1HH8A

The active n-terminal region of p67phox: structure at 1.8 angstrom resolution and biochemical characterizations of the a128v mutant implicated in chronic granulomatous disease
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
192
structure length
192
Chain Sequence
b'SLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGRLFRPNERQVAQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUTROPHIL CYTOSOL FACTOR 2
publication title The Active N-Terminal Region of P67Phox: Structure at 1.8 Angstrom Resolution and Biochemical Characterizations of the A128V Mutant Implicated in Chronic Granulomatous Disease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 76
structure length 192
sequence length 192
ec nomenclature
pdb deposition date 2000-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1hh8A00
3LPZA 3UQ3A 2DBAA 3LCAA 3RKVA 3LY7A 4H7XA 5M72A 2ONDA 5KJLA 3Q15A 4HORA 3TG5A 4J8EA 2LSUA 4RG9A 2C0MA 3EDTB 4YNDA 4H7YA 2VGYA 4UI9K 3VTYA 1A17A 1HXIA 2PQNA 5G05C 3S7BA 4NQ0A 3PDNA 1KT0A 3CVLA 1KT1A 5CCLA 4WNGA 3CKCA 4UQYA 4J0UA 2HYZA 2XGOA 4GZ5A 4GYYA 3O48A 4GZ3A 5G04C 4JA7A 1IYGA 2JLBA 4JA9A 1XNFA 2UY1B 3SZ7A 5DBKA 3KAEA 4G25A 4I2WA 5EX0A 4G26A 5LCWJ 5AYWD 5ARFA 4N2QA 3CVPA 3CK7A 4WNFA 3UUXA 4WUYA 4BT9A 3S7FA 4G23A 4NRHB 2Y4TA 3URZA 4UI9C 4G24A 2PZIA 3NF1A 1HZ4A 4U0UA 3ZFWA 4AIFA 3AS5A 3OXLA 3QWWA 3MV2B 5BT1A 4Y6WA 2XEVA 3RO2A 3AS8A 2C2LA 3LY8A 4UQXA 5KJKA 4I17A 2P58C 2VSNA 4APOA 4GZ6A 1WM5A 3MV3B 3UPVA 3HYMB 5HI7A 4YVOA 4I9EA 1E96B 1OUVA 2WPVA 2XCCA 3QDNA 4B94A 3WXXA 1FCHA 3U4TA 3ULQA 3CK9A 1HH8A 2LSVA 3Q4AB 2WQHA 3TG4A 1WAO1 3OXGA 2KCVA 2XGSA 3PE4A 5JJTA 3ESKA 4AM9A 4XI9A 4UQZA 2C0LA 3MEKA 1QQEA 3LY9A 3ZHEA 3GYZA 2HR2A 3IEGA 2YQ8A 4CGWA 4W9RA 4YVQC 3CK8A 4A1SA 4HOSA 2I6HA 2YHCA 2VSYA 5JJ6A 4JHRA 1IHGA 4U0ZA 4EQFA 3TGOA 1NA3A 2PQRA 3KD7A 2FBNA 4I2ZA 3RO3A 4XI0A 3E4BA 3MKRA 5FTPA 5BNWA 3CVQA 1ZBPA 4GYWA 2R5SA 3ZPJA 4N3AA 2V5FA 3Q49B 3ASDA 2NC9A 5CHEE 4I1AA 3AS4A 4Y6CA 5ARGA 2PL2A 5LCWC 2BUGA 3RIBA 3FWVA 1ELWA 3GZ1A 3GW4A 5D0OD 3MA5A 3Q5MA 4HOQA 4GA1A 5A6CA 1NA0A 2E2EA 5FZSA 3LYAA 4HOTA 2AVPA 2IFUA 4U07A 5KJMA 4BWRA 2LNIA 4U04A 2KCLA 2VYIA 4GCOA 1QZ2A 1ZU2A 3K9IA 3JYSA 4U0SA 4G2VA 2FEZA 3ZHEB 4AY6A 4GYOA 4WNEA 5FZRA 5G05J 4BTAA 5JJ7A 3QWVA 2VQ2A 3RU0A 3ZN3A 1TJCA 4I9CA 5FJYA 3CEQA 1W3BA 3S7DA 4ME2A 3S7JA 3QWPA 2VGXA 4N5CA 3ASFA 3LKUA 5G04J 2IF4A 3GZ2A 3CV0A 4KXKB 2OOEA 4CGVA 4BTBA 2Y4UA 3N71A 3TAXA 5FT9A 4CDRA 5EKQD 2KATA 4J8DA 4ABNA 4GCNA 3R9AB 4G1TA 3KS2A 3FP3A 4GPKA 4AY5A 3QKYA 4XIFA 4UI9J 1P5QA 2FF4A 3BEEA 4HOUA 3SF4A 3FFLA 3OXFA 4N3BA 2FI7A 2Q7FA 5HQ8A 4KYOB 4N2SA 5BW8C 3U3WA 2QFCA 2UY1A 4GA2A 4RG6A 4LEUA 4KBQA 4WNDA 1B89A 1YA0A 2L6JA 3VTXA 2KCKA 4N39A 2GW1A 3ASGA 3CKBA 4N3CA 1ELRA 2HO1A 3ASHA 3Q47B 4BT8A 3ZGQA 1PC2A 2MHKA 2FO7A 5C1DA 4IN3B 5KJNA 1NZNA 2XPIA 2J9QA 2KC7A 3CVNA 3QOUA 4GA0A 5DIZA 5EX3A 4F3VA 1KLXA 5D0QD 4O6FA 2XGMA 4JL0A 4J8FA 2XCBA 5A7DB 2VGXB 3RJVA 5CCMA 2UWJG 1Y8MA 3PE3A 5FZQA
chains in the Genus database with same CATH superfamily
3LPZA 4JEHA 2DWZA 4GTMA 3HXBA 4LERA 1UG3A 3C98A 5CBOA 3CHMA 2PNNA 4H7XA 3V30A 3PNLB 4M7CA 5J90A 4XEIG 3D9IA 3TWTA 3HHMA 1ELKA 2C0MA 2WXHA 4R7LA 3VTYA 3V31A 1HXIA 1WY6A 3F6QA 3S7BA 1O1TA 4NQ0A 4OVVA 3Q7FA 4JD2G 3PUKA 3V2OA 3CKCA 2A5UA 4HS2A 2ZGGA 2J07A 3ML8A 4F1PA 4GYYA 1BLXB 3ZRHA 3FY4A 3PVLA 3EU5A 4B8AA 4YDWA 5DBKA 4G25A 4I2WA 2IONA 5D2MC 3FTYA 3FEXA 4GTOA 3DEPA 5ARFA 2VTBA 3CVPA 4WNFA 2J09A 4FP7A 2I9CA 4KT6B 3NOCD 1VDYA 1OWPA 2GRMA 4AIFA 3QWWA 3ZXPA 1OT8A 3PZ1A 4HBDA 2ETAA 1OCCE 5G55A 2NSZA 2C2LA 3C3QA 1OWMA 3O4ZA 4UQXA 1DVPA 2J4BA 2P58C 4FADA 2VSNA 4APOA 3BUAA 4WWPA 1WM5A 3R9MA 4BESA 1AWCB 3DXMG 4I9EA 1SZ9A 4OYSA 1OUVA 2XCCA 4KZCA 1UW4B 1FVHA 3DXKG 1DCQA 3T8MA 3EIQC 1U3DA 3L9TA 5EN5D 4N5QA 3S2AA 2DCPA 1FCHA 5AQ7A 3ULQA 4UWFA 2DZNA 4JB8P 3C3OA 3CK9A 4A3TA 1K8KG 1HH8A 2LSVA 3Q4AB 2WQHA 3APCA 1WAO1 3FUDA 3PE4A 5BXUA 3CQGB 3MEKA 3EHQA 2P9LG 5EIDA 5CBNA 4XE0A 4A63B 4U8HA 4YVQC 4UWKA 2WXPA 4F1SA 3C3RA 2I6HA 2R03A 3FH7A 3HVEA 3JQ0A 1D8DA 5EILA 5JJ6A 3P1UA 4O1OA 4UWGA 2OVBA 1IHGA 4U0ZA 4J7WA 3KD7A 4HLEA 3E4BA 3AG2E 1BI8B 3CVQA 3PS6A 4HRLA 5E75A 5KWDA 2HM8A 5AJDA 2R5SA 4N3AA 3AG1E 3CIAA 3FTUA 4L1BA 4U95D 3CGHA 3ZYQA 4CDNA 2FO1E 4LG6A 2NC9A 5CHEE 2XZTG 2IO3C 4I1AA 1YMPA 4K5CA 4BY6A 3AS4A 1HE8A 5ARGA 4FHJA 4MKTA 4HB5A 1EYHA 4X8QA 4FULA 2GGFA 4AXHA 3GZ1A 4DLOA 3SFYA 4DX7D 4LSZE 2E2EA 3FUKA 5FZSA 3CHRA 3IXEA 5ENTD 2RKKA 2OVFA 3LYAA 1X81A 4U07A 5LP0A 2GRQB 5EDSA 2B0OE 4GCOA 2WXOA 3NAWA 3JYSA 2BKKB 1MZCA 2XENA 2Y69E 3ISMC 3RK6A 3UIPC 2L6BA 4WNEA 2MYOA 3CVUA 4BTAA 3D9JA 2ZXWE 3CEQA 1OWOA 3S7DA 3W9GA 4XKCA 4ME2A 2MOWA 2VGXA 3CVWA 3HXFA 2DVWA 3ASFA 4ACLA 2IF4A 3WG7E 3ESLA 2Y4UA 5B3SE 2WMNA 2CFZA 3TAXA 3GZSA 3LVRE 5EKQD 4ABNA 3TWSA 1H2TC 4LNUD 1JPLA 4AP2A 3FP3A 3UT8A 2P9UG 4A55A 1SVXA 4GB9A 4UI9J 4DX2A 5ENRD 2B6CA 2BEDA 3DEOA 4YDYA 3SF4A 3DRAA 2Q7FA 4B8CB 2F0YA 3DSUA 1N54A 4FLBA 2Y3AA 2R02A 5BW8C 2H6HA 2XQ0A 5FQ4A 4HRMB 1E90A 2IJGX 3U3WA 2WXMA 3RRMB 4KBQA 4OAUC 4WNDA 1EF1C 2X6FA 1B89A 1UN9A 2KCKA 4K03A 1UJKA 3ZUVB 3AU5A 3CKBA 4WWOA 2HO1A 1TN7A 2IOSA 4BT8A 2MHKA 2FO7A 2V0PA 4ATGA 2J9QA 2KC7A 3NQPA 5D0QD 1K1BA 4NURA 3PZ3A 3PEVB 4GAAA 1BPOA 3SFZA 3QB2A 1Y8MA 3MJWA 4K5BA 4C48B 3Q9UC 3FUJA 4WWNA 4Q96A 1QBQA 3U66A 3SD5A 2QC9A 1UOHA 1JCSA 3LY7A 5LFAA 2WB2A 1TN8A 1ZB1A 3DSVA 4HORA 2X6HA 5D66A 3UXGA 4ANVA 5AIJA 1JCRA 4RG9A 4YNDA 4UI9K 4TXRA 1H6PA 1NI1A 2PQNA 5G05C 3JUIA 3LS8A 4URKA 2OEVA 3UINC 3ZYMA 3FTZA 3PDNA 3QK0A 4NIKA 3CVLA 4XX5A 3CHQA 4J0UA 1FT2A 2XGOA 4MLPA 2JABA 4L23A 3FU5A 3NBNB 3D9KA 4OVUA 1IHBA 3CVYA 1IKND 5LCWJ 4FA6A 1Z6TA 3CK7A 2P9PG 3W9FA 3S7FA 2EILE 5CRUA 4MBGA 5A23A 3UT7A 5FQ6A 2HE0A 4BFRA 3B7UX 5KBAA 4GU5A 4G24A 1K3ZD 1HZ4A 3ZFWA 1O1RA 5ENSD 4BEPA 2GRPB 1X5BA 4HI8A 4UWLA 4LUNU 1OCZE 4J8SA 4YDOA 3DSWA 4LRZA 3B7TA 4HNAD 5KNGA 1SA5A 1Z3YA 1A5EA 3MV3B 3UPVA 3HYMB 1MX4A 4YVOA 3HG0D 3UTMA 4CT4A 1PY1A 5ENNA 1N11A 4JC8A 2H6GA 2WPVA 3T9KA 4PUCA 2WXQA 1O1SA 3D3MA 4DRXE 2CHXA 3B95A 2JEKA 3KSLA 3TG4A 3TXNA 3OXGA 1YYHA 5FWQA 3ESKA 1H6OA 2C0LA 2V5QC 1QQEA 3MKQB 2KZTA 2R05A 1WG0A 3LY9A 3ZHEA 3GYZA 4GTSA 3HVEB 1IQUA 3IEGA 4W9RA 4DX1A 4J6IA 1TEZA 3AU4A 3CK8A 3ZYLA 2X6JA 4A1SA 3CHSA 3TWXA 4ANUA 3G2WA 3ZKJA 4EPZA 3LVQE 3VLEA 1OY3D 1SZAA 1JCQA 4JHRA 2EQXA 4HI9A 3TGOA 2XPYA 2PQRA 3B13A 3MKRA 5FTPA 2CHZA 2P9NG 5AJLA 1E7VA 2L9BA 2QYUA 1OWLA 1HO8A 1BU9A 4HXIA 2V5FA 2F37A 3Q49B 1HU3A 3FDHA 3L22A 2IOLA 1TNYA 4A1GA 5LX8A 4G8LA 2L0TB 5EYLA 2XZDG 3GW4A 3C5RA 5D0OD 1TJFA 2LUHA 3Q5MA 1IXVA 4GA1A 3MGBA 4I6JA 2H6FA 3CHPA 4HOTA 1U2VG 1H2VC 4BWRA 1JWFA 1EPUA 2P9IG 2VYIA 2I2OA 1QZ2A 4U0SA 3NZSA 4G2VA 3TWRA 3R7RA 2BTDA 4C0MA 1SQMA 5JHBA 1HG2A 4GTQA 3CVVA 4GYOA 4AY6A 4G8KA 3ZEFA 3QWVA 3ZN3A 4JHKA 3AJIA 4PH4B 4I9CA 4FHKA 4NACA 1S63A 3QWPA 4F7AA 1H0AA 1MX6A 3CSFA 4YDEA 4CGVA 1O5MA 3FU3A 2WVIA 5BXOA 2KATA 1NP7A 2CHWA 3J5QB 3KS2A 3ZYKA 3DBSA 3UX4A 1HG5A 3T5XA 2Y0BG 3HDXA 3LEWA 4FJYA 4U8VD 3PUJA 4E85A 3AAAC 2FF4A 4RQIA 2WXIA 3FFLA 3MZLB 4RSYA 4KYOB 4Q94A 3DSXA 4EZKA 3EHMA 5BV0A 3E30A 3ZW3A 2L6JA 4GZDA 3G2TA 2WXRA 3D9OA 2GW1A 3PZDA 3TWQA 3ASHA 4LNBA 3ZGQA 4GZCA 4U8YD 3VLFA 1EDUA 3QOUA 4GA0A 2ETBA 5DIZA 5T3RA 1KLXA 5AENA 2XCBA 5C2YA 2UWJG 2IU1A 4B0ZA 3MCXA 3ENEA 4IRUA 1RZ4A 2V4HC 2GRLA 3Q75A 1D8EA 2ZGDA 2WM9A 2DBAA 4ANXA 1HS6A 1LD7A 2ETCA 2PM7A 3Q15A 3OAWA 3R7QA 5HS0A 3APFA 1H19A 2LSUA 3B7RL 3EDTB 5CRVA 3TJPA 3SBSA 1DCEA 3AG4E 2VGYA 4CEMA 3IV0A 3E32A 4DI3A 4CYMD 2R59A 1S0PA 3HXDA 4RVBA 4APFA 1KT1A 4WNGA 2X3MA 4ILIA 4UQYA 2HYZA 4GZ5A 3LJ3A 3O48A 4GZ3A 3FEYA 4BX9A 3U9WA 5G04C 1N4RA 3FUFA 5KNHD 2KXPC 1XNFA 2UY1B 1E8YA 4I1MA 5EX0A 3G2SA 3FUNA 5AYWD 3UUXA 3UKRG 4BT9A 1N0QA 4I6GA 4G23A 3FU6A 1DNPA 3QNKA 2Y4TA 3URZA 3UT4A 3BQOA 3UKUG 3I5PA 4F6RD 5CMWA 2PZIA 2CG3A 3BG1B 3RSEG 3AS5A 2DIWA 3SO8A 2XEEA 2XEVA 4DLQA 2XS8A 3E34A 3TWVA 3AS8A 2M63A 4TRQA 3L82A 3LY8A 3ABME 3Q79A 3PZ4A 4KVOA 4J8YA 4DUIA 1Z5SC 2WXNA 2GROB 5HI7A 1Y6IA 4V3IA 3SI5A 1SW6A 2RD0A 1E96B 1N94A 4Z68A 3QDNA 3AG3E 4AV7A 2V4LA 3D9NA 4L2LA 1S70B 4P29A 3FH8A 4BETA 2AXUA 3ZIMA 5CECB 5AAOA 1PAQA 2QZAA 4HFGA 4GPMA 3HIZA 1JWGA 4FC8A 4AM9A 4UQZA 2V8SE 5FQ8A 2WQ7A 3T8KA 2QYJA 3VLDA 2AXVA 4TXQA 3IHVA 2XRZA 5CEDB 4L7TA 2J49A 5FQ7A 4GTTA 3UM3A 2BF0X 2VTBB 4HOSA 1INZA 2J08A 1QNFA 2YHCA 4GTVA 4HVBA 2NYJA 5ANRA 2VSYA 2WMOA 5KCMA 4Q69A 3RO3A 3ZVVA 5H7PA 5JMND 3ZPJA 2GRRB 1XGWA 2AXZA 4CRWA 2OEWA 2LXMA 2OV8A 4C0EA 3FUEA 4KZ0A 4F53A 2I1KA 1K1AA 4O1PA 4GMLA 3ONLA 3QARA 3JXJA 3ML9A 2BUGA 2RFMA 4IULA 4ZHBA 3PRZA 3MA5A 3B7SA 1GW6A 5A6CA 2YHEA 2BKGA 4UUCA 2AVPA 2EINE 3D9LA 2WQ6A 5KJMA 3EHNA 3SBTB 4DI4A 2P9KG 4DPRA 3L16A 5ENPD 4U04A 3X2QE 1ZU2A 4BX8A 3FTSA 4JHJA 2RFAA 2FEZA 2IY0C 4HRNA 3ZXSA 5FZRA 5G05J 2J8SD 1YCSB 2VQ2A 2IQCA 4EHMA 4AJWA 1Q2ZA 1TJCA 5FJYA 3RAUA 4DX6D 1W3BA 1TNBA 3JUEA 3S7JA 5AARA 2XPZA 5FIOA 3APDA 3L54A 1SA4A 3GZ2A 3CV0A 5EYPF 2OOEA 5CERB 5T8IA 5FT9A 5BV1A 2ILRA 4G1TA 3L08A 4GPKA 3EU9A 3QKYA 4KVMA 3OTNA 2AWIA 1FT1A 2F8XK 4XIFA 4U7EB 4XZ4A 4JVSA 4HOUA 3PEUB 3OXFA 4N3BA 4BSZB 5ITZF 4DJAA 4N2SA 4JZYA 3CHOA 2IEJA 4PS8A 4MS6A 3G2UA 1HF8A 4L2YA 2GRNB 1E8ZA 1Z3XA 2QFCA 2R17C 4GA2A 3PNTB 4LEUA 3FTVA 2P2CP 1OCOE 3HXEA 4N39A 1MHQA 5T4YA 3ASGA 3UM0A 1N95A 3B7BA 5EIBE 3Q47B 3FHEA 1PC2A 2WXJA 5C1DA 4IN3B 5KJNA 4TUUA 4QQIA 3CQCB 3L6AA 3KEZA 2AJAA 2XPIA 1FPPA 4B93B 3CVNA 4ATZD 3T5VA 3ULEG 1MYOA 5G2NA 3LJNA 3RRNB 4O6FA 2VGEA 2XGMA 4J8FA 5A7DB 2VGXB 5CCMA 1N0RA 4BERA 3PE3A 3DPDA 3FTXA 3V2XA 5HRYA 3L13A 3JQ1A 3UQ3A 3ONKA 3E37A 4CCAA 2X38A 4KMOA 2LO6A 3G2VA 4LCTA 3ABLE 3QC1A 3LCAA 3RKVA 4EZJA 5M72A 2ONDA 5KJLA 4PS7A 4PS3A 3SNXA 3TG5A 4J8EA 1E8XA 3D9HA 3I3NA 2E0IA 4H7YA 4OAVB 3FTWA 2VJ8A 5FINA 4D10C 1QYMA 1A17A 4U63A 4PDXA 1D9SA 3PH0C 1KT0A 3FH5A 1E7UA 5CCLA 3KEAA 2DYRE 5IY5E 1MJ0A 2ZU6B 2Y1LE 2IO2C 3MKQA 4JA7A 1IYGA 2JLBA 4GTPA 4JA9A 1TYQG 1G3NB 3EUVA 3SZ7A 4JXTA 5ENOD 3KAEA 5LOZA 3HXCA 4G26A 3UM1A 1OXJA 2PM6A 1AP7A 3FULA 2WXFA 3EHRA 4GMRA 4N2QA 2CFUA 3IBEA 4EZLA 2A4ZA 2XRYA 2KM4A 2EIJE 4WUYA 1E8WA 4NRHB 1N4QA 1LF8A 4UI9C 4I6EA 3NF1A 4U0UA 2LXLA 5B1BE 3MYVA 2EIME 3OXLA 2X6KA 3MV2B 1S64A 5BT1A 3Q9NC 4ANWA 2VSXE 3RRUA 4Y6WA 4WAFA 3I4GA 2P9SG 3RO2A 3UM2A 5E76A 2YINA 4JPSA 4DK5A 1FVFA 4M3OA 1H6KA 5KJKA 2DZOA 4I17A 1TN6A 4GZ6A 2MRIA 2R2LA 4XKBA 5CMYA 3ZU7B 2FULA 4B94A 3PZ2A 3WXXA 2ZIRA 4FU3A 3U4TA 3DSTA 3D9MA 1N9AA 2I1JA 2XHEA 3CLJA 2QY7A 2KCVA 3TWUA 2XGSA 5JJTA 4XI9A 1H2UA 4JW1A 3LDZA 4K5AB 3UMVA 2YNQA 1RW2A 1KZOA 3SY2A 2H6IA 4UWHA 2WXKA 3SHFA 3FUIA 3D9PA 1U3CA 2HR2A 1V54E 2YQ8A 4CGWA 1V55E 1NL4A 2J4DA 4G11A 3ABKE 3P2BA 3DPYA 3QJZA 5ENQD 4FJZA 4AVXA 2ZISA 4EECA 3IKOB 3ASNE 3CR3A 3E33A 2X6IA 1OCRE 4U96D 4TV3A 4EQFA 4GMJA 1NA3A 5AQBA 2FBNA 4I2ZA 4XI0A 5BNWA 1MQSA 3SFXA 1ZBPA 4GYWA 2OCCE 2CG2A 3ULYA 4GTRA 4E6HA 4HLLA 1WDYA 3FUMA 3Q7AA 1TNZA 2XEHA 3IHYA 2XS1A 3ASDA 4TUMA 1HFAA 3DSSA 3CSTA 3UIOC 3EJNA 4Y6CA 3QAQA 5B1AE 2PL2A 5LCWC 3DWLG 4ILGA 3RIBA 3FWVA 1ELWA 5BPPA 1MX2A 4BSXA 1JUQA 1UJJA 4I43A 2KBXA 4HOQA 1NA0A 3I4RB 4K0RA 3SQVA 1KPSB 1DC2A 2IFUA 2LNIA 1BI7B 2KCLA 3V79K 3K9IA 4MRUA 1TNUA 3NB2A 3ASOE 3CVXA 2F8YA 2KZTB 4EBAA 3L17A 2L0IA 3KSQA 3LXUX 3ZHEB 4ACKA 1BD8A 2WXLA 1NFIE 5JJ7A 3RU0A 3U64A 4FLHA 4QFVA 1L5JA 4N5CA 1LD8A 4C9BB 2VSOE 5ANLA 3LKUA 4B89A 5G04J 1OWNA 4KXKB 3FU0A 3EIJA 4BTBA 1N4PA 2EIKE 4EBAG 3N71A 5CEAA 4CDRA 3ZNGA 4AOFA 4J8DA 4GCNA 4RLYA 3JXIA 3R9AB 2RG8A 3SGHA 2NXPA 4AY5A 3JCKC 5AQ9A 3C72A 1TR4A 4ZFHA 1P5QA 3FUHA 2A5EA 3TXMA 5HKPA 3BEEA 1N4SA 4L9PA 2DYSE 2FI7A 4ILHB 4JEUA 2LAHA 1TNOA 4CDMA 3BG0B 5HQ8A 3HRAA 4LNGA 5JA4D 4CT0A 2UY1A 4I1OB 4RG6A 4O60A 3TWWA 3NZUA 3TL5A 3NOGD 4AEZC 5JHAA 1YA0A 5BUZA 3VTXA 4IYPA 1KZPA 2WXGA 4N3CA 4CZ2D 5J08A 1ELRA 1N52A 3Q73A 3J5PA 1NZNA 4TXPA 2LAIA 3UI2A 1UN8A 5EX3A 4F3VA 1IQRA 3MX3A 4A3VA 1HX8A 5AQAA 4JL0A 3BU8A 2AW6A 4DX5D 3RJVA 4HQDA 1LTXA 3Q78A 5AN8A 3PREA 5FZQA
chains in the Genus database with same CATH topology
2GRLA 3L13A 3JQ1A 3LPZA 3UQ3A 3ONKA 3FUJA 4JEHA 4CCAA 2X38A 4KMOA 4WWNA 4Q96A 2WM9A 4LERA 1UG3A 2LO6A 3C98A 2DBAA 3G2VA 3MJWA 4LCTA 3SD5A 3QC1A 4ANXA 3LCAA 3RKVA 1HS6A 3LY7A 5LFAA 2WB2A 3CHMA 4H7XA 4EZJA 5M72A 3PNLB 2ONDA 5KJLA 5J90A 2PM7A 3Q15A 3OAWA 3R7QA 4HORA 3APFA 4PS7A 4PS3A 3SNXA 3TG5A 2X6HA 4ANVA 3D9IA 4J8EA 1E8XA 3HHMA 5AIJA 1ELKA 1H19A 2LSUA 3I3NA 3B7RL 2E0IA 2C0MA 3EDTB 2WXHA 4RG9A 3TJPA 3SBSA 4YNDA 4H7YA 2VGYA 4CEMA 3FTWA 4UI9K 3IV0A 4R7LA 2VJ8A 3VTYA 4D10C 4DI3A 1A17A 1HXIA 2PQNA 4PDXA 4U63A 3JUIA 5G05C 3LS8A 1WY6A 2R59A 3S7BA 4URKA 4NQ0A 4OVVA 3ZYMA 3FTZA 3PH0C 3PDNA 1KT0A 3QK0A 1S0PA 3CVLA 3FH5A 3PUKA 1E7UA 4RVBA 4XX5A 1KT1A 4APFA 5CCLA 4WNGA 2X3MA 4ILIA 3CHQA 3CKCA 4UQYA 2A5UA 4HS2A 4J0UA 2HYZA 2J07A 3ML8A 2ZU6B 2XGOA 4GZ5A 4GYYA 3LJ3A 3ZRHA 3O48A 4GZ3A 3MKQA 3FEYA 4BX9A 4MLPA 3FY4A 5G04C 3U9WA 3PVLA 4JA7A 4L23A 3U66A 2JLBA 4JA9A 1IYGA 3FUFA 4B8AA 3FU5A 1XNFA 3D9KA 2UY1B 3SZ7A 5DBKA 4JXTA 1E8YA 4OVUA 4I1MA 3KAEA 4G25A 4I2WA 3G2SA 5EX0A 5LOZA 4G26A 3CVYA 2IONA 2PM6A 3FUNA 3FTYA 3FULA 3FEXA 2WXFA 5LCWJ 4FA6A 5AYWD 5ARFA 1Z6TA 2VTBA 4N2QA 2CFUA 3CVPA 3CK7A 3IBEA 3MCXA 2J09A 4WNFA 4EZLA 2A4ZA 3UUXA 2XRYA 2KM4A 4FP7A 2I9CA 4KT6B 4WUYA 3S7FA 4BT9A 4I6GA 4G23A 1E8WA 5A23A 4NRHB 3FU6A 1DNPA 3UT7A 3QNKA 5FQ6A 1LF8A 2Y4TA 3URZA 4BFRA 3B7UX 3UT4A 4GU5A 1VDYA 4UI9C 4I6EA 3I5PA 4G24A 5CMWA 2PZIA 1OWPA 2GRMA 3NF1A 1HZ4A 2CG3A 3BG1B 4U0UA 3ZFWA 4AIFA 3AS5A 3MYVA 3OXLA 2DIWA 2X6KA 3QWWA 3MV2B 5BT1A 4ANWA 1X5BA 2VSXE 3RRUA 4Y6WA 4WAFA 3I4GA 2XEVA 3RO2A 5E76A 4DLQA 4UWLA 4LUNU 3AS8A 4J8SA 2YINA 5G55A 2M63A 4JPSA 4TRQA 2NSZA 2C2LA 4DK5A 3LY8A 1FVFA 4M3OA 1OWMA 3O4ZA 4UQXA 1DVPA 1H6KA 4KVOA 4LRZA 5KJKA 2J4BA 3B7TA 4I17A 2P58C 4FADA 2VSNA 4APOA 4GZ6A 2WXNA 1Z3YA 2MRIA 4WWPA 1WM5A 3MV3B 3UPVA 3HYMB 5HI7A 1Y6IA 4V3IA 4XKBA 4YVOA 3SI5A 4I9EA 1SZ9A 2RD0A 4CT4A 4OYSA 1E96B 1PY1A 5ENNA 4JC8A 1OUVA 2WPVA 2XCCA 3QDNA 4KZCA 1UW4B 2FULA 5CMYA 4B94A 4AV7A 3WXXA 4PUCA 1FVHA 2V4LA 2WXQA 3D3MA 3T8MA 3EIQC 2CHXA 1U3DA 3D9NA 4L2LA 3S2AA 2DCPA 1FCHA 4P29A 3FH8A 4FU3A 3U4TA 2JEKA 3ULQA 3D9MA 4UWFA 2AXUA 3ZIMA 3CK9A 4A3TA 1PAQA 2I1JA 1HH8A 2LSVA 2XHEA 3CLJA 3Q4AB 2WQHA 3TG4A 2QY7A 3APCA 4HFGA 1WAO1 3TXNA 3OXGA 3FUDA 2KCVA 5FZQA 5FWQA 3HIZA 2XGSA 3PE4A 5JJTA 3ESKA 1JWGA 4FC8A 4AM9A 4XI9A 4UQZA 1H2UA 2V8SE 4JW1A 3LDZA 5FQ8A 3CQGB 3UMVA 2WQ7A 2C0LA 2YNQA 3MEKA 1QQEA 3MKQB 2KZTA 3VLDA 4UWHA 2AXVA 2WXKA 3SHFA 3FUIA 3IHVA 3D9PA 3LY9A 3GYZA 3ZHEA 1U3CA 2HR2A 4XE0A 2XRZA 3HVEB 1IQUA 4L7TA 2J49A 3IEGA 2YQ8A 4CGWA 4W9RA 2J4DA 5FQ7A 4U8HA 4J6IA 4G11A 3P2BA 4YVQC 1TEZA 3AU4A 4UWKA 3QJZA 3CK8A 3ZYLA 2X6JA 4A1SA 2WXPA 3CHSA 2BF0X 4FJZA 4F1SA 2VTBB 4HOSA 1INZA 2J08A 2I6HA 4AVXA 4ANUA 3G2WA 1QNFA 3FH7A 4EPZA 2YHCA 4HVBA 3HVEA 3LVQE 4EECA 3IKOB 3VLEA 5ANRA 3JQ0A 1SZAA 3CR3A 2VSYA 2X6IA 5JJ6A 2WMOA 3P1UA 4JHRA 5KCMA 4UWGA 2OVBA 2EQXA 1IHGA 4U0ZA 4TV3A 4EQFA 3TGOA 4GMJA 2XPYA 1NA3A 2PQRA 3KD7A 2FBNA 4Q69A 4HLEA 4I2ZA 3RO3A 4XI0A 3B13A 3E4BA 3ZVVA 3MKRA 5FTPA 5BNWA 2CHZA 1MQSA 3CVQA 1ZBPA 3PS6A 4GYWA 5E75A 2HM8A 5AJDA 2R5SA 3ZPJA 1XGWA 5AJLA 4N3AA 2CG2A 1E7VA 2AXZA 4CRWA 2L9BA 3CIAA 3FTUA 2OV8A 4L1BA 4C0EA 4E6HA 1OWLA 1HO8A 3FUEA 4KZ0A 3CGHA 3FUMA 4F53A 2I1KA 3ZYQA 4HXIA 3IHYA 4CDNA 2V5FA 3Q49B 3ASDA 1HU3A 1HFAA 4GMLA 2NC9A 5CHEE 3FDHA 3L22A 4I1AA 3CSTA 4BY6A 3AS4A 2IOLA 3EJNA 4Y6CA 3ONLA 3QAQA 3QARA 1HE8A 5ARGA 4A1GA 4FHJA 3ML9A 4MKTA 2PL2A 5LCWC 4ILGA 2BUGA 1EYHA 3RIBA 5LX8A 3FWVA 1ELWA 2GGFA 4FULA 4AXHA 5BPPA 3GZ1A 2L0TB 4BSXA 4DLOA 1JUQA 1UJJA 4IULA 3PRZA 3GW4A 4I43A 5D0OD 3MA5A 1TJFA 3B7SA 3Q5MA 1GW6A 4HOQA 4GA1A 5A6CA 1NA0A 2YHEA 3MGBA 2E2EA 3I4RB 3FUKA 4I6JA 4K0RA 5FZSA 3CHRA 3CHPA 2OVFA 3LYAA 4HOTA 2AVPA 2IFUA 3D9LA 2WQ6A 1H2VC 4U07A 5KJMA 3EHNA 3SBTB 1JWFA 4BWRA 4DI4A 5LP0A 2LNIA 4DPRA 3L16A 1EPUA 5EDSA 4U04A 2KCLA 2VYIA 4GCOA 2I2OA 1QZ2A 1ZU2A 2WXOA 3K9IA 4MRUA 4BX8A 3JYSA 3FTSA 4U0SA 4JHJA 3NZSA 4G2VA 3R7RA 3CVXA 2BTDA 4C0MA 2FEZA 1SQMA 2KZTB 5JHBA 4EBAA 3L17A 1HG2A 2L0IA 3LXUX 3RK6A 3ZHEB 4ACKA 4GYOA 3ZXSA 3CVVA 4AY6A 4WNEA 5FZRA 5G05J 2WXLA 3ZEFA 3CVUA 4BTAA 5JJ7A 3QWVA 3D9JA 2VQ2A 3RU0A 3ZN3A 4JHKA 2IQCA 4AJWA 3U64A 4PH4B 4FLHA 1TJCA 4QFVA 4I9CA 5FJYA 3CEQA 1OWOA 4FHKA 1W3BA 4NACA 3S7DA 4XKCA 4ME2A 3S7JA 2XPZA 2MOWA 1L5JA 2VGXA 3APDA 3QWPA 4N5CA 3CVWA 4F7AA 4C9BB 2VSOE 1H0AA 3L54A 5ANLA 3ASFA 3LKUA 4ACLA 4B89A 5G04J 3CSFA 2IF4A 1OWNA 3CV0A 3GZ2A 4KXKB 2OOEA 3FU0A 3EIJA 4CGVA 3ESLA 4BTBA 2Y4UA 2WMNA 4EBAG 2CFZA 3FU3A 3N71A 3TAXA 2WVIA 3GZSA 3LVRE 5T8IA 5FT9A 4CDRA 5EKQD 5BV1A 4AOFA 2KATA 4J8DA 4ABNA 4GCNA 1NP7A 1H2TC 2CHWA 1JPLA 3R9AB 2RG8A 2ILRA 4AP2A 4G1TA 3KS2A 3L08A 3ZYKA 3DBSA 3FP3A 3SGHA 3UT8A 3UX4A 1HG5A 2NXPA 4A55A 3T5XA 4GPKA 4AY5A 3QKYA 3HDXA 3JCKC 4KVMA 3OTNA 2AWIA 3LEWA 4FJYA 4GB9A 4XIFA 4UI9J 1P5QA 3PUJA 4E85A 4XZ4A 3FUHA 2FF4A 3TXMA 4JVSA 3BEEA 4HOUA 3SF4A 2WXIA 3FFLA 3MZLB 3PEUB 3OXFA 4ILHB 2FI7A 4N3BA 4JEUA 2LAHA 2Q7FA 4B8CB 4DJAA 4CDMA 3BG0B 4RSYA 5HQ8A 4KYOB 4N2SA 4Q94A 4JZYA 3CHOA 1N54A 4FLBA 2Y3AA 4PS8A 4MS6A 5BW8C 2XQ0A 5FQ4A 4EZKA 3G2UA 1E90A 2IJGX 1HF8A 4L2YA 1E8ZA 3U3WA 1Z3XA 2QFCA 2R17C 4CT0A 2UY1A 3EHMA 2WXMA 4GA2A 4I1OB 4RG6A 5BV0A 3RRMB 3PNTB 4LEUA 3NZUA 4KBQA 3TL5A 4WNDA 1EF1C 4AEZC 3FTVA 2X6FA 1B89A 3ZW3A 5JHAA 1YA0A 1UN9A 2L6JA 5BUZA 3VTXA 2KCKA 4GZDA 4IYPA 4K03A 4N39A 1MHQA 1UJKA 3G2TA 2WXRA 3D9OA 5T4YA 2GW1A 3PZDA 3ASGA 2WXGA 3AU5A 3CKBA 4N3CA 5J08A 1ELRA 1N52A 4WWOA 2HO1A 3ASHA 2IOSA 3Q47B 3FHEA 4BT8A 3ZGQA 4GZCA 1PC2A 2WXJA 2MHKA 2FO7A 5C1DA 4IN3B 5KJNA 1NZNA 4TUUA 3CQCB 2V0PA 2LAIA 3KEZA 3L6AA 4ATGA 3VLFA 1EDUA 2J9QA 2KC7A 2XPIA 3CVNA 1UN8A 3QOUA 4GA0A 3PE3A 5DIZA 3T5VA 5T3RA 5EX3A 5G2NA 4F3VA 1IQRA 1KLXA 3NQPA 3RRNB 3MX3A 5D0QD 4O6FA 4A3VA 1HX8A 2XGMA 4NURA 4JL0A 4J8FA 5AENA 2AW6A 2XCBA 5A7DB 3PEVB 4GAAA 2VGXB 3RJVA 5C2YA 1BPOA 3SFZA 5CCMA 3QB2A 2UWJG 2IU1A 4B0ZA 1Y8MA 3PREA 3DPDA 3ENEA 3FTXA 4IRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LPZ A;  3UQ3 A;  2DBA A;  3LCA A;  3RKV A;  3LY7 A;  4H7X A;  5M72 A;  2OND A;  5KJL A;  3Q15 A;  4HOR A;  3TG5 A;  4J8E A;  2LSU A;  4RG9 A;  2C0M A;  3EDT B;  4YND A;  4H7Y A;  2VGY A;  4UI9 K;  3VTY A;  1A17 A;  1HXI A;  2PQN A;  5G05 C;  3S7B A;  4NQ0 A;  3PDN A;  1KT0 A;  3CVL A;  1KT1 A;  5CCL A;  4WNG A;  3CKC A;  4UQY A;  4J0U A;  2HYZ A;  2XGO A;  4GZ5 A;  4GYY A;  3O48 A;  4GZ3 A;  5G04 C;  4JA7 A;  1IYG A;  2JLB A;  4JA9 A;  1XNF A;  2UY1 B;  3SZ7 A;  5DBK A;  3KAE A;  4G25 A;  4I2W A;  5EX0 A;  4G26 A;  5LCW J;  5AYW D;  5ARF A;  4N2Q A;  3CVP A;  3CK7 A;  4WNF A;  3UUX A;  4WUY A;  4BT9 A;  3S7F A;  4G23 A;  4NRH B;  2Y4T A;  3URZ A;  4UI9 C;  4G24 A;  2PZI A;  3NF1 A;  1HZ4 A;  4U0U A;  3ZFW A;  4AIF A;  3AS5 A;  3OXL A;  3QWW A;  3MV2 B;  5BT1 A;  4Y6W A;  2XEV A;  3RO2 A;  3AS8 A;  2C2L A;  3LY8 A;  4UQX A;  5KJK A;  4I17 A;  2P58 C;  2VSN A;  4APO A;  4GZ6 A;  1WM5 A;  3MV3 B;  3UPV A;  3HYM B;  5HI7 A;  4YVO A;  4I9E A;  1E96 B;  1OUV A;  2WPV A;  2XCC A;  3QDN A;  4B94 A;  3WXX A;  1FCH A;  3U4T A;  3ULQ A;  3CK9 A;  1HH8 A;  2LSV A;  3Q4A B;  2WQH A;  3TG4 A;  1WAO 1;  3OXG A;  2KCV A;  2XGS A;  3PE4 A;  5JJT A;  3ESK A;  4AM9 A;  4XI9 A;  4UQZ A;  2C0L A;  3MEK A;  1QQE A;  3LY9 A;  3ZHE A;  3GYZ A;  2HR2 A;  3IEG A;  2YQ8 A;  4CGW A;  4W9R A;  4YVQ C;  3CK8 A;  4A1S A;  4HOS A;  2I6H A;  2YHC A;  2VSY A;  5JJ6 A;  4JHR A;  1IHG A;  4U0Z A;  4EQF A;  3TGO A;  1NA3 A;  2PQR A;  3KD7 A;  2FBN A;  4I2Z A;  3RO3 A;  4XI0 A;  3E4B A;  3MKR A;  5FTP A;  5BNW A;  3CVQ A;  1ZBP A;  4GYW A;  2R5S A;  3ZPJ A;  4N3A A;  2V5F A;  3Q49 B;  3ASD A;  2NC9 A;  5CHE E;  4I1A A;  3AS4 A;  4Y6C A;  5ARG A;  2PL2 A;  5LCW C;  2BUG A;  3RIB A;  3FWV A;  1ELW A;  3GZ1 A;  3GW4 A;  5D0O D;  3MA5 A;  3Q5M A;  4HOQ A;  4GA1 A;  5A6C A;  1NA0 A;  2E2E A;  5FZS A;  3LYA A;  4HOT A;  2AVP A;  2IFU A;  4U07 A;  5KJM A;  4BWR A;  2LNI A;  4U04 A;  2KCL A;  2VYI A;  4GCO A;  1QZ2 A;  1ZU2 A;  3K9I A;  3JYS A;  4U0S A;  4G2V A;  2FEZ A;  3ZHE B;  4AY6 A;  4GYO A;  4WNE A;  5FZR A;  5G05 J;  4BTA A;  5JJ7 A;  3QWV A;  2VQ2 A;  3RU0 A;  3ZN3 A;  1TJC A;  4I9C A;  5FJY A;  3CEQ A;  1W3B A;  3S7D A;  4ME2 A;  3S7J A;  3QWP A;  2VGX A;  4N5C A;  3ASF A;  3LKU A;  5G04 J;  2IF4 A;  3GZ2 A;  3CV0 A;  4KXK B;  2OOE A;  4CGV A;  4BTB A;  2Y4U A;  3N71 A;  3TAX A;  5FT9 A;  4CDR A;  5EKQ D;  2KAT A;  4J8D A;  4ABN A;  4GCN A;  3R9A B;  4G1T A;  3KS2 A;  3FP3 A;  4GPK A;  4AY5 A;  3QKY A;  4XIF A;  4UI9 J;  1P5Q A;  2FF4 A;  3BEE A;  4HOU A;  3SF4 A;  3FFL A;  3OXF A;  4N3B A;  2FI7 A;  2Q7F A;  5HQ8 A;  4KYO B;  4N2S A;  5BW8 C;  3U3W A;  2QFC A;  2UY1 A;  4GA2 A;  4RG6 A;  4LEU A;  4KBQ A;  4WND A;  1B89 A;  1YA0 A;  2L6J A;  3VTX A;  2KCK A;  4N39 A;  2GW1 A;  3ASG A;  3CKB A;  4N3C A;  1ELR A;  2HO1 A;  3ASH A;  3Q47 B;  4BT8 A;  3ZGQ A;  1PC2 A;  2MHK A;  2FO7 A;  5C1D A;  4IN3 B;  5KJN A;  1NZN A;  2XPI A;  2J9Q A;  2KC7 A;  3CVN A;  3QOU A;  4GA0 A;  5DIZ A;  5EX3 A;  4F3V A;  1KLX A;  5D0Q D;  4O6F A;  2XGM A;  4JL0 A;  4J8F A;  2XCB A;  5A7D B;  2VGX B;  3RJV A;  5CCM A;  2UWJ G;  1Y8M A;  3PE3 A;  5FZQ A; 
#chains in the Genus database with same CATH topology
 3LPZ A;  4JEH A;  2DWZ A;  4GTM A;  3HXB A;  4LER A;  1UG3 A;  3C98 A;  5CBO A;  3CHM A;  2PNN A;  4H7X A;  3V30 A;  3PNL B;  4M7C A;  5J90 A;  4XEI G;  3D9I A;  3TWT A;  3HHM A;  1ELK A;  2C0M A;  2WXH A;  4R7L A;  3VTY A;  3V31 A;  1HXI A;  1WY6 A;  3F6Q A;  3S7B A;  1O1T A;  4NQ0 A;  4OVV A;  3Q7F A;  4JD2 G;  3PUK A;  3V2O A;  3CKC A;  2A5U A;  4HS2 A;  2ZGG A;  2J07 A;  3ML8 A;  4F1P A;  4GYY A;  1BLX B;  3ZRH A;  3FY4 A;  3PVL A;  3EU5 A;  4B8A A;  4YDW A;  5DBK A;  4G25 A;  4I2W A;  2ION A;  5D2M C;  3FTY A;  3FEX A;  4GTO A;  3DEP A;  5ARF A;  2VTB A;  3CVP A;  4WNF A;  2J09 A;  4FP7 A;  2I9C A;  4KT6 B;  3NOC D;  1VDY A;  1OWP A;  2GRM A;  4AIF A;  3QWW A;  3ZXP A;  1OT8 A;  3PZ1 A;  4HBD A;  2ETA A;  1OCC E;  5G55 A;  2NSZ A;  2C2L A;  3C3Q A;  1OWM A;  3O4Z A;  4UQX A;  1DVP A;  2J4B A;  2P58 C;  4FAD A;  2VSN A;  4APO A;  3BUA A;  4WWP A;  1WM5 A;  3R9M A;  4BES A;  1AWC B;  3DXM G;  4I9E A;  1SZ9 A;  4OYS A;  1OUV A;  2XCC A;  4KZC A;  1UW4 B;  1FVH A;  3DXK G;  1DCQ A;  3T8M A;  3EIQ C;  1U3D A;  3L9T A;  5EN5 D;  4N5Q A;  3S2A A;  2DCP A;  1FCH A;  5AQ7 A;  3ULQ A;  4UWF A;  2DZN A;  4JB8 P;  3C3O A;  3CK9 A;  4A3T A;  1K8K G;  1HH8 A;  2LSV A;  3Q4A B;  2WQH A;  3APC A;  1WAO 1;  3FUD A;  3PE4 A;  5BXU A;  3CQG B;  3MEK A;  3EHQ A;  2P9L G;  5EID A;  5CBN A;  4XE0 A;  4A63 B;  4U8H A;  4YVQ C;  4UWK A;  2WXP A;  4F1S A;  3C3R A;  2I6H A;  2R03 A;  3FH7 A;  3HVE A;  3JQ0 A;  1D8D A;  5EIL A;  5JJ6 A;  3P1U A;  4O1O A;  4UWG A;  2OVB A;  1IHG A;  4U0Z A;  4J7W A;  3KD7 A;  4HLE A;  3E4B A;  3AG2 E;  1BI8 B;  3CVQ A;  3PS6 A;  4HRL A;  5E75 A;  5KWD A;  2HM8 A;  5AJD A;  2R5S A;  4N3A A;  3AG1 E;  3CIA A;  3FTU A;  4L1B A;  4U95 D;  3CGH A;  3ZYQ A;  4CDN A;  2FO1 E;  4LG6 A;  2NC9 A;  5CHE E;  2XZT G;  2IO3 C;  4I1A A;  1YMP A;  4K5C A;  4BY6 A;  3AS4 A;  1HE8 A;  5ARG A;  4FHJ A;  4MKT A;  4HB5 A;  1EYH A;  4X8Q A;  4FUL A;  2GGF A;  4AXH A;  3GZ1 A;  4DLO A;  3SFY A;  4DX7 D;  4LSZ E;  2E2E A;  3FUK A;  5FZS A;  3CHR A;  3IXE A;  5ENT D;  2RKK A;  2OVF A;  3LYA A;  1X81 A;  4U07 A;  5LP0 A;  2GRQ B;  5EDS A;  2B0O E;  4GCO A;  2WXO A;  3NAW A;  3JYS A;  2BKK B;  1MZC A;  2XEN A;  2Y69 E;  3ISM C;  3RK6 A;  3UIP C;  2L6B A;  4WNE A;  2MYO A;  3CVU A;  4BTA A;  3D9J A;  2ZXW E;  3CEQ A;  1OWO A;  3S7D A;  3W9G A;  4XKC A;  4ME2 A;  2MOW A;  2VGX A;  3CVW A;  3HXF A;  2DVW A;  3ASF A;  4ACL A;  2IF4 A;  3WG7 E;  3ESL A;  2Y4U A;  5B3S E;  2WMN A;  2CFZ A;  3TAX A;  3GZS A;  3LVR E;  5EKQ D;  4ABN A;  3TWS A;  1H2T C;  4LNU D;  1JPL A;  4AP2 A;  3FP3 A;  3UT8 A;  2P9U G;  4A55 A;  1SVX A;  4GB9 A;  4UI9 J;  4DX2 A;  5ENR D;  2B6C A;  2BED A;  3DEO A;  4YDY A;  3SF4 A;  3DRA A;  2Q7F A;  4B8C B;  2F0Y A;  3DSU A;  1N54 A;  4FLB A;  2Y3A A;  2R02 A;  5BW8 C;  2H6H A;  2XQ0 A;  5FQ4 A;  4HRM B;  1E90 A;  2IJG X;  3U3W A;  2WXM A;  3RRM B;  4KBQ A;  4OAU C;  4WND A;  1EF1 C;  2X6F A;  1B89 A;  1UN9 A;  2KCK A;  4K03 A;  1UJK A;  3ZUV B;  3AU5 A;  3CKB A;  4WWO A;  2HO1 A;  1TN7 A;  2IOS A;  4BT8 A;  2MHK A;  2FO7 A;  2V0P A;  4ATG A;  2J9Q A;  2KC7 A;  3NQP A;  5D0Q D;  1K1B A;  4NUR A;  3PZ3 A;  3PEV B;  4GAA A;  1BPO A;  3SFZ A;  3QB2 A;  1Y8M A;  3MJW A;  4K5B A;  4C48 B;  3Q9U C;  3FUJ A;  4WWN A;  4Q96 A;  1QBQ A;  3U66 A;  3SD5 A;  2QC9 A;  1UOH A;  1JCS A;  3LY7 A;  5LFA A;  2WB2 A;  1TN8 A;  1ZB1 A;  3DSV A;  4HOR A;  2X6H A;  5D66 A;  3UXG A;  4ANV A;  5AIJ A;  1JCR A;  4RG9 A;  4YND A;  4UI9 K;  4TXR A;  1H6P A;  1NI1 A;  2PQN A;  5G05 C;  3JUI A;  3LS8 A;  4URK A;  2OEV A;  3UIN C;  3ZYM A;  3FTZ A;  3PDN A;  3QK0 A;  4NIK A;  3CVL A;  4XX5 A;  3CHQ A;  4J0U A;  1FT2 A;  2XGO A;  4MLP A;  2JAB A;  4L23 A;  3FU5 A;  3NBN B;  3D9K A;  4OVU A;  1IHB A;  3CVY A;  1IKN D;  5LCW J;  4FA6 A;  1Z6T A;  3CK7 A;  2P9P G;  3W9F A;  3S7F A;  2EIL E;  5CRU A;  4MBG A;  5A23 A;  3UT7 A;  5FQ6 A;  2HE0 A;  4BFR A;  3B7U X;  5KBA A;  4GU5 A;  4G24 A;  1K3Z D;  1HZ4 A;  3ZFW A;  1O1R A;  5ENS D;  4BEP A;  2GRP B;  1X5B A;  4HI8 A;  4UWL A;  4LUN U;  1OCZ E;  4J8S A;  4YDO A;  3DSW A;  4LRZ A;  3B7T A;  4HNA D;  5KNG A;  1SA5 A;  1Z3Y A;  1A5E A;  3MV3 B;  3UPV A;  3HYM B;  1MX4 A;  4YVO A;  3HG0 D;  3UTM A;  4CT4 A;  1PY1 A;  5ENN A;  1N11 A;  4JC8 A;  2H6G A;  2WPV A;  3T9K A;  4PUC A;  2WXQ A;  1O1S A;  3D3M A;  4DRX E;  2CHX A;  3B95 A;  2JEK A;  3KSL A;  3TG4 A;  3TXN A;  3OXG A;  1YYH A;  5FWQ A;  3ESK A;  1H6O A;  2C0L A;  2V5Q C;  1QQE A;  3MKQ B;  2KZT A;  2R05 A;  1WG0 A;  3LY9 A;  3ZHE A;  3GYZ A;  4GTS A;  3HVE B;  1IQU A;  3IEG A;  4W9R A;  4DX1 A;  4J6I A;  1TEZ A;  3AU4 A;  3CK8 A;  3ZYL A;  2X6J A;  4A1S A;  3CHS A;  3TWX A;  4ANU A;  3G2W A;  3ZKJ A;  4EPZ A;  3LVQ E;  3VLE A;  1OY3 D;  1SZA A;  1JCQ A;  4JHR A;  2EQX A;  4HI9 A;  3TGO A;  2XPY A;  2PQR A;  3B13 A;  3MKR A;  5FTP A;  2CHZ A;  2P9N G;  5AJL A;  1E7V A;  2L9B A;  2QYU A;  1OWL A;  1HO8 A;  1BU9 A;  4HXI A;  2V5F A;  2F37 A;  3Q49 B;  1HU3 A;  3FDH A;  3L22 A;  2IOL A;  1TNY A;  4A1G A;  5LX8 A;  4G8L A;  2L0T B;  5EYL A;  2XZD G;  3GW4 A;  3C5R A;  5D0O D;  1TJF A;  2LUH A;  3Q5M A;  1IXV A;  4GA1 A;  3MGB A;  4I6J A;  2H6F A;  3CHP A;  4HOT A;  1U2V G;  1H2V C;  4BWR A;  1JWF A;  1EPU A;  2P9I G;  2VYI A;  2I2O A;  1QZ2 A;  4U0S A;  3NZS A;  4G2V A;  3TWR A;  3R7R A;  2BTD A;  4C0M A;  1SQM A;  5JHB A;  1HG2 A;  4GTQ A;  3CVV A;  4GYO A;  4AY6 A;  4G8K A;  3ZEF A;  3QWV A;  3ZN3 A;  4JHK A;  3AJI A;  4PH4 B;  4I9C A;  4FHK A;  4NAC A;  1S63 A;  3QWP A;  4F7A A;  1H0A A;  1MX6 A;  3CSF A;  4YDE A;  4CGV A;  1O5M A;  3FU3 A;  2WVI A;  5BXO A;  2KAT A;  1NP7 A;  2CHW A;  3J5Q B;  3KS2 A;  3ZYK A;  3DBS A;  3UX4 A;  1HG5 A;  3T5X A;  2Y0B G;  3HDX A;  3LEW A;  4FJY A;  4U8V D;  3PUJ A;  4E85 A;  3AAA C;  2FF4 A;  4RQI A;  2WXI A;  3FFL A;  3MZL B;  4RSY A;  4KYO B;  4Q94 A;  3DSX A;  4EZK A;  3EHM A;  5BV0 A;  3E30 A;  3ZW3 A;  2L6J A;  4GZD A;  3G2T A;  2WXR A;  3D9O A;  2GW1 A;  3PZD A;  3TWQ A;  3ASH A;  4LNB A;  3ZGQ A;  4GZC A;  4U8Y D;  3VLF A;  1EDU A;  3QOU A;  4GA0 A;  2ETB A;  5DIZ A;  5T3R A;  1KLX A;  5AEN A;  2XCB A;  5C2Y A;  2UWJ G;  2IU1 A;  4B0Z A;  3MCX A;  3ENE A;  4IRU A;  1RZ4 A;  2V4H C;  2GRL A;  3Q75 A;  1D8E A;  2ZGD A;  2WM9 A;  2DBA A;  4ANX A;  1HS6 A;  1LD7 A;  2ETC A;  2PM7 A;  3Q15 A;  3OAW A;  3R7Q A;  5HS0 A;  3APF A;  1H19 A;  2LSU A;  3B7R L;  3EDT B;  5CRV A;  3TJP A;  3SBS A;  1DCE A;  3AG4 E;  2VGY A;  4CEM A;  3IV0 A;  3E32 A;  4DI3 A;  4CYM D;  2R59 A;  1S0P A;  3HXD A;  4RVB A;  4APF A;  1KT1 A;  4WNG A;  2X3M A;  4ILI A;  4UQY A;  2HYZ A;  4GZ5 A;  3LJ3 A;  3O48 A;  4GZ3 A;  3FEY A;  4BX9 A;  3U9W A;  5G04 C;  1N4R A;  3FUF A;  5KNH D;  2KXP C;  1XNF A;  2UY1 B;  1E8Y A;  4I1M A;  5EX0 A;  3G2S A;  3FUN A;  5AYW D;  3UUX A;  3UKR G;  4BT9 A;  1N0Q A;  4I6G A;  4G23 A;  3FU6 A;  1DNP A;  3QNK A;  2Y4T A;  3URZ A;  3UT4 A;  3BQO A;  3UKU G;  3I5P A;  4F6R D;  5CMW A;  2PZI A;  2CG3 A;  3BG1 B;  3RSE G;  3AS5 A;  2DIW A;  3SO8 A;  2XEE A;  2XEV A;  4DLQ A;  2XS8 A;  3E34 A;  3TWV A;  3AS8 A;  2M63 A;  4TRQ A;  3L82 A;  3LY8 A;  3ABM E;  3Q79 A;  3PZ4 A;  4KVO A;  4J8Y A;  4DUI A;  1Z5S C;  2WXN A;  2GRO B;  5HI7 A;  1Y6I A;  4V3I A;  3SI5 A;  1SW6 A;  2RD0 A;  1E96 B;  1N94 A;  4Z68 A;  3QDN A;  3AG3 E;  4AV7 A;  2V4L A;  3D9N A;  4L2L A;  1S70 B;  4P29 A;  3FH8 A;  4BET A;  2AXU A;  3ZIM A;  5CEC B;  5AAO A;  1PAQ A;  2QZA A;  4HFG A;  4GPM A;  3HIZ A;  1JWG A;  4FC8 A;  4AM9 A;  4UQZ A;  2V8S E;  5FQ8 A;  2WQ7 A;  3T8K A;  2QYJ A;  3VLD A;  2AXV A;  4TXQ A;  3IHV A;  2XRZ A;  5CED B;  4L7T A;  2J49 A;  5FQ7 A;  4GTT A;  3UM3 A;  2BF0 X;  2VTB B;  4HOS A;  1INZ A;  2J08 A;  1QNF A;  2YHC A;  4GTV A;  4HVB A;  2NYJ A;  5ANR A;  2VSY A;  2WMO A;  5KCM A;  4Q69 A;  3RO3 A;  3ZVV A;  5H7P A;  5JMN D;  3ZPJ A;  2GRR B;  1XGW A;  2AXZ A;  4CRW A;  2OEW A;  2LXM A;  2OV8 A;  4C0E A;  3FUE A;  4KZ0 A;  4F53 A;  2I1K A;  1K1A A;  4O1P A;  4GML A;  3ONL A;  3QAR A;  3JXJ A;  3ML9 A;  2BUG A;  2RFM A;  4IUL A;  4ZHB A;  3PRZ A;  3MA5 A;  3B7S A;  1GW6 A;  5A6C A;  2YHE A;  2BKG A;  4UUC A;  2AVP A;  2EIN E;  3D9L A;  2WQ6 A;  5KJM A;  3EHN A;  3SBT B;  4DI4 A;  2P9K G;  4DPR A;  3L16 A;  5ENP D;  4U04 A;  3X2Q E;  1ZU2 A;  4BX8 A;  3FTS A;  4JHJ A;  2RFA A;  2FEZ A;  2IY0 C;  4HRN A;  3ZXS A;  5FZR A;  5G05 J;  2J8S D;  1YCS B;  2VQ2 A;  2IQC A;  4EHM A;  4AJW A;  1Q2Z A;  1TJC A;  5FJY A;  3RAU A;  4DX6 D;  1W3B A;  1TNB A;  3JUE A;  3S7J A;  5AAR A;  2XPZ A;  5FIO A;  3APD A;  3L54 A;  1SA4 A;  3GZ2 A;  3CV0 A;  5EYP F;  2OOE A;  5CER B;  5T8I A;  5FT9 A;  5BV1 A;  2ILR A;  4G1T A;  3L08 A;  4GPK A;  3EU9 A;  3QKY A;  4KVM A;  3OTN A;  2AWI A;  1FT1 A;  2F8X K;  4XIF A;  4U7E B;  4XZ4 A;  4JVS A;  4HOU A;  3PEU B;  3OXF A;  4N3B A;  4BSZ B;  5ITZ F;  4DJA A;  4N2S A;  4JZY A;  3CHO A;  2IEJ A;  4PS8 A;  4MS6 A;  3G2U A;  1HF8 A;  4L2Y A;  2GRN B;  1E8Z A;  1Z3X A;  2QFC A;  2R17 C;  4GA2 A;  3PNT B;  4LEU A;  3FTV A;  2P2C P;  1OCO E;  3HXE A;  4N39 A;  1MHQ A;  5T4Y A;  3ASG A;  3UM0 A;  1N95 A;  3B7B A;  5EIB E;  3Q47 B;  3FHE A;  1PC2 A;  2WXJ A;  5C1D A;  4IN3 B;  5KJN A;  4TUU A;  4QQI A;  3CQC B;  3L6A A;  3KEZ A;  2AJA A;  2XPI A;  1FPP A;  4B93 B;  3CVN A;  4ATZ D;  3T5V A;  3ULE G;  1MYO A;  5G2N A;  3LJN A;  3RRN B;  4O6F A;  2VGE A;  2XGM A;  4J8F A;  5A7D B;  2VGX B;  5CCM A;  1N0R A;  4BER A;  3PE3 A;  3DPD A;  3FTX A;  3V2X A;  5HRY A;  3L13 A;  3JQ1 A;  3UQ3 A;  3ONK A;  3E37 A;  4CCA A;  2X38 A;  4KMO A;  2LO6 A;  3G2V A;  4LCT A;  3ABL E;  3QC1 A;  3LCA A;  3RKV A;  4EZJ A;  5M72 A;  2OND A;  5KJL A;  4PS7 A;  4PS3 A;  3SNX A;  3TG5 A;  4J8E A;  1E8X A;  3D9H A;  3I3N A;  2E0I A;  4H7Y A;  4OAV B;  3FTW A;  2VJ8 A;  5FIN A;  4D10 C;  1QYM A;  1A17 A;  4U63 A;  4PDX A;  1D9S A;  3PH0 C;  1KT0 A;  3FH5 A;  1E7U A;  5CCL A;  3KEA A;  2DYR E;  5IY5 E;  1MJ0 A;  2ZU6 B;  2Y1L E;  2IO2 C;  3MKQ A;  4JA7 A;  1IYG A;  2JLB A;  4GTP A;  4JA9 A;  1TYQ G;  1G3N B;  3EUV A;  3SZ7 A;  4JXT A;  5ENO D;  3KAE A;  5LOZ A;  3HXC A;  4G26 A;  3UM1 A;  1OXJ A;  2PM6 A;  1AP7 A;  3FUL A;  2WXF A;  3EHR A;  4GMR A;  4N2Q A;  2CFU A;  3IBE A;  4EZL A;  2A4Z A;  2XRY A;  2KM4 A;  2EIJ E;  4WUY A;  1E8W A;  4NRH B;  1N4Q A;  1LF8 A;  4UI9 C;  4I6E A;  3NF1 A;  4U0U A;  2LXL A;  5B1B E;  3MYV A;  2EIM E;  3OXL A;  2X6K A;  3MV2 B;  1S64 A;  5BT1 A;  3Q9N C;  4ANW A;  2VSX E;  3RRU A;  4Y6W A;  4WAF A;  3I4G A;  2P9S G;  3RO2 A;  3UM2 A;  5E76 A;  2YIN A;  4JPS A;  4DK5 A;  1FVF A;  4M3O A;  1H6K A;  5KJK A;  2DZO A;  4I17 A;  1TN6 A;  4GZ6 A;  2MRI A;  2R2L A;  4XKB A;  5CMY A;  3ZU7 B;  2FUL A;  4B94 A;  3PZ2 A;  3WXX A;  2ZIR A;  4FU3 A;  3U4T A;  3DST A;  3D9M A;  1N9A A;  2I1J A;  2XHE A;  3CLJ A;  2QY7 A;  2KCV A;  3TWU A;  2XGS A;  5JJT A;  4XI9 A;  1H2U A;  4JW1 A;  3LDZ A;  4K5A B;  3UMV A;  2YNQ A;  1RW2 A;  1KZO A;  3SY2 A;  2H6I A;  4UWH A;  2WXK A;  3SHF A;  3FUI A;  3D9P A;  1U3C A;  2HR2 A;  1V54 E;  2YQ8 A;  4CGW A;  1V55 E;  1NL4 A;  2J4D A;  4G11 A;  3ABK E;  3P2B A;  3DPY A;  3QJZ A;  5ENQ D;  4FJZ A;  4AVX A;  2ZIS A;  4EEC A;  3IKO B;  3ASN E;  3CR3 A;  3E33 A;  2X6I A;  1OCR E;  4U96 D;  4TV3 A;  4EQF A;  4GMJ A;  1NA3 A;  5AQB A;  2FBN A;  4I2Z A;  4XI0 A;  5BNW A;  1MQS A;  3SFX A;  1ZBP A;  4GYW A;  2OCC E;  2CG2 A;  3ULY A;  4GTR A;  4E6H A;  4HLL A;  1WDY A;  3FUM A;  3Q7A A;  1TNZ A;  2XEH A;  3IHY A;  2XS1 A;  3ASD A;  4TUM A;  1HFA A;  3DSS A;  3CST A;  3UIO C;  3EJN A;  4Y6C A;  3QAQ A;  5B1A E;  2PL2 A;  5LCW C;  3DWL G;  4ILG A;  3RIB A;  3FWV A;  1ELW A;  5BPP A;  1MX2 A;  4BSX A;  1JUQ A;  1UJJ A;  4I43 A;  2KBX A;  4HOQ A;  1NA0 A;  3I4R B;  4K0R A;  3SQV A;  1KPS B;  1DC2 A;  2IFU A;  2LNI A;  1BI7 B;  2KCL A;  3V79 K;  3K9I A;  4MRU A;  1TNU A;  3NB2 A;  3ASO E;  3CVX A;  2F8Y A;  2KZT B;  4EBA A;  3L17 A;  2L0I A;  3KSQ A;  3LXU X;  3ZHE B;  4ACK A;  1BD8 A;  2WXL A;  1NFI E;  5JJ7 A;  3RU0 A;  3U64 A;  4FLH A;  4QFV A;  1L5J A;  4N5C A;  1LD8 A;  4C9B B;  2VSO E;  5ANL A;  3LKU A;  4B89 A;  5G04 J;  1OWN A;  4KXK B;  3FU0 A;  3EIJ A;  4BTB A;  1N4P A;  2EIK E;  4EBA G;  3N71 A;  5CEA A;  4CDR A;  3ZNG A;  4AOF A;  4J8D A;  4GCN A;  4RLY A;  3JXI A;  3R9A B;  2RG8 A;  3SGH A;  2NXP A;  4AY5 A;  3JCK C;  5AQ9 A;  3C72 A;  1TR4 A;  4ZFH A;  1P5Q A;  3FUH A;  2A5E A;  3TXM A;  5HKP A;  3BEE A;  1N4S A;  4L9P A;  2DYS E;  2FI7 A;  4ILH B;  4JEU A;  2LAH A;  1TNO A;  4CDM A;  3BG0 B;  5HQ8 A;  3HRA A;  4LNG A;  5JA4 D;  4CT0 A;  2UY1 A;  4I1O B;  4RG6 A;  4O60 A;  3TWW A;  3NZU A;  3TL5 A;  3NOG D;  4AEZ C;  5JHA A;  1YA0 A;  5BUZ A;  3VTX A;  4IYP A;  1KZP A;  2WXG A;  4N3C A;  4CZ2 D;  5J08 A;  1ELR A;  1N52 A;  3Q73 A;  3J5P A;  1NZN A;  4TXP A;  2LAI A;  3UI2 A;  1UN8 A;  5EX3 A;  4F3V A;  1IQR A;  3MX3 A;  4A3V A;  1HX8 A;  5AQA A;  4JL0 A;  3BU8 A;  2AW6 A;  4DX5 D;  3RJV A;  4HQD A;  1LTX A;  3Q78 A;  5AN8 A;  3PRE A;  5FZQ A; 
#chains in the Genus database with same CATH homology
 2GRL A;  3L13 A;  3JQ1 A;  3LPZ A;  3UQ3 A;  3ONK A;  3FUJ A;  4JEH A;  4CCA A;  2X38 A;  4KMO A;  4WWN A;  4Q96 A;  2WM9 A;  4LER A;  1UG3 A;  2LO6 A;  3C98 A;  2DBA A;  3G2V A;  3MJW A;  4LCT A;  3SD5 A;  3QC1 A;  4ANX A;  3LCA A;  3RKV A;  1HS6 A;  3LY7 A;  5LFA A;  2WB2 A;  3CHM A;  4H7X A;  4EZJ A;  5M72 A;  3PNL B;  2OND A;  5KJL A;  5J90 A;  2PM7 A;  3Q15 A;  3OAW A;  3R7Q A;  4HOR A;  3APF A;  4PS7 A;  4PS3 A;  3SNX A;  3TG5 A;  2X6H A;  4ANV A;  3D9I A;  4J8E A;  1E8X A;  3HHM A;  5AIJ A;  1ELK A;  1H19 A;  2LSU A;  3I3N A;  3B7R L;  2E0I A;  2C0M A;  3EDT B;  2WXH A;  4RG9 A;  3TJP A;  3SBS A;  4YND A;  4H7Y A;  2VGY A;  4CEM A;  3FTW A;  4UI9 K;  3IV0 A;  4R7L A;  2VJ8 A;  3VTY A;  4D10 C;  4DI3 A;  1A17 A;  1HXI A;  2PQN A;  4PDX A;  4U63 A;  3JUI A;  5G05 C;  3LS8 A;  1WY6 A;  2R59 A;  3S7B A;  4URK A;  4NQ0 A;  4OVV A;  3ZYM A;  3FTZ A;  3PH0 C;  3PDN A;  1KT0 A;  3QK0 A;  1S0P A;  3CVL A;  3FH5 A;  3PUK A;  1E7U A;  4RVB A;  4XX5 A;  1KT1 A;  4APF A;  5CCL A;  4WNG A;  2X3M A;  4ILI A;  3CHQ A;  3CKC A;  4UQY A;  2A5U A;  4HS2 A;  4J0U A;  2HYZ A;  2J07 A;  3ML8 A;  2ZU6 B;  2XGO A;  4GZ5 A;  4GYY A;  3LJ3 A;  3ZRH A;  3O48 A;  4GZ3 A;  3MKQ A;  3FEY A;  4BX9 A;  4MLP A;  3FY4 A;  5G04 C;  3U9W A;  3PVL A;  4JA7 A;  4L23 A;  3U66 A;  2JLB A;  4JA9 A;  1IYG A;  3FUF A;  4B8A A;  3FU5 A;  1XNF A;  3D9K A;  2UY1 B;  3SZ7 A;  5DBK A;  4JXT A;  1E8Y A;  4OVU A;  4I1M A;  3KAE A;  4G25 A;  4I2W A;  3G2S A;  5EX0 A;  5LOZ A;  4G26 A;  3CVY A;  2ION A;  2PM6 A;  3FUN A;  3FTY A;  3FUL A;  3FEX A;  2WXF A;  5LCW J;  4FA6 A;  5AYW D;  5ARF A;  1Z6T A;  2VTB A;  4N2Q A;  2CFU A;  3CVP A;  3CK7 A;  3IBE A;  3MCX A;  2J09 A;  4WNF A;  4EZL A;  2A4Z A;  3UUX A;  2XRY A;  2KM4 A;  4FP7 A;  2I9C A;  4KT6 B;  4WUY A;  3S7F A;  4BT9 A;  4I6G A;  4G23 A;  1E8W A;  5A23 A;  4NRH B;  3FU6 A;  1DNP A;  3UT7 A;  3QNK A;  5FQ6 A;  1LF8 A;  2Y4T A;  3URZ A;  4BFR A;  3B7U X;  3UT4 A;  4GU5 A;  1VDY A;  4UI9 C;  4I6E A;  3I5P A;  4G24 A;  5CMW A;  2PZI A;  1OWP A;  2GRM A;  3NF1 A;  1HZ4 A;  2CG3 A;  3BG1 B;  4U0U A;  3ZFW A;  4AIF A;  3AS5 A;  3MYV A;  3OXL A;  2DIW A;  2X6K A;  3QWW A;  3MV2 B;  5BT1 A;  4ANW A;  1X5B A;  2VSX E;  3RRU A;  4Y6W A;  4WAF A;  3I4G A;  2XEV A;  3RO2 A;  5E76 A;  4DLQ A;  4UWL A;  4LUN U;  3AS8 A;  4J8S A;  2YIN A;  5G55 A;  2M63 A;  4JPS A;  4TRQ A;  2NSZ A;  2C2L A;  4DK5 A;  3LY8 A;  1FVF A;  4M3O A;  1OWM A;  3O4Z A;  4UQX A;  1DVP A;  1H6K A;  4KVO A;  4LRZ A;  5KJK A;  2J4B A;  3B7T A;  4I17 A;  2P58 C;  4FAD A;  2VSN A;  4APO A;  4GZ6 A;  2WXN A;  1Z3Y A;  2MRI A;  4WWP A;  1WM5 A;  3MV3 B;  3UPV A;  3HYM B;  5HI7 A;  1Y6I A;  4V3I A;  4XKB A;  4YVO A;  3SI5 A;  4I9E A;  1SZ9 A;  2RD0 A;  4CT4 A;  4OYS A;  1E96 B;  1PY1 A;  5ENN A;  4JC8 A;  1OUV A;  2WPV A;  2XCC A;  3QDN A;  4KZC A;  1UW4 B;  2FUL A;  5CMY A;  4B94 A;  4AV7 A;  3WXX A;  4PUC A;  1FVH A;  2V4L A;  2WXQ A;  3D3M A;  3T8M A;  3EIQ C;  2CHX A;  1U3D A;  3D9N A;  4L2L A;  3S2A A;  2DCP A;  1FCH A;  4P29 A;  3FH8 A;  4FU3 A;  3U4T A;  2JEK A;  3ULQ A;  3D9M A;  4UWF A;  2AXU A;  3ZIM A;  3CK9 A;  4A3T A;  1PAQ A;  2I1J A;  1HH8 A;  2LSV A;  2XHE A;  3CLJ A;  3Q4A B;  2WQH A;  3TG4 A;  2QY7 A;  3APC A;  4HFG A;  1WAO 1;  3TXN A;  3OXG A;  3FUD A;  2KCV A;  5FZQ A;  5FWQ A;  3HIZ A;  2XGS A;  3PE4 A;  5JJT A;  3ESK A;  1JWG A;  4FC8 A;  4AM9 A;  4XI9 A;  4UQZ A;  1H2U A;  2V8S E;  4JW1 A;  3LDZ A;  5FQ8 A;  3CQG B;  3UMV A;  2WQ7 A;  2C0L A;  2YNQ A;  3MEK A;  1QQE A;  3MKQ B;  2KZT A;  3VLD A;  4UWH A;  2AXV A;  2WXK A;  3SHF A;  3FUI A;  3IHV A;  3D9P A;  3LY9 A;  3GYZ A;  3ZHE A;  1U3C A;  2HR2 A;  4XE0 A;  2XRZ A;  3HVE B;  1IQU A;  4L7T A;  2J49 A;  3IEG A;  2YQ8 A;  4CGW A;  4W9R A;  2J4D A;  5FQ7 A;  4U8H A;  4J6I A;  4G11 A;  3P2B A;  4YVQ C;  1TEZ A;  3AU4 A;  4UWK A;  3QJZ A;  3CK8 A;  3ZYL A;  2X6J A;  4A1S A;  2WXP A;  3CHS A;  2BF0 X;  4FJZ A;  4F1S A;  2VTB B;  4HOS A;  1INZ A;  2J08 A;  2I6H A;  4AVX A;  4ANU A;  3G2W A;  1QNF A;  3FH7 A;  4EPZ A;  2YHC A;  4HVB A;  3HVE A;  3LVQ E;  4EEC A;  3IKO B;  3VLE A;  5ANR A;  3JQ0 A;  1SZA A;  3CR3 A;  2VSY A;  2X6I A;  5JJ6 A;  2WMO A;  3P1U A;  4JHR A;  5KCM A;  4UWG A;  2OVB A;  2EQX A;  1IHG A;  4U0Z A;  4TV3 A;  4EQF A;  3TGO A;  4GMJ A;  2XPY A;  1NA3 A;  2PQR A;  3KD7 A;  2FBN A;  4Q69 A;  4HLE A;  4I2Z A;  3RO3 A;  4XI0 A;  3B13 A;  3E4B A;  3ZVV A;  3MKR A;  5FTP A;  5BNW A;  2CHZ A;  1MQS A;  3CVQ A;  1ZBP A;  3PS6 A;  4GYW A;  5E75 A;  2HM8 A;  5AJD A;  2R5S A;  3ZPJ A;  1XGW A;  5AJL A;  4N3A A;  2CG2 A;  1E7V A;  2AXZ A;  4CRW A;  2L9B A;  3CIA A;  3FTU A;  2OV8 A;  4L1B A;  4C0E A;  4E6H A;  1OWL A;  1HO8 A;  3FUE A;  4KZ0 A;  3CGH A;  3FUM A;  4F53 A;  2I1K A;  3ZYQ A;  4HXI A;  3IHY A;  4CDN A;  2V5F A;  3Q49 B;  3ASD A;  1HU3 A;  1HFA A;  4GML A;  2NC9 A;  5CHE E;  3FDH A;  3L22 A;  4I1A A;  3CST A;  4BY6 A;  3AS4 A;  2IOL A;  3EJN A;  4Y6C A;  3ONL A;  3QAQ A;  3QAR A;  1HE8 A;  5ARG A;  4A1G A;  4FHJ A;  3ML9 A;  4MKT A;  2PL2 A;  5LCW C;  4ILG A;  2BUG A;  1EYH A;  3RIB A;  5LX8 A;  3FWV A;  1ELW A;  2GGF A;  4FUL A;  4AXH A;  5BPP A;  3GZ1 A;  2L0T B;  4BSX A;  4DLO A;  1JUQ A;  1UJJ A;  4IUL A;  3PRZ A;  3GW4 A;  4I43 A;  5D0O D;  3MA5 A;  1TJF A;  3B7S A;  3Q5M A;  1GW6 A;  4HOQ A;  4GA1 A;  5A6C A;  1NA0 A;  2YHE A;  3MGB A;  2E2E A;  3I4R B;  3FUK A;  4I6J A;  4K0R A;  5FZS A;  3CHR A;  3CHP A;  2OVF A;  3LYA A;  4HOT A;  2AVP A;  2IFU A;  3D9L A;  2WQ6 A;  1H2V C;  4U07 A;  5KJM A;  3EHN A;  3SBT B;  1JWF A;  4BWR A;  4DI4 A;  5LP0 A;  2LNI A;  4DPR A;  3L16 A;  1EPU A;  5EDS A;  4U04 A;  2KCL A;  2VYI A;  4GCO A;  2I2O A;  1QZ2 A;  1ZU2 A;  2WXO A;  3K9I A;  4MRU A;  4BX8 A;  3JYS A;  3FTS A;  4U0S A;  4JHJ A;  3NZS A;  4G2V A;  3R7R A;  3CVX A;  2BTD A;  4C0M A;  2FEZ A;  1SQM A;  2KZT B;  5JHB A;  4EBA A;  3L17 A;  1HG2 A;  2L0I A;  3LXU X;  3RK6 A;  3ZHE B;  4ACK A;  4GYO A;  3ZXS A;  3CVV A;  4AY6 A;  4WNE A;  5FZR A;  5G05 J;  2WXL A;  3ZEF A;  3CVU A;  4BTA A;  5JJ7 A;  3QWV A;  3D9J A;  2VQ2 A;  3RU0 A;  3ZN3 A;  4JHK A;  2IQC A;  4AJW A;  3U64 A;  4PH4 B;  4FLH A;  1TJC A;  4QFV A;  4I9C A;  5FJY A;  3CEQ A;  1OWO A;  4FHK A;  1W3B A;  4NAC A;  3S7D A;  4XKC A;  4ME2 A;  3S7J A;  2XPZ A;  2MOW A;  1L5J A;  2VGX A;  3APD A;  3QWP A;  4N5C A;  3CVW A;  4F7A A;  4C9B B;  2VSO E;  1H0A A;  3L54 A;  5ANL A;  3ASF A;  3LKU A;  4ACL A;  4B89 A;  5G04 J;  3CSF A;  2IF4 A;  1OWN A;  3CV0 A;  3GZ2 A;  4KXK B;  2OOE A;  3FU0 A;  3EIJ A;  4CGV A;  3ESL A;  4BTB A;  2Y4U A;  2WMN A;  4EBA G;  2CFZ A;  3FU3 A;  3N71 A;  3TAX A;  2WVI A;  3GZS A;  3LVR E;  5T8I A;  5FT9 A;  4CDR A;  5EKQ D;  5BV1 A;  4AOF A;  2KAT A;  4J8D A;  4ABN A;  4GCN A;  1NP7 A;  1H2T C;  2CHW A;  1JPL A;  3R9A B;  2RG8 A;  2ILR A;  4AP2 A;  4G1T A;  3KS2 A;  3L08 A;  3ZYK A;  3DBS A;  3FP3 A;  3SGH A;  3UT8 A;  3UX4 A;  1HG5 A;  2NXP A;  4A55 A;  3T5X A;  4GPK A;  4AY5 A;  3QKY A;  3HDX A;  3JCK C;  4KVM A;  3OTN A;  2AWI A;  3LEW A;  4FJY A;  4GB9 A;  4XIF A;  4UI9 J;  1P5Q A;  3PUJ A;  4E85 A;  4XZ4 A;  3FUH A;  2FF4 A;  3TXM A;  4JVS A;  3BEE A;  4HOU A;  3SF4 A;  2WXI A;  3FFL A;  3MZL B;  3PEU B;  3OXF A;  4ILH B;  2FI7 A;  4N3B A;  4JEU A;  2LAH A;  2Q7F A;  4B8C B;  4DJA A;  4CDM A;  3BG0 B;  4RSY A;  5HQ8 A;  4KYO B;  4N2S A;  4Q94 A;  4JZY A;  3CHO A;  1N54 A;  4FLB A;  2Y3A A;  4PS8 A;  4MS6 A;  5BW8 C;  2XQ0 A;  5FQ4 A;  4EZK A;  3G2U A;  1E90 A;  2IJG X;  1HF8 A;  4L2Y A;  1E8Z A;  3U3W A;  1Z3X A;  2QFC A;  2R17 C;  4CT0 A;  2UY1 A;  3EHM A;  2WXM A;  4GA2 A;  4I1O B;  4RG6 A;  5BV0 A;  3RRM B;  3PNT B;  4LEU A;  3NZU A;  4KBQ A;  3TL5 A;  4WND A;  1EF1 C;  4AEZ C;  3FTV A;  2X6F A;  1B89 A;  3ZW3 A;  5JHA A;  1YA0 A;  1UN9 A;  2L6J A;  5BUZ A;  3VTX A;  2KCK A;  4GZD A;  4IYP A;  4K03 A;  4N39 A;  1MHQ A;  1UJK A;  3G2T A;  2WXR A;  3D9O A;  5T4Y A;  2GW1 A;  3PZD A;  3ASG A;  2WXG A;  3AU5 A;  3CKB A;  4N3C A;  5J08 A;  1ELR A;  1N52 A;  4WWO A;  2HO1 A;  3ASH A;  2IOS A;  3Q47 B;  3FHE A;  4BT8 A;  3ZGQ A;  4GZC A;  1PC2 A;  2WXJ A;  2MHK A;  2FO7 A;  5C1D A;  4IN3 B;  5KJN A;  1NZN A;  4TUU A;  3CQC B;  2V0P A;  2LAI A;  3KEZ A;  3L6A A;  4ATG A;  3VLF A;  1EDU A;  2J9Q A;  2KC7 A;  2XPI A;  3CVN A;  1UN8 A;  3QOU A;  4GA0 A;  3PE3 A;  5DIZ A;  3T5V A;  5T3R A;  5EX3 A;  5G2N A;  4F3V A;  1IQR A;  1KLX A;  3NQP A;  3RRN B;  3MX3 A;  5D0Q D;  4O6F A;  4A3V A;  1HX8 A;  2XGM A;  4NUR A;  4JL0 A;  4J8F A;  5AEN A;  2AW6 A;  2XCB A;  5A7D B;  3PEV B;  4GAA A;  2VGX B;  3RJV A;  5C2Y A;  1BPO A;  3SFZ A;  5CCM A;  3QB2 A;  2UWJ G;  2IU1 A;  4B0Z A;  1Y8M A;  3PRE A;  3DPD A;  3ENE A;  3FTX A;  4IRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...