1HH0A

Filamentous bacteriophage ph75
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
46
structure length
46
Chain Sequence
MDFNPSEVASQVTNYIQAIAAAGVGVLALAIGLSAAWKYAKRFLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PH75 INOVIRUS MAJOR COAT PROTEIN
publication title The Protein Capsid of Filamentous Bacteriophage Ph75 from Thermus Thermophilus
pubmed doi rcsb
source organism Bacteriophage ph75
molecule tags Virus
total genus 12
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2000-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10389 CoatB Bacteriophage coat protein B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hh0A00
1HGVA 1IFIA 1IFJA 2CPBA 1FDMA 2C0WA 1HGZA 2CPSA 1NH4A 2MJZA 1HH0A 2C0XA 1IFDA
chains in the Genus database with same CATH superfamily
1KILD 1AFOA 5TISH 3AE1C 1SQPG 5KLIC 1RE4A 1SQVG 1RH5B 2E42A 2M3BA 2GM4A 4RO0A 2IDBA 3OAKA 5AW0B 1HJ0A 3C1LA 2BCCE 3AE2C 1KYOD 3C8VA 3H1JJ 1NTMD 3RL0C 5KAIE 2R3CA 3RL0D 1RF1B 1PIXA 3B5ND 1H88A 5AVWB 4BRYA 1EQ7A 2V7QH 1RE4C 1YTZI 1P84H 3V5BA 1VQKP 1MZ9A 4EDFA 4ZNCA 1S3JA 3K5BA 1JOCA 4DZOA 1SQBJ 1T3UA 3CX5I 5KLVE 3FWLA 1NKZB 3H1HD 1KB9D 2A06E 2M0BA 2E76D 3H1LG 3W68A 1SQQG 2ZFCA 1K8AQ 2HG5D 3P8CE 1SP4A 3O6QB 1J1DC 3HE5B 3PHLA 1VQ9P 1XTGB 3L72G 2KK7A 3L74E 1VQ6P 1EXIA 4PV1D 1DEEG 2J59M 2QVAA 1HJBA 3A0HH 1N7SB 1YQ4C 5KLVK 1R8EA 2WQYC 2QSIA 3MTUE 1SQXJ 1KYOI 1VQMP 2B87B 2IBZG 3VTPC 4H13B 3E1RA 2QA4P 4EIJA 1Q86Q 3WU2E 2ZT9D 2BEQD 2N1TB 5CBNA 1CI6B 2KSEA 4CPGA 2WTYA 1HGVA 1GL2B 4GIFA 1HWTC 4XE5B 1MUUA 1OVUA 3Q5RA 3VMAA 3SWYA 4HKZH 3H32A 1KB9I 2O01H 4EI2A 5CCHA 1EZVE 1YTZT 4BXLA 4D6TJ 2IZ0A 2Q5UA 2YKPA 1N73C 3HD7B 3AEAC 2WPVB 3CC7P 1W5CE 2YO2A 1G2CB 3G71P 1YJNP 2P2UA 3L70J 2QJPC 2R3SA 2IX7C 1Y47A 2HLOA 2E75D 2C9NY 4JQ0D 1J1EB 3D71A 1KD1Q 1KYOE 2RN0A 2KXPB 2D2CB 5CCHC 5KJ7C 5KJ7D 2A45H 2R5BA 2MKVA 4N3YB 2K37A 1H0TA 1BDDA 3T97B 2HPCB 1KILB 1EC5A 4HH2A 1VQ4P 2Q6QA 1NTZG 2E74C 2E74D 4U3FG 4HYTB 1U57A 3A3YB 3M91A 3D6ZA 2WSCH 5AW1B 1KB9E 3CXHD 3W67A 4PJ0E 1LWUA 1W2EA 3HE4A 3PRJA 4H44C 3RL0B 1PP9D 2KP8A 1S2EA 3U59A 3B5NB 3FXDA 1L0NG 3H1KD 5KAIH 1SQPJ 4JBZA 2QJYB 2HFED 5TJHA 3BCCE 4IL6E 2BEZF 4OGQC 3V2NA 2KB7P 3AE5C 1BE3J 4GDOA 5CHXA 3S9OA 1QVFO 3CCQP 3G9RA 3AE6C 4DJGA 1LWUC 1GW3A 1JMBA 1BGYD 3CWBJ 4DCKA 3H1JG 2E76B 2JWAA 1YBKA 1RF1A 1M90Q 2WT7B 1FJPA 1BCCG 2ZAEB 1ZLLA 1J1DB 2Y9YA 5AVUB 3HRNA 3EFGA 3M9HA 4JF7A 2QM7A 4PV1B 4W7ZA 3JCUH 2C9LY 2CPBA 1T2KC 1T2KD 1SQBG 1SVFA 4PD4E 3SWKA 3RL0g 1IFJA 3O8ZA 4ASWA 1S9KD 2XDJA 2NZ2A 1PGQA 1K04A 1S5LE 3CXHI 1SQQJ 1RF1C 2WPQA 2LR2A 3O6QA 3HE5A 1LTTC 3L72J 3PLNA 4UB8H 3HUSC 2ZT9B 4R4MA 1YJ9P 2H89C 1OIPA 5GTIH 2WPRA 1RHZB 2J58A 3MHVA 1L0LE 4OH8B 3VMZA 1N7SA 3H1JE 1DH3A 1FDOA 2BCCD 4IFMA 1RF0A 1Q81Q 3CD6P 2OYHB 3CX5H 1USEA 2POHA 1SQXG 2B87A 2CK3H 2ZXXA 4IL6X 2Q9IA 3OJAB 2AXTE 3L75J 4KT0J 3H1IE 1JM0A 1E79H 2N1TA 1N73B 5AVQB 2QM8A 1SQBE 2W90A 1CI6A 1L0LK 1BSHA 1YI2P 1GL2A 1OWAA 2E75B 2W27A 2OTLP 1T6AA 2A06D 2YMYA 1MFTA 4HJGH 3RK3E 4H13C 2IYPA 4MN4C 2XNDH 4JPZB 2ZXEB 1KYOH 3VYIA 1ZV8A 2AEJA 1SQVD 3P8CD 3V2PA 1USDA 4D6TG 2N1TC 1VQ7P 3L74D 1KC8Q 1SQBK 5CCGD 3HD7A 2K1AA 2A45G 4M3LA 3H1HJ 4C7RA 1G2CA 3EWKA 3M0DC 1WT6A 2E74B 1PV3A 3L70G 5AW7B 1SQXE 4L75A 4N6JA 3TGUE 1QEXA 3S1KA 3L73G 5DJTB 2N9YB 3D6YA 2Y0DA 4O9BA 2YXQB 3F5HA 3MD0A 4JYCA 2O1KA 2QEXP 1KB9H 3MUDA 2OQQA 3CPWO 3HD7C 1LTAC 3T97A 3N7NA 4IOIH 2HPCA 1HTLC 1KILA 2FYUG 4OVNF 1NTZJ 1IK7A 5CMZA 5AW4B 4U3FJ 1SQXK 4U7JA 4AYCA 4L73A 1G1JA 3L71J 3H1LD 1S9KE 3KZIE 2D2CC 3L4FA 1AQTA 1X0TA 3Q5SA 4D6TE 1MV8A 2M3EA 3IN6A 3M9BA 3MUDC 4C7NB 3KQGA 1EZVD 1PPJE 3B5NA 1KILC 1OMIA 1LGHB 2Y0EA 1IJDB 1BE3G 2W6BA 2OARA 1EXJA 1GMJA 2V7QJ 3A0BE 4UB6E 2P7JA 1NU1G 2HODB 2LKMA 5B5EE 2KOGA 1VQPP 1JTHB 3CWBG 2QRXA 1FBMA 3B5NC 1BCCJ 5APYA 5AVSB 2YKQA 2Y0CA 2WT7A 2QJYC 1U7JA 3IFMA 2Z4EA 2JDIH 3HUSB 3V4WA 2IFMA 1PFIA 2KYVA 5AVVB 5KAFH 1RY3A 2E76C 2J5UA 3AEDC 4L74A 3H25A 1SQPE 1SQVE 5E79E 1A02J 4B86A 1ZRTE 1JCDA 3PTZA 1M1JB 3BVHA 4ZKUA 5B66E 2RMZA 4Y99C 4WVZA 1FOSE 1EZVI 1CW5A 4PV1C 3GG2A 3BCCD 4EOTA 1LTIC 4LLHA 3CCVP 2RKLA 3CWBE 4ZKPA 4IFFA 1K9MQ 3KYQA 2P67A 2Q3IA 2OYHA 4NPFX 1GD2E 2GUSA 3A5TA 3FGAD 1LTBC 1SQPK 2Z5IA 1SQVK 3CXHH 1MFZA 1YIJP 3GF3A 2ZT9C 3L75G 1CSBA 1LTJB 1PGPA 5AVZB 2O01J 1N73A 3M9QA 1T8ZA 1JNMA 1NTMG 1PGJA 3RBZA 3AEBC 3L37A 3H1LE 2OYHC 1LJ2A 1SQQE 4PD4D 3JSVC 3CCSP 3CCLP 2WSEH 1VF5D 3L72E 4LC1A 5KJ7A 2E5YA 2IZ1A 3CL3D 4I6MC 2H88C 2AEMA 2UWJE 1JB0J 1JY3O 2B88A 3CCEP 2VRSA 3H1HG 1L0LD 1AV1A 2E75C 3D70A 1QVGO 4W7YA 3H1JD 3A7OA 1SQQK 5H2FE 2IBZE 1JCCA 3L73J 5APSA 2PAJA 2V4HA 3USSA 1G1IA 3C9IA 3L75E 1OZHA 5AW8B 2WSCJ 4I1LA 4DOJA 3NXSA 3QH9A 3KZIH 5GTHE 4BWNA 2RH0A 2ZYDA 2KLVA 1K05A 2AEFA 2DW3A 3H1ID 2FYUJ 4HB1A 1GZLA 1CZQA 1SQBD 1FOSF 2ZVNB 4AUWA 3L71G 4WB4A 2B89A 3RGUA 4ZMDA 4UB6H 4PD4I 3AE4C 2XV5A 3RK3D 1OVVA 4C7NA 3WMM0 5CJ0A 1NJIQ 2WVRA 1HBWA 2E5TA 3HTKB 1KTMA 5KLVJ 2XKMA 2K88A 3AEEC 3GW6A 1JEKA 1P84I 2GUVA 1GTWA 1NWQA 1NU1J 1SQXD 1EDIA 1GU5A 2IFNA 5AVRB 2HODA 3TGUD 1XTCC 3I5CA 1JTHA 1J2JB 2WITA 1ZR2A 2LXBA 3CLQA 3WUVA 3H6PA 2W6JH 1ZXGA 1NTZE 1NVOA 4U3FE 4Y99B 5AW3B 1VQLP 5TISE 3HUSA 5E79H 3VMYA 3L71E 1YQ3C 1NTKJ 2NPSC 2Q1KA 2NPSD 3CI9A 3AEGC 3U1AA 1H8AA 4H0LD 1L0NE 2JP3A 2XNXA 4D6TD 1N8RQ 1UIXA 4NPDA 4N78E 1NTZK 2L5GB 1PPJD 1M1JA 2I8DA 4Y28J 2FXMA 2R5DA 3I55P 1FZCB 3L70D 1P84E 3R4YA 1IFDA 1S72P 3FWNA 1IK9A 3TNUB 4A7PA 1NOHA 3MZWB 1ZN5A 2L91A 4Z1MH 3WU2H 1ZMEC 5C39A 2G3AA 3VOPA 3II6A 1PP9G 3SSUA 1S1CX 3LW5H 2FFDB 1L0NK 5BVZA 1OX3A 2JEEA 1BCCE 2HYNA 3H1KG 4YXDC 1UIIA 1VF5B 1OW6A 1M1JC 3G4SP 3A2AA 3IAOA 3P8MC 3M0AA 1KFNA 1LTJA 3U1CA 5AVXB 5CCGA 2FYNB 4WWIA 1BGYG 4YXWH 1KFMA 3BRVB 3AE3C 1NTMJ 1LP1B 1W2BO 2WSFJ 2KZIA 3M0DA 4TT3H 1FAVA 3CC2P 3B4SA 4LGDE 1Q90D 3RK2B 1FE6A 1R5SA 1SQPD 1ZRTD 2R44A 1LTJC 2WSFH 1Y8AA 1Z56A 2A45I 5CCGC 1ZW0A 5CJ4A 2JKVA 2W83C 4ASVA 1M57D 1URQC 1URQD 3BASA 1JY3N 3CWBD 2YIUB 4AQRD 1S5LX 1DD4A 1DEBA 2KS1B 1EDLA 4RKUJ 5BU5A 3P7KA 3RK3B 2KLUA 1FZEA 3TSIA 2FXOA 1M1KQ 1DIPA 4PJ0H 5CBOA 3AE8C 4GOFA 2H43A 4W80A 3AEFC 3KDPB 3CCUP 1KN7A 2Q3EA 2BCCG 2YMKA 3CMEP 1JY2O 4IFDK 1NH4A 2FKWB 2I1KA 1DX7A 3OA7A 2H7HA 4WY4D 2CPSA 4K35A 4IL6H 1SQQD 1FZBA 1KZUB 1L4AB 3L72D 3V2QA 4RESB 2XU6A 1ZR4A 1AA0A 1WRGA 3L70E 1AJYA 1K73Q 3HTKA 3PP5A 2KIKA 1RQVA 1LT9C 3L73E 5KLVG 2A06G 3AE7C 2NPSB 2IBZD 1N7LA 1GK4A 4H0LB 2KUBA 3L75D 3L74G 2FYUE 2K9YA 4PD4H 3MIWA 1TU3F 1A02F 2OYOA 2W6AA 3L36A 3QWOC 1L0LJ 5L8RJ 1IZNB 5APVA 1OXZA 1S5LH 2OYIC 2P58A 1SFCC 1SFCD 5APTA 3TK1A 1JY2P 3MP7B 2ZVOB 1KQGB 1NTKG 1D7MA 4TLFA 3FX0A 4WBAA 2JR8A 2LXCB 2Q7CA 1YHQP 1JUNA 3H1IJ 1GW4A 2FYUK 1VQNP 1BE3E 4XA4A 3CCMP 3FXEA 3N4XA 2QG4A 1FZCA 1NU1E 2AXTH 3TNUA 4EYYQ 3SFEC 1QX8A 1X79B 1PP9J 3JCUE 3IF4A 2FFDA 1EZVG 3H1KJ 1LT1A 2IBZI 1NKNA 1RQUA 2PGDA 3TYYA 1ZP0C 1HVVA 1NTZD 2M8RA 2ZYGA 3TDKA 2C0XA 1FZCC 2WSEJ 1YITP 4U3FD 1NU1K 1NTKE 2OTJP 4UB8E 5AW9B 3TGUJ 1BGYJ 3L71D 5GTIE 2K9JB 1M8OB 4GT1A 2I1JA 3UIAA 4KHXA 1LP1A 5M1BA 1URQB 3NFQA 1AQ5A 4RJTA 2FFDC 1IFMA 3OW2O 3GHGB 1S4XA 2K3RA 1L0ND 1VF5C 3CX5E 2GA1A 3VP9A 3LIDA 4N78D 1FJKA 2YKOA 2JWDA 5APWA 1NTKK 1NO4A 1OW7A 2MJZA 2FYNC 1P84D 2YXRB 4YPCA 1X8YA 3AE9C 3CCJP 2PP6A 1FS0E 1KILE 1NAFA 2WSSH 5AW6B 2PFXA 4WY4B 5AVTB 1X22A 2KS1A 2R32A 1FZFA 1BCCD 3RK2C 2O3JA 3RK2D 1JO5A 1AVOA 3EQ2A 3BCCG 5KKZB 1X9VA 1U7MA 3CCRP 2FY8A 4I7ZB 2YNYA 3WUUA 1NTME 3KXDA 2BCCJ 5CCHD 2HR3A 3G6EP 4XFJA 1SS1A 2JJLA 2M5AB 2YIUC 1HUCA 1LT9B 2FBWC 2WZ7A 1QLED 1JY2N 1VQ8P 1HGZA 1QL2A 4JYBA 5KLIB 1VQOP 1Y9BA 3A0BH 1QL1A 2H8PD 3RK3C 3Q3DA 1VDFA 1EDKA 2KNCB 1L4AA 5B5EH 1LTSC 4GKGA 2WWWA 3H1HE 1NTMK 3P32A 1IFIA 2Z5HA 2O01N 1NGMB 1JY3P 2QJKC 1FZGA 2OYIB 1NYHA 1LTGC 4H44D 2G8YA 3BRTB 1PGOA 2Y9ZA 1SFCB 1VL2A 2E43A 1FZAA 3GMAA 3NMDA 5KTBA 2NPSA 1QGKB 1SQVJ 4QMAA 2C0WA 4OGQD 1L4AC 1L4AD 3MGNA 3L74J 1AVYA 4KJMA 4GOEA 2AXCA 2KSJA 1H89A 3I56P 2IYOA 3Q2YA 1L0LG 1EDJA 1NAYA 2KZJA 3SWFA 2OGUA 4R4LA 1NHLA 2SPZA 3VN0A 4BRYB 1OVRA 5B66H 1KORA 4K3AA 1FDIA 2B9BA 2JO1A 5BU8B 1GDTA 4H0LC 1PL5A 1RE3A 1T3JA 3H1IG 2PRRA 3LW5J 2FYZA 1SLQA 1FDMA 1IO4A 3TF5A 3B8EB 1E5WA 1DD3A 3EFFK 5AW2B 2N9BA 1FC2C 3H1LJ 1Q2NA 3L73D 3ABVC 1LNQA 2P1JA 2QIWA 1MKMA 1RE3C 2YO3A 2FXPA 1Q7YQ 5EFWB 2O1JA 3Q5PA 1ZOYC 5KAFE 2NRGA 1VPCA 1YYCA 3KPEA 3PJSK 3ZDMA 2W8ZA 2FYUD 4I2LC 2ITAA 1HF9A 3KHUA 3M06A 3TGUG 4DT0A 1M7LA 3A0HE 1WMKA 2K9JA 1URQA 1R5LA 1IFPA 1N86A 3GHGA 1N7SC 1N7SD 3E1IA 1Q82Q 3V4QA 5H2FH 3CMAP 1RF0C 3NTNA 2QJPB 4YTPC 4GODA 3AECC 3GF7A 3F89A 2QE7H 3PH0A 1KV4A 3CXHE 1BE3D 5KLVD 2WMMA 3H32B 4H13D 1NU1D 1N2DC 1PP9E 5APQA 2WPSA 2IPPA 5GTHH 1JMMA 3SFDC 1OW8A 1PZQA 1BDCA 3GLMA 3LIEA 1KMIZ 3H1KE 4NPEA 1GK6A 3BATA 2N1TD 5AVYB 3GHGC 4WY4A 1YJWP 3JC22 1KQFB 4C46A 1GL2C 1PPJG 1GL2D 2KI7B 3VMXA 3Q1MA 3CC4P 3V2RA 3BCCJ 3E7KA 1BSNA 2P10A 2ZJSE 1BGYE 3VP8A 2ZYAA 2OTKE 1FU1A 1NTKD 5DJUB 2QJKB 4H44B 3R2PA 4L76A 1H0TB 1IFNA 2M5AA 4WY4C 1HH0A 1LT9A 3IR9A 4OWFA 3HD7D 3L35A 3WUTA 1L2PA 5AW5B 1KQSO 3V6IA 1VQ5P 3RBXA 4OGQB 3CX5D 1M56D 5KKZC 1J1EC 2KNCA 5APUA 1IC2A 5APXA 3S4RA 4I7ZC 1LWUB 3HE4B 1KQLA 2D2CD 5K5GB 1OFCX 3B71A 2OYIA 2XZRA 3G3ZA 1SFCA 3ITKA 2BASA 1L0NJ 1GU4A
chains in the Genus database with same CATH topology
1KILD 2XKMA 2N1TA 2I1JA 4GT1A 2QM8A 5AVQB 4KHXA 3UIAA 1N73B 1AFOA 1URQB 1CI6A 3NFQA 1AQ5A 1L0LK 2GUVA 1RE4A 2FFDC 2E42A 1GTWA 1NWQA 1IFMA 2M3BA 2GM4A 3GHGB 1GL2A 1GU5A 2IFNA 5AVRB 2HODA 1OWAA 3OAKA 2W27A 5AW0B 1XTCC 3I5CA 1JTHA 3VP9A 3LIDA 1J2JB 2WITA 4N78D 1FJKA 2YKOA 2YMYA 1ZR2A 3CLQA 3H6PA 5APWA 3RL0C 2R3CA 3RL0D 2ZXEB 1NTKK 3VYIA 1NO4A 1ZV8A 2MJZA 3P8CD 3V2PA 1RF1B 4Y99B 5AW3B 3B5ND 1H88A 2N1TC 5AVWB 1X8YA 1EQ7A 3HUSA 3VMYA 1SQBK 2PP6A 1RE4C 1YTZI 5CCGD 3HD7A 2A45G 3V5BA 1MZ9A 4M3LA 1NAFA 5AW6B 4WY4B 4C7RA 1G2CA 2NPSC 2NPSD 5AVTB 3M0DC 1WT6A 3CI9A 2R32A 3U1AA 1FZFA 1JOCA 5AW7B 1H8AA 4DZOA 4N6JA 3RK2C 3RK2D 1T3UA 1JO5A 2XNXA 3EQ2A 4O9BA 1NKZB 1X9VA 4N78E 3MD0A 1NTZK 2YNYA 2L5GB 4JYCA 2O1KA 1M1JA 3MUDA 2FXMA 2ZFCA 5CCHD 2HG5D 2R5DA 1FZCB 3HD7C 1LTAC 1SP4A 3P8CE 1J1DC 3HE5B 2JJLA 3T97A 3N7NA 1IFDA 2HPCA 1HTLC 1HUCA 1KILA 1IK9A 1LT9B 3TNUB 1NOHA 1XTGB 1ZN5A 2WZ7A 5CMZA 2J59M 5AW4B 1JY2N 1HJBA 1HGZA 3VOPA 1N7SB 1SQXK 3II6A 3LW5H 4AYCA 1QL2A 4JYBA 2FFDB 1G1JA 1QL1A 1L0NK 2H8PD 2JEEA 1VDFA 3RK3C 5BVZA 2HYNA 1S9KE 1L4AA 3L4FA 5KLVK 1LTSC 4GKGA 1MV8A 3M9BA 3MTUE 1M1JC 2WWWA 3A2AA 4C7NB 1NTMK 3P32A 1IFIA 3P8MC 2Z5HA 3M0AA 1JY3P 1FZGA 3KQGA 3VTPC 2OYIB 1LTGC 1KFNA 3BRTB 4EIJA 3B5NA 1KILC 1SFCB 1LTJA 2E43A 3U1CA 1FZAA 1LGHB 5AVXB 5CCGA 3NMDA 2N1TB 1KFMA 3BRVB 5KTBA 1CI6B 1IJDB 2NPSA 2W6BA 2OARA 3M0DA 2WTYA 1HGVA 1GL2B 2C0WA 2P7JA 1L4AC 1L4AD 2HODB 1FAVA 3MGNA 2LKMA 2KOGA 4GIFA 1HWTC 4LGDE 4XE5B 1MUUA 1JTHB 3RK2B 2KSJA 1H89A 3SWYA 1FBMA 3B5NC 3H32A 5APYA 1LTJC 2O01H 2WSFH 5AVSB 5CCHA 1Z56A 2A45I 2YKQA 2WT7A 3SWFA 1YTZT 5CCGC 5CJ4A 1NHLA 3IFMA 3VN0A 2Z4EA 2Q5UA 2YKPA 3HUSB 5BU8B 1N73C 3HD7B 3V4WA 1URQC 1URQD 3BASA 2IFMA 1JY3N 1PFIA 1GDTA 2YO2A 1G2CB 4AQRD 1RE3A 1DEBA 1T3JA 2P2UA 2KYVA 2IX7C 2HLOA 2C9NY 5AVVB 1J1EB 5BU5A 1RY3A 3P7KA 2FYZA 3RK3B 3TSIA 1FZEA 1SLQA 1FDMA 1IO4A 3B8EB 5CCHC 5KJ7C 1E5WA 5KJ7D 2A45H 2R5BA 1A02J 5AW2B 4B86A 2N9BA 1JCDA 2H43A 1M1JB 4W80A 3BVHA 4N3YB 4ZKUA 4Y99C 1FOSE 3KDPB 1CW5A 1JY2O 2HPCB 4IFDK 1NH4A 2P1JA 1KILB 2FKWB 2I1KA 1DX7A 4EOTA 3OA7A 1RE3C 1LTIC 2H7HA 2YO3A 4WY4D 2CPSA 4LLHA 4HH2A 4ZKPA 2O1JA 4IFFA 1VPCA 4HYTB 3KYQA 3A3YB 1YYCA 3KPEA 2P67A 3M91A 1FZBA 2WSCH 1KZUB 2Q3IA 2OYHA 5AW1B 1GD2E 1L4AB 2GUSA 4I2LC 3A5TA 3V2QA 1LWUA 1LTBC 1W2EA 1SQPK 2Z5IA 3HE4A 1SQVK 4RESB 2XU6A 1ZR4A 3RL0B 1MFZA 2KP8A 1WRGA 3M06A 3U59A 1M7LA 3B5NB 1CSBA 3HTKA 3PP5A 1LTJB 1LT9C 5AVZB 1N73A 2HFED 3M9QA 1URQA 1T8ZA 1N86A 3V2NA 2KB7P 1JNMA 2NPSB 3GHGA 1N7SC 1N7SD 3L37A 5CHXA 3E1IA 3V4QA 2OYHC 1N7LA 1GK4A 1LWUC 1RF0C 3NTNA 1GW3A 2WSEH 3MIWA 1A02F 4LC1A 2W6AA 5KJ7A 3L36A 5APVA 3H32B 1OXZA 3CL3D 2OYIC 1N2DC 5APQA 2WPSA 4I6MC 2IPPA 1RF1A 2WT7B 1JMMA 1FJPA 1SFCC 1SFCD 5APTA 3TK1A 1JY2P 1ZLLA 3LIEA 1J1DB 1JY3O 1GK6A 5AVUB 3HRNA 3EFGA 3M9HA 4JF7A 3BATA 2N1TD 2QM7A 5AVYB 3GHGC 2VRSA 4WY4A 4WBAA 4W7ZA 4C46A 4W7YA 3A7OA 1SQQK 1GL2C 1GL2D 1JCCA 2C9LY 3VMXA 5APSA 2CPBA 1T2KC 1T2KD 1SVFA 2Q7CA 1JUNA 3V2RA 2PAJA 1GW4A 2FYUK 1IFJA 3O8ZA 1G1IA 1S9KD 2XDJA 3VP8A 3C9IA 5AW8B 4I1LA 4DOJA 3NXSA 1RF1C 1FU1A 2WPQA 4XA4A 3N4XA 2KLVA 3R2PA 1FZCA 1GZLA 3HE5A 1LTTC 1IFNA 4WY4C 1HH0A 1LT9A 3TNUA 1CZQA 3HUSC 3IR9A 3HD7D 3L35A 1FOSF 2WPRA 1X79B 5AW5B 2J58A 4OH8B 3VMZA 1N7SA 4AUWA 2FFDA 4WB4A 1DH3A 1NKNA 1J1EC 4IFMA 1RF0A 5APUA 2OYHB 1IC2A 5APXA 3TYYA 2XV5A 3RK3D 2POHA 1LWUB 1HVVA 3HE4B 1KQLA 4C7NA 3WMM0 2M8RA 5CJ0A 2C0XA 1FZCC 2OYIA 1NU1K 1HBWA 5AW9B 2XZRA 3G3ZA 1SFCA 2Q9IA 2BASA 3OJAB 3HTKB 1GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGV A;  1IFI A;  1IFJ A;  2CPB A;  1FDM A;  2C0W A;  1HGZ A;  2CPS A;  1NH4 A;  2MJZ A;  1HH0 A;  2C0X A;  1IFD A; 
#chains in the Genus database with same CATH topology
 1KIL D;  1AFO A;  5TIS H;  3AE1 C;  1SQP G;  5KLI C;  1RE4 A;  1SQV G;  1RH5 B;  2E42 A;  2M3B A;  2GM4 A;  4RO0 A;  2IDB A;  3OAK A;  5AW0 B;  1HJ0 A;  3C1L A;  2BCC E;  3AE2 C;  1KYO D;  3C8V A;  3H1J J;  1NTM D;  3RL0 C;  5KAI E;  2R3C A;  3RL0 D;  1RF1 B;  1PIX A;  3B5N D;  1H88 A;  5AVW B;  4BRY A;  1EQ7 A;  2V7Q H;  1RE4 C;  1YTZ I;  1P84 H;  3V5B A;  1VQK P;  1MZ9 A;  4EDF A;  4ZNC A;  1S3J A;  3K5B A;  1JOC A;  4DZO A;  1SQB J;  1T3U A;  3CX5 I;  5KLV E;  3FWL A;  1NKZ B;  3H1H D;  1KB9 D;  2A06 E;  2M0B A;  2E76 D;  3H1L G;  3W68 A;  1SQQ G;  2ZFC A;  1K8A Q;  2HG5 D;  3P8C E;  1SP4 A;  3O6Q B;  1J1D C;  3HE5 B;  3PHL A;  1VQ9 P;  1XTG B;  3L72 G;  2KK7 A;  3L74 E;  1VQ6 P;  1EXI A;  4PV1 D;  1DEE G;  2J59 M;  2QVA A;  1HJB A;  3A0H H;  1N7S B;  1YQ4 C;  5KLV K;  1R8E A;  2WQY C;  2QSI A;  3MTU E;  1SQX J;  1KYO I;  1VQM P;  2B87 B;  2IBZ G;  3VTP C;  4H13 B;  3E1R A;  2QA4 P;  4EIJ A;  1Q86 Q;  3WU2 E;  2ZT9 D;  2BEQ D;  2N1T B;  5CBN A;  1CI6 B;  2KSE A;  4CPG A;  2WTY A;  1HGV A;  1GL2 B;  4GIF A;  1HWT C;  4XE5 B;  1MUU A;  1OVU A;  3Q5R A;  3VMA A;  3SWY A;  4HKZ H;  3H32 A;  1KB9 I;  2O01 H;  4EI2 A;  5CCH A;  1EZV E;  1YTZ T;  4BXL A;  4D6T J;  2IZ0 A;  2Q5U A;  2YKP A;  1N73 C;  3HD7 B;  3AEA C;  2WPV B;  3CC7 P;  1W5C E;  2YO2 A;  1G2C B;  3G71 P;  1YJN P;  2P2U A;  3L70 J;  2QJP C;  2R3S A;  2IX7 C;  1Y47 A;  2HLO A;  2E75 D;  2C9N Y;  4JQ0 D;  1J1E B;  3D71 A;  1KD1 Q;  1KYO E;  2RN0 A;  2KXP B;  2D2C B;  5CCH C;  5KJ7 C;  5KJ7 D;  2A45 H;  2R5B A;  2MKV A;  4N3Y B;  2K37 A;  1H0T A;  1BDD A;  3T97 B;  2HPC B;  1KIL B;  1EC5 A;  4HH2 A;  1VQ4 P;  2Q6Q A;  1NTZ G;  2E74 C;  2E74 D;  4U3F G;  4HYT B;  1U57 A;  3A3Y B;  3M91 A;  3D6Z A;  2WSC H;  5AW1 B;  1KB9 E;  3CXH D;  3W67 A;  4PJ0 E;  1LWU A;  1W2E A;  3HE4 A;  3PRJ A;  4H44 C;  3RL0 B;  1PP9 D;  2KP8 A;  1S2E A;  3U59 A;  3B5N B;  3FXD A;  1L0N G;  3H1K D;  5KAI H;  1SQP J;  4JBZ A;  2QJY B;  2HFE D;  5TJH A;  3BCC E;  4IL6 E;  2BEZ F;  4OGQ C;  3V2N A;  2KB7 P;  3AE5 C;  1BE3 J;  4GDO A;  5CHX A;  3S9O A;  1QVF O;  3CCQ P;  3G9R A;  3AE6 C;  4DJG A;  1LWU C;  1GW3 A;  1JMB A;  1BGY D;  3CWB J;  4DCK A;  3H1J G;  2E76 B;  2JWA A;  1YBK A;  1RF1 A;  1M90 Q;  2WT7 B;  1FJP A;  1BCC G;  2ZAE B;  1ZLL A;  1J1D B;  2Y9Y A;  5AVU B;  3HRN A;  3EFG A;  3M9H A;  4JF7 A;  2QM7 A;  4PV1 B;  4W7Z A;  3JCU H;  2C9L Y;  2CPB A;  1T2K C;  1T2K D;  1SQB G;  1SVF A;  4PD4 E;  3SWK A;  3RL0 g;  1IFJ A;  3O8Z A;  4ASW A;  1S9K D;  2XDJ A;  2NZ2 A;  1PGQ A;  1K04 A;  1S5L E;  3CXH I;  1SQQ J;  1RF1 C;  2WPQ A;  2LR2 A;  3O6Q A;  3HE5 A;  1LTT C;  3L72 J;  3PLN A;  4UB8 H;  3HUS C;  2ZT9 B;  4R4M A;  1YJ9 P;  2H89 C;  1OIP A;  5GTI H;  2WPR A;  1RHZ B;  2J58 A;  3MHV A;  1L0L E;  4OH8 B;  3VMZ A;  1N7S A;  3H1J E;  1DH3 A;  1FDO A;  2BCC D;  4IFM A;  1RF0 A;  1Q81 Q;  3CD6 P;  2OYH B;  3CX5 H;  1USE A;  2POH A;  1SQX G;  2B87 A;  2CK3 H;  2ZXX A;  4IL6 X;  2Q9I A;  3OJA B;  2AXT E;  3L75 J;  4KT0 J;  3H1I E;  1JM0 A;  1E79 H;  2N1T A;  1N73 B;  5AVQ B;  2QM8 A;  1SQB E;  2W90 A;  1CI6 A;  1L0L K;  1BSH A;  1YI2 P;  1GL2 A;  1OWA A;  2E75 B;  2W27 A;  2OTL P;  1T6A A;  2A06 D;  2YMY A;  1MFT A;  4HJG H;  3RK3 E;  4H13 C;  2IYP A;  4MN4 C;  2XND H;  4JPZ B;  2ZXE B;  1KYO H;  3VYI A;  1ZV8 A;  2AEJ A;  1SQV D;  3P8C D;  3V2P A;  1USD A;  4D6T G;  2N1T C;  1VQ7 P;  3L74 D;  1KC8 Q;  1SQB K;  5CCG D;  3HD7 A;  2K1A A;  2A45 G;  4M3L A;  3H1H J;  4C7R A;  1G2C A;  3EWK A;  3M0D C;  1WT6 A;  2E74 B;  1PV3 A;  3L70 G;  5AW7 B;  1SQX E;  4L75 A;  4N6J A;  3TGU E;  1QEX A;  3S1K A;  3L73 G;  5DJT B;  2N9Y B;  3D6Y A;  2Y0D A;  4O9B A;  2YXQ B;  3F5H A;  3MD0 A;  4JYC A;  2O1K A;  2QEX P;  1KB9 H;  3MUD A;  2OQQ A;  3CPW O;  3HD7 C;  1LTA C;  3T97 A;  3N7N A;  4IOI H;  2HPC A;  1HTL C;  1KIL A;  2FYU G;  4OVN F;  1NTZ J;  1IK7 A;  5CMZ A;  5AW4 B;  4U3F J;  1SQX K;  4U7J A;  4AYC A;  4L73 A;  1G1J A;  3L71 J;  3H1L D;  1S9K E;  3KZI E;  2D2C C;  3L4F A;  1AQT A;  1X0T A;  3Q5S A;  4D6T E;  1MV8 A;  2M3E A;  3IN6 A;  3M9B A;  3MUD C;  4C7N B;  3KQG A;  1EZV D;  1PPJ E;  3B5N A;  1KIL C;  1OMI A;  1LGH B;  2Y0E A;  1IJD B;  1BE3 G;  2W6B A;  2OAR A;  1EXJ A;  1GMJ A;  2V7Q J;  3A0B E;  4UB6 E;  2P7J A;  1NU1 G;  2HOD B;  2LKM A;  5B5E E;  2KOG A;  1VQP P;  1JTH B;  3CWB G;  2QRX A;  1FBM A;  3B5N C;  1BCC J;  5APY A;  5AVS B;  2YKQ A;  2Y0C A;  2WT7 A;  2QJY C;  1U7J A;  3IFM A;  2Z4E A;  2JDI H;  3HUS B;  3V4W A;  2IFM A;  1PFI A;  2KYV A;  5AVV B;  5KAF H;  1RY3 A;  2E76 C;  2J5U A;  3AED C;  4L74 A;  3H25 A;  1SQP E;  1SQV E;  5E79 E;  1A02 J;  4B86 A;  1ZRT E;  1JCD A;  3PTZ A;  1M1J B;  3BVH A;  4ZKU A;  5B66 E;  2RMZ A;  4Y99 C;  4WVZ A;  1FOS E;  1EZV I;  1CW5 A;  4PV1 C;  3GG2 A;  3BCC D;  4EOT A;  1LTI C;  4LLH A;  3CCV P;  2RKL A;  3CWB E;  4ZKP A;  4IFF A;  1K9M Q;  3KYQ A;  2P67 A;  2Q3I A;  2OYH A;  4NPF X;  1GD2 E;  2GUS A;  3A5T A;  3FGA D;  1LTB C;  1SQP K;  2Z5I A;  1SQV K;  3CXH H;  1MFZ A;  1YIJ P;  3GF3 A;  2ZT9 C;  3L75 G;  1CSB A;  1LTJ B;  1PGP A;  5AVZ B;  2O01 J;  1N73 A;  3M9Q A;  1T8Z A;  1JNM A;  1NTM G;  1PGJ A;  3RBZ A;  3AEB C;  3L37 A;  3H1L E;  2OYH C;  1LJ2 A;  1SQQ E;  4PD4 D;  3JSV C;  3CCS P;  3CCL P;  2WSE H;  1VF5 D;  3L72 E;  4LC1 A;  5KJ7 A;  2E5Y A;  2IZ1 A;  3CL3 D;  4I6M C;  2H88 C;  2AEM A;  2UWJ E;  1JB0 J;  1JY3 O;  2B88 A;  3CCE P;  2VRS A;  3H1H G;  1L0L D;  1AV1 A;  2E75 C;  3D70 A;  1QVG O;  4W7Y A;  3H1J D;  3A7O A;  1SQQ K;  5H2F E;  2IBZ E;  1JCC A;  3L73 J;  5APS A;  2PAJ A;  2V4H A;  3USS A;  1G1I A;  3C9I A;  3L75 E;  1OZH A;  5AW8 B;  2WSC J;  4I1L A;  4DOJ A;  3NXS A;  3QH9 A;  3KZI H;  5GTH E;  4BWN A;  2RH0 A;  2ZYD A;  2KLV A;  1K05 A;  2AEF A;  2DW3 A;  3H1I D;  2FYU J;  4HB1 A;  1GZL A;  1CZQ A;  1SQB D;  1FOS F;  2ZVN B;  4AUW A;  3L71 G;  4WB4 A;  2B89 A;  3RGU A;  4ZMD A;  4UB6 H;  4PD4 I;  3AE4 C;  2XV5 A;  3RK3 D;  1OVV A;  4C7N A;  3WMM 0;  5CJ0 A;  1NJI Q;  2WVR A;  1HBW A;  2E5T A;  3HTK B;  1KTM A;  5KLV J;  2XKM A;  2K88 A;  3AEE C;  3GW6 A;  1JEK A;  1P84 I;  2GUV A;  1GTW A;  1NWQ A;  1NU1 J;  1SQX D;  1EDI A;  1GU5 A;  2IFN A;  5AVR B;  2HOD A;  3TGU D;  1XTC C;  3I5C A;  1JTH A;  1J2J B;  2WIT A;  1ZR2 A;  2LXB A;  3CLQ A;  3WUV A;  3H6P A;  2W6J H;  1ZXG A;  1NTZ E;  1NVO A;  4U3F E;  4Y99 B;  5AW3 B;  1VQL P;  5TIS E;  3HUS A;  5E79 H;  3VMY A;  3L71 E;  1YQ3 C;  1NTK J;  2NPS C;  2Q1K A;  2NPS D;  3CI9 A;  3AEG C;  3U1A A;  1H8A A;  4H0L D;  1L0N E;  2JP3 A;  2XNX A;  4D6T D;  1N8R Q;  1UIX A;  4NPD A;  4N78 E;  1NTZ K;  2L5G B;  1PPJ D;  1M1J A;  2I8D A;  4Y28 J;  2FXM A;  2R5D A;  3I55 P;  1FZC B;  3L70 D;  1P84 E;  3R4Y A;  1IFD A;  1S72 P;  3FWN A;  1IK9 A;  3TNU B;  4A7P A;  1NOH A;  3MZW B;  1ZN5 A;  2L91 A;  4Z1M H;  3WU2 H;  1ZME C;  5C39 A;  2G3A A;  3VOP A;  3II6 A;  1PP9 G;  3SSU A;  1S1C X;  3LW5 H;  2FFD B;  1L0N K;  5BVZ A;  1OX3 A;  2JEE A;  1BCC E;  2HYN A;  3H1K G;  4YXD C;  1UII A;  1VF5 B;  1OW6 A;  1M1J C;  3G4S P;  3A2A A;  3IAO A;  3P8M C;  3M0A A;  1KFN A;  1LTJ A;  3U1C A;  5AVX B;  5CCG A;  2FYN B;  4WWI A;  1BGY G;  4YXW H;  1KFM A;  3BRV B;  3AE3 C;  1NTM J;  1LP1 B;  1W2B O;  2WSF J;  2KZI A;  3M0D A;  4TT3 H;  1FAV A;  3CC2 P;  3B4S A;  4LGD E;  1Q90 D;  3RK2 B;  1FE6 A;  1R5S A;  1SQP D;  1ZRT D;  2R44 A;  1LTJ C;  2WSF H;  1Y8A A;  1Z56 A;  2A45 I;  5CCG C;  1ZW0 A;  5CJ4 A;  2JKV A;  2W83 C;  4ASV A;  1M57 D;  1URQ C;  1URQ D;  3BAS A;  1JY3 N;  3CWB D;  2YIU B;  4AQR D;  1S5L X;  1DD4 A;  1DEB A;  2KS1 B;  1EDL A;  4RKU J;  5BU5 A;  3P7K A;  3RK3 B;  2KLU A;  1FZE A;  3TSI A;  2FXO A;  1M1K Q;  1DIP A;  4PJ0 H;  5CBO A;  3AE8 C;  4GOF A;  2H43 A;  4W80 A;  3AEF C;  3KDP B;  3CCU P;  1KN7 A;  2Q3E A;  2BCC G;  2YMK A;  3CME P;  1JY2 O;  4IFD K;  1NH4 A;  2FKW B;  2I1K A;  1DX7 A;  3OA7 A;  2H7H A;  4WY4 D;  2CPS A;  4K35 A;  4IL6 H;  1SQQ D;  1FZB A;  1KZU B;  1L4A B;  3L72 D;  3V2Q A;  4RES B;  2XU6 A;  1ZR4 A;  1AA0 A;  1WRG A;  3L70 E;  1AJY A;  1K73 Q;  3HTK A;  3PP5 A;  2KIK A;  1RQV A;  1LT9 C;  3L73 E;  5KLV G;  2A06 G;  3AE7 C;  2NPS B;  2IBZ D;  1N7L A;  1GK4 A;  4H0L B;  2KUB A;  3L75 D;  3L74 G;  2FYU E;  2K9Y A;  4PD4 H;  3MIW A;  1TU3 F;  1A02 F;  2OYO A;  2W6A A;  3L36 A;  3QWO C;  1L0L J;  5L8R J;  1IZN B;  5APV A;  1OXZ A;  1S5L H;  2OYI C;  2P58 A;  1SFC C;  1SFC D;  5APT A;  3TK1 A;  1JY2 P;  3MP7 B;  2ZVO B;  1KQG B;  1NTK G;  1D7M A;  4TLF A;  3FX0 A;  4WBA A;  2JR8 A;  2LXC B;  2Q7C A;  1YHQ P;  1JUN A;  3H1I J;  1GW4 A;  2FYU K;  1VQN P;  1BE3 E;  4XA4 A;  3CCM P;  3FXE A;  3N4X A;  2QG4 A;  1FZC A;  1NU1 E;  2AXT H;  3TNU A;  4EYY Q;  3SFE C;  1QX8 A;  1X79 B;  1PP9 J;  3JCU E;  3IF4 A;  2FFD A;  1EZV G;  3H1K J;  1LT1 A;  2IBZ I;  1NKN A;  1RQU A;  2PGD A;  3TYY A;  1ZP0 C;  1HVV A;  1NTZ D;  2M8R A;  2ZYG A;  3TDK A;  2C0X A;  1FZC C;  2WSE J;  1YIT P;  4U3F D;  1NU1 K;  1NTK E;  2OTJ P;  4UB8 E;  5AW9 B;  3TGU J;  1BGY J;  3L71 D;  5GTI E;  2K9J B;  1M8O B;  4GT1 A;  2I1J A;  3UIA A;  4KHX A;  1LP1 A;  5M1B A;  1URQ B;  3NFQ A;  1AQ5 A;  4RJT A;  2FFD C;  1IFM A;  3OW2 O;  3GHG B;  1S4X A;  2K3R A;  1L0N D;  1VF5 C;  3CX5 E;  2GA1 A;  3VP9 A;  3LID A;  4N78 D;  1FJK A;  2YKO A;  2JWD A;  5APW A;  1NTK K;  1NO4 A;  1OW7 A;  2MJZ A;  2FYN C;  1P84 D;  2YXR B;  4YPC A;  1X8Y A;  3AE9 C;  3CCJ P;  2PP6 A;  1FS0 E;  1KIL E;  1NAF A;  2WSS H;  5AW6 B;  2PFX A;  4WY4 B;  5AVT B;  1X22 A;  2KS1 A;  2R32 A;  1FZF A;  1BCC D;  3RK2 C;  2O3J A;  3RK2 D;  1JO5 A;  1AVO A;  3EQ2 A;  3BCC G;  5KKZ B;  1X9V A;  1U7M A;  3CCR P;  2FY8 A;  4I7Z B;  2YNY A;  3WUU A;  1NTM E;  3KXD A;  2BCC J;  5CCH D;  2HR3 A;  3G6E P;  4XFJ A;  1SS1 A;  2JJL A;  2M5A B;  2YIU C;  1HUC A;  1LT9 B;  2FBW C;  2WZ7 A;  1QLE D;  1JY2 N;  1VQ8 P;  1HGZ A;  1QL2 A;  4JYB A;  5KLI B;  1VQO P;  1Y9B A;  3A0B H;  1QL1 A;  2H8P D;  3RK3 C;  3Q3D A;  1VDF A;  1EDK A;  2KNC B;  1L4A A;  5B5E H;  1LTS C;  4GKG A;  2WWW A;  3H1H E;  1NTM K;  3P32 A;  1IFI A;  2Z5H A;  2O01 N;  1NGM B;  1JY3 P;  2QJK C;  1FZG A;  2OYI B;  1NYH A;  1LTG C;  4H44 D;  2G8Y A;  3BRT B;  1PGO A;  2Y9Z A;  1SFC B;  1VL2 A;  2E43 A;  1FZA A;  3GMA A;  3NMD A;  5KTB A;  2NPS A;  1QGK B;  1SQV J;  4QMA A;  2C0W A;  4OGQ D;  1L4A C;  1L4A D;  3MGN A;  3L74 J;  1AVY A;  4KJM A;  4GOE A;  2AXC A;  2KSJ A;  1H89 A;  3I56 P;  2IYO A;  3Q2Y A;  1L0L G;  1EDJ A;  1NAY A;  2KZJ A;  3SWF A;  2OGU A;  4R4L A;  1NHL A;  2SPZ A;  3VN0 A;  4BRY B;  1OVR A;  5B66 H;  1KOR A;  4K3A A;  1FDI A;  2B9B A;  2JO1 A;  5BU8 B;  1GDT A;  4H0L C;  1PL5 A;  1RE3 A;  1T3J A;  3H1I G;  2PRR A;  3LW5 J;  2FYZ A;  1SLQ A;  1FDM A;  1IO4 A;  3TF5 A;  3B8E B;  1E5W A;  1DD3 A;  3EFF K;  5AW2 B;  2N9B A;  1FC2 C;  3H1L J;  1Q2N A;  3L73 D;  3ABV C;  1LNQ A;  2P1J A;  2QIW A;  1MKM A;  1RE3 C;  2YO3 A;  2FXP A;  1Q7Y Q;  5EFW B;  2O1J A;  3Q5P A;  1ZOY C;  5KAF E;  2NRG A;  1VPC A;  1YYC A;  3KPE A;  3PJS K;  3ZDM A;  2W8Z A;  2FYU D;  4I2L C;  2ITA A;  1HF9 A;  3KHU A;  3M06 A;  3TGU G;  4DT0 A;  1M7L A;  3A0H E;  1WMK A;  2K9J A;  1URQ A;  1R5L A;  1IFP A;  1N86 A;  3GHG A;  1N7S C;  1N7S D;  3E1I A;  1Q82 Q;  3V4Q A;  5H2F H;  3CMA P;  1RF0 C;  3NTN A;  2QJP B;  4YTP C;  4GOD A;  3AEC C;  3GF7 A;  3F89 A;  2QE7 H;  3PH0 A;  1KV4 A;  3CXH E;  1BE3 D;  5KLV D;  2WMM A;  3H32 B;  4H13 D;  1NU1 D;  1N2D C;  1PP9 E;  5APQ A;  2WPS A;  2IPP A;  5GTH H;  1JMM A;  3SFD C;  1OW8 A;  1PZQ A;  1BDC A;  3GLM A;  3LIE A;  1KMI Z;  3H1K E;  4NPE A;  1GK6 A;  3BAT A;  2N1T D;  5AVY B;  3GHG C;  4WY4 A;  1YJW P;  3JC2 2;  1KQF B;  4C46 A;  1GL2 C;  1PPJ G;  1GL2 D;  2KI7 B;  3VMX A;  3Q1M A;  3CC4 P;  3V2R A;  3BCC J;  3E7K A;  1BSN A;  2P10 A;  2ZJS E;  1BGY E;  3VP8 A;  2ZYA A;  2OTK E;  1FU1 A;  1NTK D;  5DJU B;  2QJK B;  4H44 B;  3R2P A;  4L76 A;  1H0T B;  1IFN A;  2M5A A;  4WY4 C;  1HH0 A;  1LT9 A;  3IR9 A;  4OWF A;  3HD7 D;  3L35 A;  3WUT A;  1L2P A;  5AW5 B;  1KQS O;  3V6I A;  1VQ5 P;  3RBX A;  4OGQ B;  3CX5 D;  1M56 D;  5KKZ C;  1J1E C;  2KNC A;  5APU A;  1IC2 A;  5APX A;  3S4R A;  4I7Z C;  1LWU B;  3HE4 B;  1KQL A;  2D2C D;  5K5G B;  1OFC X;  3B71 A;  2OYI A;  2XZR A;  3G3Z A;  1SFC A;  3ITK A;  2BAS A;  1L0N J;  1GU4 A; 
#chains in the Genus database with same CATH homology
 1KIL D;  2XKM A;  2N1T A;  2I1J A;  4GT1 A;  2QM8 A;  5AVQ B;  4KHX A;  3UIA A;  1N73 B;  1AFO A;  1URQ B;  1CI6 A;  3NFQ A;  1AQ5 A;  1L0L K;  2GUV A;  1RE4 A;  2FFD C;  2E42 A;  1GTW A;  1NWQ A;  1IFM A;  2M3B A;  2GM4 A;  3GHG B;  1GL2 A;  1GU5 A;  2IFN A;  5AVR B;  2HOD A;  1OWA A;  3OAK A;  2W27 A;  5AW0 B;  1XTC C;  3I5C A;  1JTH A;  3VP9 A;  3LID A;  1J2J B;  2WIT A;  4N78 D;  1FJK A;  2YKO A;  2YMY A;  1ZR2 A;  3CLQ A;  3H6P A;  5APW A;  3RL0 C;  2R3C A;  3RL0 D;  2ZXE B;  1NTK K;  3VYI A;  1NO4 A;  1ZV8 A;  2MJZ A;  3P8C D;  3V2P A;  1RF1 B;  4Y99 B;  5AW3 B;  3B5N D;  1H88 A;  2N1T C;  5AVW B;  1X8Y A;  1EQ7 A;  3HUS A;  3VMY A;  1SQB K;  2PP6 A;  1RE4 C;  1YTZ I;  5CCG D;  3HD7 A;  2A45 G;  3V5B A;  1MZ9 A;  4M3L A;  1NAF A;  5AW6 B;  4WY4 B;  4C7R A;  1G2C A;  2NPS C;  2NPS D;  5AVT B;  3M0D C;  1WT6 A;  3CI9 A;  2R32 A;  3U1A A;  1FZF A;  1JOC A;  5AW7 B;  1H8A A;  4DZO A;  4N6J A;  3RK2 C;  3RK2 D;  1T3U A;  1JO5 A;  2XNX A;  3EQ2 A;  4O9B A;  1NKZ B;  1X9V A;  4N78 E;  3MD0 A;  1NTZ K;  2YNY A;  2L5G B;  4JYC A;  2O1K A;  1M1J A;  3MUD A;  2FXM A;  2ZFC A;  5CCH D;  2HG5 D;  2R5D A;  1FZC B;  3HD7 C;  1LTA C;  1SP4 A;  3P8C E;  1J1D C;  3HE5 B;  2JJL A;  3T97 A;  3N7N A;  1IFD A;  2HPC A;  1HTL C;  1HUC A;  1KIL A;  1IK9 A;  1LT9 B;  3TNU B;  1NOH A;  1XTG B;  1ZN5 A;  2WZ7 A;  5CMZ A;  2J59 M;  5AW4 B;  1JY2 N;  1HJB A;  1HGZ A;  3VOP A;  1N7S B;  1SQX K;  3II6 A;  3LW5 H;  4AYC A;  1QL2 A;  4JYB A;  2FFD B;  1G1J A;  1QL1 A;  1L0N K;  2H8P D;  2JEE A;  1VDF A;  3RK3 C;  5BVZ A;  2HYN A;  1S9K E;  1L4A A;  3L4F A;  5KLV K;  1LTS C;  4GKG A;  1MV8 A;  3M9B A;  3MTU E;  1M1J C;  2WWW A;  3A2A A;  4C7N B;  1NTM K;  3P32 A;  1IFI A;  3P8M C;  2Z5H A;  3M0A A;  1JY3 P;  1FZG A;  3KQG A;  3VTP C;  2OYI B;  1LTG C;  1KFN A;  3BRT B;  4EIJ A;  3B5N A;  1KIL C;  1SFC B;  1LTJ A;  2E43 A;  3U1C A;  1FZA A;  1LGH B;  5AVX B;  5CCG A;  3NMD A;  2N1T B;  1KFM A;  3BRV B;  5KTB A;  1CI6 B;  1IJD B;  2NPS A;  2W6B A;  2OAR A;  3M0D A;  2WTY A;  1HGV A;  1GL2 B;  2C0W A;  2P7J A;  1L4A C;  1L4A D;  2HOD B;  1FAV A;  3MGN A;  2LKM A;  2KOG A;  4GIF A;  1HWT C;  4LGD E;  4XE5 B;  1MUU A;  1JTH B;  3RK2 B;  2KSJ A;  1H89 A;  3SWY A;  1FBM A;  3B5N C;  3H32 A;  5APY A;  1LTJ C;  2O01 H;  2WSF H;  5AVS B;  5CCH A;  1Z56 A;  2A45 I;  2YKQ A;  2WT7 A;  3SWF A;  1YTZ T;  5CCG C;  5CJ4 A;  1NHL A;  3IFM A;  3VN0 A;  2Z4E A;  2Q5U A;  2YKP A;  3HUS B;  5BU8 B;  1N73 C;  3HD7 B;  3V4W A;  1URQ C;  1URQ D;  3BAS A;  2IFM A;  1JY3 N;  1PFI A;  1GDT A;  2YO2 A;  1G2C B;  4AQR D;  1RE3 A;  1DEB A;  1T3J A;  2P2U A;  2KYV A;  2IX7 C;  2HLO A;  2C9N Y;  5AVV B;  1J1E B;  5BU5 A;  1RY3 A;  3P7K A;  2FYZ A;  3RK3 B;  3TSI A;  1FZE A;  1SLQ A;  1FDM A;  1IO4 A;  3B8E B;  5CCH C;  5KJ7 C;  1E5W A;  5KJ7 D;  2A45 H;  2R5B A;  1A02 J;  5AW2 B;  4B86 A;  2N9B A;  1JCD A;  2H43 A;  1M1J B;  4W80 A;  3BVH A;  4N3Y B;  4ZKU A;  4Y99 C;  1FOS E;  3KDP B;  1CW5 A;  1JY2 O;  2HPC B;  4IFD K;  1NH4 A;  2P1J A;  1KIL B;  2FKW B;  2I1K A;  1DX7 A;  4EOT A;  3OA7 A;  1RE3 C;  1LTI C;  2H7H A;  2YO3 A;  4WY4 D;  2CPS A;  4LLH A;  4HH2 A;  4ZKP A;  2O1J A;  4IFF A;  1VPC A;  4HYT B;  3KYQ A;  3A3Y B;  1YYC A;  3KPE A;  2P67 A;  3M91 A;  1FZB A;  2WSC H;  1KZU B;  2Q3I A;  2OYH A;  5AW1 B;  1GD2 E;  1L4A B;  2GUS A;  4I2L C;  3A5T A;  3V2Q A;  1LWU A;  1LTB C;  1W2E A;  1SQP K;  2Z5I A;  3HE4 A;  1SQV K;  4RES B;  2XU6 A;  1ZR4 A;  3RL0 B;  1MFZ A;  2KP8 A;  1WRG A;  3M06 A;  3U59 A;  1M7L A;  3B5N B;  1CSB A;  3HTK A;  3PP5 A;  1LTJ B;  1LT9 C;  5AVZ B;  1N73 A;  2HFE D;  3M9Q A;  1URQ A;  1T8Z A;  1N86 A;  3V2N A;  2KB7 P;  1JNM A;  2NPS B;  3GHG A;  1N7S C;  1N7S D;  3L37 A;  5CHX A;  3E1I A;  3V4Q A;  2OYH C;  1N7L A;  1GK4 A;  1LWU C;  1RF0 C;  3NTN A;  1GW3 A;  2WSE H;  3MIW A;  1A02 F;  4LC1 A;  2W6A A;  5KJ7 A;  3L36 A;  5APV A;  3H32 B;  1OXZ A;  3CL3 D;  2OYI C;  1N2D C;  5APQ A;  2WPS A;  4I6M C;  2IPP A;  1RF1 A;  2WT7 B;  1JMM A;  1FJP A;  1SFC C;  1SFC D;  5APT A;  3TK1 A;  1JY2 P;  1ZLL A;  3LIE A;  1J1D B;  1JY3 O;  1GK6 A;  5AVU B;  3HRN A;  3EFG A;  3M9H A;  4JF7 A;  3BAT A;  2N1T D;  2QM7 A;  5AVY B;  3GHG C;  2VRS A;  4WY4 A;  4WBA A;  4W7Z A;  4C46 A;  4W7Y A;  3A7O A;  1SQQ K;  1GL2 C;  1GL2 D;  1JCC A;  2C9L Y;  3VMX A;  5APS A;  2CPB A;  1T2K C;  1T2K D;  1SVF A;  2Q7C A;  1JUN A;  3V2R A;  2PAJ A;  1GW4 A;  2FYU K;  1IFJ A;  3O8Z A;  1G1I A;  1S9K D;  2XDJ A;  3VP8 A;  3C9I A;  5AW8 B;  4I1L A;  4DOJ A;  3NXS A;  1RF1 C;  1FU1 A;  2WPQ A;  4XA4 A;  3N4X A;  2KLV A;  3R2P A;  1FZC A;  1GZL A;  3HE5 A;  1LTT C;  1IFN A;  4WY4 C;  1HH0 A;  1LT9 A;  3TNU A;  1CZQ A;  3HUS C;  3IR9 A;  3HD7 D;  3L35 A;  1FOS F;  2WPR A;  1X79 B;  5AW5 B;  2J58 A;  4OH8 B;  3VMZ A;  1N7S A;  4AUW A;  2FFD A;  4WB4 A;  1DH3 A;  1NKN A;  1J1E C;  4IFM A;  1RF0 A;  5APU A;  2OYH B;  1IC2 A;  5APX A;  3TYY A;  2XV5 A;  3RK3 D;  2POH A;  1LWU B;  1HVV A;  3HE4 B;  1KQL A;  4C7N A;  3WMM 0;  2M8R A;  5CJ0 A;  2C0X A;  1FZC C;  2OYI A;  1NU1 K;  1HBW A;  5AW9 B;  2XZR A;  3G3Z A;  1SFC A;  2Q9I A;  2BAS A;  3OJA B;  3HTK B;  1GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...