;  1L0L G;  1YJN P;  1KIL E;  2FXP A;  2QJK B;  1PV3 A;  2FFD A;  1BCC D;  1SQB J;  5AVU B;  1GZL A;  2G3A A;  3KZI H;  1SQX E;  2B9B A;  3IR9 A;  1YJW P;  2H7H A;  1PZQ A;  1KFN A;  1PP9 E;  4RKU J;  2D2C C;  3CME P;  1PPJ D;  2A45 G;  2BEQ D;  2IZ1 A;  3BAT A;  1M7L A;  4DOJ A;  1JNM A;  2E43 A;  1JTH B;  1MFZ A;  1YYC A;  3G6E P;  3O6Q B;  5KAI H;  2K88 A;  1RE4 A;  2YIU C;  1NTZ D;  4M3L A;  3TGU E;  5BU5 A;  1JEK A;  1X79 B;  4H0L D;  1NTM K;  2OYI C;  1QVF O;  4W7Y A;  4PD4 D;  1FZA A;  1T3U A;  4BRY A;  3VMX A;  5BVZ A;  1S5L X;  3NFQ A;  3WU2 E;  2QSI A;  3H1J D;  2MJZ A;  2E74 D;  1YBK A;  2PP6 A;  5AW8 B;  1N86 A;  3H1I D;  3R4Y A;  2YO3 A;  1X22 A;  1VQ8 P;  3RBX A;  4MN4 C;  3R2P A;  2N1T D;  2QIW A;  3WUU A;  1Q81 Q;  1KIL B;  2K9J B;  1NVO A;  3L72 D;  1URQ C;  4B86 A;  2Q5U A;  1HJ0 A;  1Q2N A;  1AJY A;  1OZH A;  3GMA A;  4O9B A;  1PGP A;  2KIK A;  1BGY E;  2H89 C;  4RO0 A;  1NTM J;  4TLF A;  4U3F E;  1GTW A;  1L0L K;  1MKM A;  2Z5H A;  3S4R A;  3FGA D;  5KLI B;  1N7S C;  5CBN A;  3TF5 A;  2RKL A;  2YO2 A;  3EFF K;  1BE3 J;  4Y28 J;  1VQ9 P;  3CC4 P;  1SQB E;  2W6A A;  2M0B A;  4HH2 A;  1QGK B;  4N78 E;  3WMM 0;  4XE5 B;  3G4S P;  4K35 A;  1SQV D;  1ZXG A;  4D6T G;  1J1E B;  1SQP E;  3C8V A;  1QL1 A;  2PGD A;  2JEE A;  2R5D A;  2HYN A;  1HBW A;  3HD7 D;  3FXD A;  2QJY C;  1JY2 P;  2ZYA A;  1A02 J;  3VP9 A;  1FOS E;  2AEM A;  4QMA A;  2BCC J;  2GUS A;  3SWY A;  3GF7 A;  3L71 E;  3RL0 g;  1L0L J;  4WY4 A;  1L4A A;  3CCM P;  3IFM A;  4JYC A;  4UB8 E;  2C0W A;  5E79 E;  4I7Z C;  3E1I A;  2C9L Y;  1FZC B;  1K04 A;  2R32 A;  1LWU B;  2R3C A;  1PP9 D;  1Q86 Q;  4YXW H;  4RJT A;  3B5N B;  4HYT B;  2IYO A;  3HUS B;  2ZFC A;  3JSV C;  1SQX G;  1JY2 N;  2PAJ A;  2WQY C;  1FDO A;  3P7K A;  4PD4 H;  3TGU D;  1IO4 A;  1W2B O;  5AVY B;  1UIX A;  1EC5 A;  1HF9 A;  2QM8 A;  3JC2 2;  3CC2 P;  1NTM E;  3RGU A;  2P7J A;  1QLE D;  5TIS E;  2OQQ A;  1LTJ B;  4U7J A;  5CJ4 A;  4N3Y B;  5KKZ C;  3NXS A;  3TGU G;  1FZB A;  5APT A;  2OYH C;  1JMM A;  1HUC A;  1H8A A;  3H1K E;  5AVQ B;  2OAR A;  2IPP A;  1DD3 A;  4EIJ A;  3AE6 C;  2NPS A;  2MKV A;  3GF3 A;  5CCH C;  3M91 A;  1VQN P;  3H6P A;  4W80 A;  1CSB A;  5B66 E;  4U3F D;  1E79 H;  2OYO A;  4WWI A;  2E5Y A;  2BCC E;  2KZI A;  1GL2 C;  1RE3 C;  4OWF A;  2I1J A;  1L0L E;  1CW5 A;  1IK9 A;  4YXD C;  2W27 A;  4NPE A;  1SQB D;  4GOF A;  3L73 G;  1JTH A;  2IBZ E;  2WZ7 A;  1BDD A;  1BGY G;  1DIP A;  3O6Q A;  4D6T J;  2H88 C;  4N78 D;  1DX7 A;  2ZT9 B;  2FXO A;  2V4H A;  1T6A A;  1N73 B;  1M1J B;  1USD A;  3RK3 C;  1GD2 E;  3IAO A;  1ZME C;  1VQO P;  1K9M Q;  3EWK A;  2QA4 P;  3A0B E;  5EFW B;  3CPW O;  3AE7 C;  3G3Z A;  2L91 A;  3RK2 B;  1KYO E;  2HR3 A;  1J1D C;  2XKM A;  2XND H;  1T2K C;  2E75 C;  3PLN A;  2ZAE B;  2AEJ A;  1X8Y A;  1SQP G;  5KLV K;  1LNQ A;  2KS1 B;  2JKV A;  5AW4 B;  1OFC X;  3CWB G;  1VF5 B;  3CXH E;  2IBZ I;  1X9V A;  1IFM A;  2E5T A;  1NH4 A;  5AW9 B;  1LT9 B;  1KIL A;  2R3S A;  3AEF C;  2A45 I;  2R44 A;  3N4X A;  3L71 G;  3B71 A;  3CCV P;  3EQ2 A;  4H44 B;  3I5C A;  1VQM P;  2KOG A;  3PHL A;  2Y0D A;  1FBM A;  1SQX J;  1KYO I;  2ZVO B;  1SFC B;  2IZ0 A;  4I1L A;  2P2U A;  2Q7C A;  1GU5 A;  1FZF A;  2C9N Y;  2GUV A;  1LTI C;  5GTI E;  3PH0 A;  4JQ0 D;  2ZT9 D;  2K3R A;  2Y0E A;  2IYP A;  3WU2 H;  1NTM D;  3KXD A;  5KLV J;  3UIA A;  3K5B A;  3CLQ A;  3TYY A;  2Y9Z A;  1KQF B;  2P67 A;  3G9R A;  1BE3 D;  2WVR A;  2B89 A;  1U7J A;  4TT3 H;  3I56 P;  1R5S A;  2H8P D;  1Y9B A;  4D6T E;  3V2Q A;  4DZO A;  1P84 E;  1VF5 D;  4L75 A;  4PJ0 E;  5KAF E;  5APV A;  1JM0 A;  2AEF A;  1K8A Q;  2UWJ E;  4ZMD A;  1LTB C;  1FZC A;  3LW5 H;  1LWU A;  4OGQ D;  2BCC D;  1SP4 A;  4H44 D;  3AE9 C;  3H1K G;  5CMZ A;  1ZRT D;  3CCU P;  1L0L D;  5AVX B;  2O01 N;  3B5N A;  3FXE A;  3RL0 C;  3L73 J;  4WY4 C;  2YIU B;  1L4A C;  1BGY J;  1PGQ A;  2QJP B;  3Q1M A;  2IFM A;  3HUS A;  1NHL A;  1VQL P;  1P84 I;  3CL3 D;  2NPS B;  2V7Q H;  4Y99 C;  1VQ4 P;  5APW A;  2WT7 B;  5KJ7 D;  1ZR2 A;  3VYI A;  4GOE A;  2IBZ G;  1KYO D;  2WSC H;  3TSI A;  1LTJ A;  3TNU B;  2W90 A;  1SQP J;  2B87 B;  4UB8 H;  1NAY A;  1LT1 A;  1VL2 A;  2JR8 A;  5E79 H;  4PV1 D;  2V7Q J;  3M9B A;  3CWB J;  1H88 A;  1URQ B;  3CXH D;  1NU1 K;  5KLV E;  2OTJ P;  4H0L C;  1Z56 A;  1L2P A;  1G1I A;  1VQP P;  1S4X A;  4CPG A;  3L71 J;  2WSC J;  3A0H E;  3V2P A;  2XZR A;  1FDM A;  3L70 G;  4AYC A;  2ZXX A;  1N7S B;  3F5H A;  3CCL P;  1PGJ A;  3D70 A;  2JDI H;  1CZQ A;  3MIW A;  2K37 A;  5AW0 B;  2HPC B;  2E74 C;  3D6Y A;  1M1K Q;  2O3J A;  1MV8 A;  1OVR A;  5AW5 B;  4IL6 E;  3WUV A;  2C0X A;  3T97 B;  2N9Y B;  2NPS D;  2N1T C;  5TIS H;  3IF4 A;  1OW8 A;  2JJL A;  2QJY B;  3P8M C;  2P10 A;  1JCC A;  1NU1 J;  2AXT E;  1N73 A;  1M1J A;  2J5U A;  3L73 E;  2I8D A;  1OW6 A;  2IFN A;  1RF0 A;  4D6T D;  1EDI A;  4I7Z B;  4N6J A;  3V5B A;  1KB9 E;  1ZN5 A;  3M06 A;  2KS1 A;  5B66 H;  1KQG B;  5GTH E;  1DH3 A;  1FC2 C;  4DT0 A;  1RF1 A;  4W7Z A;  3BAS A;  3C9I A;  3H1K J;  1AFO A;  1SQQ G;  1LT9 A;  3MUD C;  3L74 G;  1JUN A;  2WMM A;  2XU6 A;  3KHU A;  4LC1 A;  4ZKU A;  3HD7 C;  1FS0 E;  1GW4 A;  2FY8 A;  3L75 E;  3CWB E;  2FYU G;  3KPE A;  1G2C B;  1YI2 P;  2A45 H;  2LXC B;  3VMA A;  4BXL A;  1SFC A;  1KB9 I;  2Y9Y A;  3RK3 E;  1IFD A;  3BCC E;  3A0B H;  1LJ2 A;  3Q5R A;  1KIL D;  1S72 P;  3V4Q A;  2Z5I A;  1KYO H;  1LTA C;  1PIX A;  1WMK A;  1SQX D;  5KTB A;  4H13 C;  5KJ7 A;  1KMI Z;  3B4S A;  3NTN A;  1WT6 A;  4BWN A;  4KJM A;  2I1K A;  1JMB A;  3SSU A;  3MP7 B;  2BAS A;  3MTU E;  3CXH H;  1KD1 Q;  3M0D C;  3HE5 B;  3V6I A;  5KLV D;  4WB4 A;  3Q5P A;  1MUU A;  1NU1 E;  3I55 P;  3L70 J;  2E42 A;  1S9K E;  2KNC B;  1GL2 B;  3WUT A;  5DJU B;  2J58 A;  3ZDM A;  3LIE A;  1Y8A A;  1JY3 O;  1VQ6 P;  3MHV A;  5KLV G;  1VQK P;  2KK7 A;  3AE4 C;  3SWF A;  1AQT A;  1N7L A;  1HVV A;  1EDL A;  5GTI H;  1SQQ K;  1OMI A;  3FX0 A;  4ZKP A;  4EYY Q;  1IK7 A;  3RK3 B;  3O8Z A;  1ZOY C;  2YMY A;  1Y47 A;  3PTZ A;  3AEG C;  2WPS A;  2FYU K;  1RHZ B;  4UB6 E;  2M8R A;  1LWU C;  1Q90 D;  3MD0 A;  1LGH B;  2WT7 A;  2P1J A;  3BRT B;  3L73 D;  2XNX A;  2WIT A;  3AE5 C;  1BGY D;  1J2J B;  4DCK A;  5H2F E;  3II6 A;  1VDF A;  3B5N D;  4XFJ A;  1P84 H;  1AVY A;  2BEZ F;  4AUW A;  1L0N E;  3OAK A;  5KAF H;  2VRS A;  4PJ0 H;  5APS A;  3HUS C;  3TNU A;  2B87 A;  2PFX A;  3Q3D A;  2KP8 A;  1SQV K;  1WRG A;  1EZV E;  1H0T B;  1URQ A;  2YMK A;  2H43 A;  1SQQ J;  3H1L E;  3L74 J;  1N8R Q;  2FFD C;  3ABV C;  1MZ9 A;  1SQP D;  1GDT A;  3CCE P;  3CCJ P;  5CCG D;  3CWB D;  2FYU J;  2IDB A;  1JCD A;  2QM7 A;  1N7S A;  3VP8 A;  3P8C E;  2WSE H;  1IFP A;  3U1A A;  1HJB A;  3A2A A;  1BSH A;  2O01 J;  2POH A;  2HPC A;  5AVT B;  3VN0 A;  3L71 D;  3Q5S A;  1IJD B;  1RE4 C;  3L70 E;  3QH9 A;  1AA0 A;  1HH0 A;  3L36 A;  2W8Z A;  3V2N A;  5AVZ B;  1JY3 N;  1EZV I;  3L75 G;  1M8O B;  3T97 A;  4EDF A;  1RF1 B;  1LTS C;  1OX3 A;  1NTK G;  3CCQ P;  2WSE J;  1KTM A;  5CJ0 A;  4OVN F;  3OJA B;  2E76 B;  3BCC G;  2QRX A;  1NGM B;  2JWD A;  1IC2 A;  3CX5 E;  1VQ5 P;  2W83 C;  2JP3 A;  2FBW C;  2WWW A;  5M1B A;  3A0H H;  1FU1 A;  1FZG A;  1NU1 D;  3ITK A;  4R4M A;  1S9K D;  3CD6 P;  2ZT9 C;  2ZYD A;  4GOD A;  1GW3 A;  2IX7 C;  3PRJ A;  1M1J C;  3BVH A;  1BDC A;  2KLU A;  3H1J E;  2LKM A;  4JF7 A;  2K9Y A;  2XV5 A;  3GG2 A;  3H32 B;  2FXM A;  3FWN A;  4IL6 H;  3W67 A;  1NU1 G;  3RK2 D;  3GHG B;  1GK4 A;  3VMY A;  2YKP A;  3GW6 A;  1OVU A;  2YNY A;  2FKW B;  3CX5 I;  4Y99 B;  1SQQ E;  2FYN B;  3L74 E;  3H1H G;  1G2C A;  5AW7 B;  3L72 E;  3H1K D;  1VF5 C;  4WBA A;  1UII A;  1YQ3 C;  2AXT H;  1LT9 C;  2YXQ B;  4IOI H;  2FYU E;  1X0T A;  2WPQ A;  1K73 Q;  2D2C B;  4OGQ C;  4H44 C;  1OXZ A;  2E76 D;  3FWL A;  1KB9 H;  2YKO A;  3VOP A;  1CI6 B;  1W5C E;  3IN6 A;  2W6J H;  2N9B A;  1ZLL A;  3L4F A;  1NTK K;  3E7K A;  5GTH H;  3VMZ A;  1SFC D;  3P32 A;  4H0L B;  5CBO A;  1OW7 A;  3HE5 A;  2IBZ D;  2OYI B;  1JOC A;  1SQV E;  5APU A;  1KV4 A;  2RMZ A;  1L0N G;  1HWT C;  1EQ7 A;  2ITA A;  5KJ7 C;  2P58 A;  1M56 D;  1KQS O;  5AVR B;  2KNC A;  1GL2 A;  1RE3 A;  3V2R A;  1EZV G;  3VTP C;  2K1A A;  3P8C D;  2PRR A;  2LXB A;  3H1L G;  3S9O A;  1DEB A;  1D7M A;  5CCG A;  2KSE A;  1IFJ A;  2M5A B;  1USE A;  3MGN A;  4PV1 C;  2N1T B;  3L70 D;  2ZXE B;  2KI7 B;  3L75 J;  4IL6 X;  3L35 A;  5C39 A;  1NTK J;  3N7N A;  3BRV B;  2D2C D;  2KLV A;  2RH0 A;  1E5W A;  1R5L A;  1DEE G;  3BCC J;  3GLM A;  4RES B;  3TK1 A;  1YTZ I;  1BCC G;  1U57 A;  3U1C A;  1QVG O;  5AVV B;  3CX5 D;  3G71 P;  2QJP C;  3AEB C;  1PPJ G;  1YTZ T;  3AE2 C;  2HLO A;  1AV1 A;  1FDI A;  1KOR A;  2WPV B;  2B88 A;  1OWA A;  3LID A;  1S3J A;  2NPS C;  2W6B A;  1H0T A;  3OW2 O;  2QVA A;  2QJK C;  3HD7 B;  2YXR B;  2HG5 D;  2OTL P;  2CPS A;  4A7P A;  1EXI A;  2ZVN B;  1HGZ A;  1NTZ G;  2AXC A;  2OTK E;  1LP1 B;  2CK3 H;  1NJI Q;  3C1L A;  4ASW A;  1SVF A;  4JBZ A;  5B5E E;  1L0N K;  3H1H J;  3SFD C;  2FYZ A;  2KSJ A;  1SQQ D;  3L74 D;  1GK6 A;  1ZV8 A;  3H1J G;  3M9H A;  2GA1 A;  4UB6 H;  1JY2 O;  1P84 D;  2NRG A;  1URQ D;  4LGD E;  4L76 A;  3A7O A;  1S2E A;  2HOD A;  4IFD K;  1Q82 Q;  4H13 B;  1S5L E;  2HFE D;  3H1I G;  2FYU D;  5H2F H;  2M3B A;  1DD4 A;  1JB0 J;  1NYH A;  3Q2Y A;  1NAF A;  3L72 G;  1FE6 A;  1N7S D;  3CCS P;  2GM4 A;  2NZ2 A;  3SFE C;  4HKZ H;  1YIJ P;  1GMJ A;  1M90 Q;  1U7M A;  2O1J A;  3KDP B;  1W2E A;  2WTY A;  3AEE C;  1PFI A;  1NTK E;  4EOT A;  1L0N J;  2WSF H;  4JPZ B;  2Y0C A;  3AE1 C;  3EFG A;  1NKN A;  3AE8 C;  2A06 E;  4XA4 A;  3JCU E;  1KIL C;  4IFF A;  2O1K A;  5KKZ B;  3W68 A;  1RQU A;  3KZI E;  3H1L J;  4C7R A;  1YQ4 C;  5APX A;  5K5G B;  1VQ7 P;  4LLH A;  1G1J A;  1SQV G;  3H32 A;  2OYH B;  4NPF X;  2WSF J;  4C7N B;  3NMD A;  5KLI C;  2M3E A;  3GHG A;  1NTZ K;  3B8E B;  4YPC A;  1H89 A;  3MZW B; 
#chains in the Genus database with same CATH homology
 1XTG B;  1JCD A;  2QM7 A;  1N7S A;  3HE4 A;  1FJK A;  2L5G B;  3VP8 A;  4GKG A;  3P8C E;  2PP6 A;  1LTB C;  2WSE H;  5AW8 B;  1N86 A;  3U1A A;  1HJB A;  5AW3 B;  1FZC A;  3A2A A;  3A3Y B;  2YO3 A;  3LW5 H;  2POH A;  1LWU A;  1SP4 A;  5AVT B;  3VN0 A;  2HPC A;  1J1E C;  3R2P A;  1IJD B;  2N1T D;  5CMZ A;  1RE4 C;  1HH0 A;  3L36 A;  1KIL B;  3V2N A;  5AVX B;  5AVZ B;  1JY3 N;  1URQ C;  4B86 A;  3B5N A;  4GIF A;  3T97 A;  2Q5U A;  3RL0 C;  4WY4 C;  1RF1 B;  1L4A C;  1LTS C;  3HTK A;  1CI6 A;  4O9B A;  2IFM A;  3HUS A;  1NHL A;  5CJ0 A;  1GTW A;  2FFD B;  1L0L K;  4IFM A;  3HRN A;  1FOS F;  2Z5H A;  3OJA B;  3CL3 D;  2NPS B;  4Y99 C;  1N7S C;  5APW A;  2OYI A;  2WT7 B;  5KJ7 D;  1ZR2 A;  2YO2 A;  1IC2 A;  3VYI A;  2R5B A;  1FZC C;  3OA7 A;  5AW2 B;  1GU4 A;  2WWW A;  2W6A A;  1FU1 A;  1RY3 A;  2WSC H;  3TSI A;  1FZG A;  1LTJ A;  1J1D B;  4HH2 A;  2J59 M;  4N78 E;  3WMM 0;  3TNU B;  1S9K D;  4XE5 B;  3KYQ A;  1GW3 A;  2IX7 C;  3B5N C;  1J1E B;  1M1J C;  3BVH A;  3M9B A;  5AW1 B;  1QL1 A;  1NOH A;  4KHX A;  2JEE A;  2LKM A;  1QL2 A;  2R5D A;  2HYN A;  1IFN A;  1H88 A;  3HD7 D;  4JF7 A;  1JY3 P;  1HBW A;  1URQ B;  2XV5 A;  1JY2 P;  1NU1 K;  3H32 B;  2N1T A;  5CCH D;  2FXM A;  1A02 J;  3VP9 A;  1FOS E;  1Z56 A;  1G1I A;  2GUS A;  3RK2 D;  3GHG B;  1GK4 A;  3VMY A;  2YKP A;  3SWY A;  2YNY A;  3V2P A;  2FKW B;  2XZR A;  5AW6 B;  1FDM A;  4WY4 A;  2O01 H;  1LTG C;  1L4A A;  2KB7 P;  4Y99 B;  1GL2 D;  4AYC A;  1N7S B;  5AW7 B;  3IFM A;  1G2C A;  4JYC A;  1AQ5 A;  5APY A;  2C0W A;  4WBA A;  4GT1 A;  5APQ A;  3E1I A;  5CCG C;  2C9L Y;  1FZC B;  1LTJ C;  2R32 A;  1LT9 C;  1CZQ A;  3MIW A;  1LWU B;  5AW0 B;  2HPC B;  2R3C A;  1MV8 A;  2WPQ A;  5AW5 B;  3L37 A;  1HTL C;  1T3J A;  3B5N B;  2C0X A;  1OXZ A;  2NPS D;  2N1T C;  1SQX K;  2YKO A;  3RK3 D;  4HYT B;  3VOP A;  2HOD B;  1CI6 B;  2JJL A;  3P8M C;  2N9B A;  1IFI A;  3MUD A;  1ZLL A;  1T8Z A;  3HUS B;  2ZFC A;  1JCC A;  3L4F A;  1JY2 N;  2PAJ A;  1NTK K;  1N73 A;  3VMZ A;  1SFC D;  1M1J A;  3P7K A;  3P32 A;  3HD7 A;  1IO4 A;  5AVY B;  3HE5 A;  2OYI B;  1T2K D;  1JOC A;  2QM8 A;  3M0A A;  1FAV A;  1NO4 A;  5APU A;  2IFN A;  1HWT C;  1RF0 A;  1VPC A;  2P7J A;  1EQ7 A;  1A02 F;  4N6J A;  5KJ7 C;  4I6M C;  3V5B A;  1XTC C;  1LTJ B;  1SLQ A;  1ZN5 A;  5AVR B;  1GL2 A;  1RE3 A;  5CJ4 A;  3M06 A;  4N3Y B;  3V2R A;  3NXS A;  3VTP C;  3U59 A;  5BU8 B;  1FZB A;  1DH3 A;  3P8C D;  5APT A;  2OYH C;  1JMM A;  2Q9I A;  1DEB A;  1RF1 A;  5CCG A;  4W7Z A;  3BAS A;  3C9I A;  2Q3I A;  1HUC A;  1AFO A;  1IFJ A;  1LT9 A;  3MGN A;  1KQL A;  2N1T B;  1H8A A;  1JUN A;  5AVS B;  2XU6 A;  1FZE A;  4LC1 A;  4ZKU A;  1N73 C;  2ZXE B;  3A5T A;  3HD7 C;  5AVQ B;  2OAR A;  2IPP A;  3L35 A;  1GW4 A;  4I2L C;  4EIJ A;  3PP5 A;  2NPS A;  5CCH C;  3M91 A;  3RL0 B;  3H6P A;  4WY4 B;  4W80 A;  2CPB A;  3KPE A;  5AVW B;  1CSB A;  1L4A B;  1FJP A;  3N7N A;  3RK2 C;  1G2C B;  3M0D A;  1RF0 C;  3BRV B;  2KLV A;  2A45 H;  1HGV A;  1SFC A;  1E5W A;  4RES B;  3TK1 A;  1GL2 C;  1RE3 C;  1YTZ I;  3U1C A;  1IFD A;  2I1J A;  3HE4 B;  1KIL D;  1CW5 A;  5AVV B;  3V4Q A;  1IK9 A;  3CI9 A;  2Z5I A;  1RF1 C;  2W27 A;  2WPR A;  1LTA C;  5CHX A;  1JTH A;  5KTB A;  1JO5 A;  1YTZ T;  2WZ7 A;  1ZR4 A;  2HLO A;  5KJ7 A;  4AQR D;  4C46 A;  3NTN A;  1WT6 A;  3V4W A;  4N78 D;  1DX7 A;  1OWA A;  3LID A;  2I1K A;  2NPS C;  2W6B A;  2YKQ A;  1N73 B;  1M1J B;  4JYB A;  2BAS A;  3MTU E;  3RK3 C;  3HD7 B;  1GD2 E;  1SQB K;  2HG5 D;  2OYH A;  3M9Q A;  2CPS A;  1N2D C;  3HTK B;  3M0D C;  3HE5 B;  1NWQ A;  1HGZ A;  4C7N A;  4WB4 A;  1SFC C;  1MUU A;  3G3Z A;  3RK2 B;  2KYV A;  1SQP K;  1SVF A;  4OH8 B;  1J1D C;  2XKM A;  1T2K C;  2E42 A;  1S9K E;  1L0N K;  5CCH A;  1X8Y A;  1GL2 B;  2FYZ A;  5KLV K;  2KSJ A;  2Z4E A;  1GK6 A;  1ZV8 A;  5AW4 B;  3M9H A;  1KZU B;  1KFM A;  2J58 A;  3LIE A;  3KQG A;  1JY3 O;  1JY2 O;  1URQ D;  4LGD E;  1X9V A;  1IFM A;  1NH4 A;  3RL0 D;  3SWF A;  3A7O A;  5AW9 B;  1LT9 B;  4WY4 D;  2HOD A;  1N7L A;  1HVV A;  1L4A D;  1KIL A;  4IFD K;  2HFE D;  3GHG C;  2A45 I;  1SQQ K;  3N4X A;  2M3B A;  1LTT C;  1NKZ B;  3EQ2 A;  4ZKP A;  2XDJ A;  1NAF A;  3I5C A;  3RK3 B;  3O8Z A;  2YMY A;  1N7S D;  2KOG A;  2GM4 A;  2FFD A;  1FBM A;  2WPS A;  2FYU K;  5AVU B;  1GZL A;  2M8R A;  1SFC B;  1LWU C;  3MD0 A;  4I1L A;  3IR9 A;  2P2U A;  2Q7C A;  2H7H A;  1LGH B;  1KFN A;  2O1J A;  3KDP B;  1GU5 A;  2WT7 A;  2P1J A;  1FZF A;  2C9N Y;  2GUV A;  3BRT B;  1LTI C;  2XNX A;  1W2E A;  2WTY A;  1PFI A;  2WIT A;  2A45 G;  1J2J B;  4EOT A;  3BAT A;  1M7L A;  2WSF H;  3II6 A;  4DOJ A;  1VDF A;  3B5N D;  1JNM A;  4AUW A;  3EFG A;  2E43 A;  1NKN A;  3OAK A;  1JTH B;  2VRS A;  4XA4 A;  3UIA A;  1KIL C;  5APS A;  1MFZ A;  3CLQ A;  4IFF A;  3TYY A;  1YYC A;  3HUS C;  3TNU A;  2O1K A;  1RE4 A;  2KP8 A;  1SQV K;  1WRG A;  4M3L A;  5BU5 A;  1X79 B;  4C7R A;  5APX A;  2P67 A;  1NTM K;  1URQ A;  2H43 A;  2OYI C;  4LLH A;  1G1J A;  4W7Y A;  1FZA A;  3H32 A;  2OYH B;  2FFD C;  1T3U A;  4C7N B;  3VMX A;  5BVZ A;  3NMD A;  2H8P D;  3GHG A;  1MZ9 A;  3NFQ A;  3V2Q A;  1NTZ K;  4DZO A;  3B8E B;  1H89 A;  2MJZ A;  1GDT A;  5CCG D;  5APV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...