1HI6A

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
publication title Crystallographic Analysis of Anti-P24 (HIV-1) Monoclonal Antibody Cross-Reactivity and Polyspecificity
pubmed doi rcsb
molecule tags Immune system/peptide
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2001-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6A01
5C0CD 2DWEA 4YE4H 3VFTB 1PQZA 3HZKA 3SKUD 2QADB 2BHZA 4JO4L 5JW4R 3FFCB 3GMPB 5CUSL 3KYKL 2Q8BL 1OAQH 4U1IA 1GXEA 5BXFA 1P6FA 1G7QA 3PHQB 4IRSA 2NY4B 2VKXA 3IS0X 4OZHA 3WIFB 4FTVA 5CZVL 2CIKA 5I76B 1FAIH 1K3IA 4HC1H 5EIIA 3QDGD 2V5TA 1TJGL 5T3ZE 4DGYH 2NZ9C 4V1DA 1EAPA 3MJ7B 1JGLL 1MJJB 5CD5C 3GMPA 5C0EB 2ZUYA 1TQBC 1FNAA 3E6FA 3ES6A 4LVEA 4WFFE 4G7VH 5BRZA 2FJGB 4I3RH 5GGUB 5DO2C 3WIHH 3WIFA 3MUZ1 2VR9A 1EBPA 1HSAB 2DI9A 5F1OB 4DQOH 3GBNL 4U1KB 2UUDK 4DWHA 3CFKB 3WKNA 4Z7WB 1PG7H 3L3OB 5D1QD 5D9SA 3T2QA 1HH9B 3TZVA 2VLJA 2VDNH 4Y1AA 4UIMB 2FJGA 1HXMA 1T2XA 4UU9B 4N0YL 3ARGB 4G9FE 3RL2A 3JTSB 4HZLB 1HSAA 4UT9H 4TSBH 3B9VA 3K8LA 2PYFA 5BS0A 2ORBL 2VZOA 1ZKAA 1KIPA 2Q8AL 3NH7L 2NW3B 1J1PL 2D7OA 2EIZB 4HC1A 5LAXA 3RAJH 3GI8L 4QKXB 3EJZD 1F97A 2VLKB 1P4LB 3WE6A 4YXLL 3QIUA 1MWAB 7FABH 4NM8L 2P5WB 4MJ5A 2IANE 5ISZB 1N5AB 3UTSE 5GGRB 3KPSB 4UTBL 4RZCA 4K94H 3WIHA 4NZRL 1JGUH 2YC1A 3HMXH 5D7LD 3O81A 1N0LA 4TQEH 3H9YA 4HWEH 5C0AB 3OX8B 5C1MB 4PJIF 2OCFD 4OQTL 2HKHL 3QFJA 1N5AA 4Q6IB 3TA3D 4HIJB 2AABH 1UKSA 4P2QB 2XY1A 4QHLB 1F4WH 3HRZA 4K7PH 4I2XA 1S78C 1AFVL 4JFOA 2YEZB 3HPJB 5EOTB 4U6YA 3UTTA 4TVSa 3LHPL 3EJYC 4Q6IA 1ZSDA 3CVHA 2GT9A 4GKNB 3HI6L 1KCVL 4XB8A 2VZTA 1KELH 3WV0A 3NTCL 4C4KO 4OGAD 1KPVA 3QQ4B 3HPJA 1HN1A 2D0FA 4HD9A 4MGXA 1QHOA 5GS2H 1DBBL 2CKBB 4UMGA 1P1ZA 1CU4H 5CILL 1BP3B 1L7IL 3DMMD 4E9LA 3T65A 1QP1A 4TUOA 3BHBB 2GUOB 3PWJB 2HRLA 2IALB 1JIBA 1XEDA 1S9XB 3QQ4A 2OTWA 4DGVL 4PJFE 5DC4B 4E41B 4KAQH 4OT1H 2J6EA 3ZDZF 3R0NA 2PO6C 1T5XB 1K2DA 1UKQA 4JZJC 1I85C 1NANH 3P9LB 2GUOA 3PWJA 4P57A 1S9XA 4AIOA 1R5VA 4M7KH 4PB9L 2Y9RT 4X7TA 3RWJA 5I19L 1U92B 2I07A 4JGUA 4OV6F 2VAAA 3GKWL 2NCMA 1IM9D 2GK2A 4PJ7F 5J1SC 2PYED 2EDEA 3RGVC 4Z78B 4R96A 3P9LA 3ZTNH 3DHMA 1E6OH 3U4EA 2GY5A 3PV6B 5EUOF 1FNFA 5ACZA 1BLNB 3GHBL 5DUBA 4Z7OE 5EU3A 3IJYB 3UXFA 2ICWI 2MOVA 3MNZB 2LVEA 5DQDH 5F7YC 3M1BB 3KLHD 4NKMA 4Z78A 1K6QH 4LOUD 3U0PA 1AE6H 2GJ6E 4HJJL 4LMQI 5HY9A 2JCCE 4NZTL 4XPBL 1FPTL 1T66C 2BVQB 3FMGL 3WEXB 4HKBB 1UH3A 2OLDA 3LRHA 2DIAA 4YH6A 4PP2B 4QRTB 3F58H 1XGUB 2YXMA 3IJYA 3MNZA 2IPUK 3VXNB 2LFGA 1N5YL 2WIMA 1UEYA 1KG0B 3M1BA 3EBAA 2G5BB 3DETD 4L1DA 1ZT1B 4PFEA 2AQ3A 4RMWA 2A6KB 2FIKA 3KJ6L 3QA3B 4FFVC 5DUMH 3VG0L 1QEWB 4PD4J 5IR1A 1I8LC 3MLYL 3K4ZA 1WEJL 1B0GA 5DK0A 1JMXA 1BAFL 1KG0A 5B4MD 3PQYA 3OR6B 3W9EA 4WFGD 2Z35B 4PJ7A 5HYJE 4KI5C 1MRFL 4FXKA 4UTAH 4MDIB 1CF8H 3VXTA 2V7NB 1R5WA 2HT4D 3K74B 3LEYH 2HAZA 3MLWL 5EUOA 3HC0B 3GUTB 4OZGB 3TLRA 5IFAH 4LLQA 2Z35A 1DN2A 3DO3A 4GAYA 3QO1B 3EYSH 1GGTA 3LQZA 1EA9C 4HC1L 5KVDL 4BZ2H 2Z91B 3C08L 4RMUA 2D03L 3MJGX 4JPIB 4NN6C 4HBQA 4TTDC 3UJJH 5HHPA 2YMXL 4WW2C 3ZZ1A 1FGVL 3HC0A 1RU9L 3GUTA 3IDNA 2APFA 4NC1C 1FFQA 3ULUC 2JB6B 5HHMD 1DBAH 1F4AA 4APQB 1DANT 2YD3A 3FO2A 3I9GL 2Y5EA 1KEML 3RVXD 3QDMD 1FYHB 1Y6KR 3OPZL 3QIWB 3LEVH 3MRKB 4X6CE 4AIZB 5EZLB 1BGXL 1UM4L 3FFDA 3V7AE 2VDNL 4XXCC 2JB6A 1R3KA 1M4KA 4JFDE 1A4JB 1TQCB 2RCSL 4XNMB 4CVWA 4E0RA 1T20A 4APQA 2C7UB 3TVMB 1A7PH 3QAZC 4DK6A 4W4OA 1BOYA 1HH6A 3L3IA 5GGSB 4AM0B 1MJUL 4UDUA 3OKOB 4OLXL 5D71H 4GS7B 2R15A 5EZLA 3VMNA 1CFBA 3L3HB 4U31A 3CVHL 2G60H 5BW7C 1CGUA 2NY1D 3L3GB 1WWWX 4L4TB 5EBMA 3ARPA 4DTGL 5ANME 5J06A 1NEZB 5GGSA 3ZKMC 4AM0A 2CKNA 4RQQA 4HMCA 5CP7B 1QBMH 1VGEH 4JVUA 4TVPL 4K94L 1Q8MA 5K9QG 1EGJA 4C83B 4H0IA 2NYYC 1XGPA 1EZVX 2GYSA 1KN2H 1NCWL 5IESH 1D5IL 4HH9B 5EORH 5GIRA 4I48B 1T89C 2G9HB 3MRNA 1G0XA 2XKNB 4S1SL 2J6EL 5C0AD 3IS1X 1MCQA 2QSVA 4O51A 2YSSA 3BN3B 1UFUA 4GBXA 1RVFH 4QOKA 5M95B 3MFGB 5I15H 2DM7A 1NDMA 5HDLA 1NUNB 2G9HA 4L4VB 1MAJA 4S1QH 3BO8A 3EDEA 5E2WH 1JNNL 5CFHA 1MY7A 3PUCA 4X4MA 4TPRL 3B5HA 3VXUB 3MTRA 4ELKA 1WBXB 1F4XH 3T0EB 4UDTB 2BC4A 1QRNB 1INEL 2BERA 1CU4L 4OZIF 1XGRB 3VFMA 5CGTA 2D7PA 3TBWB 3WXWH 2XQBH 3T3ME 4U2ZA 3QRGH 4ZPTB 4O9HL 1QSEA 3WHXA 4EVNA 5ABDE 3VXMA 3VXUA 2PNDA 3IFPA 4B7LA 4NWTL 4UDTA 5KJRH 1KGCD 1C1EL 4NQTA 1ACZA 1E4JA 1MHPL 1HKFA 3BRGC 4MDJA 1OLLA 1D5BB 2F58L 2DQHL 4HFWA 4BFIA 5ETUA 4ZSOB 5I75B 2AEQL 1NGPH 4RAUB 4L8CB 3LY6A 4JQXA 1FG9C 2X09A 4RAHA 4Z0BL 1N64H 4LAJH 5IWLC 3KXFE 4PP1D 3QEQB 2R1YB 1R3JB 3HNVL 4XVUC 1FJ1A 1A3LL 3PP4L 4OCSL 4ZSOA 1C12B 5HJ3B 3D85B 3BYTA 3LMJL 5JZ7C 1QLFA 3T0AA 3GJFB 1RUQL 3I3DA 1R3JA 2IH1A 1DANU 4N0UE 3W11C 3DX9B 4I5BB 3QDAA 1NC2B 3BH8B 3OXSA 4XNXH 4OZIA 3B9AA 1KPUB 4P46C 3TO2B 4I0PB 2Z31C 4R0LA 3QI9C 1IGCL 5D7SH 1OP9A 1I7RB 2ESVB 5DJAB 3IVKA 3QT2A 3C6SA 1D5MB 3ARFA 2I9LA 1OVZA 3DX7A 3L5WA 5IGXH 1KYOJ 5T3XD 4PJDF 1NC2A 5DUML 1S7WA 1VGKA 5FYLL 1HWGB 5EFIB 5JMRA 3BIKB 2D3VA 5D7JC 1CICD 2DWDB 2KZWA 3LSOB 3WO4B 2DBJA 1U42A 3C5ZD 3WS3B 4X7FC 1HDMB 1V7MH 2MCPL 1A5FH 2AKRB 4HWUA 3FT4B 1CD9B 5T1KA 1S9VB 1T22B 3K0WA 3I6GB 1JZ3A 2ID5A 2GEEA 3OTTA 3E2HB 4P5TB 5EFIA 5MEQA 4PRIB 4UTAL 1FQ9C 3P77A 4U0QB 3INUL 3WS6C 2AKRA 5AAMA 4F2MA 1YEEH 1T7YA 3MRBA 1GGCH 1HK6A 3WFBL 2NY0C 2RFXB 3I6GA 2CJUH 5C08B 1H0DB 4K2UH 2XFXB 1A6TB 3TNNA 3EYSL 1WWAX 4PJBF 2J8UE 2Z4QA 4P5TA 2WIIA 4HJGB 2V5RA 1GIGL 5GRJL 5BO1L 1NLBL 1AXTL 1GL4B 2VISA 2FO4A 4CDGC 5KSAB 2XTLA 3K4AA 1G6RH 4HMEA 4ZXBC 3V8OA 3ARZA 2WBJC 1A6TA 3O4OC 5A1AA 4G8GB 5CLTA 1LEGA 4YWGL 1EGJL 3BMVA 5FO9A 3V6FA 1YDPB 4KUCF 4J7RA 4AEFA 4KK6C 4PJDA 4WY7H 1TTGA 1NGQL 1OM3H 1OOAA 2Z93A 3GI9H 4EI5D 3BYYA 1NMAL 2W9DH 1I9JL 1PY4A 3VFSA 5GXBB 3QIWD 1AO7D 4G8GA 2ZNWA 2J88L 3QNYB 4XMKL 4DZBB 4ELMF 2FX8H 5J89A 1VERA 1YDPA 1BQHG 1MCWW 4XGZA 4GO6B 1MFNA 1PLGL 3LPGA 2JELL 5D71L 5I71C 5KS9E 2HVKB 4KY1H 1A3RH 4NKDB 5SV3A 4ZUUB 1TXKA 3S88L 4G6AD 4ONOA 1ZHNA 5TFSH 4ETYA 3NPSB 4WV1C 8FABB 3D18A 4D0CA 5I8OL 1LP9E 5DZOA 1IVLA 3HR5A 5T1LA 2XNAB 4U7MA 2BVTA 1MOEA 3OBAA 4MCYB 4R7NB 1OCWL 1KJ3L 4YK4B 1G6RA 4JB9L 1CLZL 4PJBA 1FL6A 2W9LA 1VGEL 5DA4A 4OFIA 1C5CH 4UT6L 2XTJC 3V2AR 1IBGL 2OL3B 2P8MB 3WNMA 2BXZA 1UQSB 1MCCA 2XNAA 3WFZA 3HS0B 1VACA 2XG5A 3BKYL 2ZPKL 4Q9CA 4OQ1A 3ECBB 2AJ3A 1A6VL 3NA9H 2VUYA 3QJHB 3P0YL 25C8H 4CVZA 2A9NH 2ZCLH 4WFHE 3LZFL 2OL3A 2WBKA 4KROC 1J1XH 4TNWF 3V6OE 5ICYB 1GC1L 1TZHA 4XAWL 2DOCA 2FIRT 4QO1A 5D70L 4G42B 4BH7B 5CD3A 1FFRA 1ZVSB 4CKVX 3UJTL 4I13B 1CDYA 3VFNB 5FYJD 1BX2B 1L9MA 4RAVA 3ECBA 4HBCH 3SO3C 4ELMA 1P7QB 2W92A 2DKMA 4FMFA 1MFCH 3QYCA 4JAMA 3TN0B 1ETZA 1RMFH 1VFUA 4BH7A 3U2SA 5E56A 5FB8B 4Z7UB 1N3NB 3W0WA 3F5WA 3GZKA 1T04A 4PD4K 2I25N 1II4E 1P7QA 1RULL 3WLBA 4U1SA 4N0CD 3T77B 5I1HL 1TTUA 2JKXA 4LLAA 4DVRH 4WCYL 4NBXB 5JUEH 1QRKA 3EKCA 1MVUA 4NBZB 1MCOL 1I7UA 4YHLH 5DC0A 3MRRB 1S5HB 5I74B 2MCG1 1A47A 2WUBH 3IDGB 3O6FB 3MMEA 3WN5C 5GS1B 4HUWB 4R7DA 1OGTA 4KTEL 3V5DB 3O9WD 2CDGA 3T1FA 3DARA 4OZ4A 2XKSA 4KJPC 3TH3T 4XCYB 3WNNA 1EAJA 3TJHC 1S5HA 4H1LB 4QXUH 5DVMA 4HWZA 3IDGA 2DBLH 4GW4B 5C09B 2BVPB 5GSVA 2Y5TB 2ICWB 1XT5A 4RFOL 5I1AA 4U1NA 2AK4A 5HSFA 1A7BA 2CDFB 3MV7A 3UP1A 5C2BL 3E6HA 3HLAA 4AEEA 3CFIC 2IFFL 4MAYD 4DK3A 5JIKA 4YDLC 1FLRH 2DJUA 1UVQB 1CTNA 3IXAB 1H15B 1NCCH 4G6FD 4WWKD 3U46B 5IOPA 2EH8H 3GIZH 1YC7A 5C09A 2BVPA 5DT1H 2Y5TA 9CGTA 4LSTH 4QXTA 1BQHA 3HI1A 3EFDL 5CBAB 1AO7E 3ULUH 1EFXA 3LRSB 2IAMA 5C0BB 5EWIH 5JQHC 3QUYC 4WENB 2VYRE 3B8YA 1U3YA 2ZUWA 3GKZA 4FQIH 1UXWA 2EYSA 2OQJA 1UB5B 5J12B 1JGVH 2XIDA 2DTSA 3LRSA 1PSKH 2OMNA 4DEPB 1J0ZA 1IQDA 5IIEB 1P6AB 3IAGC 1V7ML 1NGWA 2VZ3A 1MQKH 1Q0XH 3ARDB 5CEZE 4M48H 4LKCA 3REVA 1DQJB 1ES0B 4DUVA 3ZKNC 4O00A 4U0RC 5C9JA 1EBAA 4MB3A 1AD0A 5FO7B 4RWYL 1RK1A 2IPKB 5I2IA 2G5RA 4R2GD 5INCA 4KUZL 3S5LG 4GQ9L 4NZDA 4ZUVB 2RAMA 3KPPA 3C2SA 4IRZH 3VWJC 2FJFB 3TCLB 3MBEC 2J5LB 1ZA3A 2HKFH 2R29L 3T0XA 4OI7A 5SWSD 3N85H 4HIHB 4HJ0D 4ZUVA 1GGYA 1G6VK 2AQ1A 3TCLA 3MSPA 3ZKXB 4MSWB 4EDWL 4K7FB 3S9DB 1J87A 4QWWD 4O02H 4P3DB 2BFVH 3AUVA 1EMTH 1L0XA 4MD5B 4O2EA 4ZS7L 4F37F 5IT2L 1WQVT 4HIHA 1DZBA 1J05A 1AGDB 1DLFL 2ZP0T 1OD7A 2FJHA 4QT5B 3GJEA 2W65B 5FUCE 3UCRA 2DLFH 1OSPH 2OL3L 1EH9A 3GJFK 3CNKA 4KTDH 4XMLH 6CGTA 5E00A 1M7IB 3LS4H 2EEAA 3NIDF 1XGQB 3MXVL 1S7TB 1YNTB 4HGWA 4NQED 4XBGB 5E9DD 5EUKB 4BFGA 3VD7A 1AY1H 3QULB 1AGDA 3PL6C 5C0GB 3RUGE 4MQXD 4KV5F 1B90A 4FQXA 5I66B 5F1IA 4ODHH 3QG7H 1ZGLP 3AGVA 3ZDXE 3MRGA 3LPFA 2A74A 5DFVC 5CIPB 1AR1C 4M7LL 1RUKL 5DYOB 5EC1B 2WZPD 2HFEB 4L9LB 1ZWIB 5EUKA 5IMMB 1ZVHA 1NUDA 4KDTA 2V5MA 5FUZL 2P47B 3VCLA 3LKQA 1T4KB 4LSSH 4YPJA 4Y4KC 5GS0C 1S7XB 5DYOA 5I1JL 1DL7L 2LTQC 4GW1B 4IJ3C 2FB4L 3WYRA 3QQNA 2YKLH 4ODUB 2ZCLL 2ARJB 4JFYB 4OAWB 1IAOB 3FQTB 4OCXL 5EZIL 3EOAA 3QG6B 3RFZC 1MIEL 1S7XA 1I3GL 5DHVA 5E6IC 3OQ3B 4GRWF 5EOCH 3WXVL 2BMKA 4ODUA 2ARJA 3BISA 2BCKB 1W2KT 1MFCL 2EDNA 4R90H 1P9MA 3FQTA 3NFPA 1DJSA 3PWNB 2MQ0A 2BSRB 2LU3A 1BFOA 5TQ0H 1AI1H 3VI3E 4XX1G 2YUVA 1FL5A 2D9CA 1WTGT 3U6RB 3G9AB 2PW1B 3ARBD 1QNZH 3GRWH 2Y1VA 4IRJA 3WFCH 1WWCA 1ND0A 3IAPA 3VRIB 1O7VA 3BD5A 1CK0L 1LO4H 4YR6A 3CLEH 4HCRH 2UY7A 2Z8VC 1U2CA 3S5LA 1EHNA 3KWWB 2ZKHH 1D3CA 5T1MA 3U6RA 3MRPB 2QEJA 1NAMH 5HVWA 2XWBB 5IROA 3MRMB 3FQXB 2WUBL 3LQAC 5E08H 4ODTH 3GNML 2HH0H 4MNQA 3KPMB 3VRIA 3BGMB 2DMBA 2J3SA 1GRWA 3L5XH 5TDOA 4WDIA 3MNWB 4F57H 4NBYB 3KWWA 3D39B 5C07D 5SWSE 5JNYB 3MRPA 4FABH 3BD4A 4OZFB 3ZT5A 2Y25A 4FA8A 1AH1A 4RMQA 5DVKA 1G0DA 1WZ1L 4Q97A 2WW8A 4U1LB 3BZDA 2LU4A 4PGDB 1YNKH 1UC6A 1Q0YH 3U4BL 2IQAB 1BD2D 4NQCB 3U79A 3L3KA 4LHUD 1VDGA 2V9RA 3QI9A 4PJ5D 5JNYA 3GRWA 1GJIA 3ARRA 3JXAA 2VC2L 3ULSB 3CAFA 2QQKL 1S7UB 1OF2B 4OGXH 4OFYD 5KTEH 4I4WA 4UUJB 3HG1B 2QHRH 3DYOA 1E28A 2IQAA 1O5DT 4I9WE 3W82A 1QQDB 1CD8A 3PV7A 5SX5K 2DQFA 3HAEB 1NAKL 3FT2B 5JOFB 1IEAA 4NZJA 2I9TA 1YEHH 4KHTL 1M71B 1UGNA 1NFIA 3OKLB 3BAEL 4JANB 1IGJA 1BQSA 3K2MC 4KK9D 4OCNC 1OTTD 4XPHL 4YBQD 3HG1A 3JTTB 1CFVH 3NCYP 2I27N 3TA3C 4JY4B 2L4OA 4RA0C 4YO0B 3MRLA 3SEPA 2GSIB 4HIIA 3L7FA 2PXYB 3QEGL 4HUVA 3VFUA 3MRDB 1IKFH 3JTTA 3CVIL 2P5EE 4DZ8B 1I1YA 2AJZA 3ARDD 1J12A 4MMZC 2H6PB 5EB9A 2YPLD 1LWRA 1OTUC 1XF1A 4I3GA 4DOHB 2R0WH 3QZWG 3D48R 4XWOD 2OI9B 5HDBE 2PXYA 3FONB 2LVCA 3Q48A 4XBEL 2DI8A 4Z7VB 4XRCB 4WEUD 2A38A 3R1GL 1A1MB 4HUXB 5TF0A 2H6PA 3SDDA 3VD9A 4P2OB 4NUGH 1MI5E 3B9EA 5K93A 5IVZB 2WP3T 3TF7C 4JN1H 3ARED 3SDAD 5HHVH 5DEGB 1UJ3A 4GH7B 1CGTA 1CFNA 2FR4A 1Z0MA 3EJJX 3SOBH 1C8PA 1TVBB 4IBLT 2B5IC 2R0KH 4O02L 4BSVB 1EMTL 2BRRH 2KDGA 1BBDH 1KLUA 1Y18B 4OLYH 1TLKA 3AB0B 4PRBB 2M8XA 3VA6A 4OD2B 5IJKA 2VXVH 1MNUL 4KXZH 3VJ6B 4LARH 1MCHA 2NY6D 3LQMA 2DLFL 3EHBC 4PIRF 4BSVA 1YEKH 2X4PB 2P46B 3NBNA 3TP4A 1G9NL 3BPNB 5DK2B 5HHNB 1DQML 4PRBA 3Q6FB 1ED3A 4OD2A 3AU1A 5J1AB 5CZKA 4ODWB 3VJ6A 4TNVK 3MV8D 1YYLL 3NABH 3MV9D 4ZOEA 2CGRL 5C0ND 4ODHL 3KLHC 3QDJE 1QFOA 2X4PA 4K3EH 4LOUC 1GAFH 4NCC1 5HHNA 4XCNA 4WI9A 4NUJB 1A6WH 1AHWB 3ULVE 1A6UL 3Q6FA 4MJIA 5C07E 3H9HA 2AW2A 2R0LL 3O8XB 3U7AA 1P7KB 4ODWA 1ZT7B 4QY8A 5HBBA 4JHWL 4D0BA 3VWKA 2H3NB 1UACH 4ZAKD 3DETC 3IETA 3QCVL 3X3FL 2VXSH 4XPTL 5ALBL 1AHWA 1G1CA 5F97E 4R97B 3BUTA 2VOTA 4OFPA 7CGTA 3TBVA 3IRZA 4JM4H 2BVOB 35C8L 3FN9A 1QLRA 3H42H 3SPVA 3HUJE 4M62L 5JW4N 3PWUA 1X5FA 5F8QC 5L7XH 1U41A 2VLLB 2YK1H 1R3LB 1Y6MR 1KJVB 5F7HA 3A67L 4PJ9B 1P4IH 2BVOA 5FYKL 1KBGH 1PZ5A 4XP5L 2VDMH 3QUXA 3FQWB 4H5SB 4PB0H 2Y7QB 1AR2A 4MA8H 4XC3L 1HHHA 4LLUB 1REIA 5DJXA 2P24B 1F2XK 3BP4A 3GRWL 1B4JL 1H3PL 1HINH 3C60D 3BZ4B 4NO3B 3F7VB 3MLXH 1CXFA 2I5YH 3TFKD 5J6GB 3FQWA 3QZWA 4H5SA 5FUOL 1ZLUH 3CLEL 1AIFB 3QJFB 1MJ7H 5ICZA 3MLSH 3ZO0A 4ZOBA 5JXAH 4C56B 2HH0L 5T3ZH 4OLWH 2OK0H 5F72S 3RQ3A 2HT3D 3CDFA 1HOCA 3L5XL 1MCKA 2Q76B 5AZ2L 3KPNA 4J3WA 4X5WB 3SGKA 5DJCB 1ZEAH 5LGKA 1F58H 2VIRB 4P3WA 1HNFA 1UZ8A 5FDWB 1H5BB 3L3DB 4FQCL 5IFHL 5DMYA 2GSGA 4P5MB 5AWNL 3FQRB 2IG2H 2QQNL 2QQQA 1X5AA 4J1UA 1IGML 3D2UD 1ACYH 2XG4A 1N4XL 1AKJB 4NN5B 2VIRA 5KSBB 2NY1C 1QLEH 4YHNB 5T5FL 1H5BA 3L3DA 4F37K 3QHFL 3GMRA 4CMHC 1ONQB 3B9KA 4PRDA 1VCAA 5ENWA 3E3QC 5DRXB 5IB3B 1OPGH 1CDHA 4M7LT 1WK0A 3HE6C 3HZMA 2FL5A 3OB0H 4PRPD 1AKJA 5EU6E 4A2LA 3VG9B 5SWZD 3WFHA 2CDEA 5MERA 3UAJD 5JHDD 4M8VA 1JGEB 3BKJH 5EO0B 3U36A 2YA2A 4ALAH 5F93C 4LASL 4JREC 3RWHA 2IF7A 3BWAA 3O2WL 5CINH 3I85A 1X6LA 1UYWH 3P3YA 2W0FB 4J3TA 1C7TA 5CGYD 1XF4A 2Z0BA 3B6SB 4JFEE 5E2UL 5DSCB 3SDCD 1S9WB 2F5AL 3EYUL 1XIWD 5E99L 2ILLA 3TO4D 4W6XB 2R1WA 1OAKH 4UOJA 3RWEB 1KIRA 1P84K 2CLZA 5IB4B 3MRHA 1WISA 4Y19E 2XXMB 4IHOB 1MFAL 1BMGA 1G7HB 5TDPB 3B6SA 4JO3H 1UXSB 1TPXC 3P0VL 3PWLB 1FNGA 1T7VA 3SE9L 1BWWA 1QSFA 1FCGA 2JJWA 2LV4A 5GS0H 4LCWA 5K9KB 1G7HA 5FK9A 2X4QB 1ZA6A 2IANA 2WP3O 5IHBA 3P11L 4XAKD 3HFMH 3RNQA 4N8VG 4PJFF 1NL0L 3PWLA 1FGNH 4M02A 5JOPE 4ONGH 3DO7A 1U3ZA 1KXQE 1OB1B 4ODBD 4UIKL 4IRSD 1BJ1H 5TGBA 1LO5A 4FTVD 1QFWL 2L0DA 1ZTXH 2AGJH 2W0PA 1J0KA 4NQDE 4ODVH 4KKBC 5J6HB 1ZLSH 4V1DD 2X4QA 2XZZA 4RFNB 1T5WB 2HN7B 1H3UA 2YWYA 2C3VA 3SKNB 5TE6H 5CSZB 5DD3L 1U3HD 4MHHI 1D5ZA 5BRZD 3O11B 4OGZA 1JK8A 3KR3H 1P5VA 1MEXH 4W81A 5IBTL 4DAGH 4FXGB 1EO8H 1JGDB 5BV7B 2FEEL 3GM8A 1QBAA 4OV5B 3GMNA 3RI5K 1FZJA 5CSZA 4Z7OF 3TZVD 5L2JA 2VLJD 4D9LH 2ZNXA 4Y1AD 4KJWD 5F89A 2L7UA 4Z76B 1S5IH 2ZZUT 3ISWA 5GSRB 4CL7A 1KXTB 1KPRA 2AV7A 4NOBA 3TYGH 5BS0D 5HGDA 3SHSA 1MRCH 3LQAH 1T21A 4Y5XC 4YDKH 1PJ9A 5HI5D 1RURL 1VB9A 4PRHD 1O0VA 1QD0A 4GT7A 4Z76A 3V7AG 4XCCH 4HIXH 4PJFA 3RY6C 3QIUD 2WSKA 2XN9B 1CICC 2JLLA 1ZV5A 3T08A 3C5ZC 4B7IA 4G6ML 1TNMA 1G1YA 4U49A 4NNYB 1XGYH 3H42L 1F6LL 1XMWA 5GHWH 2FCBA 3GB7B 3L6FB 1JYNA 5D2NE 3T0VA 2FSEA 4KFZC 2ARWA 5SWZE 3HNSH 4UQ3A 4PJEB 1C08B 1I8KB 3WD5H 4NO0B 3QFJD 3UPRB 1LDPL 1S7QA 3UC0H 2JIXB 4NNYA 4NZUH 4HWNA 4LSQL 2XA8H 4BUHA 3O0RH 1UB6B 3GB7A 3DRTA 5IUSA 4CAGA 4H8WC 2ZG3A 1QFUH 4OD1L 1HHJB 3UTTD 4Z6AT 4P5KB 4ZQKA 2ZWLT 1JPSH 2Y36H 4DN3H 1YMMD 3PDOA 4ZDHA 1B0RA 2EE2A 4WJ5A 5JMOC 3O45B 3U1SH 3QUKA 3H9SB 4PJ8A 5JIPA 4M5YL 3GO1H 4OBRA 4YFLF 3DVNA 1HHJA 1GOGA 1G7MB 3MLUH 4Y5YC 4PV9B 3T0DA 4N8VB 5IW6B 1N59A 2O26U 1LO0H 3IDUA 2AEPL 2AXJA 4BJLA 4EI5C 5DLMH 3RWGA 2I26N 2YS4A 3SJVE 3TCXA 5IHUL 3RA7H 1ZEAL 4J6RH 1N0XL 4XCFH 1DTUA 4F9PC 1PKQE 4XVTH 3V5KB 4AYFA 4N8VA 1KN4L 4XH2A 1AD9B 4XNUL 5DJYB 5FOBB 3CFBA 2WUCL 5HD8C 4Y16D 2IG2L 4D8PA 3DGGA 5JIIA 4TSAH 2PKDA 5GRYA 3V5KA 5LWYH 3WNPA 3IKCB 4N8CH 5MP6H 1AD9A 3GIVB 4UB0H 4YEFA 1I9RH 2BNQB 3JWOL 4GRLA 2VSDA 3KHQA 5DJ0A 3MRQB 1T03L 4HUUB 4LSDA 4M8QA 3STBA 5LXGH 5I73B 1AGFA 2H26B 4AG4H 2XWTB 3QPQD 5JQ6L 2P1YA 3KS0H 5EC2A 2W07A 4HS6B 1BOGB 4DVBA 5IW3A 1EO5A 3MCG1 3WJLA 3B3IB 2HWZH 4PLOB 4QEGA 1NBYB 3WMSA 3REWA 4Y2OA 1OQXA 2Z92B 1TVHA 3VMOA 4V2CB 2A73B 1QHPA 3JUZA 3KLDA 1MELA 2NY5L 4P9HL 2O61B 1CLOL 3KYOB 4JDZA 5ACLA 4Z7WE 2PR4H 1LO2L 4JFDA 4JPWL 1T1WB 2GIYA 3B3IA 1BZQK 1OGAB 4MD4B 1BM3H 4OB5H 5E2VH 1KB9J 1OSZA 1JN6B 3K7UA 5DUPL 5HI4D 4X8JB 2A73A 2XXCB 5DXWA 1WWBX 5DFTA 2FZ3B 2HJLA 4DGIH 1VEOA 3HPLA 4HK0B 4LGSB 4ZFFB 4WI6A 5HHQB 3BSZL 4HLZG 3MRJB 4N0CC 4EN3C 4PGEA 3D9AH 2ICES 1JHKL 2EH7L 1EEQA 5E6YA 3DSFL 1JN6A 2P8LA 4K3HA 4HKJA 3T3MF 4X8JA 5I1CH 3RNKA 1TQBB 3B83A 5ANMA 4YDJB 2FZ3A 3D0VB 2P5WE 3ZHLA 1HXYB 2DLEA 4KHXL 5BV7L 5EBLA 1R3IH 3KPSE 3MRJA 3UTOA 4LLDB 4I2XE 2VQ1B 3O9WC 3ETBF 5EO1A 1I3UA 3SE4A 3OJ2C 1TZIB 3CD4A 5MEOB 3FCTB 3WJJA 3GMMA 4BKLB 1R0AH 4JRXB 1EK3A 1PW3A 4WHYG 3AC0A 4P2QE 5FYLD 3VRLE 3PDGA 3RL1B 1FIGL 3K80A 4PLNC 4J2XA 2D4FA 3CJJA 5EBWA 2XZCH 4MAYC 3C2AL 4NHUA 4QRUB 4TVPE 4KRPB 4ZD3L 1P2CA 1IGFH 3MLTB 3FB8A 2EKSB 4OGYL 1W0YT 2A6JB 4BQBA 2CPCA 4EBQH 5DD6A 4YDIH 1ZK9A 3AY4C 4KQ4L 4HAGA 5IMKB 2DQTH 2OXGA 1MF2L 4QRUA 1DUZB 5CAYB 1L4IA 2KH2B 3MODL 3V52H 3MLTA 4YHYC 5J3HD 4O2FB 4HPOH 3AS1A 2BDNH 1SYSB 4OF7A 4M7JL 3CC5B 2XYCA 1U91A 2CXKA 1QR4A 1KC5L 1YEJH 4E41E 2CK0H 1DUZA 3P4NB 1LE9A 4AZ8A 1RUAH 2P8PB 3O4LB 1IL1B 2V2WB 4N5ED 1ITCA 3T2NL 3TYFA 2NXZB 5JO5B 4TRPL 2D0GA 5LJYH 5ITBH 1A7QH 3CZFB 3P30L 1IC5L 4X6FB 2GI7A 1BJ8A 3P4MA 5B22A 3MNVA 5FCUH 3VFGH 4ZMAT 3KXFA 4KXZI 1F11A 5F71A 4M4RA 5AYUH 1U8KA 3CFEA 3MLVL 4R4BB 1QYGL 3WHE1 3UTPD 4GBXD 3CZFA 4QOKD 5TE4H 4EKXA 4Y2DB 4JKPL 5B8CC 1JPSL 1OARH 5J4MA 3B5TA 1A4KA 1I8IB 2IQ9L 4KC3B 2J8UF 3MC0A 1Q72H 5JORA 4N0UA 4B5EA 4OCRH 4HJ0C 2ICEB 2HJFB 3V6ZA 2X70A 1M6OA 2LAGB 1BEYL 1MLBB 3WL9B 2PO6B 2UZIL 3R06B 3GMQB 4Y2DA 4QWWC 3K81A 3AAZA 1NC4A 2A6DA 1K4DB 4MWFA 5CEXA 3F65A 1HKLL 1R5IA 3SE3C 1KLGA 3PQYE 2RHEA 3HNTH 4GOSA 5FYKU 4Z18A 5E8PB 1N7ML 1QSED 3RZCA 3RA7L 3VXMD 1UA6H 2PETA 3PWPB 4PJ7E 5DK3A 3RGVB 2VNCA 3QWOA 1ORQA 4JRWA 1AP2A 4NRYA 5F3HB 2A0LD 2IMMA 4CVUA 3PWVB 4PTUB 2PF6A 3QUZA 4MJ6B 1MCPL 1HCVA 4BM7A 3WCYA 2G2RA 3MBXH 4O4YL 5EUOE 1PZUB 3TBYB 2F5BL 2FYYA 2FGZA 5KS9F 1WBZA 1IGYB 3A6CL 4M03A 4MQXC 3VH8B 2NY3D 1YEGH 1UM6H 5GGVL 5F9WC 4CNIB 4UB0L 3BPCB 4HT1L 4X5XA 1BFVH 3NACH 1LP9F 4QRRB 1BBJA 4C58B 2B4CC 3L3JA 3EYOB 3FT3A 5K59E 1VFBB 2J8UA 3QIBC 2BSED 1RK0B 2GK0B 3FQUA 1X3DA 1FYTD 5HGAB 5LXGL 5I18L 3I02A 4JDVA 4CNIA 4AG4L 3GMLB 5C0DA 1I7TB 4B53A 2WBWB 1FFNB 3VXQA 4TOYH 1CL7I 2YPVL 3RTQC 1A64A 1OAXH 4PGCA 2VZVA 4MMXC 3RVVC 3D87B 2VH5L 5CKGA 1E4XH 5GZOC 4LSVH 4G6KH 3O6LH 3HCVB 2HTLD 3ARFD 3I2CH 4U1MB 2PR4L 4H25B 4K7PX 3L9RB 4JRYB 4U1JB 1ZS8A 3OJDA 4L8DB 4EOWL 4IEFB 1A7NH 3Q3GA 4FFZH 4AENB 4X6DB 4X7EC 4XVSL 3OMZA 3RDTB 3MJ6A 3TV3L 3VXSB 3DNKA 2X9XA 1JWUB 5KS9A 1DP0A 3MOAH 3KHOA 3ARBC 5T1KD 3PABA 1CTOA 1VADA 1A6ZB 4U1MA 4ZUSB 5IQ9A 3TWCH 1FFPB 3ROOB 3L9RA 3X12B 4ZNEA 3MLRH 1U8PB 4MD0A 4YQXL 4QYOA 2EDOA 2F53B 3K46A 4NN6B 3S37L 4AT6A 3OJMB 3LDBC 1LP9A 1YECL 4NT6A 4WW2B 2NY7L 3UZQA 1JF5A 3RDTA 2ADFH 4DN4L 4XVJH 1JWUA 4XP4L 2IJ0C 4ZUSA 1H3WM 3STZB 3JWDC 3X12A 2XRAL 1QA9B 1U8PA 3FOLB 3LKRA 5A43C 4MA7H 1I7ZB 1NCBL 4XNYL 4X6BA 4YIQB 4LSPH 3KPOB 5DRWB 4B50A 4ENEC 2X4SB 3QXTA 1I1RA 4Q9QH 4LCCC 2AXHA 1CDJA 3QAZB 3FOLA 1GHFL 4Z77A 1W8NA 3C6LA 3V6OA 4BUGA 4X4ME 2ZG2A 1KFAH 3GBML 3O2VH 4H8WH 4PJXF 3VFRA 3KPOA 1SVCP 3S36L 4U1HA 2YRZA 1CLYH 5D93C 2DAVA 1IGIH 1M7DA 1S7SB 1IGFL 3BGAA 4QHUA 4Z9KB 4WIQA 1JHTA 3JSSA 2V17L 4LIQL 4S0SD 4Y89A 4JHBA 3VXUE 3EZ8A 4YDIL 4HS3B 1IC4H 3T0EE 1DVFC 4M61A 5FEBA 2ADJB 3CXHK 4HPOL 4KK9C 2R0ZH 1OTTC 3S3PA 4YBQC 4Q9RL 5B39B 1ORSA 3V0WH 4L9DA 5F1KC 5T1LD 3TESA 5FV1L 1KTRL 4QF1A 4Z0XB 3GSQA 2K9UA 4HHAA 4NYLB 3NZ8B 1HQ4A 1SBSH 4GKZA 1HYSD 4NOFA 5HYSG 4ZSOE 3WFEH 5L2KA 1AC0A 1U95B 2NX5A 4GXUN 4QRPB 3B43A 3EJYD 4Z0XA 1YUHB 2X1QA 3FOMB 2MPAH 4NYLA 5IBLC 2ATKB 3QEQE 4UNTA 4PJXA 5CEZH 4Z5RA 4Y4HB 3QQ9C 4K23H 3T4AA 1LVEA 4ONHA 4POYA 3IJHA 3F7YB 3MOBH 1P4BH 3O2DH 4HEPG 4LCYB 1U95A 2AJXL 3VXRB 3UEZA 1W0WA 1RZFH 1YUHA 5CKAA 4X9BA 4XWGH 4XZUA 4LLMB 3AREC 5F7MC 3FN0L 2X4OA 3ZTJG 5IJVA 1Q38A 2X1PA 1E4KC 1WZKA 1H8NA 4M6ML 3VXRA 3GSRB 2EEDA 3RPIB 3W0WD 2HTKC 5FOJA 5MEND 1KB9K 4J4PC 1EO7A 2C1OB 2GAZA 4X7CC 1YNLH 4JZOB 1UWEH 3FB7B 1WCQA 3IGAB 1BHGA 2V6HA 5CEYB 2NY6C 1U8OB 2DD8H 1PFCA 4Q0XH 1R3HB 2QSQA 3RPIA 4P0DA 1LEIA 5KG9A 5JW3H 4UBDC 4Y5VA 3IDXL 5DMJB 5IQ7L 3OG4B 3OKDA 2BOCA 5HHOB 3O2DA 4UZGA 1A14H 1UCBH 2A83A 3RVUD 5CEYA 1U6AL 4HKZA 4ONFH 3QEUB 5AUMB 2YA1A 1R3HA 1D9KA 3QCTL 4ZYKA 2E6QA 5HVHB 3RUGF 1MCNA 4KGJA 4PRIE 1CE1L 2X10A 1BFVL 1I1AC 3TBSB 3ZDXF 1K9TA 1RIHH 3P4OB 5HHOA 1LMKA 2OP4H 1RZJL 2VRAA 3D3VB 4ZFOA 1G9MH 5LBSH 3MLZH 1MRDL 2AK4D 3QUMH 3MV7D 4ZAKC 1SEQL 4OFVA 4G8FB 4F58H 4P48A 4DUXA 4PJDE 1TMCB 2FH6A 4HF5H 2B0SH 5D7JB 4RNRA 4LLYB 1LK3L 4QLRA 4QHMB 5GRVL 4IDLA 3UTZA 3KYNB 1QO3A 2EZ0D 5ELIA 4NDMB 2EDWA 5INDA 4G8GE 1T1XA 5DD1H 1EFXD 2IAMD 1AXSB 3KYMA 4H88H 4HS8H 4HXAL 3ZTJH 3GSWA 2DTML 2EIBA 3IFNL 4QTHA 3RP1A 3MACL 4FZ8L 2AJVH 4I77L 5LGJB 2VDQH 4FFYL 4KI5D 3WKML 5C71A 2CR6A 3SE8L 1JPTH 3KPQB 4NNXA 5CMAB 1XR9B 1LK2A 4WU7B 4U6HB 3OKEB 5HYSA 2XPGA 3LKNB 4P49A 1EEZB 3ZHKA 3C60C 5E2TL 3QUMA 1OT2A 3EGSA 4ETQA 3TFKC 2GTZB 3MREB 4ZXBB 2FBJL 2R8SL 1BQLL 4Y8AA 3QB7C 1MIMH 3GSNH 5SV4A 4LVOC 1A6AB 3KPQA 2WBJB 3AM8A 2WV3A 1XZ0A 4G8EA 4TTDD 3U7WL 3VFWA 2WWMD 3FO0L 3OKEA 3QNZA 2K7PA 2DL2A 2MKWA 3QWRA 5GRUH 4OLZH 3G5ZA 1NCUA 3MREA 1WC7B 3HC4H 4I1NB 3NVQA 3L95B 4M1GH 5BJTA 3ABZA 1F8TH 3GSUA 3D6GA 1B2WL 4XP9H 4JJ5A 3TT1L 1HILB 5IF0B 5ITFB 4XPGL 5I71B 4F7PB 1BVLB 2JJVA 1KFAL 4UINH 3EYQC 2DYPB 3KNBB 4N68A 4WV1B 3HE7B 1UENA 4LRIA 3BP5A 2X40A 5KOVC 4LDEB 3TT3H 4LPUA 4AL8H 1XH3A 4KWUA 1EJOL 5CHNB 5IF0A 3X13B 5C0FB 4PGBA 1IE5A 3OKMB 2PW2B 2DYPA 4JR9L 4F7EB 5D2NC 2G75A 4Z7UE 4JVWA 5I1EH 4L8BB 3HE7A 2A77L 3OAUH 2F54B 4NCDA 1ZE3C 4K8RL 3OSKA 4LKXA 4WU5B 3UAJC 1CDGA 4LBEA 2GTWA 4L3CA 5CHNA 4HIEA 32C2A 4JFZH 5C0FA 2J4WL 5HTSA 4FQXD 3BJ91 1ZGLA 3P9MB 5ALCH 4NJ9L 4ZTPH 3SKJL 4F7EA 1DQLH 4L8BA 4TUKL 4OLEA 3PJSB 3SO5A 4KROB 4BQ6A 4BZ1H 1KT2B 4FP8H 3NCCB 2RR3A 5I1KL 2NTFB 4J3OC 4WU5A 5C0JA 5CGYC 4WHTA 3M17A 1XIWC 2X4NA 3P9MA 5CSBA 3SO3B 5FAAA 2P7TA 2YD8A 4N9GA 4PTTB 2AK4E 5F9DC 1IAIH 5GRVK 1T2JA 5E8NA 3D25A 5GGSY 5GZND 3VGBA 4JDTL 5EO9A 1XR8A 2GCYB 1MVFA 3HZVB 4S1RH 5F3BA 3SDXF 4JFFB 4JQIL 1C5DA 1FE8H 5FXCH 5HDBF 5E4EC 3NCJL 5EOQH 5C09E 1CQYA 3N0PB 2B4CH 3O2DL 3O6KL 2ZJSH 4G8IB 4PTTA 4FHBD 1NCAH 1RZFL 1S9YA 3SE3A 4WNQB 1HHIA 1B9ZA 1NJ9B 2YBRB 3GSXB 3LN4B 3BRDA 1F3RB 1FN4A 4KQ3H 1KB5H 2H32H 3VFOB 4CMMA 2BJML 1RZIB 4YX2H 4WI2A 2YD7A 1J8HB 3G04A 5D2LB 4WUUB 1U8HB 3C5SA 4NP4L 2DQDH 2F19L 1YN7B 2XI9A 4H26A 3WN5B 4ZFOL 5DD5L 2V2TA 4IRSC 5C0BE 4NQSA 2AXGA 1NJ9A 4IRJD 5J56B 3SCMA 4PS4H 3VFOA 5F6HI 1CZ8H 2VDKL 5SWQB 1J8HA 1N6QH 2YA0A 5HPMA 1U8HA 1RIUH 3DHJA 1YN7A 2NY4C 2F15A 4WGWB 4PGJA 5IG7A 1N26A 3W39B 1FV1B 3H3PL 1MSPA 5D6CB 3BDYH 3FRUB 2B1AL 3IDJA 3RX7A 2FX9H 4XVUD 4HPYL 4HWBH 4MNQD 5KANI 1MPAH 2Y06H 2P5EA 1KENH 1L7TL 1MLCB 1N8ZA 3LS5H 4OLUL 4D9QD 4YDLB 4X80L 3L7EB 4XPFL 2X42A 4NWUH 3MCLH 4FRWA 1FLTX 3DI3B 3SDXA 3TZVC 3U9PL 2DMCA 4OUUB 2H32A 5FYKD 3V4UH 4YUEL 3W11D 5ERWA 3ULVF 1K3ZA 3C5JB 3ZMRA 3QUYB 5J57B 3JWDH 3L7EA 5KVFH 1G9ML 2B1HH 2VDRL 1SYVB 4P46D 1IGTB 1FG2A 2Z31D 1UEMA 1MI5A 3QI9D 4NGHH 3UYRH 4JM2B 3M45A 4ORGB 3ARGC 4G5ZL 4XBPA 4OUUA 1VFMA 3QIUC 3BP7B 5FO8B 4LCIL 4DKDC 3F6LA 5FHBH 3H0TA 2GHWB 1INQA 4TUJA 2OBGA 1OQOA 5HGBA 5DD1L 1CIDA 1VPOL 1OT1A 1WAAF 3NZHH 3QDHA 4JM2A 4NHCL 4KVCL 5JTWA 5C6TL 4U0RB 2AXFB 3HUJF 1SEBB 2DRUA 4JPKH 2WINB 2H2SD 2AJVL 4M3JA 2UYLA 2VDPH 5SX4H 4M1DH 2X7LB 2BNRB 5EULV 3BGFC 4NNPH 2NLJA 4ZFZA 1Z5LB 4WI8A 1YEFH 3VWJB 2OZ4A 3DVGB 3V0VA 1JPTL 1AGBB 1PG7W 3PGDB 1U93B 1YY9C 3IJSB 3GSVA 3MBEB 4HX1B 3MYJA 4PR5A 2AXFA 3THMH 2NY0D 2R2EA 5ADPH 5AD0A 1F02I 3VGHA 4L3EA 2NNAA 4Q6IC 2H9GB 2VXUH 4HLJA 3N1GC 3QDJA 4UV7H 5KVEH 3BPOB 1WSST 3VRJB 4OF5A 5IP4A 3DVGA 3EO0A 4HUNB 5A16A 1AGBA 1JF6A 2RQ8A 3G6JB 4LSRL 3BZEA 1J1OH 2H9GA 4GW5B 3CK0L 3SDDD 3CSBA 1MAKA 3HC4L 1BFTA 5B38B 5D1XA 3ARYA 3NAAL 3S35H 4P23A 1HEZA 4B0MM 4JN2A 4KK6D 3U48A 4XP1L 2QQLH 3UTSB 4XMPL 4OI9A 4HXBL 3G5VB 1JHLL 2I60H 3UBXG 2Y4SA 1KNOB 5D1ZA 1KJMB 5H2BB 1SJEB 1BJ1J 1WAAA 3KLAB 1LE5B 3NN8A 2CIIA 2VLRA 3NIDE 4NO5B 3KPLB 1YQVH 3VMPA 1GPOL 4M6NH 3DUSB 1E4XI 3MQIA 1CD1B 1PYWA 3KPRB 3T4YB 2B20A 2DICA 4KV5E 1OL0A 1SJEA 2W0KA 4OM0L 1IAIM 3Q5YA 3BVNB 3GHEH 2Q86B 3BN9D 4P2RB 3G08B 3KPLA 1MCEA 4EIZC 4GUPB 2VQUA 3EO9L 1NGXA 1VESA 3KPRA 4LPTA 4FNLL 3RRQA 3T4YA 1XF2A 2VLMD 2AI0H 2AK1H 4Y4KB 2XTJD 1FVDA 3KYAA 1RUPL 1YYMH 2Q86A 2LTQB 1Y0LA 3H3BC 4LQFL 2ED9A 1UZ6E 4IJ3B 3ZSTA 4GUPA 5BVJB 1CQKA 1CDUA 3N06B 4XB7A 3N50A 1NGYB 4MB4A 3RHWK 2IPUG 1I9IL 4MJID 4BZ1L 4FP8L 5JIHA 3O3AA 4ISVB 2E9JA 2KUTA 5FYKE 1AGCA 4FFWC 4P4KB 1PKOA 3DBXB 4JCMA 5E6IB 3VWKD 3BX7C 4YPGB 1VFAB 4RGND 2NW2B 5BVJA 1JYWA 4LK4A 2KBGA 3FO9B 1GGIH 3IFOB 1NGYA 2FECL 3D39E 3F7PC 1CN4A 4ISVA 2ZCHL 5T33H 5HI4C 4GAJL 4PJGF 3S97C 4NFCA 5CUSH 3GGWB 5C0CA 4NQCE 3QDGB 3KYKH 2Q8BH 4LPCA 3CGTA 5CZVH 2QTEA 1ZLVH 4BSJA 2W60B 2BX5A 2DMKA 1TJGH 3U7YL 3H7BA 4Y4FA 1JGLH 3HG1E 4I0KA 3MGOB 4GMSL 3QUXD 3RBGA 2ZSWB 4K9EL 2DQDL 3FTGB 5EBGA 1ZHKB 4RISL 2F74B 4JKLA 4WVRA 2FD6H 5D1QB 1IEBA 2OSLA 1A1OB 2YUXA 2H8PA 3GBNH 5JW5A 5H94A 4HUKB 1CZ8L 3QO0B 5DI8A 2ZSWA 1Z9OA 2ADIB 4CN6A 2F74A 1ITBB 3D69B 3TJHD 4MLIA 1I1AA 4N0YH 4Z8FL 1CDBA 1CL7L 5D1QA 2CR3A 4IIQA 3WIIL 1A1OA 3I3BA 4KVNL 1FO0A 4JFXB 5BZDA 4JFEA 4KU1A 2BXYA 3M07A 1KENL 4HMDA 2ORBH 3LS5L 5D8JH 5I6XC 3DURB 2VABB 2QR0A 2ADIA 2Q8AH 1G7JB 4YXKL 3NH7H 4LP5A 5JOEA 1J1PH 5L0QC 1HHKA 3JV4B 3GI8H 4PJGA 2A6IB 4Y19A 4AQ1B 4APQC 2OZ4L 3ET9F 3K1KC 3Q0HA 4JFHE 2UVEA 3LKPA 3QPXL 3UYOD 4HEME 5IMOA 4W4OC 4NM8H 1T0NA 3ROLB 1F90H 1GOHA 5CZXD 1CFTA 4HULB 3BEVB 5D7LB 1FZKA 2NY2D 4UTBH 3SKMA 5DHXB 4NZRH 4XX1E 2ZSVB 5J3HC 5JHLL 4F15B 1TQCC 5F9OL 2ZUXA 3DX8A 2A6IA 3HTLX 3TA3B 1YMHB 3B8SA 3TVMC 2OTUA 3ULVL 4RX4D 3HR6A 3ROLA 1KJ2A 3B9KD 4UT7L 3BE1L 4OQTH 3BEVA 4YGVB 1IFHL 2HKHH 1P69B 3U4AA 6FABH 1CFQB 3JV6B 4N5EC 4U3HA 2OMBA 5CS7A 3JVGA 1AFVH 3KS0J 1YMHA 3H8NA 4NQDA 2KL6A 5T3ZD 5FV2A 5E0QA 4JPKL 4WGVB 3BW9A 1A9BB 1RZ8B 2VLME 4JPVL 1HI6A 2VB5A 3LHPH 5LG1A 2CLVB 4MA3A 4MXVE 3U0WL 1YPZB 4L4JA 3HI6H 1KCVH 3OKKB 5DJDB 3VFVA 2PTTB 3OKNB 2BOBB 4X6CB 3NTCH 3DMMB 4GBXC 5DMKB 5TDNB 2Q3AA 1A9BA 1RZ8A 1DBBH 2VE6A 1JPGB 5KW9L 5CILH 3ZT6A 1L7IH 2VXUL 4PG9B 4QHKJ 3ZYJA 2WQ8A 1MAML 5GRXG 2A9ML 5DJDA 4RBPK 1X7QB 2EDBA 1DQTA 3OKNA 1F6AB 4G9FD 2VN4A 4WO4A 4F33B 1X5KA 3WDIA 3DMMA 5DMKA 1JYXA 2B5IB 4ZODA 4DGVH 1JF1A 4FQ2L 1X4XA 4FXLA 1Q9OA 3QXAA 4HV8A 2X4RB 3EDKA 3GBLA 3LIZL 3TIEA 2YD6A 4NQVB 3K2UL 4M6OH 1X7QA 1RAMA 1XAUA 1F3DH 1IM9B 1BVKB 1QSFD 5D96C 3EDJA 5DURD 5IFJA 2PYEB 4LCWD 1GZQB 2I60L 2J7LA 4PB9H 5I19H 2X4RA 2IAND 2A0LC 3GKWH 4PLKD 4XNZC 3QHZL 1RIVL 1OP5K 5D7IB 3RWCA 4UV4L 1KIQB 5ESAA 4OSUL 2E7LA 5DWUL 4LHJB 1EUUA 4FZEL 1IM9A 1GC1C 4X4ZA 4RGMB 2PYEA 3DJ9A 4JQXC 3VXOA 3GHBH 4R4FL 2DJSA 3PL6D 3GHEL 1RUML 3DXAA 3LD8B 4NKIL 1VA9A 3BQUA 4HJJH 4NZTH 4XPBH 1FPTH 5C0IA 1AR1D 1U58B 4Z95L 3FMGH 2J8HA 4UNUA 2CRMA 2HFFB 2IPTH 2DQEL 4F3FA 3IYLW 4ZUWB 1OAUL 3CDGB 1N5YH 1F45A 1D6EB 3DPBA 5CCKL 3UJIL 2Q3ZA 1DQDL 1OD9A 2PCPB 1JVKA 3KJ6H 4GKSB 3VG0H 1S7RB 2QL1A 3EW3B 1ZOXA 3MRCB 2CRIA 1NCDL 2YZ8A 2OR9H 4URTB 5F6HJ 3MLYH 1Z9SA 3N1FC 4R0LC 3KDMB 1WEJH 2BY1A 1BAFH 2AJSL 4ZUWA 4F7MB 1XF3B 5ESVA 4BH8B 4LRNL 2HTLC 3ARFC 2ED8A 4N1HB 3G5YA 1K4CB 2BSSA 3SJVA 3G6AB 2HRPL 4Z7WF 2DQGL 1S7RA 4L8SA 4MNGB 1FBIL 3IXTA 3MRCA 1MRFH 4CADB 1JNLL 5BMFL 3EYFA 2MHAB 4JEGB 1FO0L 4DKFL 3IU3A 3KG5A 3V5HB 4KJQD 1W0VA 3MLWH 4OCWL 4UI2A 5E70A 2V7HB 4HQQL 3G6AA 1DEEA 3PF2A 2XQYK 2IGFL 4MNGA 4CADA 5KVDH 5KSBE 3LV3B 1X5HA 2YOCA 3AXLB 3VFTA 3ZL4L 1I4FB 1SY6A 3C08H 2D03H 3DOSA 3HMWL 5HHMB 3FFCA 2YMXH 2JJSA 1FGVH 3QXUA 1RU9H 2FO1A 3A6OA 1MFEL 3PHQA 3QDMB 3BKML 5I76A 2FD6L 1F4YL 1GSMA 4P5TC 1BIIB 3AXLA 3I9GH 1MFDL 1KEMH 1U8IB 1JTPA 2NR6C 3MJ7A 4F7CB 1MJJA 1H3VA 3OPZH 5C0EA 1KJ2L 5IMLB 2GJ6D 1BGXH 1UM4H 1KCSL 4PJ8D 4KI1A 5GGUA 2RCSH 4GRMB 4RGOH 4JQVA 1DQQB 4GLRH 2EDLA 4G3YL 1X5JA 1SHMA 2GJZB 3VRLF 4U1KA 3W9DB 3NFNB 1FL3B 3CFKA 5GS3A 3MGTB 4Z7WA 5D8JL 1MJUH 3L3OA 2NY1B 4OLXH 1ZANL 2BP3A 5KSAC 1A0QH 1HH9A 4CMHB 2CK2A 1YJDH 4UIMA 3CVHH 4OF3A 4UU9A 1IAII 3ARGA 1QSFE 3NMEA 3JTSA 5CP3H 4HZLA 4IMLB 4X99B 4LCWE 3OZ9L 4DTGH 4F80A 4AJ0A 1F90L 2HP4A 2FH8A 4X9IA 2ZUTA 1MCJA 4TVPH 2NW3A 3QEHB 2EIZA 4EQ3A 5HYJD 4UAOB 2RIKA 2VLKA 1P4LA 5I1LB 1MWAA 4C55A 3FN3A 4JREB 1NCWH 2P5WA 1D5IH 4YHIB 1TCMA 1QBBA 5ISZA 1VENA 4F9LA 3BH9B 5GGRA 1AQKL 3EUUA 3KPSA 6FABL 4GRLD 4S1SH 2J6EH 1FDLL 5IHZB 2XKUA 1DFBL 1HYSC 4HG4K 3PXJA 3S34L 2V9QA 5C0AA 3OX8A 1QSVA 3DSNA 4HIJA 4P2QA 5FECB 1C5BL 1OTUD 4JO1L 4QHLA 5IHZA 1JNNH 1NLDL 5CP3A 2UZXB 1VEMA 4TPRH 1TPXB 2YEZA 2O5ZL 5EOTA 5T1DL 1BZ7B 2ITDB 2BY2A 4IOIB 4EUPB 1PBYA 1HZHL 1UWXK 1INEH 4GAGH 1NDGB 1JV5B 4GKNA 4JFDD 4YDVB 5HHXL 1G7PB 2VDLL 4O9HH 3CXDL 2APXA 3V4VL 1WITA 3T09A 2E6PA 4NWTH 4EUPA 2H2PC 1JCKA 1C1EH 2CKBA 5ICXB 3RIAK 1MHPH 4HDIB 1RJLB 4X4YB 4I0CC 1FNSL 2ZUQB 4M6OL 1ZAGA 3BHBA 3NFSL 2F58H 2VSCA 2DQHH 3CZJA 2IALA 2AEQH 5EU5B 3QCUL 1TETL 1L6ZA 3B2VH 4X7SH 5J11B 3VD3A 1ADQA 4E41A 1IC7L 1HQRB 4Z0BH 2X44D 3RGHA 3EHBD 1T0PB 1T5XA 2YD4A 3HNVH 1A3LH 3PP4H 5E95B 2A1WL 4OCSH 3RVUC 3GK8L 1RD6A 3AS2A 1KTDB 3LMJH 1U92A 4WHCA 5DJ8B 1I3RB 4PJEE 3G5XB 1IZKA 1RUQH 1CG9B 5I74C 1NEZG 3M8OL 5E1HB 3O6FC 4M6AA 2EC9T 1CD0A 3MJ9A 5H37G 2JK5B 4N0FB 3PV6A 1KTDA 1BLNA 4OZGF 1GOFA 3TIDB 1I3RA 2IPTL 5K59F 2EDDA 1IGCH 2HG5B 1EDQA 4X98B 1CG9A 4NKOB 5JLZB 3TC9A 1SY6L 4QNPE 5DRZB 5ESQB 1CICB 1DDHB 5D4QA 2BVQA 3C5ZB 2JK5A 1JWMB 2EZ0C 4HKBA 3WEXA 1U8JB 5FYLH 2OR9L 2IAMC 2XOTA 4PP2A 3TIDA 4QRTA 1XGUA 5AG8A 3VXNA 1RFDL 2MCPH 5KN5B 5CJBA 2G5BA 1WTLA 4RIRB 1ZT1A 4J23A 4YHZL 1W72B 2YD1A 5JR1L 2A6KA 3QA3A 1QEWA 4OD3L 5E8OB 2BK8A 1HIML 1IKNA 4ZTOL 4YXHL 3ZYOA 2E7MA 1I1FB 2EEBA 2QJDA 2VXQH 3SGEH 1SM3L 1T7WA 4KPHH 5D7KE 3INUH 3OR6A 1BJMA 5CJQH 1NCTA 4K71B 3A0OA 3WFBH 3VGGA 1WFOA 2FATL 1W72A 4PJCB 4JHAL 2EDKA 5F7DB 5E8OA 2OX5A 1T2QL 3VXPB 4OCYL 5MI0C 4DEPC 1GIGH 4FG6D 4MDIA 2V7NA 5GRJH 1U8MB 5BO1H 3KXFD 1NLBH 1AXTH 5F7EL 1DUYB 5DJ2B 2BNQE 2WWMC 3R4DA 2ATPB 4OZGA 5D5MB 3IFLL 1DE4B 1LD9B 2Q7NA 3QO1A 4DW2L 3OR7B 5EDXA 4FOMA 4R4ND 4YWGH 1EGJH 4LVHB 1Q9LB 1JI2A 2VXTL 4D9RD 3BP6B 4EI5B 2Z91A 1U8MA 1JZ6A 3MZGB 1MWAL 4IDJL 4PJAB 4JPIA 1DUYA 1AO7B 1NGQH 3JV5A 3AMLA 1NMAH 1DE4A 1I9JH 5JDSB 1LD9A 4RGOL 3K4DA 5I0DA 2VJXA 2J88H 5I0ZA 4XMKH 1J10A 5BVPL 4NN7B 1NC4D 4YC2C 5DJZB 3RX5A 4F8TA 1PLGH 3QIWA 2JELH 1BPVA 3MRKA 4AIZA 1A0QL 2X4UB 2IBZY 4CDHA 3S96B 1YJDL 5J13C 4PRNB 1A4JA 4XNQB 3S88H 4XNMA 1K8IB 3RZCD 1KCKA 1J86A 1OGAE 3BUYB 1NBZB 2C7UA 4CVXB 3TVMA 5I8OH 3RPKA 1OCWH 1E6JL 1KJ3H 2DS4A 2VERN 3OKOA 4JB9H 4A6YB 3QUZD 1CLZH 1G84A 3MCKB 5E5MB 2X4UA 4HW6A 5KSUB 4ZPVB 3L3HA 4UT6H 5CJOL 3HE6D 1EPFA 2GFBB 4XNQA 3SGJA 1IBGH 1AJ7L 2O5YL 1F6FB 3BUYA 3L3GA 4FQXC 3OHXB 12E8L 3L1OL 4L4TA 4MNHB 1QR1B 4ODXB 3BKYH 3UBXI 1NEZA 4I3SL 2ZPKH 4TULL 3CPLB 3MUJA 5EA0L 4NO2B 5I8KL 1QBLH 5CP7A 5E5MA 2CKBL 1AQDB 1JTTA 1A6VH 1HNGA 2FNBA 5KSUA 2R9HD 1ZVYA 3P0YH 4KDTC 4JFQB 4YHML 5I1IL 4XPAL 3VA2C 4C83A 3LZFH 1JRHL 3VGAB 1GC1H 5L88L 4XAWH 5D70H 2IADB 1A9EB 3UJTH 3PXHA 4HH9A 4I48A 5GZNC 4DJMA 1TIUA 4NO2A 1ADQL 3UDWA 4ZO8A 4JRXE 4YNYB 1MCRA 2XKNA 3O3DB 1X5GA 4FQQB 4JKKA 2IBGA 1G9NC 4ZS6C 2IADA 1EEUA 5DGQA 4GAGL 4ODSL 1I8MB 4L4VA 1NMBL 4KGLA 1AGEB 1FORL 4AH2B 1B0WA 1RULH 1N2RB 5TH2B 5JPMB 3PHOB 3QP3A 4LNRB 5I1HH 1P9MC 3TBTB 4WCYH 4PLJD 1WBXA 2HJKB 3MJ9L 3T0EA 1QRNA 3GMOB 1MCOH 5JPNB 3O9WB 1XGRA 3TBWA 1N2RA 2LU7A 4IRJC 1X5YA 5MEPB 3C09C 3PHOA 2P44B 4ZPTA 5F1NB 4KTEH 1SMOA 1ZLWH 2LAAA 3B2VL 4KKBD 4X7SL 5ADOL 1DBJL 5JXEA 1D5BA 3R8BB 3BI9X 5IROC 1S3KL 5T3XL 5I9QC 5MEPA 4PRAB 3O4LE 3WBDA 4LIQE 4MAYB 3BXNB 1TJIL 4RFOH 4RAUA 4L8CA 1M05B 4G6FB 4ERSH 3QNXB 1U8LB 3FO1B 4WWKB 4D9RE 4R6UA 5C2BH 5KZCD 1KIUA 1WJ3A 2IFFH 2CLRB 2D7QA 5E5RB 3QEQA 2AJUL 4WTZG 1CE6B 2R1YA 3HI5L 4WI3A 3NCFB 4WFHD 5DMIL 2XACC 5IVOA 3BXNA 3C6LD 4LLWB 1XCQB 1W72L 1C12A 5HJ3A 2AERT 3EFDH 1M05A 4KMLB 3D85A 1VSCA 3IU4L 1A8JH 4YHYB 4WWKA 3DV4B 1FSKC 3GJFA 4GXUM 4KKCC 3GSNB 3FQNB 4OKVB 2V2XB 3DX9A 3FAXA 2W9EL 4I5BA 3Q6GL 3BH8A 5GQBA 1KPUA 3TO2A 2EXWC 4I0PA 4LF3B 3UO1L 3MUGB 1I7RA 2ESVA 5DJAA 5CJ8A 4AEIL 1D5MA 2VR4A 3X11B 3OKYA 2H2SC 2R2BB 4R2GB 1NCNA 3DUHA 3ZE2E 3V8CA 5I8CB 3BIKA 4RWYH 2DWDA 2P4AB 2VXQL 3LSOA 3S3JA 4KMTL 4KPHL 3WS3A 4JKMA 1HDMA 2AV1B 5IVNA 5EZOL 2MJWA 4KUZH 3NCYS 5CJQL 3EDFA 3FT4A 1TNNA 1S9VA 2F9BT 4GQ9H 5I1GL 1T22A 4O58H 5B8CB 3DX6B 2VWEE 5SWSB 5IEKB 2QKIB 3S4SG 1RZ7L 5L2KD 2R29H 1NBVL 2NX5D 4PRIA 2BSTB 2OJZL 1A1NB 5EIVA 2AV1A 3LAFA 2PXYC 4U6XB 5DDHB 2RFXA 3DROB 4QRRE 5GISH 5C08A 1H0DA 2XFXA 5KBNC 3DGCR 3S37X 4EDWH 4JCLA 2UWEB 3SDDC 5TPWL 1JZ7A 4HJGA 3MR9B 4NM4L 4QRQB 1X44A 4ZS7H 5IT2H 2VDOL 1V5JA 2RBLA 3CSYB 4LFHG 5DRNB 5KSAA 2EYTB 4A6YL 2YHGA 1UJ3C 4H1LG 1DLFH 3EAKA 4XI5C 5D72L 5IB5B 2UWEA 4FQHB 5FKPB 4NQEB 2OL3H 5K33A 2NPLX 5E9DB 2ICCA 1YY8B 3I84A 5HD8D 4IS6B 3MXVH 4PBVC 5C0RL 5L9DL 5IJKC 5F9WB 4YEEA 5HYIA 2R4RL 4ZNEE 2YPKB 4JRYE 3CCHB 3QNYA 3SKOB 3BN9C 4DZBA 1BREA 5TF1L 5FYJL 2V5SA 1T1ZB 4FQJL 4M9PA 4KKLD 3X3GL 4M7LH 3VW3L 1RUKH 3AB0C 4IS6A 4XCEB 3VXSE 5CEZD 3P4LA 2HVKA 4Z7QF 4CU6A 4QGYA 4NKDA 4Z7UF 4DKEL 4ZUUA 5FUZH 2YPKA 3MROB 4K3DL 2EO9A 8FABA 2F53E 4Q58C 2YR3A 1LEKB 1FRGL 2P45B 2VN7A 4WRLA 4BELD 1D9KD 1P5UA 4MCYA 4R7NA 4LL9A 4WTZA 3RTQB 4XCEA 5I1JH 1IQWL 1DL7H 1QBLL 1MHCB 2VZSA 3X14B 2FB4H 3MROA 2R56L 5EPMB 3VWKC 2P8MA 3ZE0E 5IB2B 5IV2B 2H1PL 1KOAA 1UQSA 3EYVB 4MQ7B 4OCXH 4RGNC 5EZIH 4L29B 3HS0A 2R2HB 1MIEH 2APVA 4HFUL 1I3GH 1AHWC 3DUUB 4BFEA 3N1QC 4AQOA 1MH5B 4U7KA 1MHCA 3NIFE 3QJHA 3WXVH 4WW1B 5EPMA 3LH2L 3ARBB 5ICYA 4GLRI 1RZKL 4G42A 2ICWJ 2R2HA 1ZVSA 3E0GA 3VFNA 5I1DB 1Q94B 3MUY1 1BX2A 1MH5A 2YUWA 3CDCA 3S4SB 1DSFL 4EN3D 4H1LH 4U6VL 4PREB 2N7BA 1GVIA 2IH3B 3TN0A 1CK0H 3QUXC 4DFIA 4U1GC 3ARWA 5FB8A 3F8UB 4OTXL 5A3IC 1FHGA 1NKOA 4Z7UA 1F4HA 1N3NA 5I1DA 3BFOA 5HYFA 4NJAL 1OW0A 4TNVF 3S4SA 2NMSA 1YN6B 3T77A 3GNMH 4PJ9C 5C7XL 2IH3A 5C07B 2CRZA 2WNGA 4LCCB 4O2CB 1HHGB 5GGVY 5BCAA 4LAQL 2HA1A 4PJHB 5L2KE 4OKDA 2NX5E 1TFHA 5I17B 4JG0L 3MRRA 2GKIA 1BD2B 3RIFK 1OY3B 3O6FA 5IVXB 4LHUB 5GS1A 5D93B 1WZ1H 4HUWA 3FB5B 4PJXE 4PJ5B 3BEWB 3V5DA 2VL4A 3ESVF 1YZZA 4PJHA 3U4BH 4HGKC 1J0IA 4QTIL 5IK3B 3WUWB 1C16B 5EZJB 4ERSL 5E1AB 4XP6L 4XCYA 1MY5A 4MAUL 4YAQB 3SGKC 4ZFGL 2VC2H 4CW1B 4H1LA 2QQKH 1F2QA 4E5XB 4G6JL 4GW4A 4OIIL 2O5XL 5CZXC 1ZT4B 1S8DB 2ICWA 4YHPB 4U33A 3EIFA 5KAQG 1V3JA 2H45A 3WUWA 2CDFA 1C16A 2NY2C 5E1AA 2EDJA 1TZGL 3VXRE 2DQJL 1NAKH 4YAQA 2BY3A 4KHTH 1UVQA 3IXAA 3BAEH 1H15A 1K8DB 1H5BC 3U46A 1RZGB 4XPHH 2KZ1B 1NMCC 1R24B 3LEXB 3B9KC 1S8DA 5F88B 3WFDL 3HRPA 5CBAA 1MREL 4OI8A 2HFGL 5C0BA 3EO1B 4OJFL 5IB1B 4AMKL 4WHDA 1K8DA 3MXWL 3QEGH 2YPLB 3RWDB 1CFSB 5JA9A 1NANI 1UB5A 3CVIH 3QFDB 5A2KH 3VFPB 4LPXA 1J8KA 1E4WL 1CR9L 5IIEA 2CMRL 5LGHL 5GGQL 1IMHC 3ARDA 5TQ2L 2YPLA 4P4RB 4XBEH 4WUKL 4O58L 5FF6B 5HHOE 1DQJA 4LDLB 3R1GH 1ES0A 3L5HA 1RJYB 5FO7A 3AREB 2B8OT 3SDAB 2IPKA 1T83A 2DQIL 4NC2B 1F42A 5GJSL 3HC3L 2C1PB 5LCVL 1JFQL 4CU7A 1NFDF 5GISL 3UYPA 5C6PB 5D6DA 2FJFA 3JWOC 5J9PB 1KV3A 3D3VE 3SDAA 3IB4A 5KAQF 2C4FT 4P9ML 3DTXB 5FGSA 5FHAL 1PDKA 2NY6B 2YN3A 1EXUB 5FM8A 4I18B 5FFLA 1MNUH 2WMPA 4PLKC 4OZFG 4I9WD 4MSWA 4K7FA 4ZO7A 1MJ8H 4P3DA 5E94B 1BVZA 4MD5A 3MA9L 4EDXB 1G9NH 5C8JB 1RY7B 1DQMH 3MV8B 3OAYK 1KACB 3J8F7 3MV9B 3SBWA 5DHVH 2NY5C 3CUPB 4P9HC 2XZAL 4U2YA 3SCMD 2FWOB 3R0MA 1KUMA 4QT5A 3TM6A 1YYLH 2W65A 5CJXA 2CQVA 2CGRH 4EDXA 2E9BA 2ZCKL 1NFDB 1M7IA 5C8JA 2QLVB 1H3GA 1NSNH 1XGQA 15C8H 3SGEI 1A6UH 1UCTA 4L5FL 3HAEG 1S7TA 1YNTA 2HVJB 4XBGA 1RJZB 3CFCL 1A7OL 2R0LH 4ZAKB 3QULA 1P84J 1Q1JL 2P5ED 4RFNC 5C0GA 4JHWH 3QIBD 4YBLB 5GPRA 5I66A 1GZPB 3V6BR 4J3UA 3QCVH 1NFDA 4QXGL 4FN0A 4XPTH 3X3FH 5ALBH 5CIPA 5EC1A 1UZ6F 1G0YR 2HFEA 4L9LA 3RZWA 4BK4A 1ZWIA 3TNMB 5IMMA 5BV7C 3RTQD 2N4IA 1G9EA 3RVVD 3RWFB 1T0MB 1V7NL 35C8H 1I75A 1T4KA 2Z8SA 1GZPA 4RA3A 3C9NB 1MI5D 4Q6YA 1IARB 3RY5A 3NIGE 5GZOD 2MFNA 4M62H 5E8DL 3V4PL 4GW1A 3I50L 4BQCA 3A67H 2VZ1A 1ODAA 5FYKH 4JFYA 4OAWA 4XP5H 2OJEB 1NGZB 1IAOA 1S7VB 2HMIC 3QG6A 5AYQA 1JUFB 3CMOL 4MJ4A 4KJQC 3CX5K 1WFTA 4KRMB 4GRWH 4U7SA 3C60B 4XC3H 3D0LB 3F7RA 3Q1SL 1B4JH 1H3PH 4IMKA 3U9UB 2BCKA 4NQXB 3B2UD 4EI6B 3PWNA 2MSPA 2BSRA 4R3SB 5FUOH 5CLWA 3OL2A 4OM1L 4P3CL 2YD9A 3LRGA 2PW1A 3MJ8B 2F54E 4J12A 2ZOLB 4L3ED 2X05A 3KLSA 3RI5F 3BWUC 2UVFA 1Q9KB 3QDJD 1B88A 4LSUL 4R3SA 2VL5B 4PJ8C 1QVOB 3ULVD 4S1DD 5AZ2H 2R1XB 4ENED 5F6IB 3I6LE 4MXWL 2XWBA 1FNEB 1JNHB 3MRMA 3FQXA 2ZOLA 1IM3B 4JLRB 4FQCH 3KVQA 3KPMA 5IFHH 3D2UB 3VDAA 5AWNH 3BGMA 3MYZA 4X0KB 2QQNH 3MNWA 5D1XD 4P23D 1IGMH 3D39A 1N4XH 5DEFB 5DTFB 4OZFA 5T5FH 1WIPA 1IM3A 5D1ZD 4KZDL 2ADGB 3PGFL 3QHFH 3D2UA 4JFFE 4U1LA 3SY0B 2C4FU 3FB6B 1U3JA 4PGDA 1WZMA 2VLRD 4PRPB 5GRZA 1X6NA 5SWZB 4NQCA 1L0YA 1GYAA 4OLVL 5JHDB 4Z7VF 4KJYB 2QSCL 3ULSA 1DVFD 2E27L 3PG2A 4LU5L 1S7UA 4XHJC 1OF2A 2DQUL 4JY5L 3F6IA 3CLFL 4UUJA 2KQNA 2D2OA 1DN0B 1IC1A 4TSCL 1J8HE 5D2LE 1QQDA 4WUUE 4LASH 1WT5A 3O2WH 4GRLC 3HAEA 4YBHA 3FT2A 5JOFA 3SDCB 1XIWB 1M71A 5LQBL 1FZOB 3I6KB 3OKLA 4JANA 3TO4B 1ROWA 3A6BL 5JDJA 3KJ4C 3N9GL 3LOWA 4P2CG 5E2UH 1DN0A 2F5AH 3EYUH 5BQ7B 1Q9WB 5E99H 4JY4A 5FA3B 2JTDA 4YO0A 2IBBA 3SDXE 3WJLC 4MXVF 2WQRA 3SDCA 3U30C 2GSIA 4IOFC 1OAYL 4KDVA 5HI3C 3TO4A 5IBLD 3UPAA 4S2SB 1U2HA 1MFAH 3STLB 3MRDA 1WLHA 3QQ9D 5K9QI 1U8NB 3ARTA 1PKQB 1MHEB 4DZ8A 3OGCB 1VKXB 1FP5A 5EH1A 5FA3A 2XWJB 3MZTA 3P0VH 4X6EB 3WSQL 2DWEB 1PQZB 3SE9H 3HZKB 2WM0A 1KCUL 4M4PA 1Z0NA 1IT9L 2LQRA 3FONA 3STLA 2X2YA 2E7BA 5BXFB 4K3JL 1G7QB 4IRSB 4XRCA 4Z7VA 4PGZA 5AZEL 1NUGA 3P11H 4OZHB 3OGCA 1A1MA 4FTVB 2CIKB 4HUXA 1YEIL 2APWA 4XC1L 1NL0H 4P2OA 4BQ9A 4LPVA 4UIKH 1EAPB 3BKCH 4V1DB 5KVGL 5IVZA 2HTKD 4R26L 4J4PD 1QFWH 4PUBL 5DEGA 5B3JF 1U3HB 3E6FB 3ES6B 4Y4FD 5BRZB 2GITB 4LQ1A 4S11A 1TVBA 5DMGD 1MJ8L 4H0HB 3RJDA 3T0BA 1DBKL 5DD3H 1Y18A 5EU6D 5E7FA 4UBDD 3SE4C 5D9SB 2JB5H 3FHQA 3IDIB 5IBTH 2JJTA 1U3HA 3TZVB 5IBUB 2VLJB 4Y1AB 3WJJC 2GITA 1HXMB 1GGBL 2D4DA 4L3EE 1P7HL 3RL2B 2BNRE 1DEDA 5DK2A 3O6ML 2PYFB 4EIGB 5BS0B 1RHFA 1I1AD 1NSNL 15C8L 1SJXA 1KIPB 4HKXB 3IDIA 1WF5A 5J1AA 4JFED 1CBVL 1UH4A 5LAXB 4PRHB 1QKZL 4GSDL 3WE6B 2MWCA 3QIUB 4XTRC 1INDL 4RRPG 1RURH 4MJ5B 4NUJA 5I30L 3BT2L 4Y19D 2C26A 1T6WA 3G6JE 1DBML 1MQ8A 4HKXA 4LPWA 4RZCB 3O8XA 1P7KA 2EICA 5TE7L 1ZT7A 4PRHA 2YC1B 2VZUA 1WAAE 2VMFA 4UILL 4G6MH 2H3NA 4KRPC 2VLRE 1WCBB 3QFJB 3TJEL 3I75B 3BGFB 5FYJU 4WFEE 4YHKL 1EHLL 4HK3J 3HRZB 2BRQA 2R4SL 4I2XB 4JVPA 2IWGA 4JFOB 1TJHL 5JOPD 3RX8A 1LDPH 1Z3GL 4U6YB 1OAZH 3UTTB 1WCBA 4FMKA 4LSQH 2VLLA 3I75A 1YMMB 1ZSDB 4NQDD 3CVHB 1RI8A 2GT9B 1R3LA 3KPRE 4OD1H 1KJVA 4FG6C 2Y07L 4PJ9A 5KSBF 1EVTC 1KPVB 4P2RE 5DD0L 2Y7QA 1UADC 2NXZC 4YHOL 4M5YH 1KULA 1P1ZB 3CU1A 4LLUA 1YMMA 2P24A 4ZO6A 1EHXA 3T65B 4R4NC 4TUOB 4NO3A 3BZ4A 3F7VA 3RU8L 3SDYL 1DCLA 2AEPH 1JJUA 5J6GA 2OTWB 3BJLA 1UWGL 3H6JA 4LP4A 1AIFA 3QJFA 1FAKT 4D3CL 4WO4D 5IHUH 1N0XH 4Y16B 2NXYD 1K2DB 4Y2DC 4C56A 3HMXA 4XHQA 1KN4H 4PJIB 2XZQL 4P57B 4XNUH 4JO2H 2WUCH 2PUQT 1R5VB 4I8DA 4X7TB 3RWIB 3RWJB 1T3FB 3TEUA 2I07B 2HT2D 2Q76A 2VAAB 3AROA 2ARJQ 3EYQD 5C0CE 4X5WA 3RZCC 5DJCA 1ZLVK 4Y16A 4M43L 3L5JA 3S6CA 4Q74A 2H41A 5FDWA 1SBBA 4R96B 4PJIA 3BIBX 1DR9A 3U4EB 4P5MA 3FQRA 3QUZC 3RWIA 3AFLA 1T3FA 5ACZB 3JWOH 5DUBB 2XA3A 3QDGE 5EU3B 1T03H 3FZUD 5KSBA 4YHNA 4NKMB 3U0PB 1V3LA 4LNVA 2K1MA 1IJ9A 5HY9B 1ONQA 5JQ6H 3DXAD 1J9CT 5DRXA 2VUOA 4R8WL 5IB3A 2VWEC 3BQUD 2R9HC 1MFBL 1D6VL 1XF5B 3C8HA 2YWZA 1FH5L 2R69L 2VAJA 1JGEA 5EO0A 2NY5H 2FIKB 4P9HH 1CLOH 4RRPA 1QFWM 5IR1B 1RQ5A 1B4RA 1LO2H 3C8KB 4JPWH 3ALXA 5DK0B 1B0GB 2E8ZA 1UM5L 1MCLA 4PJGE 4D94A 5HDQL 4N5UA 3PQYB 5ILTL 1XF5A 2B2XL 3W9EB 2W0FA 5DUPH 2MKLC 5DSCA 4PJ7B 1S9WA 3D5OF 4JKWA 3KAAA 2F8OA 4FXKB 3BSZH 3C8KA 1KCRL 2DDQL 5FCSH 3SJVD 3RWEA 3VXTB 1R5WB 1PX3A 5IB4A 1JHKH 2EH7H 3DSFH 4PLJC 4IHOA 5EUOB 4YZFE 3T2PA 5TDPA 4LLQB 4DCQB 4GAYB 3VU2A 1UXSA 4KHXH 5D7LE 5BV7H 3LQZB 5CJ5A 1RZJC 4YE4L 3BKCL 2OTPA 3WNLA 5HHPB 4RWHA 5K9KA 3IDNB 1OAQL 3RDTC 4DCQA 2QADD 5KSVB 1FAIL 1WFNA 3FFCD 2ZUSA 1U8QB 4K3GA 3FO2B 1OB1A 4DGYL 3S35X 2NY4D 5I6XB 3N1PC 1FIGH 2JB5L 2D0HA 5J6HA 3FFDB 5BZWB 4G7VL 5L0QB 1R3KB 4I3RL 5KSVA 1T5WA 2HN7A 3WIHL 5L8JB 3FRPG 3C2AH 1BF2A 2OXHA 1T20B 5T5NG 4E0RB 3SKNA 1YPZE 1U8QA 4ZD3H 4MA1B 4F7TB 4DQOL 1LQSR 4PJEF 1HH6B 4ZNCD 3L3IB 4XT1C 1PG7L 3O11A 4OIAA 4UDUB 3C6LC 2P42B 4OGYH 3V6OC 4C59B 4FXGA 5BZWA 5IW1B 1JGDA 5HGGS 4KQ4H 1TDQA 4OV5A 1MF2H 4UT9L 4TSBL 5EBMB 4F7TA 3MODH 4RQQB 4M7JH 3ARGD 5GSRA 4QNPF 1FVEB 1G7IB 1KC5H 1M7XA 5IW1A 2GW5A 3RAJL 2WLZA 5C2UB 1XGPB 1ERNA 1QPXA 7FABL 3T2NH 4RFEB 2Q87A 5GIRB 4BA8A 3GM0A 4TRPH 2VLKD 1FVEA 3MRNB 1G7IA 3P30H 3RKDD 2PYEE 1IC5H 4KK8C 2XN9A 2P5WD 3JWNC 1JGUL 4O51B 3HMXL 2YSSB 5ISZD 4GG8B 5D7IE 4GBXB 4Y8DC 4QOKB 3KPSD 3DXAE 4TQEL 1CGVA 1OAZL 4HWEL 4RFEA 5FM5O 3VGDA 3MLVH 1NDMB 3L6FA 1QYGH 1YY9D 2AABL 3BO8B 1F4WL 4K7PL 2Y72A 4PJEA 4JKPH 4R9HA 1C08A 1I8KA 4NO0A 4GG8A 2IQ9H 3UPRA 5FGBA 2JIXA 4P2QD 4ELKB 4BFBD 2FEDC 5T5NF 2BC4B 1UB6A 5IM7B 4K07A 4M1CC 2HFTA 1BEYH 3UPCA 1EHAA 3VFMB 2UZIH 4P5KA 4KK5D 1KELL 5D96B 2BZDA 1QSEB 3WHXB 4K8RC 4TVPD 4EVNB 1HKLH 3VXMB 4JGJA 3S98A 2IFGA 3IFPB 3FAWA 3O45A 4MS8D 3H9SA 5E5UB 4Y4HC 5IM7A 4XNZB 1N7MH 3VE0B 4LCUB 4MDJB 5E6ZA 3P73B 1G7MA 4PV9A 4X9GA 3CXHJ 5IW6A 4HFWB 4BFIB 4JO2L 5ETUB 4WFGE 4EZMA 2NY3B 1MCPH 1QSZA 4O4YH 4KAQL 1IEHA 4OT1L 3VE0A 2W59A 2AP2A 2F5BH 4LCUA 3P73A 3A6CH 4MNGE 4TYUA 4E41D 1FJ1B 5GGVH 2MNUA 2AJYH 2X89A 3IT8D 4HT1H 4KKLC 1BZ9B 5DJYA 5FOBA 2COQA 4Y5VC 4M7KL 1FYTB 3FFCE 2DLGA 1QLFB 4HZAA 2AEIT 1CI5A 5HPOA 2IH1B 3FRPA 4WI4A 5I18H 1D9KC 3IKCA 3MPCA 3GIVA 1BZ9A 3ZTNL 1E6OL 3OXSB 2BNQA 4OZIB 3I3EA 5J0BA 4M5ZH 1FYTA 5HHME 3IRPX 2YPVH 3B4NA 4R0LB 2EDFA 3MRQA 3ME0A 1X4YA 1PVHA 5DQDL 3QDME 4MZ3A 2NZIA 4MJ2A 3IVKB 4HUUA 3C6SB 1K6QL 2VH5H 4B41A 1BF8A 3ARFB 1AE6L 2I9LB 3DX7B 4N1CA 3L5WB 2H26A 5HVHC 2XWTA 4FFWD 1S7WB 1VGKB 1BOGA 4HS6A 2VR5A 2Z9TA