1HH4A

Rac1-rhogdi complex involved in nadph oxidase activation
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
189
structure length
189
Chain Sequence
PQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVSLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Rac1-Rhogdi Complex Involved in Nadph Oxidase Activation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/inhibitor
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 56
structure length 189
sequence length 189
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hh4A00
4YMTA 3N2EA 4TLAA 4DEXA 1T0HB 821PA 4G5OA 1GRRA 2BV3A 4BECA 1VHTA 3IDQA 4G5RA 4BQSA 2ZU6A 1TUEA 2BBOA 1KI9A 3LVRE 2P5TB 1OT3A 5FBQB 3TUIC 2ZEJA 4JBXA 4DLRA 1QHHA 4EFMA 2B92A 1VCIA 3THOA 2PCJA 1GL6A 3W8NA 3U61B 1NLZA 1VTKA 2I1QA 5EZ5A 1BYIA 2VTKA 3WMGA 2KJQA 2C99A 2P6UA 4Z1MA 4BFYA 2R6DA 1E2GA 2OBLA 1ZU5A 2JLSA 3IO5A 4UNPA 5IDVA 1R5NA 4Q1EA 3T34A 1KI3A 1U99A 3CKLA 4ZV4A 4IDNA 1P2TA 2MMGA 3C8UA 1OB2A 2O8FA 1XWIA 4DIDA 2AFIE 2QZ4A 3C4JA 3QOFA 4RD2A 3N2IA 4PZYA 4BZXA 3MJRA 3R9XA 3FFBA 3JZAA 1NN0A 2QRNA 2QTHA 3A4NA 3PCRB 2OBMA 1RYFA 3HYTA 4FMCB 2OCYC 4ZCLA 4A2QA 3TGPA 4D80A 2PBRA 2Q3FA 4NKRA 1J99A 1P62B 4PHTA 2YKGA 1COWD 4TLBA 4NCKA 1E69A 3QQ5A 4Q9LA 4NYJQ 1XD9A 2WWFA 4M9QA 1MKYA 3FMPB 3U2QA 2ZRPA 3DHWC 1NKTA 3WNBA 4F91B 2RGDA 1TQ6A 1G5TA 2ZAMA 4TMWA 2J5XA 1D6JA 5CLLA 3L8YA 2F43B 4O25A 4KSCA 3TKLA 3CR7A 2F1IA 5M04A 3R20A 3QG5A 2HT6A 3LW7A 5D3QA 3TJZA 5L3SA 2GEVA 5TMPA 1G21E 3AKEA 1AS2A 1NVVQ 3QXSA 4MQBA 3CZQA 5JCPA 4CEJB 1G8HA 4FIDA 3T5GA 1L2TA 5JS7A 2ZJAA 1AQYA 4ACAA 1CJVC 2GESA 3PEUA 4Q7KA 4Q9IA 1FNNA 2QRZA 1Z2CA 3AVOA 1ZM3A 2C98A 4MGKR 1WCV1 4QFMA 1Z5ZA 2DFLA 4P4TA 3D8BA 1BS1A 3D31A 3VR1A 2GZDA 5FBVB 5GJVC 4P4UA 2E1RA 1NVVR 1EFTA 4BFVA 2V54A 3DZDA 2FOLA 3LBHA 5C1BA 4MA4A 4AYTA 3BK7A 3EIHA 2F7SA 1ZUNB 4M1SA 2X2FA 3QF4B 3QEJA 2V6JA 3KUCA 4K46A 3SU8A 1DEKA 1KSJA 4EPYA 2G3YA 2C9YA 5EE1A 4QHSA 4FMDF 1WMSA 4Z1MD 4F4JA 3GP8A 3QXXA 5CLQA 3VHXA 2O0JA 3AVXA 4DC9A 3BAFA 4DLYA 2F1JA 1P60A 2ZUDA 2OESA 4ZKEA 2WAXA 4PSAA 4DCNA 3SQXA 2MSEB 3GLGA 1UKZA 2D7CA 3WYGA 2BEJA 3V4FA 4QXAA 4WOPA 1M34E 4HAXA 1MO3A 1U0JA 2W2TA 4LJAA 4L9SA 3B13B 2J0UA 1OXTA 1NBME 3AH8A 3F0TA 2OZEA 1E2PA 2KB0A 4CYMA 2D2EA 2B21A 3QXJA 4OI4A 2XSZD 3WHLA 3SYNA 3VKHA 1AM4D 121PA 2QM8A 3MFYA 2GTPA 2RGAA 3VX4A 3A1VA 3ONWA 4CEHA 4OI0A 5BN4A 4B44A 1U94A 2Z43A 4D81A 1GNQA 4W5HA 3VKWA 2NZJA 2X19A 2NO0A 5D3MB 1ZMXA 3R8FA 5K8IA 4MYCA 5FBLB 4P4SA 3ZIAD 3FKQA 1R7RA 1RJ9A 3T1QA 3RRNA 3PUXA 3U3KA 2R62A 4RY2A 4M1YA 2X77A 4BRUA 1R0XA 1KDRA 2KSQA 4TMTA 4DEYA 1CRPA 4R2IA 1KO4A 4L15A 2XXAA 1K8RA 2HJGA 1CJTC 3FGNA 2QE7D 1MT0A 3PIRA 1LY1A 2J87A 2WPDD 2IWRA 5B57C 2ZRBA 4A0HA 2JEOA 1KI7A 3CUEF 4FCVA 3K9LA 2VP5A 1VYUA 4C7OB 5K8LA 4Q66C 4RCYA 1I2DA 2R6GA 3DKPA 2VIIA 2AXNA 2BHRA 2WOOA 2YV5A 3K1JA 3KX2A 3NBXX 4B33A 3RDPA 2FSIA 2ZITA 2XTMA 2F6RA 5ANRB 4KJZA 4A36A 1NP6A 1NN1A 1N0UA 4LUCA 3Q5DA 4P31A 1H8EA 5H70A 4KFRA 1OB5A 2ZSEA 4Q03A 1E1QD 1NBMA 1F60A 3NBYC 2V4ZA 4IFBA 3EWAA 1NLYA 4GI7A 3UMSA 4Q1AA 2DR3A 4ZDIA 4OQXA 1FP6A 3P4YA 1E99A 2JLVA 3PR1A 2YOHA 1D2MA 2ZJBA 4RD3A 1TPZA 4N0EA 1R5BA 1SVIA 4L16A 1SVWA 4YC7A 4MUAA 4HB3A 3OHMA 4E22A 1NKSA 3MUFA 2GXUA 2ZJ5A 2D62A 1D5CA 3A4LA 1US8B 1RC8A 1YZLA 1NSFA 2J1LA 2ORVA 1YR8A 4MKHA 3VU9B 1J8YF 3PITA 4EPWA 3OEED 4Q48A 3G5UA 2IYYA 2ZE7A 5JS8A 2IEZA 2VQSA 3UWKA 2FN4A 1CR4A 2V8OA 2YYZA 3L0OA 3M0EA 4M1TA 1NN5A 1XRJA 2GHIA 1R8QA 4G5GA 1UPTA 1Q3HA 4NONA 2D4HA 3RRMA 4M9XA 4DKXA 2HXSA 4YXWA 3CM0A 2GXSA 3KKMA 1SZPA 3U5ZB 1V43A 1TMKA 3THWB 4IDOA 2QPTA 1KI1A 1X6VA 4GMXA 4NP6A 4R7ZA 3THYB 3O8CA 2LKDA 3CH5A 1G16A 1ESMA 5BWMA 5CITA 3LA6A 1Z07A 3Q7QA 4RD1A 1XX6A 3SFZA 2ZXUA 3SJBA 2BDTA 2VYFA 5KU1A 4XSGA 1CF4A 3SFVA 1E2FA 1FW6A 1P7CA 3BXZA 4HZUB 4ARZA 2DFTA 5AUOB 3U6KA 1E4YA 2GCNA 1ZCBA 5J5CA 1Q21A 2AFHE 4DRZA 3KTAB 1DADA 3AVVA 1E79D 4HSEA 3RSOA 1EESA 3GLFE 1GILA 2ATXA 1SVMA 3QXCA 2ZVPX 3LQRA 3I32A 3SHFA 6Q21A 4QL3A 1GNPA 2VF7A 2O8DB 3OEHD 1LNZA 2JJ2D 1W46A 2ZRCA 1G5PA 2NO6A 2ZRMA 4B43A 2GK6A 1HURA 1ZD1A 4AKGA 1EFHA 1ZD8A 2Z83A 4WZ6A 5JHGB 4TYYA 1FX0A 5LDDC 2CCKA 4NZYA 1C4OA 3OEEA 2C2HA 1WP9A 1DELA 4BWYA 4RD4A 3ZDQA 3WNCA 1XTJA 1IONA 1E94E 2CXXA 3Q3JB 3WBKA 2W0MA 2ZYVX 1QHSA 4JVSB 3GPLA 1CR2A 4RZUA 3THYA 2JCSA 1RVDA 4CGZA 3SJAA 5KSYA 3TMKA 3SYKA 5CYOA 3SBDA 4ZO4A 1HV8A 5J4LA 2WJIA 1NY6A 4J0QA 5IF9A 4LYJA 1W4CA 4Q4JA 4ASUA 1S3SA 1SKYB 2FDCA 3I61A 3BORA 2IYVA 5JHHB 2FWRA 1CLUA 1VG1A 4HI0E 2WJYA 4V0LA 3QKRB 2L0XA 1D8TA 1P9NA 2GNOA 4Q9JA 1II8B 2ANCA 2ZROA 1M1YE 1T3LA 3GQBA 2OFWA 4FXPA 1DS6A 2WHXA 4TMXA 4LHZA 2OCPA 3KKNA 1P4SA 3GJ3A 2JATA 1HEIA 2C04A 2OFXA 3B1ZA 1P72A 3VQTA 2FFBA 2WJHA 2LKCA 4UNQA 2PZFA 3TQCA 1Z06A 2PMKA 3AF4A 2WKPA 4W5JA 4Z8XA 1F2UA 4RSGA 1W5TA 1N6NA 3FYHA 4L8GA 4TMVA 5GJWC 3VFDA 2QY9A 1KI4A 1TEVA 4M53A 4PO8A 5F98A 1Q3TA 1AQUA 2IUSA 2ANBA 3CRRA 3VNVA 3KZ1E 4QKQA 1VCOA 2CCGA 4EPTA 1QHYA 4PC7A 3QG1A 1RRCA 2W2VA 3TBKA 3UWOA 2XSZA 4JBYA 3IIJA 1KSFX 3KFVA 3LFUA 4URUR 4A6XA 4MRSA 3OEHA 2A9KA 1OIXA 3TAHA 1YZUA 1VCMA 4A8JC 2AK3A 2BVNA 5DGXA 2ERXA 2P5SA 1XCGB 4AYWA 4PHHA 5FI1B 1T4GA 4US2R 4DUGD 4DCTA 1UEIA 1XBTA 4PQRA 4E03A 1IJEA 1PLKA 3CNNA 2NPFA 3DKVA 1Z2AA 2FU5C 3GJ4A 4WVFA 1GKYA 3TRFA 3U3MA 3PJRA 3KJEA 1EX6A 4LOAA 3VR2A 4UJ3A 1TNDA 3ZD6A 3MD0A 5EE3A 3AP1A 2DCUA 1FL9A 5DI9A 2RB4A 2OLJA 4QGAA 2DWQA 5EE9A 4TN1A 2OLKA 3K70B 1XEFA 3ZIAA 5CYPA 2IXFA 2BBTA 3EAQA 2H57A 1Z0AA 4GOKA 1DBSA 3DEFA 3GLFA 3U44A 3RC3A 5FPHA 2CNWA 4PXAA 2V3CC 2IS6A 1GM5A 3NDBB 2JIZA 3SE0A 2YC4C 3RLFA 1UEJA 1Z63A 4PSVA 1RJ9B 3U6BA 2DPXA 1NL3A 1G4UR 1UBEA 4NYIR 1WA5A 3UANA 4I1SA 1W44A 1G41A 3TUZC 1E2QA 2ZSAA 2XNDD 3WXMA 1KDTA 2GWHA 2CHVA 3RS0A 1E1RD 5A0FA 1E3MA 1G8PA 2CK3A 5DE3A 5E3HA 2VHCA 3R7WA 2XNDA 3NH9A 3OAAD 2ZYTX 1ZM2A 5BN5A 5ELXA 4M4SA 1G7CA 4M8NE 3ASYA 2QP4A 4Z54A 2ZSDA 3CH4B 4BFWA 3A6PC 1E2LA 2C8VA 2ZS7A 2J0UB 1XPOA 2DFNA 3I4LA 3BH0A 1RRFA 3CX8A 5HZKA 4Q4HB 2FGKA 3AF2A 3VTKA 4TLCA 3GCGA 1W49A 2NO9A 3GLGB 2O0HA 1KMHA 3MWJA 3RYTC 1A7JA 1DARA 3CX7A 4E07A 1HQCA 1TEXA 2ERYA 3BJIC 1Z22A 1BYUA 3DVLA 3SBEA 2FFAA 3FMFA 2XB2A 3JVUA 5AWFC 3SHWA 3KJIA 1AGRA 2XJ9A 3KL4A 1MO4A 4AC9A 1ZNYA 2HXYA 2GDJA 4OBEA 3LX8A 1P61B 2OUKA 3C7KA 3CF0A 3CPEA 1YRAA 2ZRNA 3HR8A 1YZTA 3L82B 4AURA 4RFSA 2Q3MA 4C0KA 1AKEA 3PUVA 221PA 4IVRA 5EXTA 3WMFA 2QPOA 5L3VA 1KO8A 4TTPA 4W5WA 1IN4A 1PUIA 1Z6GA 1OE0A 4US0R 1AN0A 3AP3A 4B3DA 1CJMA 1W2GA 1KNQA 2G0NA 4V0ME 1XB2A 2FX3A 3SJCA 4XWOA 2ZVQX 1YZNA 3BFXA 2ZJZA 5B2ZA 2CLCX 1YKSA 2C9CA 1BH2A 3AKYA 3SEAA 2RGNC 3ZZ0A 2CL6X 4DBLC 3QPWA 4ILEA 3QKUA 1R6BX 3T35A 4B76A 5C18A 3TR5A 4JSYA 1G19A 2AKAB 5CIWA 3FE2A 1XXHE 2IUUA 3KQUA 4A1FA 1RRPA 4IKEA 4TMZA 3I5YA 1UADA 4KHZA 1PJRA 3I5XA 1IXSB 1TU3A 3EZ7A 1T3SA 2NO1A 5H8WA 2WJVA 4NMMA 4TYQA 2CK3D 2ZJOA 3T1OA 2B8WA 1FNMA 1IXZA 1N3BA 1Q1EA 4CVNA 5FPKA 2J0QA 3CB4A 3GFOA 3CRQA 4KITB 3VMFA 3RS7A 2EFGA 4B3XA 3G82C 1E0AA 2HEIA 1Z47A 4DXAA 2N46A 4Q9KA 3Q72A 4A4DA 4C3ZA 4YMSA 2FFHA 4NU0A 4DDVA 5CDFE 2R8RA 2GF0A 4QGGA 1JALA 4JLVA 3EPHA 1M74A 2ORWA 4A0GA 2GVDC 1GP2A 4BLRA 4IDHA 4AKEA 5H68A 2KE5A 4XTCS 1ZUHA 4HB2A 1AS3A 2VPPA 2DFKB 2ZREA 4JVMA 4Y0VA 1QHIA 2XITA 4LZZA 1MO5A 2QQ0A 4Q21A 3X1WA 2QMHA 2ZIAA 2DWOA 4BLQA 5K8TA 1KO5A 4IEIA 5HKKD 2VRWA 2V1XA 2WBLC 5FOVA 2ZE5A 1RFLA 2WWGA 4JLAA 1EFCA 4MRNA 2P3SA 2IS4A 1XFAA 4D2IA 1KO1A 2R65A 3FB4A 1VYVA 4BRWA 4FN5A 1QZXA 1ZP6A 4A2PA 1Z28A 3U3OA 3PXGA 3L0SA 5C4GB 5HPYB 1ZYUA 2QTFA 1CXZA 4OK6A 4PC6A 2J45A 1TUIA 1HA3A 3B2EA 1XCPA 2JJ8A 4IOJA 3IIMA 2IX3A 2XZLA 1OPXA 1SVSA 5CK5A 5FPSA 1W0KA 4D4JA 2CE7A 1T0JB 2WMOB 4XOIA 4A15A 2CNWD 3RVBA 1IAQA 4TSFD 5KUTA 3L0IB 4BFUA 5CDFA 1DAHA 4B74A 2ZRIA 3IPXA 3SYLA 1CTQA 1EFRA 2YOFA 3QVUA 2MSCB 2ZRGA 4JJZA 5DYGA 2G9NA 1U9IA 1L4UA 1K5GA 3RANA 4TYWA 4KLNA 4PX9A 1Q57A 1RIFA 2A5JA 4IFEA 1JR3A 1DO0A 2GRJA 1U8YA 4URVR 2MSDB 1LB1B 1QHGA 4I1OA 3A37A 4DT1A 3GLHA 4QM7A 1ZINA 1I4DD 2W2XA 3PUZA 4C0LA 2PL3A 3SR0A 2XZPA 1CP2A 1OHHD 4E5UA 2NIPA 5JJLA 3LV8A 4Q1BA 3MRSA 1LS6A 3EA0A 3NEYA 1G3UA 1OIVA 2PLRA 4D4KA 4JS0A 4MUBA 2R6FA 3MCAA 2R44A 4FWTA 3Q85A 1OFIA 3ZZUA 5EQTA 4M1OA 2PCLA 2H17A 3T12A 4D0NA 5DLQC 4LWZA 1I2MA 2IUTA 1XP8A 2WWXA 2FEMA 3X1XA 4YQFA 1LS1A 3HPQA 1T8TA 3IQWA 5SZIA 2IS2A 1KSGA 4XVUA 1IOZA 5DI3A 3QPVA 1WBDA 4JLDA 2HYDA 2WKRA 3LXRA 3NG1A 2NMVA 3SJZA 4HAWA 3QY0A 1W7AA 4NYIQ 2E9SA 1ZNWA 1N6IA 1HT1E 2IYQA 4MRPA 5DI3B 2ZETA 3AGQA 3NDPA 1SXJA 4EAQA 1H65A 3HR7A 5EE5B 1G1MA 3P20A 4BEBA 5BW8A 1O3YA 4DIEA 1XMJA 1EGAA 1FOEB 1XJ0A 4ZIRB 5KNCA 1ZU4A 1XPUA 4B47A 3E1SA 4S2EA 3VR4A 1SKQA 2D2FA 2VH5R 2ZI7A 4PC1A 4IHQA 4JYBA 4LV5B 3W8RA 3L43A 1UKYA 2AR7A 4L9WA 2OXCA 5DSZA 4ABYA 2A78A 1GRQA 4F93B 1ZW6A 4OK5A 2RMKA 4PZLA 3GEEA 4GOXA 5FL3A 3T61A 2VBCA 3IEUA 3L8ZA 3QKTA 3EZFA 3TVDA 4EUNA 3K0AB 3GLHB 4GFDA 5E7JA 1TQDA 3OF5A 4DT1B 4MRVA 4O3MA 1KMHB 3FMIA 5AUQA 2OM2A 2ZI4A 3UG7A 2BMEA 3NIBA 4LJ6A 1E9RA 1M7HA 1ZIOA 3B60A 4DLSA 1BMFD 2CVHA 4PHGA 3Q9LA 1E9BA 3P1JA 4LV6A 3QPUA 4DCSA 3U60B 3D6TB 2HDNB 1DAGA 2P6RA 1N6HA 3HJNA 2DB3A 2FJUA 3QNUA 3UG6A 2PLFA 3I8SA 5GJCA 4JVLA 4GZMA 2CJWA 4I4LA 4I1VA 4IOKA 5KSOA 5L8VA 3ZS9A 4LJYA 3B5JA 3ZZTA 4KU4A 2ONKA 3R7WB 1YJ5A 1D9XA 5P21A 3BS4A 3SI7A 2EFDB 2BJVA 2QE7A 3NEJA 1KDPA 1N6OA 4Q7JB 1T91A 1R10A 3CF6R 3SC3A 1Q0UA 1NI3A 2G6BA 4A8JB 3E5HA 4FINA 1JPJA 1OW3B 1XF9A 3CIOA 4CEIB 1XDBA 4C0HA 1FQJA 3MLEA 4FI3C 1OKKD 5TV2A 4LYHA 4HAVA 4WIAA 3QSYA 1HY3A 3DZ8A 5J4VA 1GUAA 5IRCD 5CJ2A 5B30A 3MSXA 5FBRB 3X1YA 1RPZA 4Z8YA 1XU4A 3A1WA 4US1R 1GNRA 3BRWD 4C2TA 5FOTA 2QMUA 4HDQB 5B58C 1XMSA 3SN6A 1ZC4A 2RAPA 5EE0A 2ZYUX 2VP0A 1HUQA 1G18A 2HCBA 1CEEA 3FHOA 4LHXA 4OHXA 4M1WA 5DHFA 2OCAA 4C0JA 4N3NA 1E2EA 4WBSA 2A5FA 4D0LB 4PTLA 1VCNA 3QENA 4PANA 2C9OA 4NBSA 3ZVRA 1SKYE 5EP1A 4KFUA 4EFNA 3KUDA 3WP1B 3K9HA 3AVPA 1W0JA 4M1KA 3HU3A 2NO7A 2WSSD 1F48A 2G88A 4LJ9A 3C16C 5EP2A 3NC0C 4YXWD 5FOUA 3AGPA 3C5HA 3A1TA 3LWNA 2G0TA 2YVUA 1ZM4A 1N25A 4B35A 8OHMA 2F9LA 3EPLA 2Q6TA 3UMRA 3AVQA 4GDFA 1CRQA 2Q9CA 5KO2A 3LLUA 1N0WA 4V02A 3X2SA 4EPVA 5JRZA 4IVQA 5FPTA 4B3FX 5JSZB 4DUGA 1J8MF 4LJ7A 2GKSA 2ZAOA 1F2UB 3FHCB 1LFDB 2QORA 1OKKA 3MGCA 4PR0A 4URXR 4W9MC 1AZTA 5DYIA 2JAQA 1LTQA 4TQUS 4X8HA 3LD9A 2QPAA 4UXHA 1E0KA 2FV8A 4PHFA 2QG6A 2N42A 1IY1A 1TF5A 3A1UA 1R5OA 2IYSA 2B7BA 2FPLA 4DJTA 2C78A 3T06B 5IHPA 3M6AA 3LRPA 3H1TA 5AJWA 1W1WA 4JL8A 2BMDA 3OIVA 4YMVA 4LJ4A 2F9MA 4Q4JB 1W0KD 1E9CA 1I4LD 2XJ4A 1AJEA 2QL6A 1E9EA 2QROA 2ECKA 4JT4A 4TYPA 4DDTA 1JEDA 1P3JA 4LHYA 2Q0HA 3ADDA 2XNSA 1KGDA 5UKDA 3BB4A 2NOAA 1JAIA 1QF9A 3QKSB 3MWYW 5CIQA 3UATA 2F55A 2RHMA 3B85A 2ZJYA 4C0QC 4DDUA 2BOVA 1G20E 4Q47A 3K0FA 1RZ3A 1ZUIA 4HUTA 2C96A 1L8QA 2HYIC 5F9FA 1S9DA 3FKSD 2QUZA 3BIFA 2BEKA 4CT4B 4M9ZA 3ZYCA 3ZD7A 1YZKA 4PQFA 3UK6A 1OH7A 1Y63A 3F8TA 1E4VA 2ZUBA 3RS3A 1H8HA 1T6NA 4U02A 3WHKA 3IHLA 1I4TD 3RHFA 4LPKA 5JMTA 1SHKA 5C46F 1CR1A 4RD6A 2O8DA 1P75A 1H8HD 3T1VA 2RGNA 3ZS8A 2W6ID 1G3RA 2D3WA 2R6CA 2SHKA 1G3QA 2G77B 4MYTA 2F3TA 1C9KA 5CM9C 3FMOB 521PA 4DSTA 3N5CA 4HZUA 5LB2A 2V6IA 4JVNA 2QBYB 2WKQA 3OAAA 3CF2A 3IQXA 1NRJB 3PV0A 1PV4A 4DCUA 2K5UA 1R2QA 3U44B 2JIZD 4PO9A 3QVVA 3R9WA 3GJ6A 2EQBA 4GRAA 1KKMA 1L7VC 2ZYWX 4CT5A 2BM0A 2UVQA 2ZUCA 3EX7C 4DLVA 2VSOA 1IBRA 2O5VA 1EK0A 3IBYA 2QN6A 3B82A 4NH0A 4RD0A 2WWHA 5DHAA 1G7RA 3K9GA 1Q22A 2IA5A 2RHDA 5J4KA 3THWA 3NVAA 4ZCMA 4I81A 2G1JA 3MJHA 1TTTA 1ZD9A 2AWOA 2OEPA 4GT1A 5JJKA 4B2LA 2X8AA 3ZVMA 3FKSA 1A1VA 3ZH9B 1XTKA 1IQPA 1Z6AA 3Q8XB 4QNRA 1O87A 4UXJA 4DLZA 3EC1A 4OI1A 1IN7A 2PEZA 4XD7A 421PA 4NHOA 3I1FA 3LXXA 4IXNA 1S0UA 3DMNA 1W5SA 3AUXA 1LF0A 1IHUA 2BMJA 2QSYA 1PZNA 2AHOA 1W4AA 3A58B 2JJ1A 2QENA 4QBFA 1Q20A 3I3SR 4MITA 4FD2A 3VU9A 5JJIA 5FTKA 1EFUA 3MG9A 3ADCA 4RZ3A 1T3HA 4GSYA 3VR5A 3EPJA 2W0SA 1US8A 2RGBA 3DOEA 3O8DA 2ZANA 4U5XA 4X8LA 1ZJ6A 3N70A 4F7WA 2CLSA 1OH6A 4KFTA 1GL9B 4LDJA 4R2HA 1DAIA 4BZPA 3CBQA 1EXMA 1UM8A 1YE8A 2GETA 2V9PA 1P9WA 3L0PA 4CDGA 4RCZA 1N5JA 1S4QA 3LDAA 4PAQA 2BCGY 4XJXA 1DTSA 4ZPXA 3KQLA 1BMFA 3GLHE 3OESA 3U4QA 1XMVA 1UAAA 3ICQB 1II8A 1DAMA 1OFHA 1RRGA 2FGJA 2IK8A 3K9NA 3QKRA 1V5WA 1X8JA 4FW9A 4Q18A 4HATA 5H1YA 4ASUD 1Z0JA 1NN3A 2O8CB 3FOZA 3IBGA 1N6RA 1Y3AA 2VHJA 3OE7D 1XTSA 5BN3A 4KV9A 3B1XA 4M2LA 4ERNA 4MGIR 5BYKA 4K8OA 4IEEA 3KQKA 2WWYA 2OE2A 3O8BA 2H1LA 2JLYA 4BLOA 2J59A 2HF9A 1OV4A 3C41J 2P6NA 3EASA 4BEJA 2V7QD 2DYKA 3RWOA 2J46A 1KZ7B 1SXJE 2V7QA 2OSBA 3FTQA 4LJ8A 3TW4A 1FX0B 1P73A 4PPGA 3W6PA 3OFND 2WVJA 3IO3A 1BOFA 5HKKA 3F3YA 1ZVQA 5J40A 4P4SB 1NG9A 1NG1A 2ZI9A 5FUXA 5D3MA 5F3WB 1KK1A 3WRXC 3DPUA 2IXGA 2Z0MA 4KAXA 3PEYA 3Q7PA 3X1DA 1N0VC 3EC2A 4X8OA 1GDDA 3REGA 1E2NA 4RJLA 1W36C 2WJGA 2AKYA 2WWIA 4JIMA 4PC2A 1N5LA 2W6JA 3PUYA 4EKDA 3KKPA 4IRUB 5KPJA 3A36A 3HYRA 5JWHA 1JQJC 1DOAA 1R0WA 2FG5A 1NVXQ 3AEZA 3FVQA 4JLNA 5A5GA 2GXAA 4KSBA 2JJ2A 1Z0KA 2GZHA 1CS4C 4ARZB 4B73A 4ZCIA 3FHTA 1QDEA 1G8GA 4O2LA 4BPBA 4L4UA 4LYFA 3DO6A 5EXXA 1FPMA 5E7MA 3C5CA 1S2MA 2GAAA 1XJQA 5EUMA 4C4PA 3K0CC 2QGNA 4BFZA 1KNXA 2A2ZA 2BM1A 4LHVA 2CE2X 2OO7A 3RNLA 1E0JA 2XAUA 1SQ5A 5G3ZA 3QBVA 3FWYA 5SZJA 3EWSA 2WIBA 4AWXA 2ZRKA 4EQ6A 3KJGA 1P2SA 4WA7A 2CL0X 2IEYA 3A4MA 2XTZA 4V0NA 2BMFA 4TZ6A 3ZVNA 2Z4RA 3PENA 4POAA 3W5IA 1IXRC 4ACBA 1GKIA 3QF4A 2REXB 4NCIA 3DL0A 4DSNA 4H1VA 1CR0A 1MABA 1W4BA 1FTNA 3OIUA 3LBIA 5DISB 1GZSA 5FBWB 5FUWA 5G41A 4JJKA 1ELOA 1FZQA 3BD9A 5AUPB 3G0HA 3R8CA 2ODEA 1B0UA 3GLIA 1YR7A 1DG1G 2BBWA 3IPYA 4QBHA 3U7HB 2A30A 1CULC 1OJLA 2VF8A 2WICA 3B78A 2R9VA 5CK4A 3ASZA 3H2YA 5LPNA 4CEJA 1YRBA 1U98A 1MV5A 1T5LA 4TQ9A 4HAZA 1D2NA 2BCJQ 4Q19A 5EP3A 5FOSA 3W3ZB 1UDXA 4FMDB 4JYCA 4V0KA 4DSUA 4P0TA 5L3SB 2PX0A 2J41A 4YLGA 2F43A 1R0ZA 3CRVA 3TR0A 1TU4A 4NYMQ 2O0KA 2RGXA 1NJFA 3ZGXA 2P65A 1GWNA 2JA1A 3P32A 3TQFA 4DLWA 3SNHA 1KSHA 4OQMA 4AG5A 3EIEA 1NMZA 5JI2E 2O52A 5FH9A 2QU8A 3GJ0A 2GCPA 4K81B 5LB4A 1MOZA 3ND9A 4A82A 1BO6A 1DAFA 1E2IA 2FEOA 2ORIA 5FOXA 4LCBA 1W36D 1P6XA 3MWLA 3BE4A 2IS1A 3OIWA 5JFGA 4C9BA 1NLFA 1E0SA 1TX4B 1ZIPA 2FH5B 4TLDA 4OHYA 4OJKA 4NCNA 1NVUQ 2I1VB 4NCHA 1KZGB 2CHQA 5CB6A 2O8FB 3WNDA 4JSTA 3IIKA 3WYAA 2IL1A 3NC1C 2IHYA 3TW8B 2F3RA 3H84A 4PC3A 1G9XA 4Q4LA 2VP2A 2OBNA 1U8ZA 4XSHA 4YMUA 1J70A 3GEIA 3LO5A 2C5LA 4P32A 3HP1A 5FPYA 4DLTA 5J4HA 1OXUA 1VIAA 2F1RA 1NIPA 1ODFA 3P4XA 4Q02A 1Z6XA 3KFXA 1QHHB 1N6KA 3WY9A 4HZIA 4OHWA 4ON9A 3K0SA 3TVTA 2JLUA 3NKVA 1MRSA 3AKCA 1WQ1R 1U2RA 5FTLA 2WM9B 3LBNA 3AVYA 2HJVA 5HCNA 4RKEA 3CO5A 3B9QA 1HT2E 3GFTA 4ZDWA 1N2CE 3KB1A 3ADKA 3NWJA 3V00A 5E7IA 5FL7A 2H92A 1UF9A 2CJWB 1P2VA 2IYZA 1IM2A 2ZR0A 4V0MA 3RAPR 5HCIA 2JJ1D 3TLXA 2BC9A 5KTYA 2VP9A 1ZNZA 1W48A 2O8BA 5EXPA 3UMFA 1YHNA 1IJFA 2QGZA 4HLUA 2FF7A 3D7MA 4KVAA 2A5YB 1F2TA 4ESVA 2D74A 2E87A 2ODBA 3A1SA 4QGFA 1KJZA 5FUYA 4B71A 5KSZA 3GJXC 2J0SA 5EJEA 2RCNA 3LH5A 4BUJA 2R6AA 1IN5A 3KXIA 1LV7A 2GVZC 1G7SA 5KNBA 1NMXA 1OFUX 3K0AA 1KMQA 2QAGB 2UZIR 4WXRA 5HE9A 5TDHA 3WP0A 3LNCA 4LBWA 2ODWA 5L3RA 1FMLA 4RVCA 2XZOA 4LSGA 3RS2A 4KLZA 3WRYC 4Q00A 3KB2A 4I1UA 1KK3A 2VHUA 2ZE6A 1JB1A 5L3QB 2ZRFA 1DVRA 1UBFA 2C03A 3CRW1 2FNAA 3MWKA 1KI6A 4ZIRA 4CRWB 1WRBA 3OZXA 4QBIA 3FFAA 1E2JA 1MH1A 5HTKA 1SXJB 1FQKA 3CWQA 3HU2A 3HWSA 5TXGA 4V03A 5FUVA 1KYIA 4QC2A 1R8SA 5LD2C 1KDOA 1YU9A 1YVDA 2DWPA 1GL7A 1VG8A 4UNSA 2HCJB 1UKEA 5DO9A 2XX3A 4YONB 2GAOA 4ITRC 2KI5A 3LAWA 4QHYA 3AUYA 1S9HA 1GTVA 2G1KA 2H18A 2WIAA 3IILA 4AG6A 1A4RA 5C4MA 5AJZA 4HLDA 3BGWA 2F1HA 2OG2A 4LBVA 1KI6B 1VG0B 1XEWX 1EWQA 3NHBA 2GJAA 1KI8A 4N1AA 2WAYA 5L3QA 3KQNA 4QBGB 1E98A 3WBJA 4OK3A 2IYWA 4BFTA 3TSOA 2ODNA 3GJ5A 1KY3A 5BXQC 3E2IA 3CWZA 2WTUA 1F3OA 2P0EA 2VO1A 3RS4A 4HDOB 3GJ8A 5JZVA 3B1VA 3QUSA 1N6LA 1KAOA 3ETLA 1EG7A 3SDZA 4DB4A 4LGMA 5TVKA 1K5DA 3VR6A 1AS0A 2QSZA 2ZQ5A 1GIAA 1E2KA 3DOFA 3GJ7A 1VHLA 4Q1DA 4JL5A 3KJHA 1M2OB 3NHAA 2GILA 4Q1FA 1NIJA 2UKDA 2WMNB 3L2OB 3BWDD 1NVWQ 1UJ2A 1FFHA 1KK2A 2JASA 2B7CA 2O8BB 2EW1A 1U9IC 3ECCA 4EPXA 2J7PA 1F5NA 1OXXK 3BC1A 2IF2A 3U7GA 1IN8A 1OSNA 2XOKA 1X8LA 4MDFA 4X8MA 4C0AC 3W34A 2CHGA 3UKDA 3ZLJA 3VX3A 1CIPA 1W4RA 3H86A 4URZR 4Y0AA 2QMOA 1SVOA 4TL7A 3EARA 2EFEB 4BGDA 4WZAE 3TSZA 5LBIA 2QA5A 3NBFA 2ASEA 5LD2B 1TF2A 1KHTA 1Z83A 5EUQB 1S3GA 1Z0DA 4MRRA 3LW8A 1BIFA 1A2KC 1JPNA 4MYHA 2VHTA 3W5JA 2IYLD 4FMBB 5KPDA 5GJBA 4G3XA 1WDTA 3C14C 2PX3A 1M6NA 1Q1QA 1P9RA 1IY0A 2AD5A 1KIMA 1XTQA 5KOYA 4DZZA 3QJYA 1AKYA 2FMXA 5EXSA 1JJVA 2P2LA 4D0GA 2GBLC 5TARA 2RGGA 4MDEA 1XXHB 2QAGC 1GAJA 1YR9A 2QM7A 2CLDX 5F2EA 4Q7LA 4GPTA 4G5SA 1G3MA 1N5IA 1HTWA 1J90A 1JBKA 2YWGA 4QJ3A 4TYNA 5TB5A 2WPDA 4ESHA 4LX0A 4QJ4A 4Z51A 1G8YA 5FL7D 2CBZA 1TAGA 2Z5FA 2ZRJA 3QIAA 4NE2A 1E6CA 4BE7B 5KDOA 3PEVA 4OHVA 3EZ9A 3R9IA 5JBQA 4Q01A 4EPRA 5J47A 5AJXA 4HB4A 5BYJA 2NQ2C 3SZRA 2QP9X 1X3SA 1G291 2OCBA 2HUPA 4PO1A 5SZHB 4HAUA 1E2HA 4FWIB 4QHTA 1KTVA 2DY1A 2EWVA 2RH5A 4NL4H 4R9UC 4BZQA 3KXKA 5FTJA 4U7DA 4XIGS 3BB3A 4QGHA 1Z29A 4BLPA 4TT3D 3VKGA 4A0RA 1E9DA 3T1TA 1DG3A 1XD2B 3LVQE 1JQLB 4H9GA 4RZ2A 1OXSC 4O0MA 3OIYA 1OYYA 3RC8A 1Z08A 1JXOA 1J2JA 3HDTA 2GCOB 4NYMR 1GITA 5TY0A 3B9PA 5HZHA 4IOLA 1OLOA 4JZKA 3U7EB 3CRMA 3GLGE 1YZGA 2AD1A 3KDSE 4PSKA 2JLZA 4AKIA 3B1YA 3GLIB 3RRZA 4Q7MB 3BFKA 4OYHA 2PT5A 5GADl 4MYUA 3S1AB 1EFRD 3EXAA 1CJKC 4Q1CA 5FR2A 1MABB 4JLMA 1AK2A 3W9YA 1OYWA 2FZLA 1KKLA 1FUKA 2QP3A 4B48A 4NYJR 2ZU0C 2UZ3A 1RYHA 2Z4SA 2AWNA 2VP6A 2H5EA 2QNRA 4RFSB 4TMKA 5FI0B 5JECA 1ZC3A 2ZI6A 2OHFA 4XH9B 2VLIA 4PQYA 2EFCB 4EQ6B 1FP7A 1ZM7A 4IJMA 4CIDA 2CVFA 2A7QA 2WSSA 4I99A 3P27A 5G53C 3RWMB 5E4FA 1SVLA 2W83A 3QE0A 1B23P 3D3QA 3EZ6A 4HUQA 3AQ4A 2ZS9A 4QRHA 4EJSA 4FCTA 4EDHA 2QMEA 1OFTA 4Q4HA 3THXA 5JWRA 4OL0A 4BASA 3IHWA 2REOA 4NPHA 5IT5A 1JECA 4MH0R 3LLMA 4MGZR 3P26A 3VHLB 5B64A 1NNEA 1SVKA 4IW3B 3VR3A 4DCVA 4HLQB 3NXSA 1Z8FA 3TH5A 1NSTA 1HE1C 2CCJA 2D06A 1FTSA 1M7BA 4LYAA 2GXQA 4AD8A 4TT3A 2CDNA 4URWR 4R71A 4B75A 4URYR 3V4RA 4D26A 1QVRA 1G3IA 5CM8B 2ZPTX 1Z0FA 3RRYA 2EU8A 1E79A 4JL6A 3H0KA 3T5DA 3I8XA 3KQHA 1GOTA 2PJZA 2YOGA 2IYUA 3BH6A 2ZJ2A 3C15C 4LC1A 2J7PD 2W58A 1VMAA 3GLFB 1WF3A 1DAKA 2GA8A 1G5RA 1ZCAA 4TL9A 3BOSA 4KI0A 4BFXA 1JJ7A 3B1WA 4F38A 1SULA 5J4YA 2C95A 1II0A 1KAGA 1AA9A 2GK7A 5C2JB 2FZ4A 3AB3A 3AV0B 2JGNA 1XEXA 1GFIA 1XPRA 4TLEA 5KHOC 2GZAA 1YR6A 2ZSFA 1ZAKA 4LK2A 4L5BA 1HYQA 1XTIA 2O8CA 3PUWA 2OXRA 5EZ6B 1WXQA 3W6NA 2V1UA 2V55B 2ZRAA 1XMIA 3I92A 4B34A 2NPIA 2VP4A 4DLXA 1E2DA 1T8UA 3U4QB 2HT1A 4TZ0A 2FFQA 4UNRA 4QOSA 1DAEA 1AGPA 3ZQ6A 2O8EB 1NF3A 4UJ5A 3K8YA 2FPKA 4HEJA 1XEWY 3CW2A 1YQTA 4KYUA 5JCZA 2A5DA 3ZQJA 1QRAA 4OJQA 3OE7A 1CKEA 3B6EA 4V0OA 1WB9A 4KO8A 3ZJYA 5A4JA 3BBPA 5BQ5A 2KBEA 2OFOA 1N6PA 4HYYA 3TSWA 2QTVB 2AL7A 1HH4A 2FSHA 1CBUA 1JR3E 1LW7A 3EG5A 4JT2A 2BJWA 4TL6A 4D25A 1W47A 3EZ2A 1OH8A 1TQ4A 3NTUA 1ZRHA 3AF3A 2B6HA 4Q4AB 3REFA 3W90A 1M8PA 2HLDA 5KNDA 1VYTA 2BKUA 1UFQA 2RGCA 4KODA 1ZM9A 4M21A 5CJPA 5AUNB 5JRJA 3ICEA 2O8EA 4YDSA 2WOJA 1TL7C 3BB1A 3CPHA 5JEEA 1W2HA 4B3BA 1E1QA 1NBMD 1KOFA 2H8KA 2X1VA 3KKQA 4QJ5A 1T5IA 4YMWA 1QHXA 2WWWA 2Z6VA 5JWOA 1VKJA 2ONJA 5JI3E 1G6HA 3M1IA 2VL7A 3T15A 1MR3F 4B32A 2IC5A 5KDDA 2B8TA 1OIWA 4FCWA 4LC0A 2J9RA 1LVGA 3PFIA 1ZBDA 4H1UA 2D7DA 1Z6TA 4P33A 2PZEA 2QAJA 3DDCA 2W6JD 5FR1A 1XEXB 3PEWA 1TF7A 3QI2A 2GEUA 4RZXA 3A8TA 3CLVA 4TSFA 4B2IA 2BKEA 3GMTA 4R98A 4TWZA 2KBFA 1KO7A 4DSOA 4QM6A 5AJVB 2G83A 1JNYA 5JEDA 5JLJA 2WZQA 2VSXA 1S96A 5F9HA 1M7GA 3V9PA 4BLSA 4E09A 4DHEA 2FSGA 2YWEA 1U0HC 2ZR7A 2C77A 2PMDA 2QBYA 1EX7A 1XTRA 1G8FA 4GP6A 4ZI3A 5DN6D 2ZRDA 4LI0A 4PAOA 3TNFA 2HF8A 2ZE8A 3GD7A 1J7KA 2OILA 4RKFA 4UKDA 1X86B 1KJYA 2QT0A 2DBYA 4XWKA 5GVSA 4XTRA 1U90A 4TL8A 4GNKA 2AXPA 1GSIA 2BBSA 5K8UA 1QG4A 1QBKC 1CJUC 1DE0A 4WAUA 4AY2A 3KTAA 1G17A 2OV2A 5HR5A 1WBBA 3DMDA 1AZSC 3B8HA 5FTNA 4EJSC 1P2UA 4PPFA 3THXB 2WSMA 1ETUA 3O8RA 4M22A 3H4MA 4C0BA 1VIYA 3CR8A 3TAUA 1X8KA 1X1SA 3K0FB 4OKSA 4EJSB 1VPLA 2YZ2A 1TQ2A 3M4YA 3NH6A 1LF5A 4LRWA 3K09A 4AIIA 4WW0A 4OHZA 1Q12A 1Z6YA 2OT3B 3PQCA 3QKSA 4QNMA 5AJYA 1K6MA 4C30A 3QXHA 2ZR9A 1XCMA 4C0SA 5E95A 2AX4A 1E32A 1XD8A 1QG2A 3WYFA 4OQNA 3HU1A 4XD7D 3W3AA 3LX5A 1ESNA 1X1RA 4Q9HA 4JLJA 2HV8A 1GKUB 4HB0A 4A0FA 4LPSA 1JI0A 1UDWA 3X1ZA 3EW9A 4JLPA 3SOPA 3OFNA 4HLUC 2EYUA 4D4MA 1JR6A 2REBA 3S1AA 2VSFA 4IOMA 2IBMA 4UXIA 4G01B 1NY5A 1D2EA 3EPKA 4F4CA 4HAYA 4PFSA 3CNOA 2IXEA 4N0DA 1SXJC 1S1MA 2FE4A 4Q5IA 4EFLA 4MKIA 4OQFA 5SZKB 2W6IA 3BH7A 1COWA 4Q4AA 1OH5A 3IEVA 4DLUA 5JSZA 5AK0A 3EA5A 3O47A 2H16A 4U00A 3B7GA 2Y8EA 1D9ZA 4HDCA 4KCGA 4NCJA 2WV9A 3KKOA 4XVRA 4KBGA 1XD2A 4KVGA 5IK2D 2Q9AA 1BKDR 1GG2A 2H7VA 4KBFA 4PAMA 3UIEA 1E2MA 5IK2A 2CMKA 2NZ8A 1VG9B 5HE8A 4JBWA 3GLIE 1SGWA 3F5FA 3LY5A 4OQLA 2MMCA 4A92A 4GL2A 1FUUA 1XZPA 2I4IA 2YNMA 1XNJA 1U0LA 4BLTA 1IN6A 1G6OA 4G0NA 1E9AA 2IF0A 2JDID 3EIQA 1C1YA 2AK2A 2XEXA 4MKFA 2OAP1 4P3YA 2ZI5A 4B6FA 3Q5EA 2JLRA 1HQYE 3IGFA 3ZVLA 2YC2C 1JR3D 1Q44A 4JLOA 5CB8A 3GEHA 2RKOA 3DM5A 2N1BA 4D6PA 4WZBE 3RABA 1PVOA 1XJCA 1YZQA 5GVRA 1XXHA 1ZNXA 1MO6A 1KY2A 1Q1BA 4NTZA 2Q9BA 4C7OA 2Q21A 3K70C 2FPMA 3VNUA 1GVNB 2FA9A 3AKDA 3I72A 4JLKA 5DH9A 4AK9A 3K09C 3ND8A 721PA 1KK0A 4UQOA 2ATVA 4KYIB 2JLWA 2XXAB 1RW4A 1QVAA 2QEQA 2GEDA 2YHSA 3QF7A 4M0LA 4A2WA 4LHWA 1XZQA 1S1CA 4IVPA 1P5ZB 3RS5A 4A9AA 2A3RA 2ZS8A 1F6BA 1MRNA 4CEIA 1G64A 5AR1A 2NTYC 4A8JA 3QBTA 4HLCA 4BFSA 5DNYB 4DDWA 1JAHA 4GOJA 1Q1ZA 4G1UC 4WXPA 1W0JD 1VDZA 2NGRA 2XOKD 4LBYA 4W7SA 2EVWX 2IHBA 3J81k 3MAAC 4JKIA 2YWFA 4O2RA 1G7TA 4CEHB 3RSLA 4LV8B 4TTRA 2DHRA 2P67A 4ZI2A 4LY6A 5G3YA 5FTMA 4ZDKA 1EWRA 1VECA 3UXMA 3CONA 3W6OA 5DN6A 1SXJD 1NJGA 3PVSA 2X2EA 2JLQA 2ZSBA 4M9SA 3SS8A 4DVGA 3UPUA 1N5KA 1FMJA 1PUJA 2XB4A 2BWJA 3BERA 2ZRLA 1E9FA 1U8AA 3IKJA 5FFMA 4B3GA 3CNLA 1UBGA 621PA 4LBZA 3HPRA 4HUQB 3CX6A 4D4LA 4II7A 1II9A 3K0EA 4OI2A 2J3EA 4KFSA 1A5TA 2HLDD 4JLBA 2LCFA 3AVUA 1Z3IX 4GP7A 3VAAA 2GJ9A 3FDIA 2QI9C 3TUJC 3JVVA 4ZKDA 4IDPA 2ZTSA 2JDIA 1DPFA 2IT1A 1S8FA 2GBLA 4M1MA 1E1RA 4B3CA 1E96A 2IYXA 5EP4A 4NDZA 5KSPA 4PPQA 1KJWA 4DB2A 4TTQA 1WE2A 3KXLA 4F92B 1RE0A 2ZRHA 3TK1A 1CU1A 1AIPA 4AYXA 4CW7A 3U3RA 4MGYR 4A6PA 1G4AE 4B2PA 4FMCF 1ANKA 1UBCA 2YINC 2PT7A 4CZ2A 2GJ8A 2QQEA 4XWAA 1NMYA 2IW3A 3AVTA 4DWJA 2OAQ1 1TADA 3AF1A 4D82A 4PPNA 3K53A 1PLLA 4QG7A 2VEDA 5KYKA 3AVWA 4AI6A 4UNNA 3K70D 2ZI3A 4GBMA 4C2UA 4G5QA 3FPAA 4KXFB 1W36B 2FSFA 4F4IA 2EWWA 1JEEA 4ZDJA 2GCOA 1R0YA 1SHZA 2VA8A 2IWHA 2ZM5A 1HE8B 2NG1A 3SQWA 3AM1A 1UKVY 2TMKA 2R2AA 1Z0IA 2IYTA 2J0VA 4AKHA 2GF9A 1OF1A 2BIFA 3I73A 4RFVA 3MMPA 3GFPA 1GRNA 1U81A 3AP2A 4JMPA 2A5GA 1A82A 4CF7A 3U7FB 4TQAA 4GMDA 1H8ED 2YWHA 3TIFA 4IDQA 2JLXA 4JKYA 2RGEA 2GJKA 1DO2A 2J7KA 2GJSA 2PEYA 3U3JA 4B6EA 2XGJA 2KWIA 4IXMA 2W00A 2YJTD 2WJJA 2ZJ8A 3AF0A 5FOWA 3QEOA 2XTNA 3IUYA 3ADBA 1KI2A 2QT1A 2QAGA 3E70C 5DIFA 3K0CA 5KDLA 3BFVA 1OXVA 2LWIA 2EYQA 2VHQA 1QHNA 3PG5A 2CEAA 3LQQA 4YDHB 1E9SA 1RKBA 2I3BA 2IYRA 3DM9B 3JZMA 5G40A 1T9HA 1ONBA 1A2BA 1R4AA 1JXMA 1PLJA 1F2TB 2PZGA 2CL7X 2AN9A 3TE6A 2Q3HA 3NBZC 4XVQA 2PH1A 2PJRA 1L4YA 4MKGA 2EFHB 1IY2A 3WMEA 1OHHA 4LJ5A 3CPJB 4S35A 3I62A 4PZZA 4GZLA 4EIWA 3CZPA
chains in the Genus database with same CATH superfamily
3S40A 1Y1RA 2O14A 4JHXA 2GVNA 4DCCA 3BGVA 4CU5A 1R50A 4OHBA 2ZB7A 2FZVA 2BV3A 5CLGA 1EX9A 3MTAA 4BQSA 1JFVA 2ZU6A 1TJYA 4MW5A 1LU9A 5I8ZA 3SZGA 2VUTA 1OU0A 4ENVA 1GSHA 3F4BA 1AKRA 1ZL0A 3W5BA 1YB7A 4JBXA 4BKQA 5LMNB 4DLRA 4ZT5A 3DVSX 4EFMA 3ZLTA 4AS2A 4G2TA 4GHWA 1G6KA 3X2EA 5AVUA 1NLZA 1X15A 2WWRA 1IXKA 3HYSA 1CUEA 2JGDB 2VTKA 4NEQA 2CXRA 1QF7A 1EVIA 4OQDA 5EZSA 3FCOA 2KJQA 2QVGA 4RGYA 4YLEA 4YAUA 4YHBA 2H4XA 3IEPA 5MGBA 1E2GA 1G8MA 2JLSA 3C43A 1N0HA 3T34A 3TW8A 3WE7A 5AVQA 1S3FA 4N5DA 3H5AA 3ENKA 1M0EA 1T43A 2MMGA 3C8UA 1W96A 1OB2A 3ZWVA 2O8FA 4F3YA 4FUQA 4MB2A 2Q07A 2PIDA 2FHSA 4RD2A 3S8YA 3AO0B 3N2IA 1ADFA 1UBUS 2ZJFA 4IJKA 4KN5A 4BZXA 1PZFA 2AQIA 3TD9A 5F7JA 3PCRB 1RYFA 2XV1A 3ZDZB 4FMCB 4ZCLA 4CM3A 4G0PA 3EZLA 3TGPA 2OD9A 2PBRA 2Q3FA 1OT5A 1M72A 4FWBA 1H94A 1CY2A 3A6JA 4PHTA 4TLBA 1T1SA 1FDRA 1E69A 2HA0A 3QU2A 4Y9DA 2C7OA 4DDKA 2DBQA 2EF0A 4IIVA 4Z3OA 2JGKA 4HJXA 4LIPD 4EYOA 3WNBA 1C4XA 5LU9A 3JQBA 3BHJA 1MJFA 2RGDA 4Z0PA 3I9FA 2DY0A 1U8XX 1KYVA 2UZ1A 4ALKA 1E4EB 2AFHB 3GH3A 4O25A 5CLLA 3TKLA 2WG0A 4Z1OA 1E3TA 1J0BA 2JC3A 5DF1A 3R20A 1JDZA 5DK4A 3HZZA 5M04A 3H9EO 1U4OA 2X1HA 4H7FA 4M83A 3AKEA 1XDWA 1AS2A 1BDMA 2FI1A 1TCVA 3JY6A 3QXSA 1J2RA 3QPCA 2DMRA 3CZQA 2E5LB 5DXAA 4I50A 3HB9A 2HIHA 1K7YA 5ERXA 5JCPA 4CEJB 2F17A 1JA9A 1G8HA 3ELUA 3T5GA 4ZI7A 2ZJAA 3PEUA 2J9GA 4PLHA 4Q7KA 1NW7A 5DBFA 1SA0A 3CISA 3AVOA 3F98A 3R3WA 2V3WA 4NAUA 4QFMA 4IZOA 4YS6A 1SIBE 1DC4A 4P4TA 3D8BA 3FFTA 3D31A 3FWNA 4MR7A 3UHAA 4IDFA 5K3SA 3DOHA 1YQDA 5ITSA 4P4UA 1TVMA 4OFXA 1EFTA 1JHQA 1P9OA 1V8DA 3BGDA 3IOMA 4WJKB 4WKNA 1Z7YA 5EKUA 1SIOA 2GN9A 3K2QA 1N2HA 5BR4A 3QF4B 2PNJA 4DIMA 3BAZA 3KG2A 1FDSA 4K46A 1QH9A 4W5RA 1ZMRA 1EFPB 3EBLA 3BTVA 1N92A 4M7RA 3QU9A 5EE1A 1CF2O 1BN7A 1E7WA 3AUFA 3KQQA 3IT0A 1FFBA 1E1DA 5BXYA 2XYQA 2Q1WA 5CEJA 4OIMA 3MWFA 4LN1A 3QXXA 3NANA 3GP8A 3AVXA 1ADCA 3PXCX 4PSDA 4DNOA 1P60A 2A6PA 4P22A 4E70A 2ZUDA 1SCDA 2OESA 1RYNA 3HFRA 1L3BA 2NNWB 3N2GB 4UUNA 4ATNA 4ZCRA 2GR9A 3KYDB 4TRRA 3VPXA 4ENWA 2OOKA 5CH5A 4ZT2A 4D99A 5KNDH 2A0WA 3WYGA 4M99A 2BEJA 4N3GA 2HCFA 3R3YA 4QBKA 1MO3A 1U0JA 1ZGCA 3E22B 4H77A 5ALWA 5A7HA 1V6AA 2RHBA 3B13B 4NWIA 3CZCA 1X3LA 3OPMA 3A2NA 4LY9A 4B6JA 4Y2TA 1NBME 3X1JA 2OZEA 1J0EA 1FC0A 5KVAA 3OZCA 2D2EA 4DCPA 1XMPA 2OHOA 2Z6AA 3RBZA 3VKHA 1NJ1A 121PA 3IAM6 2GTPA 3WJAA 1UBSB 3VX4A 4OB6A 4RGBA 1O95A 1NE7A 2H1RA 5BN4A 2FRDC 2H4JA 1U94A 3Q11A 4LE1A 4B44A 4CM4A 4A0SA 4D81A 4FQ5A 4RM3A 3T4XA 3N0TA 3VKWA 3K2EA 1RPZA 1ST2A 1R0CA 4RJKA 3EF0A 1I2CA 5K8IA 4D3SA 3ETJA 3WBFA 2FPXA 1CX9B 3T1QA 5BSTA 2PUGA 4RMNA 3D6AA 1ZKMA 4H3VA 1FDTA 4L8LA 4P81A 4LOHA 2BP7A 4RHFA 1E3IA 1G8JA 1NW8A 4L15A 3GDOA 2VWPA 5E38A 3RAJA 5JQWA 2XXAA 1MT0A 1JKXA 1V48A 2J87A 4QUBA 2IWRA 4ZALA 4K9NA 1KYWA 1A8UA 1K68A 2ZRBA 4BMSA 2Y27A 1TGVA 1VPEA 2Q5JA 1BJTA 1QIDA 1T24A 2ZT7A 1XAJA 2HC9A 3CUEF 4J2OA 4CCAA 1W85B 3QFHA 4RCYA 5HS6A 1JPUA 3F5MA 2VIIA 1B0ZA 2FSSA 3SLGA 1MMFB 3LCRA 3RC8A 2IHUA 3RU7A 3RHZA 4ZOLA 3RDPA 1KS2A 1XTBA 2F6RA 4F85A 5ANRB 4F5ZA 3CTPA 1WPQA 4F1JA 1WY5A 2FDXA 5IG2A 1NP6A 1PFQA 3P9ZA 1NN1A 1A76A 1SC9A 1N2IA 1N0UA 3OUTA 3PCXA 4LUCA 1Q14A 4JEUA 4P31A 5I7OA 1QTNA 3SLKA 1ONNA 2ZSEA 3PU6A 1E1QD 2ZZNA 3GD5A 1QQ6A 3TI7A 1F60A 3NBYC 4BHTA 3BCRA 4KB5A 3EWAA 5CFPA 2XNCA 1KQPA 1PJ4A 4GI7A 2LE0A 1E63A 1HRDA 1KVQA 2GCIA 1FP6A 2H2WA 1E99A 3IT3A 2OD2A 5BV7A 1Y6GA 1RAAA 1Y6FA 3FWZA 3O84A 2NUAA 3Q8WA 4RPKA 2PY6A 1PWZA 4YJHB 4B4UA 4DLVA 3PRHA 4BO6A 3DBRB 1XCLA 4V3BA 1USVA 1R5BA 2RHOA 2CDRA 4OX9Y 2M6LA 3H9QA 1J07A 1OAOA 3NGMA 4ARUA 1GN9A 2EV9A 3OHMA 5IJAA 3RIHA 3IPRA 2B1GA 3DDZX 1VSTA 3CN7A 3KYBA 3N8IA 2ZJ5A 3AUAA 3VNBA 1GCGA 4MWBA 1D5CA 3ZHYA 3A4LA 1I3LA 5DOZA 1RC8A 1YZLA 1GU1A 1YR8A 4JMLA 4MKHA 2WTBA 5HG0A 1YCDA 3VU9B 3FXAA 4FS3A 2Q5LA 5FWDA 2IYYA 5JS8A 2IEZA 1EIZA 1M9NA 2Z1NA 4K1XA 3UWKA 2C2OA 5J9FA 5KQSA 2V8OA 1EGMB 1V16A 1L7RA 2GQ0A 4LDPA 4MMZB 2A57A 5CDUA 2YYZA 4UHDA 4RJJA 3KU4A 4M1TA 2D5AA 1LVHA 1NN5A 1ODKA 3UW1A 2PZAA 2VHEA 3NYRA 2CXSA 3C8HA 2MR5A 4N65A 1FFEA 1UPTA 2M1XA 4MIKA 4AY6A 3S6JA 1AKMA 1I7NA 3ZDXB 3ZCSA 3O2QB 3AIOA 1T2FA 3RRMA 2CUNA 3GNLA 1G6Q1 1RQLA 4O4HB 1P7VA 3IAEA 3H7AA 3BDVA 1R64A 4K88A 1UK9A 1RM4A 3UC5A 1E18A 5K0CA 2OPBA 1YBFA 2FPIB 3T1NA 1QZZA 1VI2A 4RDXA 4H7IA 1YTUA 5B2EA 1J20A 2ZBPA 3F4KA 1JHDA 1ZW1A 1T13A 2CFRA 1RD4A 3NI2A 5BORA 3LA6A 4O4LF 3JD1A 4GWGA 5HRCA 1YQEA 2Z95A 1K6IA 2QTWB 2ZCJA 4CQMB 2JAUA 3SJBA 2ZXUA 2BDTA 4XLTA 2I7XA 2J3IA 5BUQA 3DULA 1RQPA 1KJIA 3JAWA 4XSGA 4IIJA 1CF4A 1O6CA 2D00A 1XVVA 2QI9F 1E2FA 1NVMB 2G72A 5HMLA 1HMPA 3R24A 2DFTA 1OLXA 4N9QA 1V1RA 4U63A 1E4YA 4UPVA 2XUPA 3EB9A 5CB4B 1Q21A 1T4CB 1U0FA 1E89A 1KAMA 2AFHE 2VUSA 2Z1MA 3JPWA 3OPVA 4DRZA 3OZRA 1KL7A 2DLCX 1ST3A 4QGSA 3USES 3G88A 4KNWA 2W2LD 3MW8A 2QOEA 3ZCUA 1KJNA 4DR3B 4BNHA 3OEHD 2V65A 1DWPA 1LNZA 2X7XA 4MLCA 2JJ2D 1R6DA 3CHYA 4ND5A 1LDBA 1L5VA 3K1TA 4EQZA 2XBLA 1N32B 2QUAA 4UFNA 4RQTA 7REQB 1H42A 2GK6A 4GPIB 4AKGA 2GEFA 1HGXA 3LDUA 2NXNA 1EFHA 1ZD8A 1BFDA 1JDUA 1B42A 4WSOA 5JAZA 1N2ZA 4WZ6A 4ZICA 3LUGA 1K6XA 2CCKA 5BNIA 1ZI8A 1J8VA 3KVVA 4JUDX 4F3CA 1KXZA 2C2HA 4IUCS 7GPBA 1DELA 3GW8A 5AW5A 2C5BA 3LUPA 3ZDQA 3WNCA 3N53A 3Q3JB 3WBKA 2W0MA 3HLKA 1QHSA 4JVSB 4MKZA 4OXYA 4R2JA 1YVPA 4FKBA 4JEMA 4EY7A 3SJAA 4M8SA 1PD1A 5KSYA 2B69A 2WA2A 1Y7HA 3A04A 1V1MA 3DEAA 3RBAA 3RK0A 1NQTA 5BN3B 1W4CA 2AMJA 1GA1A 5DX1A 3FAKA 4ASUA 4C2BA 1S3SA 1JKMA 2FX5A 2FDCA 2NV6A 3COWA 1R16A 4HO1X 3QU5A 4FEEA 3TIIA 2MWMA 3IT2A 3QKRB 2GNOA 3H1AA 2ANCA 2C94A 2L18A 4F6RB 1SUBA 1DCTA 4JYAB 4FXPA 1SURA 1SOVA 2WU4A 1DC8A 3EN0A 1ZSYA 1WUJS 2WHXA 1QIEA 4HAOA 3U4HA 3VR0A 4WK6A 3KKNA 2W42A 4NSNA 2E6KA 3WB0A 5K01A 4MMXB 2Q4TA 2IBTA 3AUTA 5IAGA 1MBZA 1V16B 3GJ3A 5AVRA 1ULTA 3H2GA 4IIUA 1P72A 4DE5A 1Z2OX 4XGIA 2FSVA 5FNVA 4QPPA 1SBNE 1BE1A 1E3JA 4UNQA 3TQCA 4AB1A 4LF7B 2PMKA 3AF4A 3BIXA 3HL0A 1RM3A 4B40A 1Q7EA 5HIJA 4RSGA 3ROEA 4N48A 3TL6A 1B6GA 4NI5A 4TMVA 5GJWC 1J5PA 1JTVA 1MIOB 1O58A 2RGYA 5L3ZA 3RU2A 3WGUA 1KI4A 5EZQA 4YCBA 5F98A 1A5BB 2QTVA 4L4RA 4A0QA 1BEUB 1PG5A 3F2VA 2YHIB 2W22A 2X14A 3I01M 4TKVB 4DM4A 4EPTA 4RVSA 2PQ2A 4E5NA 1FZTA 2E4VA 3L07A 5HWSA 3SIWA 1RRCA 3ILSA 3UWOA 1UBNA 3AW8A 3HTXA 3IIJA 2WFMA 4GR5A 3FUXA 3IL2A 4AJKA 3OEHA 4RV5A 4JODA 3MZ0A 4L08A 4FQ8A 3HMKA 3TAHA 3AJEA 3L8EA 2NWQA 5KAMA 4CODB 1DZIA 1GGVA 2V6MA 2GPSA 2P5SA 3B53X 4ENUA 1XCGB 4WASA 4BL5A 3FGZA 4Q16A 3B1FA 5FI1B 1T4GA 4E6EA 3DZIA 1IEWA 4DCTA 4IG9A 2A14A 4LY3A 1RWVA 4F9GA 3OCVA 3DKVA 4AMGA 3D0OA 3E7WA 2ZAYA 1ZIYA 2AFRA 3HB4X 4RLSA 2XT9A 3TRFA 3ND7A 3KJEA 1PSDA 4UEWA 3KOXA 3GLVA 4UJ3A 4BOYA 4L6AA 2NUTB 3M1AA 3MD0A 2INGX 3JQ8B 3VYUB 5I4KA 3ROKA 2C0QA 3V80A 1OA0A 2ST1A 1OXMA 2CBXA 1XRLA 2CYCA 4RSMA 1W36C 1FSFA 2DBVO 4YJKA 3EGOA 1QGYA 3ZIAA 3JQFC 5C37A 5L4SA 4LNUB 3OBBA 1LX6A 2UVPB 4QLAA 5GGYA 1L5SA 3DEFA 3PD7A 4FX5A 3GLFA 1GNTA 3U44A 4PXAA 2IS6A 1NX9A 5EJ4A 1T4BA 1BZYA 4YGYA 2NSYA 5E8RA 1NQWA 2Q6IA 3GAFA 3QE2A 1XCBA 1NVFA 4HQNA 3U6BA 3P2OA 1G4UR 3NTLA 4LA4A 3UANA 5HF8A 4I1SA 3TFOA 5JDIC 1FF9A 2VR1A 3TUZC 3O4HA 3IPAA 2HLPA 1K86A 1A8QA 1KDTA 1Y6RA 3WXMA 1E1RD 1C30A 1NVGA 2XEDA 5DE3A 4A5OA 4CM4B 1KR5A 3MCWA 3NH9A 3ZWMA 2X4GA 1K7SN 2G09A 3FGPA 2UZAA 1I3OA 2W6CX 1G7CA 2Q2OA 1GFWA 2YVQA 4WZZA 5H5JA 5ELXA 2JKVA 2QP4A 1ND5A 3AOEA 3CH4B 3DT8A 1H1LB 4UVDA 1XOIA 3RSQA 4PN3A 1KQGA 3A6PC 2CMHA 2C7PA 2ZS7A 2J0UB 1PQPA 5HBGA 4FFRA 1B8OA 2WQ7A 1S2LA 1TYDE 2C1EA 5EI5A 2WIDA 3SIRA 5GP1A 4X1IA 5HZKA 1YRYE 1CZOA 1L4GA 2FGKA 3AF2A 4XIIA 3RG2A 4IQ4A 4TLCA 5K6RA 3GCGA 1TO1E 2FZKA 1KEZA 1W30A 3RYHB 4NEHB 3RYTC 1KMHA 1L7XA 1A7JA 2WWVD 2B1IA 3C45A 5AK3A 3V1MA 3A3OA 3LNTA 5THKA 2OV3A 3HA7A 1Z22A 4KREA 3MBOA 1J39A 1E3DA 3TPZA 3FMFA 1MO2A 3JVUA 2Q6OA 3I2YX 4ZTZB 3VH3A 3KJIA 1AGRA 4IYJA 3TXAA 1MO4A 2QLJA 1ZNYA 2HXYA 1RCUA 4AF7A 4CL2A 2VDNB 3KKKA 3U16A 2OUKA 2VDUE 3OLQA 1KETA 3L82B 3NS7A 1R0RE 4QXOA 1NW9B 4O4LA 1AKEA 3PUVA 221PA 4IDCA 4IVRA 2QPOA 2PDAA 2YRWA 4G4SP 2VJOA 3EDMA 2X8WA 3NHYA 4GG1A 4TTPA 1L8OA 2QTCA 4W5WA 2XMRA 2DBRA 1T9CA 1V5EA 3E3LA 1CJMA 1W2GA 2JANA 1DXQA 3KWJA 3BCHA 1R0KA 4AMVA 4RWEA 2Q5OA 3F1LA 1T1RA 3R6GA 3SJCA 3UFXA 4AO6A 1YZYA 3BFXA 5B2ZA 2X1LA 3ZWDA 5B3JC 4BDTA 1BH2A 1ORWA 2JAPA 1OI2A 5DT2A 2O8EB 1LLUA 4DBLC 1A95A 2Z3VA 3OIFA 4X90A 2F8MA 1SELA 1WJGA 2IHVA 2W4QA 4FJ0A 5FB3A 4YNBA 5A5VA 1K88A 3TZ6A 2JAHA 2H9YA 2IDZA 4ZI7B 4EJMA 1SPXA 1U3TA 4MCIA 2GYWA 4KHZA 1PJRA 2GSWA 2VBGA 1IXSB 2O7VA 3VHRA 4J1TC 5ILOA 4DA9A 3AIKA 1G20B 4QOEA 1NI4A 2WZBA 3TCKA 4J0JA 3UC9A 1XA4A 2B8WA 1IXZA 1N3BA 1FJXA 2MOKA 3TD2A 4QFBA 4KITB 2G36A 4JUCA 3IDOA 4PGFA 4CUJA 2WSYB 4B3XA 3G82C 1IZ9A 3HUFA 3T9DA 1E0AA 3TLZA 2QPLA 3ANYB 1Z47A 2HA6A 3Q72A 2WI8A 3DHYA 2KHZA 5TSDA 2B20A 2FFHA 4MW1A 4WPGA 5T4FA 5KWEA 3EFEA 3HRHA 5FPQA 3V2UA 1I1QB 2I4OA 4A0GA 2GVDC 1YS4A 2WB4A 3IP7A 1GP2A 5KYUA 1E1KA 4DV4B 4GRIA 3S5JA 1WWKA 1Y7IA 1ZUHA 4G85A 4JU9A 4KQJA 1RLMA 3V34A 5M29A 3N75A 2AR0A 3HCOA 4QUGA 1YIAA 4LZZA 2XUOA 1IFXA 4XX0B 3X1WA 4JYPA 3EOAI 2DWOA 3X43A 4BLQA 5K8TA 6CHYA 5HKKD 3I05A 4BX2A 1QYRA 1RFLA 4BU1A 2WWGA 4C3VA 5E2AA 2P3SA 1UMDA 1LSJA 1UPCA 5DT9A 1VYVA 2QRKA 4FN5A 4BV3A 1ZP6A 2DP4E 3RUAA 2OC9A 4UAVA 1AF7A 4UFPA 4CMIB 3EVFA 1WD7A 1B41A 3UK2A 4DQUA 3TYXA 1I3MA 3UPTA 2CJYA 3B2EA 3EGDA 4QU5A 5IEJA 3QTTA 4PLFA 5CM2Z 5CK5A 4JK3A 3DV9A 1C9DB 1XVUA 3A31A 3JVDA 3Q3IA 2WMOB 3EF1A 3C7CB 3U9TA 4BVHA 4N76A 5KUTA 2Y1KA 4FZRA 3ZHXA 2HMVA 4AUKA 2AG6A 1EVKA 2BI7A 3E9YA 1IHDA 2Y0PA 3H83A 3PJFA 1XJ5A 1D4FA 4BGVA 1O2DA 4MI6A 4JJZA 1MC5A 2Z3ZA 5DYGA 2G9NA 3SXUA 3KOUA 1H6AA 1L4UA 1K5GA 1H4TA 3NTQA 1L5YA 1NXPA 2V7XA 1PT8A 1RIFA 1VJCA 3KT0A 4PAGA 2FX2A 3CUUA 2OGSA 1YGPA 3V8QA 3WX0A 2CMGA 3OUZA 1DQRA 3DBVO 3HGQA 2QIPA 2OOSA 5M3BA 3RODA 5IASA 2FY8A 2ROQA 3GLHA 4IG4A 4Z9AA 1LLFA 3UJPA 4QM7A 2YHBA 4Z7QB 3O74A 5KNLA 3SR0A 1R66A 2XZPA 3T6KA 5KREA 1OHHD 1L6RA 3AL2A 3IRUA 3O90A 5DULA 1WF6A 3DZFA 1W75A 3MRSA 1IJBA 2RKWA 4HJRA 4EJFA 2QSUA 2OGTA 2I9PA 1BA3A 3ABSB 4OGLA 3WISA 1GJRA 3AHEA 1G20A 3OQHA 4A27A 4M1OA 2PCLA 4OG2A 4EZBA 3HI6A 3T12A 4B6RA 2OQIA 1RYYA 2ZZKA 1JUDA 2DPMA 1I2MA 4MX8A 4RPJA 4W63A 5DLQC 2WWXA 4QUHA 2O2SA 5IAAA 1UOOA 3G9UA 2HU2A 1JDJA 1T8TA 2DE0X 1Q0PA 2V98A 2XUJA 4GDMA 4NQZA 3HN6A 4RA9A 2G4CA 4O4IB 4R83A 5DI3A 2X5JO 3CLUC 4S05A 4LHSA 1IUPA 4JLDA 1C7IA 4L9RA 1TOAA 3MBKA 1HLFA 3U4MA 2I5PO 4P5DA 1ODTC 3E53A 1HT1E 2IYQA 4MRPA 3REOA 5L51A 2ZETA 4DCMA 1TCAA 3DV0A 3I9LA 1GRCA 2ONZA 5B12A 4G4IA 3O7WA 4QATA 3ZDDA 3WKDA 4IQGA 3GUUA 2C83A 1V4VA 3AFIA 3M33A 1MVOA 4J29A 1RMTA 4YJ3F 4S2EA 2JZOA 5SYAA 3VR4A 2D2FA 4CTMA 2ZI7A 3FGOA 3P9PA 5KNCD 4AZWA 3L7LA 3W8RA 1AKVA 5DGHA 1NOJA 1PNTA 1A4IA 1RDFA 3EXIB 4BMVA 3BDAA 3WV5A 1J0CA 1PEYA 2AW3A 1HDXA 3NJRA 3R0QA 5KJFA 1Y8CA 1P1BA 2MT9A 2RMKA 1JQBA 1ZO8A 3WGNA 2V7EA 4HDSB 3TOZA 7MDHA 4P7KA 3IEUA 1R9MA 3OLYA 3NYWA 4OXIA 3EGXB 3L8ZA 4KE7A 1E8NA 3TOCA 4D8WA 3AOGA 3K6RA 3QJGA 5A05A 4AMBA 3VPFA 5E7JA 1TQDA 3KKEA 3ITDA 2FEKA 3FROA 2WD8A 2P1DA 4DSAA 3DVAB 3ZDCA 4KW7A 1B3BA 4MW9A 3SVZA 2G7ZA 5MFZA 3Q1LA 5CXXA 3N7UA 2B25A 2QRMA 4JOBA 1M7HA 1ZIOA 3I1YA 4Q3NA 3UCXA 5DYTA 1ZD5A 1CY8A 3ANSA 4L5IA 1R4NA 2I6XA 1Y8QA 3UT0A 4DLSA 3G2OA 5JNWA 1E9BA 2QTRA 3W7BA 3DLBA 1ECBA 5JANA 3D6TB 5CCXA 2P6RA 1N6HA 5CFQA 3HC7A 1HO3A 4FXOA 5DN9A 3I8SA 3E15A 4J1TA 2G4VA 5JCJA 4ETIA 2SECE 2ATIA 4UATA 8ATCA 4KNYA 2NYRA 2R1TB 4I4LA 4IOKA 3T5BA 2B2NA 1BX3A 3BKXA 3OBIA 4LJYA 3ZZTA 4KU4A 3T3HA 3OU6A 2YWDA 4JJ8A 5EWLB 5FJIA 2UYHA 1XPJA 3BS4A 3K1YA 2EFDB 4KXQA 2DKFA 2Q8NA 2QE7A 1KDPA 2C2WA 1QCCA 3NEJA 5IVIA 1OROA 5IDQA 1R10A 2CLLB 1SN7A 5HUHA 2XKKA 4B6GA 3SC3A 1AUXA 1WZNA 3TRDA 3C7TA 4AN1A 3GAMA 1NWCA 2XNHA 1NI3A 3RT1A 4DR7B 5A6SB 3DMYA 3E5HA 1XF9A 1OW3B 4FINA 2Q3LA 1XDBA 5K9ZA 1OKKD 3B12A 4ML3A 3OMLA 1YB6A 3DLCA 2HGZA 3DZ8A 2VWGA 3C98A 1POWA 2P4HX 5A7FA 5I7AA 1PKXA 1HFEL 1QKKA 5TPZD 1CDOA 4JQZA 2QMUA 3M9LA 1XMSA 3HB7A 4FSDA 3S2ZA 1VPTA 3VH2A 2RAPA 5FQNA 3TM5A 3NCTA 3I9KA 3P9NA 4HZGA 1CEEA 3P5BA 1M8GA 4IMIB 1HMYA 4YT2A 3ADPA 3NHZA 2YVKA 4M1WA 5DHFA 1IZZA 3A9CA 2HK6A 5FA6A 3PXBA 1E6WA 3I23A 4ND8A 1NHWA 2Y9MB 5IARA 1VBKA 1IPEA 3CV3A 4PTLA 5ALGA 4QVGA 5F5XA 4D0LB 4NBSA 1Q2XA 1G2QA 1X7YA 3ZVRA 5MN4A 1UCFA 2Q5HA 3R2JA 4DAOA 8LDHA 1Z7BA 2VJAA 4JFRA 1W0CA 4TLLB 3H1GA 4GICA 5EVJA 4M86A 4EHHA 4TXMA 3WJ2A 2WSSD 2XQVA 4ZEVA 1J42A 2G88A 2OCLA 1WZUA 4LJ9A 3C16C 3F78A 3K5WA 5AYVA 3NC0C 1QBGA 2FAXA 2WY2D 3DUFB 5I9BA 1JFTA 3A1TA 3LWNA 2YVUA 3IOBA 1FYVA 1JYEA 1CY4A 4RORA 5MFPA 1ZM4A 1EBUA 2MDTA 4DA4A 5I7SA 1ENOA 2O59A 2I7CA 1K8ZB 1PHPA 5COBA 1YJXA 1HDIA 4W6QA 1I3NA 3AYXB 4KMMA 2HKIA 1SC6A 1CRQA 1L5FA 4V02A 2Q3EA 3X2SA 3OX2A 1IN1A 3F97A 5FPTA 3GFQA 2ECOA 3JQGA 3KPUA 1J8MF 4HNQA 3A7DA 4DCGA 5BVHA 1QH0A 4LJ7A 5IDWA 2GKSA 1Q50A 2ZAOA 3QA9A 5AFSA 1ACLA 5IXYA 4OJYA 4EHNA 3D7NA 3T7KA 1H9BA 1H2AS 1LTQA 4TQUS 1GG8A 4XFDA 4E2FA 2QPAA 4R84A 1F0PA 3ZE2B 3SQLA 4PHFA 2QG6A 4CIBA 3HJFA 3HCRA 1TF5A 3A1UA 3IPCA 2B7BA 5L7YA 2DF8A 2HU5A 3EPPA 3JQPA 4B4DA 4MQUA 4LXYA 4M0MA 3S28A 5EJ9A 2D5LA 1D03A 1G8KA 3CZ4A 3T06B 1LLCA 3M6AA 5I4CA 1ZONA 4EA8A 1X0VA 2O57A 2X58A 3H1TA 3LRPA 5DHPA 1KHHA 3G23A 4ZAFA 5G0TA 3ZTTA 4D8TA 3OIVA 3ZCQA 2VT2A 4LJ4A 4Q4JB 2PQMA 4WN3A 3VZBA 1AJEA 4GXQA 3CN9A 1U3DA 4N0MA 4I3FA 1R9NA 1A5AB 1D3AA 5EMLA 3WDKA 3RROA 1J0AA 4CMAA 1TEHA 2ECKA 2OBBA 4JT4A 2ZWMA 4DDTA 4OGGA 1P3JA 3RSSA 1QP4A 3W1EA 2DX7A 3BB4A 3C8DA 1YT5A 3SKXA 2OHGA 5CIQA 2F55A 3A9WA 1DC6A 3B85A 3PE3A 2Q4BA 3AU8A 4YWJA 4C0QC 1G8AA 3Q9NA 1DXHA 3O4RA 1CDEA 3HYNA 4Q47A 3VMMA 4OREX 1ZUIA 2HYIC 5EIEA 5IBQA 4UPDA 2M6SA 2HHAA 4JYMA 5JSHA 5L7TA 1RHMA 1NAIA 3MFQA 1ZL2A 1RLOA 1QLHA 1K98A 2F1KA 1R4ZA 2VF5X 3UYLA 1YZKA 3EIUA 4EHIA 1Y63A 4U6QA 1INLA 5J23A 4DKJA 2FQXA 1G9SA 1U7OA 2MINA 1P0FA 2ZUBA 3BTOA 3OZDA 3QHPA 4LF6B 2WMYA 4O4JA 4YAOA 5IX8A 2QTLA 4LECA 1QJ4A 1YZHA 3EVNA 1Y1LA 1L5RA 3L7NA 2P2NA 3VYVA 4YJ3A 3ZS8A 2PXHA 4I4TA 4R7GA 5H02A 2GGSA 3PUIA 2ETXA 1QGUB 2FN7A 2WTAA 2GEJA 1BE0A 1XRMA 2XB8A 5EGSA 4DSTA 5CA1F 3IP8A 1WD5A 3QEMB 1V1RB 2CHEA 5MN5A 4M0UA 2V59A 1MOQA 4HZUA 4RL4A 5LB2A 1Z8DA 5CHYA 2ZIVB 4AJHA 4JVNA 2GA9A 3QMWA 1FFXB 4WZAA 4OXNA 3CF2A 4MV3A 2CUKA 5F73A 4BQEA 3RV3A 2FW9A 3NDIA 1PS9A 1PJAA 1U04A 3TTSA 2O2GA 2JGLA 4PO9A 3OUUA 3GWGA 4J6EA 5GV7A 3SOZA 2GHRA 3GJ6A 4G63A 2V9ZA 2UV8A 2EBWA 2V7TA 1L7VC 1Y89A 1EK5A 4KZKA 4LXUA 1RU3A 2QTNA 1IBRA 2O5VA 5KTNA 3QEBZ 2R11A 1QGAA 2QN6A 3I1IA 3DMGA 4R1UA 3W3AD 4EVSA 1T8SA 4O2AF 4EYSA 5C52B 1R12A 4ZVOA 2WWHA 3JQ8A 4GX0A 5B7PA 2FPIA 1UOPA 2A0UA 3IDZA 2JJYA 4TM8A 3TTUA 2NZWA 3NVAA 4LCJA 1TFUA 5K05A 3CINA 2ODTX 4GPZA 4LWQA 2QVZX 2G1JA 1SVNA 2JFWA 1N5MA 2I3GA 4ZHQB 2V45A 1ZD9A 4UE6A 5BPFA 4A10A 2I2AA 4BFCA 3ZVMA 1V5IA 2OCXA 3DEHA 3ANTA 4BMYA 4ZO9A 4F46A 3ZU3A 1KZ9A 2OC4A 1XTKA 1IQPA 1P7YA 2PGLA 2TMDA 1BW9B 1O87A 3MLAA 2JAWA 1U0RA 4MJ7A 4WFJA 4XPZA 4DXDA 1NVDA 2PEZA 421PA 2I6TA 2VRCD 3I1FA 3LXXA 2O05A 4XYLA 2D6FA 1T9KA 3DMNA 2VDWB 1IHUA 3HCAA 3BMNB 1YULA 1PZNA 2QSYA 1NYLA 4ES6A 1AK1A 1EFVA 1FNDA 3SMVA 4QBFA 1U8UA 4M89A 1Q20A 5D2CA 3VU9A 2VDRB 1DTWB 1DP4A 4L9AA 1NUHA 5JQGF 3QITA 1T3HA 3KB6A 3IMGA 3TPFA 4DZTA 1US8A 2RGBA 3C3DA 3ER6A 4X8LA 3E05A 4OLAA 1IOWA 3R6WA 1V2HE 2NXCA 3N70A 4ER3A 1X70A 3I6IA 1OH6A 2ILVA 4R2HA 4LNAA 2HQSA 3F9RA 5DWVA 5ALIA 3TTTA 2VPZA 1V9CA 1CEXA 3JPYA 3OE4A 3D5TA 3DL7A 4K1LA 1Q3KA 2GETA 2V9PA 2TRSB 4G0VA 4RE6A 4RCZA 1QCYA 2NUAB 4YMGA 5KTOA 1X14A 3BMNA 4XJXA 2G6TA 1Y9ZA 2IOFA 2Z4TA 5EC8A 3VAYA 3ONNA 2H4ZA 3O1LA 2FUG1 1PP4A 1GAXA 3QYAA 4J0IA 5EJAA 3KQLA 4D0SA 5JD6A 3EWIA 3GLHE 1BC5A 3OESA 5LA6F 3U4QA 2O7QA 1UAAA 1II8A 1DAMA 3NTVA 1CP3A 3QKRA 1V5WA 4WLVA 5E9QA 2X5KO 4HATA 1AUOA 4LDNA 1ZIXA 2R7AA 4UULA 3TNDA 4EO9A 3AHGA 4F6LA 1RJEA 5AVKA 1JTFA 3LCMA 5BWOA 2O8CB 2VZLA 3T9EA 1TYZA 2XMCA 3IBGA 1MEJA 1N6RA 1Y3AA 3MJDA 3OE7D 4N4AA 4YJ2A 2DHEA 1QGOA 4DADA 3B5IA 3IOCA 4MGIR 1CZKA 4WH0A 1P7PA 2IFTA 4YRIA 1YQXA 3JZDA 4FYVA 4GE0A 1CY7A 3MTJA 1NP7A 2OE2A 3IAM1 3Q12A 2VS1A 4BLOA 1Q1AA 2AN1A 4YYEA 3O3MB 4BFLA 1TK9A 1BE8A 3EASA 5LXTA 4IV5A 4Q4CA 5BUZA 5I5EA 3WAGA 1FFAA 3LBFA 4GS5A 3RWOA 2P6MA 2XUFA 3GZJA 1KE1A 2MU1A 4MW6A 2VDVE 4C1NA 2DSTA 1AGXA 3KU1A 4PGHA 2JB9A 2A9OA 2LR0A 1VI5A 1MC8A 5J40A 1TT7A 1HC7A 3JQQA 2MSWA 2ZI9A 5FUXA 4Z0TA 3ZGYA 5D3MA 5TLSA 5F3WB 3L5OA 4INJA 4Z9XA 3EVBA 3C0KA 3DPUA 5ICEA 1LPAB 1NLMA 4ZXFA 2VUHB 1RTKA 1SQ6A 1N0VC 3Q6MA 2HA7A 4XQGA 4JH0A 3VAZA 4BZZA 4QDKA 4WA8A 2IV7A 2AKYA 3L0ZA 3NW9A 3R75A 2IYPA 3WLKX 4PLPA 1L7AA 3L8DA 1S3IA 3ZI0A 4EKDA 1YUNA 3MJEA 4PVCA 1R0WA 3ECAA 4WNCA 5TR9A 3WGHA 3ZHSA 3JQ9A 2O2CA 1Z0KA 3OFJA 4XQCA 4ARZB 1KJ8A 2WAMA 4OBXA 1RKQA 4ICIA 3WVNA 1ZRSA 5F3RA 4IX1A 3JAWB 4QU9A 1FPMA 2Z2YA 4HN9A 4EZIA 4GUDA 2IH5A 1E8DA 3M81A 4BNLA 3C74A 4C4PA 3W0LB 4DQLA 4DYDA 1MD9A 5BQ3A 1BXKA 3WK6A 4D44A 2J3JA 4JJAA 5HKBA 4R9RA 1T8YA 4NFYA 3FWYA 3EWSA 4LTMA 2N47A 4QOJA 1T29A 4V24A 5GAJA 3UJHA 4AWXA 4CFYA 1X7ZB 5FLKA 5F5NA 4KXVA 5IJ0A 4WY8A 2IEYA 1WAMA 3G1TA 5A06A 4GQIA 4AROA 3WLNA 4O2BB 4TZ6A 2AQHA 2CWDA 3UGQA 4G8CA 2VTBB 1F7UA 3W5IA 3IEMA 4CWAA 1OU4A 4N5MA 1ABFA 1GKIA 4PSUA 1NRWA 2REXB 4V0SA 5AJHA 1PYDA 3SXPA 4EUFA 4H2DA 3Q0EA 1MABA 2I2DA 1M1YA 3UGKA 3JARB 1NXSA 5G41A 2WMDA 3PC7A 4JJKA 1ELOA 3ASVA 3BD9A 1EXVA 3FTPA 1E58A 2ODEA 1JB9A 1PT7A 1Q77A 5FT9A 1BXRA 1QNLA 2D0OB 2GCGA 2HSGA 2RAFA 1CULC 1OJLA 3B78A 3QHAA 4LDZA 5TS3A 2R9VA 1M6EX 5CK4A 3W79A 3U7IA 4KKVA 3QFFA 1MAAA 2X3UA 3D3EA 2AMYA 4J2TA 5FJJA 3ILXA 2QUIA 4FHFA 1SXHA 4DIFA 1MV5A 4FT4A 4R8LA 1LWNA 5LZ9A 4ERXA 4X91A 4Z2AA 1X2BA 1DC3A 1H5QA 2AXQA 2BCJQ 2GT1A 2VRCA 2PX6A 3BHNA 4JOQA 4V0KA 4DSUA 1TM5E 5CX1A 1JH9A 1FA9A 2J41A 4YLGA 2CNLA 1YHYA 2F43A 3SHVA 1YNSA 1OV6A 1NVKA 1XHFA 3K16A 1ZH2A 2RGXA 3MGKA 2JFGA 1NJFA 4JROA 2YVLA 3ZGXA 4AJ1A 4E32A 3DUFA 3DWFA 2JA1A 3C3MA 3SNHA 4YP6A 1X7XA 3AILA 4HT3B 1GQOA 1PF7E 2O52A 2SKDA 1KMNA 2QM3A 3BEDA 3CH7A 3R77A 5DHTA 5A3SA 3U39A 3W5VA 1AQNA 1CVRA 1W36D 1DAFA 4LCBA 3KWMA 4L95C 1NONA 1IBCA 2E4ZA 3BZUA