1HGZA

Filamentous bacteriophage ph75
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
source organism Bacteriophage ph75
molecule tags Virus
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
total genus 12
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hgzA00
1NH4A 1IFIA 2CPBA 1IFDA 2C0XA 1IFJA 1HGZA 1HH0A 2CPSA 2MJZA 1HGVA 1FDMA 2C0WA
chains in the Genus database with same CATH superfamily
3CX5E 5APVA 3CCLP 3A0BE 1NTKJ 3BVHA 3I5CA 3RK2D 1RF1B 1FZCC 4QMAA 3HTKB 3Q5PA 3GHGA 1L0ND 3VMZA 3EFGA 3CCJP 2E76D 1X79B 3NXSA 2V4HA 3PHLA 1KB9D 1FZCB 3TGUG 1H88A 2AEFA 2YXRB 5AW1B 1L0NG 1NAYA 1NU1E 4C7NB 1SQQD 3H32B 2WSFJ 1BCCD 3CWBE 3V2NA 2WSFH 3PH0A 2D2CC 2KB7P 2E75C 1SQVD 2KK7A 4UB6H 1NHLA 2OYHB 3H1IG 4UB6E 1FU1A 1SQQK 2WPSA 5KJ7A 2K37A 4AUWA 3H1JE 2IX7C 1YI2P 1FDMA 1BGYE 3TGUJ 1LTJA 2JP3A 1Q86Q 4OGQB 2RN0A 4JYBA 2W6JH 1JOCA 4JYCA 2HFED 3HD7C 2WPRA 1DEEG 3CL3D 3H1HE 3L74E 4HH2A 3RBXA 1VQPP 1JMBA 1W5CE 3CCVP 1FDIA 1NTKG 2OTJP 1NTZE 4XFJA 3H1KG 2B87A 1EQ7A 3G9RA 4N78E 2M5AB 1URQA 3HD7B 2BEQD 4BXLA 3H25A 1SQXG 1EDKA 5BU5A 3L71E 2K9JB 5AW5B 3L75J 4LGDE 2FYUK 3H1KD 2IFMA 1QL1A 2JR8A 4JPZB 3C8VA 4N78D 1SQPE 2R44A 1SQVE 3B5NC 3HRNA 1RE4C 1H0TB 1OXZA 2BCCD 1AVOA 3PTZA 3GHGC 1VQOP 2E75B 4GOEA 4W80A 1EXIA 2A45G 2FYUG 3L75D 1BGYD 1MZ9A 1RE3A 2HYNA 1NTZJ 2AXCA 2N1TB 2XNDH 2Q5UA 3MHVA 5CCGD 1ZP0C 5K5GB 2C9NY 3R2PA 1JTHA 4XE5B 3GHGB 2KLUA 5L8RJ 3D70A 4OWFA 3O6QB 1EDIA 3H1HD 1T3UA 3L74D 1JCDA 1LP1B 2KP8A 2ZXXA 2BCCJ 1H0TA 2LR2A 1KYOH 1LNQA 5KAFE 4D6TE 1GU5A 1VQ7P 4D6TG 2FBWC 1FZGA 1N7SA 2KSJA 2M0BA 5KLIC 1FAVA 3GMAA 3L71D 3L72J 1LT9C 1FC2C 2ZJSE 1T8ZA 1SQXJ 2P1JA 1LP1A 1LWUC 3C9IA 3HE5A 4IFMA 5CCGC 3U59A 3SWFA 1RF1C 1VQ9P 3CC4P 1JUNA 2PGDA 1JCCA 1WMKA 1NTMK 3L4FA 4KHXA 3TNUA 1NKNA 1NTZK 2KLVA 2M3BA 2O01N 3M06A 2PFXA 4I1LA 5CBNA 2QEXP 5KLVD 4DJGA 1QEXA 4I7ZB 1YYCA 2OQQA 3KQGA 1GK4A 3L70D 2J58A 2QJYC 1OVUA 3HE5B 4JQ0D 1HJBA 1N73A 2JDIH 1BE3J 2G8YA 4L74A 1KB9E 1Q90D 1JEKA 2KI7B 3A2AA 1AVYA 4ZMDA 4BRYB 3PJSK 1YITP 2H7HA 1Q7YQ 3Q5RA 2M5AA 3I56P 1SQQE 1BCCE 4PV1D 2O3JA 4YPCA 1BSHA 1M1JB 1YQ3C 2HG5D 4H44C 3L70J 1SQXK 3O8ZA 1M56D 4GDOA 2QM8A 2R3CA 5EFWB 4DZOA 1N73B 3H1LG 1N7LA 1BDDA 2KXPB 4WY4D 2O01H 1LTIC 1YJWP 1GZLA 2YMKA 1SQPD 3IAOA 1FBMA 2IBZD 2IFNA 1M1JA 2K88A 2QVAA 2N9YB 2OYOA 4RJTA 1LWUB 2B9BA 4PD4D 4B86A 1EDLA 1BE3E 3B5ND 1GW3A 1SQPK 3G6EP 1VQ4P 3AECC 3P8MC 5AVRB 2RKLA 3O6QA 1PFIA 1KV4A 3B5NA 3H6PA 1M57D 2A06G 1ZRTE 2VRSA 2WMMA 3K5BA 5DJTB 3V6IA 4U3FJ 3VMAA 1KQLA 1VL2A 2RMZA 2FXOA 1JNMA 1SQXE 1R5SA 4JBZA 1VQLP 3F89A 2C0XA 4H13D 2BEZF 2MJZA 5H2FE 3ZDMA 2K3RA 1L4AA 1GW4A 4N3YB 5APXA 4EYYQ 1AFOA 2PP6A 5AVYB 5AVUB 4ZKPA 2IZ0A 1PV3A 2YNYA 2QIWA 1Z56A 1SQBJ 2XZRA 1OIPA 2QJYB 1LTGC 1SQPJ 2IYOA 3V4QA 2OYIC 3TDKA 3IFMA 1ZLLA 2Z5IA 3AEDC 1DEBA 1PGJA 1U7MA 3BCCD 2Q7CA 4IFFA 2NPSC 4OGQD 4PD4I 2R5BA 5GTHH 5E79H 1L4AC 4K3AA 1L0LD 5AVWB 2NRGA 3TK1A 3WU2E 5KTBA 3HUSC 1SFCA 1J1EB 3V2PA 1GTWA 1R5LA 4H44D 1GMJA 1NU1G 3V5BA 1GL2A 4YTPC 4EDFA 3NMDA 3D6ZA 2YMYA 1SQBG 1WT6A 4EIJA 1KQFB 2E76C 1CSBA 2GA1A 4YXWH 2ZAEB 3SFDC 1N2DC 1S9KE 3EQ2A 1RF1A 1MKMA 1PZQA 1G2CA 3AEGC 3N4XA 5AVXB 4YXDC 2HODB 3B8EB 2FFDA 1SFCB 1S5LX 2O1KA 4U3FD 3SWKA 3GLMA 2P67A 3MUDC 1RHZB 1S5LE 2KS1A 2MKVA 3AE5C 3ABVC 2C0WA 4OH8B 1FZCA 1HJ0A 2Q3IA 1SQVJ 1PP9D 1RY3A 1LTSC 1KILD 1AA0A 3OA7A 1E5WA 4U3FE 4U3FG 1P84D 1URQD 2QA4P 1IK9A 5APUA 3RL0D 4UB8E 1HUCA 1BE3D 2FYNC 1FZBA 3H1JD 3UIAA 1VPCA 3CC7P 3RK3C 3H1LE 1KC8Q 2HPCB 4I7ZC 1X22A 4O9BA 1DIPA 2XDJA 1KILA 2LXCB 3AE1C 3CXHE 1JY3P 1OVRA 3AE7C 3MUDA 1LTJB 2H43A 1L0LK 1YTZI 3EWKA 3MZWB 3FWLA 3BCCJ 1VQ8P 3HUSB 2Q9IA 1SQBE 1ZV8A 2W6AA 3SFEC 4R4LA 2Y9ZA 3CWBD 4WY4A 2E42A 3H1IE 3AE3C 2IDBA 3V4WA 1N8RQ 1QVFO 1TU3F 4HYTB 1NVOA 1JM0A 1RF0A 3IF4A 5AW9B 4PV1B 1VF5C 2OYIB 1KILB 3CWBG 3WUVA 1N73C 2LKMA 1USDA 1JMMA 3HD7A 2OTKE 3HUSA 3RGUA 1SFCC 1PGPA 1EZVG 2K9JA 2OTLP 1LT9A 3EFFK 4WY4B 1HF9A 1JY3O 1KILC 1M7LA 1NKZB 1T3JA 4L73A 2Z4EA 1P84I 5KAFH 4UB8H 2ZYAA 3CCEP 1T2KD 2Y0CA 1KFMA 1KYOI 1LT9B 2WPVB 1KTMA 2JKVA 1D7MA 3A7OA 1YBKA 3SWYA 2KIKA 1E79H 3FXDA 2N1TD 1BCCG 3W68A 5CCHD 3H1JJ 3Q1MA 3MGNA 1HWTC 1PL5A 5KJ7C 1U57A 3CCRP 1S9KD 1Q81Q 3CLQA 1NTMD 3HE4B 1RE3C 3JCUH 3JCUE 4ASVA 4C46A 4D6TD 4CPGA 2OYHA 1K05A 1OW8A 1PIXA 4LLHA 1R8EA 2FYZA 3VMXA 2FYUE 4KJMA 2NPSD 4OGQC 4RKUJ 3A0HH 3H1LJ 3RK3E 1VQNP 2CK3H 5AW0B 5B66H 3S1KA 2E5YA 4NPDA 1XTCC 2QJPC 1OZHA 3LW5J 3VMYA 5GTHE 2ZT9B 1K04A 3LW5H 5AW2B 2KOGA 2D2CD 1N7SC 2JWAA 2A06D 2XV5A 2E74B 4LC1A 2O1JA 5E79E 3TNUB 3AEEC 3M9BA 1M1JC 4GT1A 1HGVA 3AEFC 2WT7A 5GTIE 3L36A 3KZIE 2B88A 2R32A 3AE4C 3E1IA 1SQQG 1ZR4A 1J1EC 1ZN5A 4H13C 5APSA 3FWNA 2M3EA 3GG2A 5H2FH 2OGUA 3FX0A 1NTKD 1S2EA 3GF3A 4H0LC 2QSIA 4WVZA 3TGUD 2OYIA 1T2KC 2DW3A 1SP4A 1OW7A 2Z5HA 1J2JB 2O01J 1KQSO 2E76B 1S5LH 2WT7B 4GOFA 2WVRA 3A5TA 1FJKA 5CCHA 5KLIB 5AVQB 3Q5SA 2WITA 3C1LA 3A0HE 2E74D 3M9QA 4IL6E 3CMAP 3CCUP 1IFPA 3CC2P 1CI6B 2IBZI 1SFCD 2J5UA 1SQQJ 1ZW0A 2QG4A 1EZVI 3W67A 2IZ1A 4D6TJ 2KYVA 1RF0C 3E1RA 3U1AA 3S4RA 1BSNA 2BCCG 4PD4E 3PP5A 1Q2NA 1SVFA 2KUBA 3H1HJ 3L74J 1YJNP 3CXHH 3KDPB 2KNCB 5B5EH 1S72P 1LWUA 3L37A 1N7SB 5KJ7D 1RQVA 2QM7A 3H1KE 5GTIH 5CCGA 2WTYA 1NTZG 1CI6A 2YO3A 1ZRTD 1SQBK 4KT0J 1G1IA 2FYUJ 5CCHC 3KPEA 5AW6B 3Q3DA 3KHUA 2PRRA 1NAFA 3L71J 4M3LA 3V2QA 1VQMP 3AEAC 1M8OB 2P10A 4PJ0E 3P32A 4NPFX 1NTZD 1Y8AA 2K1AA 3M0AA 1QVGO 1L0NJ 1FOSE 1N7SD 3Q2YA 2QJPB 2Q3EA 3V2RA 1S1CX 5AW3B 5CBOA 3II6A 1L4AB 1EZVE 1YQ4C 2FYUD 3L75G 4RESB 3VYIA 1YIJP 2SPZA 2YKQA 4IFDK 3H1JG 1W2EA 1BCCJ 2B89A 1HBWA 1FS0E 3H1KJ 2GUSA 5M1BA 1JY2P 1EZVD 3PRJA 4TLFA 4BRYA 3B71A 1IFJA 4AYCA 1GD2E 2W8ZA 4H13B 4EOTA 2YO2A 4RO0A 1SQXD 2PAJA 2FKWB 3MTUE 2ZVNB 5APWA 2N1TC 2AEJA 1OWAA 2WZ7A 1T6AA 1L0NE 1LTTC 1QLED 1AQ5A 1IK7A 2WSCJ 2ZFCA 2OYHC 1NTMJ 3SSUA 1SQVK 4R4MA 1M1KQ 2WPQA 1KQGB 2B87B 1ZXGA 1NYHA 3M0DA 1YJ9P 3T97A 2JO1A 3OW2O 4XA4A 1GL2B 3H1IJ 1X0TA 3RK3D 5KLVE 3L71G 1FDOA 3LIEA 3IR9A 4Y28J 1KZUB 3GW6A 5KLVK 3G4SP 3IN6A 2L91A 5KKZB 1EC5A 1IC2A 4PD4H 4WBAA 1IO4A 3AE6C 1FZAA 2BASA 1DH3A 5AVTB 2YIUC 3CX5D 4U7JA 3WU2H 2WQYC 2Y0EA 4NPEA 1IFMA 2P58A 3B5NB 3H1HG 1L0LE 1LT1A 3L74G 3L75E 1KILE 1IFIA 1VF5D 3MP7B 3CXHI 2FFDC 1YTZT 1IFDA 1S3JA 1LTAC 1KMIZ 3OJAB 2KNCA 3NFQA 1Y47A 2I1JA 1USEA 1PPJE 2WSCH 3ITKA 3H32A 3MIWA 5TISE 3RBZA 5AVVB 3BATA 4C7NA 3P7KA 3KZIH 4H0LD 2KZJA 3BRVB 1K9MQ 3FXEA 1XTGB 2K9YA 3QWOC 3WUUA 5APYA 1BGYJ 2XNXA 3TGUE 4HKZH 3U1CA 2WSSH 1RE4A 3BRTB 1GU4A 2I8DA 2AXTE 5BVZA 2NZ2A 5AW7B 1SQVG 2LXBA 3L72D 1A02F 3KYQA 1PGOA 3AE2C 4H44B 3RL0C 2XU6A 3AEBC 1FZEA 5C39A 3VTPC 1NH4A 1DX7A 1GL2C 1JY2N 1Y9BA 1VQ5P 5AW4B 3BCCE 1NJIQ 5KKZC 2E43A 3D71A 2H88C 3P8CE 1U7JA 3JC22 4IL6X 4GIFA 1VQ6P 3PLNA 4ZKUA 4L75A 2E75D 2IBZE 1KYOE 2Y9YA 2ZXEB 2AEMA 2UWJE 3CXHD 2C9LY 5APTA 1LTBC 3GF7A 1FJPA 3E7KA 1KORA 2OARA 5KLVJ 2FXMA 2JWDA 2QJKB 4DT0A 1KYOD 3L73J 4W7ZA 1FOSF 3WMM0 3T97B 2JJLA 1SQPG 3TSIA 4DCKA 1LTJC 1H8AA 2A45I 4AQRD 1KD1Q 2V7QH 3VP9A 2BCCE 3AE9C 1K73Q 2ITAA 2N1TA 1MUUA 1VQKP 1UIIA 3CMEP 1CW5A 2E5TA 1PP9J 1KFNA 4Z1MH 1DD4A 1JTHB 4DOJA 2FYNB 1GL2D 3CX5H 3AE8C 3I55P 1OX3A 2L5GB 3CCQP 2FY8A 1HVVA 2W27A 3N7NA 1MFTA 3G71P 3TYYA 4MN4C 1EXJA 3RL0B 4K35A 4OVNF 1OW6A 1PPJG 3P8CD 1AJYA 2R5DA 4TT3H 4ASWA 1A02J 1MV8A 1BDCA 4WY4C 1DD3A 1L0LG 5B5EE 1PPJD 2V7QJ 1IJDB 4I6MC 1ZOYC 2HLOA 2M8RA 2W6BA 1GK6A 2YKPA 3CWBJ 2D2CB 1KB9H 2W83C 4PV1C 3RL0g 3VP8A 3VOPA 3CPWO 3L73D 5BU8B 1GDTA 3H1ID 2IPPA 1PP9E 4PJ0H 4Y99B 3WUTA 5KAIH 2QJKC 2I1KA 2WWWA 1ZMEC 5B66E 2HR3A 2YXQB 1W2BO 2CPSA 2QE7H 3L73G 4N6JA 3BCCG 3BASA 4HB1A 1X8YA 4Y99C 3FGAD 5APQA 1YHQP 2RH0A 2Q6QA 3L70E 1FZFA 2R3SA 3L70G 1HH0A 1AQTA 2P2UA 3RK3B 3RK2B 3CD6P 2P7JA 1OVVA 2A06E 2IYPA 1Q82Q 1NOHA 1CZQA 1LGHB 5AVSB 3VN0A 1QGKB 3L35A 3D6YA 2YIUB 2ZYDA 1H89A 1SQBD 1L0LJ 1X9VA 5AW8B 4C7RA 1BE3G 4EI2A 1JY2O 2ZT9C 1WRGA 1OFCX 1NGMB 1M90Q 1KN7A 2NPSA 1AV1A 2POHA 3HE4A 5TISH 1VF5B 1NU1D 3H1LD 3L72E 1MFZA 1NTKE 2AXTH 3MD0A 3A3YB 1N86A 5KAIE 3USSA 1RQUA 2Y0DA 1OMIA 4GODA 1NTME 5AVZB 2ZT9D 1ZR2A 1VDFA 1PP9G 3HD7D 4IOIH 2QRXA 4WB4A 4WWIA 2Q1KA 1JO5A 3JSVC 1J1DB 1G2CB 2KZIA 3F5HA 2IBZG 3KXDA 3NTNA 4W7YA 2HODA 1UIXA 1BGYG 5CJ0A 2NPSB 5TJHA 2FFDB 2N9BA 2YKOA 3L72G 1NU1J 1QL2A 2WSEJ 1IFNA 1IZNB 1SLQA 2KS1B 1JB0J 2H89C 3LIDA 1J1DC 1SS1A 2ZYGA 3M0DC 4L76A 1P84E 1NO4A 1P84H 1L0NK 3G3ZA 2CPBA 3A0BH 2J59M 4JF7A 5KLVG 2ZVOB 1G1JA 4IL6H 3CCMP 4ZNCA 3CCSP 5CHXA 1L2PA 1NTKK 4H0LB 1KB9I 1LJ2A 1QX8A 1S4XA 3R4YA 2GM4A 4I2LC 4GKGA 4HJGH 3OAKA 2HPCA 1FE6A 1NWQA 1HGZA 2WSEH 1URQB 3B4SA 5DJUB 3S9OA 3TF5A 3L73E 1K8AQ 1EDJA 1L4AD 1RH5B 1NU1K 3RK2C 1JY3N 1NTMG 4A7PA 2W90A 2JEEA 1URQC 2GUVA 2KSEA 1HTLC 2A45H 2G3AA 3HTKA 3QH9A 2E74C 5CJ4A 2FXPA 3M9HA 5CMZA 4BWNA 2H8PD 1PGQA 3CX5I 2XKMA 3M91A 3CI9A
chains in the Genus database with same CATH topology
5APVA 3BVHA 3I5CA 3RK2D 1RF1B 1FZCC 3HTKB 3GHGA 3VMZA 3EFGA 1X79B 3NXSA 1FZCB 1H88A 5AW1B 4C7NB 3H32B 3V2NA 2WSFH 2KB7P 1NHLA 2OYHB 1FU1A 1SQQK 2WPSA 5KJ7A 2IX7C 1LTJA 4JYBA 1JOCA 4JYCA 2HFED 3HD7C 2WPRA 3CL3D 4HH2A 5APTA 1EQ7A 4N78E 1URQA 3HD7B 5BU5A 5AW5B 4LGDE 2FYUK 2IFMA 1QL1A 4N78D 3B5NC 3HRNA 1RE4C 1OXZA 3GHGC 4W80A 2A45G 1RE3A 1MZ9A 2OYHC 2HYNA 2N1TB 5CCGD 2Q5UA 2C9NY 3R2PA 1JTHA 4XE5B 3GHGB 1T3UA 1JCDA 2KP8A 1GU5A 1FZGA 1N7SA 2KSJA 1FAVA 1LT9C 1T8ZA 2P1JA 3HE5A 3C9IA 1LWUC 4IFMA 5CCGC 3SWFA 3U59A 1JUNA 1JCCA 4KHXA 3L4FA 1NTMK 3TNUA 1NKNA 1NTZK 2KLVA 2M3BA 4I1LA 3M06A 1YYCA 3KQGA 1GK4A 2J58A 1N73A 3HE5B 1HJBA 3A2AA 2H7HA 1M1JB 2HG5D 5AVVB 1SQXK 3O8ZA 4DZOA 1N73B 2QM8A 2R3CA 1N7LA 4WY4D 2O01H 1LTIC 1GZLA 1FBMA 2IFNA 1M1JA 1LWUB 4B86A 3B5ND 1GW3A 1SQPK 3P8MC 5AVRB 1PFIA 3B5NA 3H6PA 2VRSA 1KQLA 1JNMA 2C0XA 2MJZA 1L4AA 1GW4A 4N3YB 5APXA 1AFOA 2PP6A 5AVYB 5AVUB 4ZKPA 2YNYA 1Z56A 2XZRA 1LTGC 3V4QA 2OYIC 3IFMA 1ZLLA 2Z5IA 1DEBA 1FDMA 2Q7CA 4IFFA 2NPSC 2R5BA 5AVWB 1L4AC 3TK1A 5KTBA 3HUSC 1SFCA 1J1EB 3V2PA 1GTWA 3V5BA 1GL2A 3NMDA 2YMYA 1WT6A 4EIJA 1CSBA 1S9KE 1RF1A 1N2DC 3EQ2A 1G2CA 3N4XA 5AVXB 2HODB 3B8EB 2FFDA 1SFCB 2O1KA 2P67A 1FZCA 2C0WA 4OH8B 2Q3IA 1RY3A 1LTSC 1KILD 3OA7A 1E5WA 1URQD 1IK9A 5APUA 3RL0D 1HUCA 1FZBA 3UIAA 1VPCA 3RK3C 2HPCB 4O9BA 2XDJA 1KILA 3MUDA 2WTYA 1JY3P 1LTJB 2H43A 1L0LK 1YTZI 2GM4A 3HUSB 2Q9IA 1ZV8A 2W6AA 4WY4A 2E42A 3V4WA 4HYTB 1RF0A 2OYIB 5AW9B 1KILB 1N73C 2LKMA 3HD7A 1JMMA 3HUSA 1SFCC 1LT9A 4WY4B 1JY3O 1KILC 1M7LA 1NKZB 1T3JA 2Z4EA 1T2KD 1KFMA 1LT9B 3SWYA 3A7OA 5CCHD 2N1TD 3MGNA 1HWTC 5KJ7C 1S9KD 3CLQA 3HE4B 1RE3C 2OYHA 4C46A 4LLHA 2FYZA 3VMXA 2NPSD 5AW0B 1XTCC 3VMYA 2FFDC 3LW5H 5AW2B 2KOGA 2XV5A 1N7SC 4LC1A 2O1JA 3TNUB 3M9BA 1M1JC 4GT1A 1HGVA 2WT7A 3L36A 2R32A 3E1IA 1J1EC 1ZN5A 5APSA 2OYIA 1T2KC 1SP4A 2Z5HA 1J2JB 3A5TA 2WT7B 1FJKA 5CCHA 5AVQB 2WITA 3M9QA 1CI6B 1SFCD 2KYVA 1RF0C 3U1AA 3PP5A 1SVFA 3KDPB 1LWUA 3L37A 1N7SB 5KJ7D 2QM7A 5CCGA 1CI6A 2YO3A 1SQBK 1G1IA 5CCHC 3KPEA 5AW6B 3V2QA 1NAFA 4M3LA 3P32A 3M0AA 1FOSE 1N7SD 3V2RA 5AW3B 3II6A 1L4AB 4RESB 3VYIA 4IFDK 2YKQA 1W2EA 1HBWA 2GUSA 1JY2P 1IFJA 4AYCA 1GD2E 4EOTA 2YO2A 2PAJA 3MTUE 2FKWB 5APWA 2N1TC 2WZ7A 1OWAA 1AQ5A 1LTTC 2ZFCA 1SQVK 2WPQA 3M0DA 3T97A 4XA4A 1GL2B 3RK3D 3LIEA 5KLVK 3IR9A 1KZUB 1IC2A 4WBAA 1IO4A 1FZAA 2BASA 1DH3A 1IFMA 3B5NB 1IFIA 1YTZT 1IFDA 5AVTB 1LTAC 3OJAB 3NFQA 2I1JA 3MIWA 2WSCH 4C7NA 3H32A 3BATA 3P7KA 3BRVB 1XTGB 3U1CA 5APYA 2XNXA 1GU4A 1RE4A 3BRTB 5BVZA 5AW7B 1A02F 3KYQA 3RL0C 2XU6A 1FZEA 3VTPC 1NH4A 1DX7A 1GL2C 1JY2N 5AW4B 2E43A 3P8CE 4GIFA 4ZKUA 2ZXEB 2C9LY 1LTBC 1FJPA 2OARA 2FXMA 4W7ZA 1FOSF 3WMM0 2JJLA 3TSIA 1LTJC 2A45I 4AQRD 3VP9A 1CW5A 2N1TA 1MUUA 1KFNA 1JTHB 4DOJA 1GL2D 2L5GB 1HVVA 2W27A 3N7NA 3TYYA 3RL0B 3P8CD 2R5DA 1A02J 1MV8A 4WY4C 1IJDB 4I6MC 2HLOA 2M8RA 2W6BA 1GK6A 2YKPA 3VP8A 1ZR4A 4AUWA 3VOPA 5BU8B 1GDTA 2IPPA 4Y99B 2WWWA 2I1KA 2CPSA 4N6JA 3BASA 1X8YA 4Y99C 5APQA 1FZFA 3RK3B 1HH0A 2P2UA 3RK2B 2P7JA 1NOHA 1CZQA 1LGHB 5AVSB 3VN0A 3L35A 1H89A 1X9VA 5AW8B 4C7RA 1JY2O 1WRGA 2NPSA 3HE4A 2POHA 3MD0A 1MFZA 1H8AA 3A3YB 1N86A 1ZR2A 5AVZB 1VDFA 3HD7D 4WB4A 1JO5A 1J1DB 1G2CB 3NTNA 4W7YA 2HODA 5CJ0A 2FFDB 2NPSB 2N9BA 2YKOA 1QL2A 3LIDA 1IFNA 1SLQA 1RF1C 3M0DC 1J1DC 1NO4A 1L0NK 3G3ZA 2CPBA 2J59M 4JF7A 1G1JA 5CHXA 1NTKK 4I2LC 4GKGA 3OAKA 2HPCA 1NWQA 1HGZA 2WSEH 1URQB 1L4AD 1NU1K 3RK2C 1JY3N 2JEEA 1URQC 2GUVA 3HTKA 1HTLC 2A45H 5CJ4A 3M9HA 5CMZA 2H8PD 2XKMA 3M91A 3CI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH4 A;  1IFI A;  2CPB A;  1IFD A;  2C0X A;  1IFJ A;  1HGZ A;  1HH0 A;  2CPS A;  2MJZ A;  1HGV A;  1FDM A;  2C0W A; 
#chains in the Genus database with same CATH topology
 3CX5 E;  5APV A;  3CCL P;  3A0B E;  1NTK J;  3BVH A;  3I5C A;  3RK2 D;  1RF1 B;  1FZC C;  4QMA A;  3HTK B;  3Q5P A;  3GHG A;  1L0N D;  3VMZ A;  3EFG A;  3CCJ P;  2E76 D;  1X79 B;  3NXS A;  2V4H A;  3PHL A;  1KB9 D;  1FZC B;  3TGU G;  1H88 A;  2AEF A;  2YXR B;  5AW1 B;  1L0N G;  1NAY A;  1NU1 E;  4C7N B;  1SQQ D;  3H32 B;  2WSF J;  1BCC D;  3CWB E;  3V2N A;  2WSF H;  3PH0 A;  2D2C C;  2KB7 P;  2E75 C;  1SQV D;  2KK7 A;  4UB6 H;  1NHL A;  2OYH B;  3H1I G;  4UB6 E;  1FU1 A;  1SQQ K;  2WPS A;  5KJ7 A;  2K37 A;  4AUW A;  3H1J E;  2IX7 C;  1YI2 P;  1FDM A;  1BGY E;  3TGU J;  1LTJ A;  2JP3 A;  1Q86 Q;  4OGQ B;  2RN0 A;  4JYB A;  2W6J H;  1JOC A;  4JYC A;  2HFE D;  3HD7 C;  2WPR A;  1DEE G;  3CL3 D;  3H1H E;  3L74 E;  4HH2 A;  3RBX A;  1VQP P;  1JMB A;  1W5C E;  3CCV P;  1FDI A;  1NTK G;  2OTJ P;  1NTZ E;  4XFJ A;  3H1K G;  2B87 A;  1EQ7 A;  3G9R A;  4N78 E;  2M5A B;  1URQ A;  3HD7 B;  2BEQ D;  4BXL A;  3H25 A;  1SQX G;  1EDK A;  5BU5 A;  3L71 E;  2K9J B;  5AW5 B;  3L75 J;  4LGD E;  2FYU K;  3H1K D;  2IFM A;  1QL1 A;  2JR8 A;  4JPZ B;  3C8V A;  4N78 D;  1SQP E;  2R44 A;  1SQV E;  3B5N C;  3HRN A;  1RE4 C;  1H0T B;  1OXZ A;  2BCC D;  1AVO A;  3PTZ A;  3GHG C;  1VQO P;  2E75 B;  4GOE A;  4W80 A;  1EXI A;  2A45 G;  2FYU G;  3L75 D;  1BGY D;  1MZ9 A;  1RE3 A;  2HYN A;  1NTZ J;  2AXC A;  2N1T B;  2XND H;  2Q5U A;  3MHV A;  5CCG D;  1ZP0 C;  5K5G B;  2C9N Y;  3R2P A;  1JTH A;  4XE5 B;  3GHG B;  2KLU A;  5L8R J;  3D70 A;  4OWF A;  3O6Q B;  1EDI A;  3H1H D;  1T3U A;  3L74 D;  1JCD A;  1LP1 B;  2KP8 A;  2ZXX A;  2BCC J;  1H0T A;  2LR2 A;  1KYO H;  1LNQ A;  5KAF E;  4D6T E;  1GU5 A;  1VQ7 P;  4D6T G;  2FBW C;  1FZG A;  1N7S A;  2KSJ A;  2M0B A;  5KLI C;  1FAV A;  3GMA A;  3L71 D;  3L72 J;  1LT9 C;  1FC2 C;  2ZJS E;  1T8Z A;  1SQX J;  2P1J A;  1LP1 A;  1LWU C;  3C9I A;  3HE5 A;  4IFM A;  5CCG C;  3U59 A;  3SWF A;  1RF1 C;  1VQ9 P;  3CC4 P;  1JUN A;  2PGD A;  1JCC A;  1WMK A;  1NTM K;  3L4F A;  4KHX A;  3TNU A;  1NKN A;  1NTZ K;  2KLV A;  2M3B A;  2O01 N;  3M06 A;  2PFX A;  4I1L A;  5CBN A;  2QEX P;  5KLV D;  4DJG A;  1QEX A;  4I7Z B;  1YYC A;  2OQQ A;  3KQG A;  1GK4 A;  3L70 D;  2J58 A;  2QJY C;  1OVU A;  3HE5 B;  4JQ0 D;  1HJB A;  1N73 A;  2JDI H;  1BE3 J;  2G8Y A;  4L74 A;  1KB9 E;  1Q90 D;  1JEK A;  2KI7 B;  3A2A A;  1AVY A;  4ZMD A;  4BRY B;  3PJS K;  1YIT P;  2H7H A;  1Q7Y Q;  3Q5R A;  2M5A A;  3I56 P;  1SQQ E;  1BCC E;  4PV1 D;  2O3J A;  4YPC A;  1BSH A;  1M1J B;  1YQ3 C;  2HG5 D;  4H44 C;  3L70 J;  1SQX K;  3O8Z A;  1M56 D;  4GDO A;  2QM8 A;  2R3C A;  5EFW B;  4DZO A;  1N73 B;  3H1L G;  1N7L A;  1BDD A;  2KXP B;  4WY4 D;  2O01 H;  1LTI C;  1YJW P;  1GZL A;  2YMK A;  1SQP D;  3IAO A;  1FBM A;  2IBZ D;  2IFN A;  1M1J A;  2K88 A;  2QVA A;  2N9Y B;  2OYO A;  4RJT A;  1LWU B;  2B9B A;  4PD4 D;  4B86 A;  1EDL A;  1BE3 E;  3B5N D;  1GW3 A;  1SQP K;  3G6E P;  1VQ4 P;  3AEC C;  3P8M C;  5AVR B;  2RKL A;  3O6Q A;  1PFI A;  1KV4 A;  3B5N A;  3H6P A;  1M57 D;  2A06 G;  1ZRT E;  2VRS A;  2WMM A;  3K5B A;  5DJT B;  3V6I A;  4U3F J;  3VMA A;  1KQL A;  1VL2 A;  2RMZ A;  2FXO A;  1JNM A;  1SQX E;  1R5S A;  4JBZ A;  1VQL P;  3F89 A;  2C0X A;  4H13 D;  2BEZ F;  2MJZ A;  5H2F E;  3ZDM A;  2K3R A;  1L4A A;  1GW4 A;  4N3Y B;  5APX A;  4EYY Q;  1AFO A;  2PP6 A;  5AVY B;  5AVU B;  4ZKP A;  2IZ0 A;  1PV3 A;  2YNY A;  2QIW A;  1Z56 A;  1SQB J;  2XZR A;  1OIP A;  2QJY B;  1LTG C;  1SQP J;  2IYO A;  3V4Q A;  2OYI C;  3TDK A;  3IFM A;  1ZLL A;  2Z5I A;  3AED C;  1DEB A;  1PGJ A;  1U7M A;  3BCC D;  2Q7C A;  4IFF A;  2NPS C;  4OGQ D;  4PD4 I;  2R5B A;  5GTH H;  5E79 H;  1L4A C;  4K3A A;  1L0L D;  5AVW B;  2NRG A;  3TK1 A;  3WU2 E;  5KTB A;  3HUS C;  1SFC A;  1J1E B;  3V2P A;  1GTW A;  1R5L A;  4H44 D;  1GMJ A;  1NU1 G;  3V5B A;  1GL2 A;  4YTP C;  4EDF A;  3NMD A;  3D6Z A;  2YMY A;  1SQB G;  1WT6 A;  4EIJ A;  1KQF B;  2E76 C;  1CSB A;  2GA1 A;  4YXW H;  2ZAE B;  3SFD C;  1N2D C;  1S9K E;  3EQ2 A;  1RF1 A;  1MKM A;  1PZQ A;  1G2C A;  3AEG C;  3N4X A;  5AVX B;  4YXD C;  2HOD B;  3B8E B;  2FFD A;  1SFC B;  1S5L X;  2O1K A;  4U3F D;  3SWK A;  3GLM A;  2P67 A;  3MUD C;  1RHZ B;  1S5L E;  2KS1 A;  2MKV A;  3AE5 C;  3ABV C;  2C0W A;  4OH8 B;  1FZC A;  1HJ0 A;  2Q3I A;  1SQV J;  1PP9 D;  1RY3 A;  1LTS C;  1KIL D;  1AA0 A;  3OA7 A;  1E5W A;  4U3F E;  4U3F G;  1P84 D;  1URQ D;  2QA4 P;  1IK9 A;  5APU A;  3RL0 D;  4UB8 E;  1HUC A;  1BE3 D;  2FYN C;  1FZB A;  3H1J D;  3UIA A;  1VPC A;  3CC7 P;  3RK3 C;  3H1L E;  1KC8 Q;  2HPC B;  4I7Z C;  1X22 A;  4O9B A;  1DIP A;  2XDJ A;  1KIL A;  2LXC B;  3AE1 C;  3CXH E;  1JY3 P;  1OVR A;  3AE7 C;  3MUD A;  1LTJ B;  2H43 A;  1L0L K;  1YTZ I;  3EWK A;  3MZW B;  3FWL A;  3BCC J;  1VQ8 P;  3HUS B;  2Q9I A;  1SQB E;  1ZV8 A;  2W6A A;  3SFE C;  4R4L A;  2Y9Z A;  3CWB D;  4WY4 A;  2E42 A;  3H1I E;  3AE3 C;  2IDB A;  3V4W A;  1N8R Q;  1QVF O;  1TU3 F;  4HYT B;  1NVO A;  1JM0 A;  1RF0 A;  3IF4 A;  5AW9 B;  4PV1 B;  1VF5 C;  2OYI B;  1KIL B;  3CWB G;  3WUV A;  1N73 C;  2LKM A;  1USD A;  1JMM A;  3HD7 A;  2OTK E;  3HUS A;  3RGU A;  1SFC C;  1PGP A;  1EZV G;  2K9J A;  2OTL P;  1LT9 A;  3EFF K;  4WY4 B;  1HF9 A;  1JY3 O;  1KIL C;  1M7L A;  1NKZ B;  1T3J A;  4L73 A;  2Z4E A;  1P84 I;  5KAF H;  4UB8 H;  2ZYA A;  3CCE P;  1T2K D;  2Y0C A;  1KFM A;  1KYO I;  1LT9 B;  2WPV B;  1KTM A;  2JKV A;  1D7M A;  3A7O A;  1YBK A;  3SWY A;  2KIK A;  1E79 H;  3FXD A;  2N1T D;  1BCC G;  3W68 A;  5CCH D;  3H1J J;  3Q1M A;  3MGN A;  1HWT C;  1PL5 A;  5KJ7 C;  1U57 A;  3CCR P;  1S9K D;  1Q81 Q;  3CLQ A;  1NTM D;  3HE4 B;  1RE3 C;  3JCU H;  3JCU E;  4ASV A;  4C46 A;  4D6T D;  4CPG A;  2OYH A;  1K05 A;  1OW8 A;  1PIX A;  4LLH A;  1R8E A;  2FYZ A;  3VMX A;  2FYU E;  4KJM A;  2NPS D;  4OGQ C;  4RKU J;  3A0H H;  3H1L J;  3RK3 E;  1VQN P;  2CK3 H;  5AW0 B;  5B66 H;  3S1K A;  2E5Y A;  4NPD A;  1XTC C;  2QJP C;  1OZH A;  3LW5 J;  3VMY A;  5GTH E;  2ZT9 B;  1K04 A;  3LW5 H;  5AW2 B;  2KOG A;  2D2C D;  1N7S C;  2JWA A;  2A06 D;  2XV5 A;  2E74 B;  4LC1 A;  2O1J A;  5E79 E;  3TNU B;  3AEE C;  3M9B A;  1M1J C;  4GT1 A;  1HGV A;  3AEF C;  2WT7 A;  5GTI E;  3L36 A;  3KZI E;  2B88 A;  2R32 A;  3AE4 C;  3E1I A;  1SQQ G;  1ZR4 A;  1J1E C;  1ZN5 A;  4H13 C;  5APS A;  3FWN A;  2M3E A;  3GG2 A;  5H2F H;  2OGU A;  3FX0 A;  1NTK D;  1S2E A;  3GF3 A;  4H0L C;  2QSI A;  4WVZ A;  3TGU D;  2OYI A;  1T2K C;  2DW3 A;  1SP4 A;  1OW7 A;  2Z5H A;  1J2J B;  2O01 J;  1KQS O;  2E76 B;  1S5L H;  2WT7 B;  4GOF A;  2WVR A;  3A5T A;  1FJK A;  5CCH A;  5KLI B;  5AVQ B;  3Q5S A;  2WIT A;  3C1L A;  3A0H E;  2E74 D;  3M9Q A;  4IL6 E;  3CMA P;  3CCU P;  1IFP A;  3CC2 P;  1CI6 B;  2IBZ I;  1SFC D;  2J5U A;  1SQQ J;  1ZW0 A;  2QG4 A;  1EZV I;  3W67 A;  2IZ1 A;  4D6T J;  2KYV A;  1RF0 C;  3E1R A;  3U1A A;  3S4R A;  1BSN A;  2BCC G;  4PD4 E;  3PP5 A;  1Q2N A;  1SVF A;  2KUB A;  3H1H J;  3L74 J;  1YJN P;  3CXH H;  3KDP B;  2KNC B;  5B5E H;  1S72 P;  1LWU A;  3L37 A;  1N7S B;  5KJ7 D;  1RQV A;  2QM7 A;  3H1K E;  5GTI H;  5CCG A;  2WTY A;  1NTZ G;  1CI6 A;  2YO3 A;  1ZRT D;  1SQB K;  4KT0 J;  1G1I A;  2FYU J;  5CCH C;  3KPE A;  5AW6 B;  3Q3D A;  3KHU A;  2PRR A;  1NAF A;  3L71 J;  4M3L A;  3V2Q A;  1VQM P;  3AEA C;  1M8O B;  2P10 A;  4PJ0 E;  3P32 A;  4NPF X;  1NTZ D;  1Y8A A;  2K1A A;  3M0A A;  1QVG O;  1L0N J;  1FOS E;  1N7S D;  3Q2Y A;  2QJP B;  2Q3E A;  3V2R A;  1S1C X;  5AW3 B;  5CBO A;  3II6 A;  1L4A B;  1EZV E;  1YQ4 C;  2FYU D;  3L75 G;  4RES B;  3VYI A;  1YIJ P;  2SPZ A;  2YKQ A;  4IFD K;  3H1J G;  1W2E A;  1BCC J;  2B89 A;  1HBW A;  1FS0 E;  3H1K J;  2GUS A;  5M1B A;  1JY2 P;  1EZV D;  3PRJ A;  4TLF A;  4BRY A;  3B71 A;  1IFJ A;  4AYC A;  1GD2 E;  2W8Z A;  4H13 B;  4EOT A;  2YO2 A;  4RO0 A;  1SQX D;  2PAJ A;  2FKW B;  3MTU E;  2ZVN B;  5APW A;  2N1T C;  2AEJ A;  1OWA A;  2WZ7 A;  1T6A A;  1L0N E;  1LTT C;  1QLE D;  1AQ5 A;  1IK7 A;  2WSC J;  2ZFC A;  2OYH C;  1NTM J;  3SSU A;  1SQV K;  4R4M A;  1M1K Q;  2WPQ A;  1KQG B;  2B87 B;  1ZXG A;  1NYH A;  3M0D A;  1YJ9 P;  3T97 A;  2JO1 A;  3OW2 O;  4XA4 A;  1GL2 B;  3H1I J;  1X0T A;  3RK3 D;  5KLV E;  3L71 G;  1FDO A;  3LIE A;  3IR9 A;  4Y28 J;  1KZU B;  3GW6 A;  5KLV K;  3G4S P;  3IN6 A;  2L91 A;  5KKZ B;  1EC5 A;  1IC2 A;  4PD4 H;  4WBA A;  1IO4 A;  3AE6 C;  1FZA A;  2BAS A;  1DH3 A;  5AVT B;  2YIU C;  3CX5 D;  4U7J A;  3WU2 H;  2WQY C;  2Y0E A;  4NPE A;  1IFM A;  2P58 A;  3B5N B;  3H1H G;  1L0L E;  1LT1 A;  3L74 G;  3L75 E;  1KIL E;  1IFI A;  1VF5 D;  3MP7 B;  3CXH I;  2FFD C;  1YTZ T;  1IFD A;  1S3J A;  1LTA C;  1KMI Z;  3OJA B;  2KNC A;  3NFQ A;  1Y47 A;  2I1J A;  1USE A;  1PPJ E;  2WSC H;  3ITK A;  3H32 A;  3MIW A;  5TIS E;  3RBZ A;  5AVV B;  3BAT A;  4C7N A;  3P7K A;  3KZI H;  4H0L D;  2KZJ A;  3BRV B;  1K9M Q;  3FXE A;  1XTG B;  2K9Y A;  3QWO C;  3WUU A;  5APY A;  1BGY J;  2XNX A;  3TGU E;  4HKZ H;  3U1C A;  2WSS H;  1RE4 A;  3BRT B;  1GU4 A;  2I8D A;  2AXT E;  5BVZ A;  2NZ2 A;  5AW7 B;  1SQV G;  2LXB A;  3L72 D;  1A02 F;  3KYQ A;  1PGO A;  3AE2 C;  4H44 B;  3RL0 C;  2XU6 A;  3AEB C;  1FZE A;  5C39 A;  3VTP C;  1NH4 A;  1DX7 A;  1GL2 C;  1JY2 N;  1Y9B A;  1VQ5 P;  5AW4 B;  3BCC E;  1NJI Q;  5KKZ C;  2E43 A;  3D71 A;  2H88 C;  3P8C E;  1U7J A;  3JC2 2;  4IL6 X;  4GIF A;  1VQ6 P;  3PLN A;  4ZKU A;  4L75 A;  2E75 D;  2IBZ E;  1KYO E;  2Y9Y A;  2ZXE B;  2AEM A;  2UWJ E;  3CXH D;  2C9L Y;  5APT A;  1LTB C;  3GF7 A;  1FJP A;  3E7K A;  1KOR A;  2OAR A;  5KLV J;  2FXM A;  2JWD A;  2QJK B;  4DT0 A;  1KYO D;  3L73 J;  4W7Z A;  1FOS F;  3WMM 0;  3T97 B;  2JJL A;  1SQP G;  3TSI A;  4DCK A;  1LTJ C;  1H8A A;  2A45 I;  4AQR D;  1KD1 Q;  2V7Q H;  3VP9 A;  2BCC E;  3AE9 C;  1K73 Q;  2ITA A;  2N1T A;  1MUU A;  1VQK P;  1UII A;  3CME P;  1CW5 A;  2E5T A;  1PP9 J;  1KFN A;  4Z1M H;  1DD4 A;  1JTH B;  4DOJ A;  2FYN B;  1GL2 D;  3CX5 H;  3AE8 C;  3I55 P;  1OX3 A;  2L5G B;  3CCQ P;  2FY8 A;  1HVV A;  2W27 A;  3N7N A;  1MFT A;  3G71 P;  3TYY A;  4MN4 C;  1EXJ A;  3RL0 B;  4K35 A;  4OVN F;  1OW6 A;  1PPJ G;  3P8C D;  1AJY A;  2R5D A;  4TT3 H;  4ASW A;  1A02 J;  1MV8 A;  1BDC A;  4WY4 C;  1DD3 A;  1L0L G;  5B5E E;  1PPJ D;  2V7Q J;  1IJD B;  4I6M C;  1ZOY C;  2HLO A;  2M8R A;  2W6B A;  1GK6 A;  2YKP A;  3CWB J;  2D2C B;  1KB9 H;  2W83 C;  4PV1 C;  3RL0 g;  3VP8 A;  3VOP A;  3CPW O;  3L73 D;  5BU8 B;  1GDT A;  3H1I D;  2IPP A;  1PP9 E;  4PJ0 H;  4Y99 B;  3WUT A;  5KAI H;  2QJK C;  2I1K A;  2WWW A;  1ZME C;  5B66 E;  2HR3 A;  2YXQ B;  1W2B O;  2CPS A;  2QE7 H;  3L73 G;  4N6J A;  3BCC G;  3BAS A;  4HB1 A;  1X8Y A;  4Y99 C;  3FGA D;  5APQ A;  1YHQ P;  2RH0 A;  2Q6Q A;  3L70 E;  1FZF A;  2R3S A;  3L70 G;  1HH0 A;  1AQT A;  2P2U A;  3RK3 B;  3RK2 B;  3CD6 P;  2P7J A;  1OVV A;  2A06 E;  2IYP A;  1Q82 Q;  1NOH A;  1CZQ A;  1LGH B;  5AVS B;  3VN0 A;  1QGK B;  3L35 A;  3D6Y A;  2YIU B;  2ZYD A;  1H89 A;  1SQB D;  1L0L J;  1X9V A;  5AW8 B;  4C7R A;  1BE3 G;  4EI2 A;  1JY2 O;  2ZT9 C;  1WRG A;  1OFC X;  1NGM B;  1M90 Q;  1KN7 A;  2NPS A;  1AV1 A;  2POH A;  3HE4 A;  5TIS H;  1VF5 B;  1NU1 D;  3H1L D;  3L72 E;  1MFZ A;  1NTK E;  2AXT H;  3MD0 A;  3A3Y B;  1N86 A;  5KAI E;  3USS A;  1RQU A;  2Y0D A;  1OMI A;  4GOD A;  1NTM E;  5AVZ B;  2ZT9 D;  1ZR2 A;  1VDF A;  1PP9 G;  3HD7 D;  4IOI H;  2QRX A;  4WB4 A;  4WWI A;  2Q1K A;  1JO5 A;  3JSV C;  1J1D B;  1G2C B;  2KZI A;  3F5H A;  2IBZ G;  3KXD A;  3NTN A;  4W7Y A;  2HOD A;  1UIX A;  1BGY G;  5CJ0 A;  2NPS B;  5TJH A;  2FFD B;  2N9B A;  2YKO A;  3L72 G;  1NU1 J;  1QL2 A;  2WSE J;  1IFN A;  1IZN B;  1SLQ A;  2KS1 B;  1JB0 J;  2H89 C;  3LID A;  1J1D C;  1SS1 A;  2ZYG A;  3M0D C;  4L76 A;  1P84 E;  1NO4 A;  1P84 H;  1L0N K;  3G3Z A;  2CPB A;  3A0B H;  2J59 M;  4JF7 A;  5KLV G;  2ZVO B;  1G1J A;  4IL6 H;  3CCM P;  4ZNC A;  3CCS P;  5CHX A;  1L2P A;  1NTK K;  4H0L B;  1KB9 I;  1LJ2 A;  1QX8 A;  1S4X A;  3R4Y A;  2GM4 A;  4I2L C;  4GKG A;  4HJG H;  3OAK A;  2HPC A;  1FE6 A;  1NWQ A;  1HGZ A;  2WSE H;  1URQ B;  3B4S A;  5DJU B;  3S9O A;  3TF5 A;  3L73 E;  1K8A Q;  1EDJ A;  1L4A D;  1RH5 B;  1NU1 K;  3RK2 C;  1JY3 N;  1NTM G;  4A7P A;  2W90 A;  2JEE A;  1URQ C;  2GUV A;  2KSE A;  1HTL C;  2A45 H;  2G3A A;  3HTK A;  3QH9 A;  2E74 C;  5CJ4 A;  2FXP A;  3M9H A;  5CMZ A;  4BWN A;  2H8P D;  1PGQ A;  3CX5 I;  2XKM A;  3M91 A;  3CI9 A; 
#chains in the Genus database with same CATH homology
 5APV A;  3BVH A;  3I5C A;  3RK2 D;  1RF1 B;  1FZC C;  3HTK B;  3GHG A;  3VMZ A;  3EFG A;  1X79 B;  3NXS A;  1FZC B;  1H88 A;  5AW1 B;  4C7N B;  3H32 B;  3V2N A;  2WSF H;  2KB7 P;  1NHL A;  2OYH B;  1FU1 A;  1SQQ K;  2WPS A;  5KJ7 A;  2IX7 C;  1LTJ A;  4JYB A;  1JOC A;  4JYC A;  2HFE D;  3HD7 C;  2WPR A;  3CL3 D;  4HH2 A;  5APT A;  1EQ7 A;  4N78 E;  1URQ A;  3HD7 B;  5BU5 A;  5AW5 B;  4LGD E;  2FYU K;  2IFM A;  1QL1 A;  4N78 D;  3B5N C;  3HRN A;  1RE4 C;  1OXZ A;  3GHG C;  4W80 A;  2A45 G;  1RE3 A;  1MZ9 A;  2OYH C;  2HYN A;  2N1T B;  5CCG D;  2Q5U A;  2C9N Y;  3R2P A;  1JTH A;  4XE5 B;  3GHG B;  1T3U A;  1JCD A;  2KP8 A;  1GU5 A;  1FZG A;  1N7S A;  2KSJ A;  1FAV A;  1LT9 C;  1T8Z A;  2P1J A;  3HE5 A;  3C9I A;  1LWU C;  4IFM A;  5CCG C;  3SWF A;  3U59 A;  1JUN A;  1JCC A;  4KHX A;  3L4F A;  1NTM K;  3TNU A;  1NKN A;  1NTZ K;  2KLV A;  2M3B A;  4I1L A;  3M06 A;  1YYC A;  3KQG A;  1GK4 A;  2J58 A;  1N73 A;  3HE5 B;  1HJB A;  3A2A A;  2H7H A;  1M1J B;  2HG5 D;  5AVV B;  1SQX K;  3O8Z A;  4DZO A;  1N73 B;  2QM8 A;  2R3C A;  1N7L A;  4WY4 D;  2O01 H;  1LTI C;  1GZL A;  1FBM A;  2IFN A;  1M1J A;  1LWU B;  4B86 A;  3B5N D;  1GW3 A;  1SQP K;  3P8M C;  5AVR B;  1PFI A;  3B5N A;  3H6P A;  2VRS A;  1KQL A;  1JNM A;  2C0X A;  2MJZ A;  1L4A A;  1GW4 A;  4N3Y B;  5APX A;  1AFO A;  2PP6 A;  5AVY B;  5AVU B;  4ZKP A;  2YNY A;  1Z56 A;  2XZR A;  1LTG C;  3V4Q A;  2OYI C;  3IFM A;  1ZLL A;  2Z5I A;  1DEB A;  1FDM A;  2Q7C A;  4IFF A;  2NPS C;  2R5B A;  5AVW B;  1L4A C;  3TK1 A;  5KTB A;  3HUS C;  1SFC A;  1J1E B;  3V2P A;  1GTW A;  3V5B A;  1GL2 A;  3NMD A;  2YMY A;  1WT6 A;  4EIJ A;  1CSB A;  1S9K E;  1RF1 A;  1N2D C;  3EQ2 A;  1G2C A;  3N4X A;  5AVX B;  2HOD B;  3B8E B;  2FFD A;  1SFC B;  2O1K A;  2P67 A;  1FZC A;  2C0W A;  4OH8 B;  2Q3I A;  1RY3 A;  1LTS C;  1KIL D;  3OA7 A;  1E5W A;  1URQ D;  1IK9 A;  5APU A;  3RL0 D;  1HUC A;  1FZB A;  3UIA A;  1VPC A;  3RK3 C;  2HPC B;  4O9B A;  2XDJ A;  1KIL A;  3MUD A;  2WTY A;  1JY3 P;  1LTJ B;  2H43 A;  1L0L K;  1YTZ I;  2GM4 A;  3HUS B;  2Q9I A;  1ZV8 A;  2W6A A;  4WY4 A;  2E42 A;  3V4W A;  4HYT B;  1RF0 A;  2OYI B;  5AW9 B;  1KIL B;  1N73 C;  2LKM A;  3HD7 A;  1JMM A;  3HUS A;  1SFC C;  1LT9 A;  4WY4 B;  1JY3 O;  1KIL C;  1M7L A;  1NKZ B;  1T3J A;  2Z4E A;  1T2K D;  1KFM A;  1LT9 B;  3SWY A;  3A7O A;  5CCH D;  2N1T D;  3MGN A;  1HWT C;  5KJ7 C;  1S9K D;  3CLQ A;  3HE4 B;  1RE3 C;  2OYH A;  4C46 A;  4LLH A;  2FYZ A;  3VMX A;  2NPS D;  5AW0 B;  1XTC C;  3VMY A;  2FFD C;  3LW5 H;  5AW2 B;  2KOG A;  2XV5 A;  1N7S C;  4LC1 A;  2O1J A;  3TNU B;  3M9B A;  1M1J C;  4GT1 A;  1HGV A;  2WT7 A;  3L36 A;  2R32 A;  3E1I A;  1J1E C;  1ZN5 A;  5APS A;  2OYI A;  1T2K C;  1SP4 A;  2Z5H A;  1J2J B;  3A5T A;  2WT7 B;  1FJK A;  5CCH A;  5AVQ B;  2WIT A;  3M9Q A;  1CI6 B;  1SFC D;  2KYV A;  1RF0 C;  3U1A A;  3PP5 A;  1SVF A;  3KDP B;  1LWU A;  3L37 A;  1N7S B;  5KJ7 D;  2QM7 A;  5CCG A;  1CI6 A;  2YO3 A;  1SQB K;  1G1I A;  5CCH C;  3KPE A;  5AW6 B;  3V2Q A;  1NAF A;  4M3L A;  3P32 A;  3M0A A;  1FOS E;  1N7S D;  3V2R A;  5AW3 B;  3II6 A;  1L4A B;  4RES B;  3VYI A;  4IFD K;  2YKQ A;  1W2E A;  1HBW A;  2GUS A;  1JY2 P;  1IFJ A;  4AYC A;  1GD2 E;  4EOT A;  2YO2 A;  2PAJ A;  3MTU E;  2FKW B;  5APW A;  2N1T C;  2WZ7 A;  1OWA A;  1AQ5 A;  1LTT C;  2ZFC A;  1SQV K;  2WPQ A;  3M0D A;  3T97 A;  4XA4 A;  1GL2 B;  3RK3 D;  3LIE A;  5KLV K;  3IR9 A;  1KZU B;  1IC2 A;  4WBA A;  1IO4 A;  1FZA A;  2BAS A;  1DH3 A;  1IFM A;  3B5N B;  1IFI A;  1YTZ T;  1IFD A;  5AVT B;  1LTA C;  3OJA B;  3NFQ A;  2I1J A;  3MIW A;  2WSC H;  4C7N A;  3H32 A;  3BAT A;  3P7K A;  3BRV B;  1XTG B;  3U1C A;  5APY A;  2XNX A;  1GU4 A;  1RE4 A;  3BRT B;  5BVZ A;  5AW7 B;  1A02 F;  3KYQ A;  3RL0 C;  2XU6 A;  1FZE A;  3VTP C;  1NH4 A;  1DX7 A;  1GL2 C;  1JY2 N;  5AW4 B;  2E43 A;  3P8C E;  4GIF A;  4ZKU A;  2ZXE B;  2C9L Y;  1LTB C;  1FJP A;  2OAR A;  2FXM A;  4W7Z A;  1FOS F;  3WMM 0;  2JJL A;  3TSI A;  1LTJ C;  2A45 I;  4AQR D;  3VP9 A;  1CW5 A;  2N1T A;  1MUU A;  1KFN A;  1JTH B;  4DOJ A;  1GL2 D;  2L5G B;  1HVV A;  2W27 A;  3N7N A;  3TYY A;  3RL0 B;  3P8C D;  2R5D A;  1A02 J;  1MV8 A;  4WY4 C;  1IJD B;  4I6M C;  2HLO A;  2M8R A;  2W6B A;  1GK6 A;  2YKP A;  3VP8 A;  1ZR4 A;  4AUW A;  3VOP A;  5BU8 B;  1GDT A;  2IPP A;  4Y99 B;  2WWW A;  2I1K A;  2CPS A;  4N6J A;  3BAS A;  1X8Y A;  4Y99 C;  5APQ A;  1FZF A;  3RK3 B;  1HH0 A;  2P2U A;  3RK2 B;  2P7J A;  1NOH A;  1CZQ A;  1LGH B;  5AVS B;  3VN0 A;  3L35 A;  1H89 A;  1X9V A;  5AW8 B;  4C7R A;  1JY2 O;  1WRG A;  2NPS A;  3HE4 A;  2POH A;  3MD0 A;  1MFZ A;  1H8A A;  3A3Y B;  1N86 A;  1ZR2 A;  5AVZ B;  1VDF A;  3HD7 D;  4WB4 A;  1JO5 A;  1J1D B;  1G2C B;  3NTN A;  4W7Y A;  2HOD A;  5CJ0 A;  2FFD B;  2NPS B;  2N9B A;  2YKO A;  1QL2 A;  3LID A;  1IFN A;  1SLQ A;  1RF1 C;  3M0D C;  1J1D C;  1NO4 A;  1L0N K;  3G3Z A;  2CPB A;  2J59 M;  4JF7 A;  1G1J A;  5CHX A;  1NTK K;  4I2L C;  4GKG A;  3OAK A;  2HPC A;  1NWQ A;  1HGZ A;  2WSE H;  1URQ B;  1L4A D;  1NU1 K;  3RK2 C;  1JY3 N;  2JEE A;  1URQ C;  2GUV A;  3HTK A;  1HTL C;  2A45 H;  5CJ4 A;  3M9H A;  5CMZ A;  2H8P D;  2XKM A;  3M91 A;  3CI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...