1HI6B

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic Analysis of Anti-P24 (HIV-1) Monoclonal Antibody Cross-Reactivity and Polyspecificity
pubmed doi rcsb
molecule tags Immune system/peptide
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B02
3EO9H 2XFXA 4B7IA 4B50A 1JF6A 3I9GL 3GGWA 3T1FA 1ED3A 2HH0L 5FGRA 3V5KB 5IB1A 5IEKA 3CFBA 2X2YA 3LV3A 4KUCD 3OL2A 5HHME 3DXAE 2D9CA 1PQZA 4ZUWB 1XGUA 4P23C 2G5RA 5KVDL 4PRHD 2C5DC 4ODSH 1HE7A 2JIXA 4OCSH 2RB8A 4ZFOB 1G9NH 4LSDA 1NJ9A 1HIMH 2DF3A 2UYLB 1KLUB 4H25A 4YHNB 3VFPB 1N3NB 1QYGL 3CZFB 5GIRB 3RUGB 4KRPC 1Z3GH 1J5OL 1ZA3B 2I25N 2GT9A 1Z6JT 3ZT7A 3KLHC 1W72H 2XICA 3KXFE 3O6LL 1FN4B 5D93B 4JFDA 3QNYB 2MPAL 1EHLL 3PL6B 5E6YA 2JLLA 2FYYB 1W0WA 5JXAH 3TN0C 1MAMH 3SDCD 5F9OH 4YWGH 5CS7A 2E9BA 2IADA 1T03L 2J4WL 2NY3D 1CDCA 4NQDE 1RUAH 3AXLB 3LKPA 4WI9A 5I0ZA 4KTDH 3QIWC 1Q9KA 1AXTH 4MNHA 5IB3B 3OAZK 1MRDH 2DL9A 3QI9A 3WS6C 2K3TA 3DRTB 3VD4A 1FFPB 1X5FA 1T04B 5KAQF 1TZHA 1QBAA 5D2LB 5T3XD 5F8QC 4JG0L 2CDGA 4DOHE 5GSVB 1KXTB 1ZT4A 4Q97A 3PV6A 4XVUD 3GSQB 1XT5A 4NO5A 1JN6B 4X8XA 5GZNC 1GC1C 4K71B 1DBJL 3G9AB 4JZNA 5J9PA 4KFZC 3TVMB 5JIPA 3UTQA 4KVCL 2DIJA 1MCPH 5EO1A 3IFOA 3BSZL 3GMLA 4MGXA 4P2RD 4IJ3C 1S7QB 4MJ6B 4F7TA 5J1SC 2CR3A 2CRMA 3KPPB 5HGDA 3VXTA 4GRWF 4M3JA 1YA5A 3DHMA 1MFAH 5DD5H 5F9OL 1XF4A 2H6PB 3C87A 4GAJH 5JORA 2QADD 4HGWB 4G7YL 2NYYC 3QRGL 3KPRD 3VFVA 2PYFA 4R96A 2ENYA 2Q8BL 3QDME 4TVPE 6CGTA 2XG4A 4MX7B 3NFNA 4KUCF 1EGJH 3OBAA 3LKQB 2BVOA 4EDWL 4EUPA 2V2TA 1CS6A 3AAZB 4X5XB 4GMSH 5D1XB 1U8IA 3RY6C 5GGUB 5DZOA 3LS5H 1QD0A 3VWJA 3EDJA 5IQ7H 4M6OH 2VMFA 4MLSA 3VGHA 1ZANL 2YD7A 5I1GL 3HR5A 3N1FC 1I1YA 1KPRA 2AABL 1AHWA 3BUYB 5ABDE 2CRZA 3QXDB 4JN1L 3TBYA 1LO5A 5DJYA 2E27L 3DYPA 3RPIA 3STZA 5IM7A 5DD6A 5ESQA 3WSQL 4YAQB 5GGRA 2CRYA 3VW3L 3MLXL 4P2QD 2NW3B 1CT8A 1UWXH 2HWZL 2VLLA 1QSFE 1UFUA 3IS0X 4O00A 1AKJD 5FHAL 3P4MB 1B4JL 1AY1L 1RMFH 1EEZB 1KEML 3MMEB 2IH1B 1ZLWK 3ULUC 3S3JA 2NW2A 4MAYB 2CH8A 4KKLD 5IHLB 4XGZB 2UUDK 5E1HB 4MVBC 3WNMA 5GJSL 5C0AA 4TNWF 4ZXBB 2XZQH 3S4SA 4NQED 4KVNL 2NR6D 2QQLL 1CU4H 4IBLT 5C09D 2BSED 1KJ2B 4IRSB 2XA8L 3QO0A 2GSGA 3S36H 2AV1A 5I15H 3RP1A 1GGYA 4K2UL 1FO0L 1S8DA 4PLJD 4XPFH 4MZ3A 1YMHA 1G1YA 3O3EB 3QUML 1URLA 5E2TL 3BOVA 2R2HB 3Q3GB 3FAXA 3F58L 2ATPB 1WAAE 1ND0B 1BJ1H 3U9PH 1R3KA 2X4NB 3TP4A 2H8PA 4WW2F 4IOIB 5E5UB 4I3RL 2DN7A 3MLVL 4P2QB 4NO2B 4WV1B 4TQEL 5T5FL 4Y19E 3HPLB 5FO8A 5EU4A 4HC1L 5KJRH 1U8KB 1NGYB 3KYMA 4YHMH 1I7RB 3VGFA 4PGDA 4HUKB 5DC0A 4ZODA 3O9WA 4MDIA 1R6VA 1MVUA 2Q3ZA 3BKCH 1Y18B 4M61A 5FA3A 3HS0B 3PQYD 4MA7H 2QSVA 4GRMB 2EIEA 2H1PH 5E00B 5A2IH 2VQ1A 3OSKA 3I2CH 1FGNH 2YSSB 4QCIB 5GS2D 1N5YH 1N5AB 1J1PL 5LG1A 4ENED 3FZUD 3MRGB 5CJ5A 1FO0A 4R4ND 2BOBA 1ZA6A 1YUHA 1RJCA 2VLJA 5DT1L 3HAEA 3QEQE 4GW5A 1G84A 4YDVA 1KUMA 1CLYH 4I48A 3Q1SL 2ZUSA 3DVFA 4HJ0D 3O6KH 3WMSA 4DK3A 5AUMA 1CFQB 2VZUA 5HD8D 1GZPB 2BFVH 2W0PA 2PKDA 2Y72A 3HI5H 5D96C 2ZOLA 1N7ML 3RJQB 3LS4H 1FFNA 3LQAC 5I17B 3MLWH 1XGRB 3B3IA 4G43B 4J3UA 5I1AA 1NL0H 2P8PA 3WJLA 4YDLB 4K7PY 5HDLA 5GGRB 2AJ3B 1KCUL 1OGAD 1NC2D 3THML 4N90D 3R8BB 1K9TA 3KXFA 5DHYB 1TQCC 1MCSA 1KPVA 1NGXA 1SMOA 4NQVB 3AB0B 4XX1G 1NCDL 2OK0L 1UB5A 1GXEA 5IHUH 5EPMB 4D9QD 2QQNL 4ZAKC 2RCSH 3O8XB 2YR3A 2GTZA 4H1LG 2Q76A 3MRCB 4F7CA 1BJMA 3IDGA 4NNPH 4JPWH 4DZ8A 5TDOB 2XNAA 1NUFA 1HHJA 1SEQL 1W0WB 5KS9B 2CIKA 5GGTH 4HZLB 1O7VA 2DTSA 4LCWB 5FFLA 1BD2D 5JOFA 3EFDL 4JFZH 4KJPC 5CD5C 3KNBB 2HVJB 3VFMA 1LE5A 3H9HA 5SX5K 4UILL 2YPLA 1AGBB 3Q1SH 1FRGL 4OLZH 4AEEA 4XVJL 1M05B 1H3PL 3QFJD 3EO1A 2X4UB 3O4OC 2UY7A 4F7MA 5ICXB 4F7PA 2DQHL 4IMLA 1AH1A 4JKPL 4BQ8A 1RAMA 2F15A 3DRTA 2EDXA 1OP3H 3FOLB 5JDSB 1LWRA 3RAJH 2F5BL 1J0IA 3KJ4C 5HI5D 1D6EA 1AKJA 4JZJB 3SKJH 3CH8A 1BGXH 4YHKL 1DJSA 2Z8RA 4NQSB 2XV6B 2D7PA 3QDHA 2I26N 4WFFE 5F44A 1RZJH 5DSCA 3GRWH 5TE7L 1QR4A 3QCVH 5C71A 3X3FL 1DL7H 1ZSDA 4WO4C 3Q6GL 3I2CL 5BRZB 1WITA 3F6IA 5CWSB 1ZLSH 1FNSH 1RJLB 3CSBA 1Z9OA 5EO0B 4M7KL 4L4TA 4JFQA 3CFCH 1JIBA 5F88B 35C8H 3UTSB 1RJLA 4YGAB 4XXCA 5JHLL 4U1GB 1U8HB 4XVTH 4I18C 1LO0H 2RQ8A 3U7AA 1O7SA 4WWKB 4HXAH 5FYKD 2DB8A 1LO3H 3RU8L 1BZ9B 5IVXF 2H6PA 3TA3C 5GZOC 3MV01 5E5MA 3RWGB 2G9HB 5JNYB 2ITCB 4MA7L 2X9WA 5IK3A 5I2IB 4Y8DC 1YEGL 3OXSA 4JRYD 1JGLH 2LU7A 3PWPB 3HUJE 3TT3L 3GI9L 4M7JH 4F8QA 1YEIH 1TJHL 2VABA 1HK6A 2Q7NA 2Z8VC 4K94H 3FQXB 2W9EL 2C9AA 5JW4M 4U1NB 1CICB 4M7LH 1RJZA 2J8UE 1QSFB 1BVLA 2VISB 3VXQA 4YH6A 3S4SG 4DKAA 2BNRB 2ZCLL 1PKOA 2AXGA 5CJXA 3MRBA 5IHBA 3QEHA 3I6LD 3FQUA 4PY7A 5F9WC 4LVHC 3TYGH 4JZOB 1K4DA 4XWOD 5I30L 2ZZUT 3BHBB 3S96A 3TBWB 4PUBL 3MROB 3EYFA 4U7SA 5GGSB 3HG1D 4CADA 5ADOL 4NQVA 3DECA 1RUKH 1FSKB 2R56H 4D94A 4HJGB 3EYFB 1T7XA 1VESA 1KJ2L 1ZGLA 1N59A 1F5WA 1MNUL 3S34L 2WWKO 4Y5VA 1YYLH 5DYOB 5IR1A 5D1ZB 1I8MA 2G75B 3MRBB 1HINL 5BS0B 2VDQH 3K4ZA 5FUOL 4PJ5D 4S2SA 4NHCH 4JFQB 3RTQD 3BDBA 4WFED 4LBEB 1GZQB 1F45A 2OP4L 3OGCB 4IRJD 5TE7H 3RVXC 1C5DB 2XTLA 4BH8B 3MRRA 1B0RA 4PB9L 4XNQB 4TVPH 1OT2A 2ARJQ 2P42B 5SX5H 2ARJB 1AO7E 2ITDA 3KYKL 3M45A 5J12C 3ZE1F 3FRPA 1PYWA 1NGQH 1J0HA 1YEJH 4JKPH 1LO0L 2X9YA 4PJDA 3TO4D 4OQ1A 3NN8A 1HKFA 3JTTA 4GUPA 1DQLH 3HG1B 3IT8D 5CP3A 4IRJA 3C60B 3VGBA 5I73B 2CDFA 4L4TB 1NKRA 4RFNC 2YPLB 2FIKB 5EUOE 2A2QT 5T3ZH 1B4RA 1GH7A 2WIIA 4PP1D 1II4E 1EO8L 3R4DA 5D72L 3E8UH 4AG4L 1J05B 4YBQC 5IW3A 5DGQA 5JOPE 4NKMA 1UB6B 1CDUA 2HP4A 5DUBA 4ORGA 4U1HA 3GHBH 1I9RL 5FM4A 3S36X 5F7WC 1K5NA 4Y4FD 1ZHBB 2W92A 3WN5B 4NM8L 3SQBA 4NNXB 5GS0D 1DP0A 3B5GA 1G6VK 3ARFC 3NFSL 4XNZC 4PJFB 4M7LT 4NWUL 2HT2D 4JB9H 3RA7H 1XCQB 4J8RB 5BW7C 1GSMA 4HULB 1ERNA 4C58B 2VC2H 5JHDB 3GJFK 4X80H 4CN4A 3MLZH 1CE6B 3D39A 1IGCL 3FT4B 4JANB 1CK0H 2XRAH 2B1HL 3VRIB 1G0YR 5HHVL 1FV1A 3ET9F 3S35L 1R3LB 2DWDB 1XGYL 3KPLA 5D2NB 5F7NC 2CKNA 2B5IC 5I15L 2O5ZH 3HR6A 3TNNA 5IGXH 1I9JL 3H9YA 3U6RA 4M48H 3MOAL 2CGRH 3EKCA 4Z77A 2FHCA 3U9PL 2IC2A 3HMXH 4DFIA 2VLME 1KPVB 2H1PL 1KPUA 3PHQA 1KCLA 2Z91B 3C6LA 5IB4B 2CO7B 5CD3B 1XF2B 2GAZB 1N26A 3L7EA 2I9LA 4OF3A 3LIZL 4O5LL 5LKNA 1A6AA 1KELH 4JFXB 4X6CF 5IVOA 3FFDB 3KDMB 2NXYD 4HZLA 3C09C 2I5YH 4KRMB 5KS9A 3HR5B 5KVFL 4RAVB 4FQLH 4WVRA 4PJEF 3BD4A 1FC2D 2OSLA 5I76A 1GGUA 4DGYL 3HZYA 1NC4A 1Q0YL 4L4TD 1OT1A 5I75B 1DBMH 5C0ND 4X98B 3MJ7B 1CXIA 3CJJA 3MFFB 1YJDC 2BVUA 3DXAB 5F93C 1HHIA 2VSCA 4PP2B 1QQDB 4X6DA 1TZGL 4XNXH 4WCYL 1DFBL 4J4PA 4JAMA 4W81A 2IBGA 5I16B 4MXWH 4F58L 4HCRH 4NHUA 4EOWH 2VH5L 1X6NA 3VXNB 1M7DA 1D5ZA 4KTEH 5KANG 1N64L 3SO5A 1ZLWH 4A2LA 5JO5A 1EA9C 4OZHB 1D6VL 2EIDA 3TO2A 5DMKA 3W39A 4X6EB 2GCYB 4PJFE 1NGYA 2CKBB 4QRRE 3V4UL 4LSSH 2UZIL 3SDAB 3ZDZF 3C8HA 4MQXC 4N8VB 2B1AL 2X4QA 3TN0A 2BK8A 1A9EA 1D3CA 1UG9A 3FHAA 1YEKL 4N8VA 2GUOB 2YPKB 4KDTC 5EU3B 1RURL 4PREB 4YFDB 1OTTD 3AB0C 4AEIH 2YZ8A 4QF1A 3DBXA 1I8LC 3VJ6B 3AGVA 3WUWA 2PYFB 2OZ4H 3RQ3A 2C26A 4Y89A 3C6LD 5DZLA 1DUZB 1IT9L 1UZ8B 4DJMA 1FCGA 3OR7B 2F5BH 3RWFB 2FX8H 3CDGB 3MLUH 2DWEB 1ZE3C 2BSRB 4X9FA 3D1MC 2AXHA 2VLLB 3KPRB 4O51B 4JM4H 5JZ7D 3ARRA 1QFWH 1OSZB 2FL5A 4ZNCD 1L9NA 5GPRA 3WKNA 3LZFL 2H2SC 3OGOE 2Z31A 3RL1B 3KYMB 3KPOB 4YR6B 3O4OB 1MHHB 1G7QB 4YXLL 2W0LA 5FA4A 1UACH 5L88H 4NKMB 3H2WA 1OCWH 4MDIB 3VWKB 3IKKA 2V17L 3S4SB 5D7IE 4O9HL 3MRIA 3HHRB 4UT7L 1XZ0B 3ORJA 4EDWH 4GG6E 1PG7X 2PXYC 2H2SD 5T1LA 2BNQA 4LLDA 1BJ1J 2AEQL 4I3SL 5MP6H 4O51A 1NEUA 2PO6B 5D7LE 5DO2D 2WBJC 4X4ZA 1B0WA 2Z93B 2VSDA 1CT8B 4FQ2L 4P2CG 4RSVA 4WO4B 2EICA 1A02N 4OAWB 1WJ3A 2AJZB 5HTSA 4XB7A 5BS0E 2GSIA 3GRWL 3IF1A 1JWSB 3HUJB 3Q3GA 3L1OL 4WO4A 1YEGH 5ICZA 1CI5A 1OW0A 3GIVB 5IUSA 2ED8A 2B39A 4HG4K 2M8XA 2OQJA 5IBLD 4MVBD 1OTTC 1AHWB 5IB5A 1AGFB 5FGCE 3OKNA 4LFHD 3K80A 1I1AA 2X05A 4YHIA 3SGJA 1JL8A 4PJCA 4PJXB 3VWJB 3TA3D 4ZXBA 1GGTA 3MUZ1 3RVWC 1NCBL 4UDTB 1AQKL 3O9WD 5DRXA 1TJIL 4KROB 2DQDL 2VNCA 1LK3L 4MS8D 4PLJC 4UTBH 3CLFL 4RFOH 4EUPH 2QSTA 4KV5E 1T21A 3CUPA 3QXAA 1ODAA 4TUKL 1MCIA 3L3DA 1FFPA 1TENA 2XZQL 4PJDE 2OSLB 5IB2B 2QQLH 2XOTA 1J8KA 4M3KB 4P23B 4MAYA 3DURA 5FGBA 5T5FH 3QT2A 1FIGH 3T04D 4CVZA 4KK9D 2I9LB 1DBML 2AJSH 4QT5B 2H3NB 3SY0B 3G6JF 4GXVH 5GXBB 4GRWH 1PX3A 4HDIA 3MLRL 4ZD3L 3OZ9L 3WCYA 4Z7WA 1A6TB 3QULA 2PO6D 2MHAB 3SGDI 3QZWA 3SBWC 4JQVC 3SO3B 3QWOB 4OIAA 2ZCLH 4Z5RB 2MQ0A 4E41B 3QUYD 4U6YB 4WU5B 5GRUH 5CJQH 2DQGH 1DBKH 1U93A 4P5KB 1I1YB 3MXWH 3DROB 3I50L 4YJZL 4NZUH 4HK3N 2DLTA 5IOPA 1PEWA 3MLVH 4YDIH 1HN1A 3EYUH 3BO8B 2VIRB 1YN7B 3D25B 4LSSL 5CJ8A 4ZS6D 3TF7C 5D7JB 1JJUA 2H32B 1U8LA 4NCDA 2FEEL 1DEDA 1KN2H 1DVFC 1RK1B 3LKSA 5IHZB 4JVUA 3FONA 4K3HA 3OKMA 4MXQC 3DWTA 5HHPA 1E27A 4L4VD 3D0VB 1YEJL 1WTGT 4N0UB 15C8L 2N7BA 4KZDH 1IC7H 4M5YH 4NSKB 2W65A 5FM8A 4L8DB 1N4XH 5EO1B 1IILE 2R2BA 4JFOA 3C2SA 4KUZH 2DQCH 1E28B 1IARB 2XXMB 4DN4L 4WI4A 4KK5D 3THMH 5HYSB 5F1IA 3MC0A 5J4MA 4ZO6A 3O3DB 4JDZB 4XP6H 5FDYA 5J11B 4P2RB 1QSEA 4X4XB 3WHE0 1QO3B 3OR6B 5DJ8B 2NX5D 3VWJD 4EBQH 1BLNB 3C5ZD 1MCPL 4XP9L 4WFHE 3JUYA 2B8OT 3IFPA 4NPYB 1UGNA 3O4LD 3QEGL 1N3NA 2EH8H 4OCSL 5C0IA 1SVZA 1XF5A 3RWDB 5IK3B 2X7LB 3ZDZE 3KPSD 2BC4A 3NVQA 1EAJA 1A7OH 4JM2A 3JWOH 5JR1H 1IAKA 1MF2H 2GI7A 1H3VA 1EJ6A 5C0DA 4YBQD 2BY3A 2IPTH 2OI9B 4UMGA 3UTZB 1BQHG 43CAA 4BZ1H 5T3ZL 1YY9D 4LKCA 3HI1B 3UTZA 3DVIA 2ORBH 1FNFA 4P5TC 2C4XA 1DUYA 2HRPL 1IGIH 2XN9E 4NKOA 1WTLA 4RWYL 4JPIB 4WHCA 1FNEA 4OCWH 1DBJH 4CBPA 4YHLL 4GMSL 4YK4B 1FL3A 4KQ3H 1FLRL 2QQNH 5CIPH 2HVJA 2XI9A 4Z9KB 1IBGH 3P9WB 4XNZB 3FFCE 3WNLA 4ZOCA 2AK4E 4MCZA 3PHOA 5CEXA 3MRNB 5T5NF 5DMGD 2BSSB 3WIHH 5H37G 1MFAL 4PV9B 1FE8H 3D9AH 2E9JA 4Z18A 2MCPH 4Q74A 1LK2B 1IGTA 4K9EH 4BELD 1AKJB 4JZJA 4MJID 1UB5B 4Y4HD 4NRXA 3OKNB 3PDOA 4QRRA 3RZCC 1I8MB 2ZP0T 3GHEL 3MV7D 1SJEB 2IQ9L 3WD5H 3PQYB 2PXYA 2ZUWA 4PGZA 2ZKHL 2D9QB 5CEZH 1MI5A 1RIVH 4OB5L 1A3LH 4NJAH 3WUWG 3CX5J 3AS1A 4TTDC 1ZT1B 2C3HA 3CLEL 2OJZL 1ROWA 2WINA 5TE6H 5TF0A 4KZEL 1C5DA 4U2ZA 3OR6A 5D6DC 5C1MB 1R3JB 1A7QH 2P47B 1U0QA 3PGFL 4EDXB 2ED9A 4MAUH 4APQA 3MCG1 4UV4H 1FNSL 5IVZB 5IOPB 2D03L 4PJHA 3VXOB 4UUJA 3EYUL 1X5AA 3U4BL 3QULB 2DI9A 5T1KA 3QEUA 2ZUUA 3HPJB 4XPHH 2E8ZA 1FZKB 2W65B 3S6CA 4PGCA 3OKLA 4FTVB 2VB5A 2G5BB 1N8ZA 4GKOA 4HD9A 4DVBA 3BT2L 4WV1C 3IB4A 4UZGA 4NQCD 2XACC 4M61B 5FA3B 4KZDL 5TQ0L 3NACL 3QI9C 4XAWL 1J7VR 3V6OA 5FYJL 1CXEA 1AGBA 1INQA 4ZXBD 3DTXA 2W60A 1FJ1B 1OTUD 1Z2KA 4L8CA 3FQUB 3N1GC 3RWJA 1LEGA 3BGFB 2DKUA 4ZQKA 5I17A 3CK0H 1RIHH 1WBXB 4JPVH 4NKQB 5D5ME 1ZHKA 2NY2B 1S9XB 2BOCA 4JG1L 4S11A 4X6BB 5KVEH 5DJ8A 3IXTA 3UZVB 3WSQH 2A6DA 3GSRB 5SWQA 3SGEI 3MRDA 43C9B 4NQSA 4NSKA 2NX5A 1XIWB 3UYRH 5TDNA 3PWPA 4R26H 4GBXD 3FTGA 4QTHA 2IBZY 5IBTL 3DX6B 3K46A 3RGHA 1F3JB 1BBDH 4AH2B 3M07A 4PGBB 4QHKI 4OLXL 5K9JL 4QOKB 1L7TL 5HYJE 1RU9L 1YN6B 3HNVL 2ADJB 2GSGB 4W70A 5IQ9A 1Q9WA 3TWCH 1YEKH 4X99B 4LLQB 4OUUA 5LCVL 3OJ2C 1KYOJ 5K59F 1IGIL 3CUPB 1MHCA 5FK9A 5C07E 3BT2H 2FB4L 3K2UH 2LE9A 3FQRB 4PRHE 1DEEA 1IQWL 3QHZL 1F13A 3U0TB 1RK0B 3MUGA 1KIRB 4Z7VA 2FR4A 5C0BA 2DKMA 4F80A 2EIZA 3QDJE 4F15B 1ES0A 3OJVC 5EIIB 3IVKB 5ALCH 3GMQB 4KMLB 4NC1E 4MA3A 5L88L 3L3JA 4U6YA 1JWUA 1VFBA 1A1MB 3B6SB 4MD5A 1NEZG 5JOEA 3VA6A 1ZMYA 2NXZD 4S1QH 2HFEB 2R9HC 3MLSH 3WIFB 5KG9A 4JJHA 1U58B 4PRPE 1KTDA 2AJVH 3BP4A 5DQJA 1MVUB 4TSAH 5FKPB 2UWEB 2PO6C 4F37K 2QQKL 5K9OA 3QJFA 5D7JA 1RIVL 2AP2A 1PW3A 2VIRA 3D25A 3QUZD 5E6IA 3RBGA 2Z8WC 3CMOL 7FABL 5EBGA 3EDEA 3TNNB 2E5EA 1Z9SA 2F54E 4HC1A 2W0FA 3BN9C 5B39G 3DETD 4JY4A 5E2UH 3O6LH 5CLWA 4QWWC 2AK1H 3FQNB 4NKIL 1YUHB 4NWTL 2IPUK 3W9EA 3C6SA 2H41A 4UAOC 1F6AB 4U1KA 3MRQB 2BY0A 2R0LL 1KT2B 4JGJA 4WTXA 1FVDB 4Z7UE 3BZDA 3WXVL 3TIDB 3I6LE 3O6FB 1YQ2A 3D6GA 1U8OB 2NR6C 1NCAH 4YWGL 4JRXB 3CFDB 1LEIA 3MOAH 5CMAA 1GL4B 5CSZB 2J8HA 2GY7B 4C59B 1P1ZB 1IAIM 1A6UL 3LQMA 4RX4A 1LK3H 2C4FU 1BVZA 3T0AA 1TJIH 5IEHA 5DD3L 3PIQA 1H5BC 2FWOB 4H20L 2RBLA 5JTWA 3ARSA 3TYFA 5DMYA 3TO4B 3FQNA 4UOW0 4RMRA 2EXYD 5FK9B 1LEKA 2A6KB 2NY5C 1A1NB 4WUUB 1CK0L 1RI8A 4ZAKB 5CILH 2RIKA 2X6MA 4D9LH 4L3CA 4GXVL 5EZIL 3INUH 5ITFB 3VG0H 2Y36L 4R9HA 4EIGB 2BMKB 4MNGB 4W4OC 2IAMD 5E8PA 1H8OA 3BESR 5T1DL 4Z76A 5HVHB 5I6XC 4IRJB 1EEQA 3A6CL 4KJQC 2BXZA 3CFJA 1KTLA 5IKCA 5LAXB 1MFCH 1MAJA 1UCBH 1A21A 5B8CA 3GSOB 3LDBC 1Q9LA 3QBTB 4R26L 4J3VA 4L9LB 1HILA 1TJHH 5JA8B 3IRPX 3M8OL 3TBYB 1A9BA 2BJML 1WBYB 3GSNA 4YZFF 3MFFA 2ICCA 4KKAC 3IYLW 4PJ7F 3PWVB 3HRZA 4X7TA 1FDLH 1PY4A 1A9EB 3MSPA 1EEYA 4NZTL 2VOTA 2DQIL 5GSVA 1KGCE 1QTYT 3NA9H 1J86A 3T0DA 3RKDC 1CFTB 2QHRH 2VZTA 1RULL 1U8MA 4M1GL 4PJEA 1T83C 2MQ3A 1DCLA 2DQTH 3VXRB 2YUXA 1HQ4A 1X4ZA 3QNXA 1T89A 4R96B 4LHJB 2IANA 4LGRB 2D7TL 1EEUA 3KPMB 2Y06H 1JZ5A 1NCNA 2DJUA 3O0RL 3MRPA 3C5ZC 5AZEL 3PQYA 5DGRA 2X10A 3N0PB 1KG0A 3BPLB 5LVEA 3BVNA 3X3FH 4PTTB 4HT1L 3OWEA 3WIFA 5KG9B 2WP3T 2IADB 3V0VA 1J8HE 5D7IF 5EC2A 5F96H 1FYTA 1QRNA 2R0LH 1YPZE 4WTZA 3SE3A 2DM7A 5DTFA 4UIKH 5IP4A 1K5NB 4WRLA 3FRPG 1RJYB 4OKVB 5I8EB 3PP3H 3ARYA 1C5CL 2EYTA 1X7QA 3QEGH 4C56A 3C6LC 1UB6A 4M1DH 4NO5B 4H8WH 4EUPB 4QHMA 5I1DB 3L5XH 3T0XA 4N0CD 3IU4L 1ZT4B 2QSCL 5F72S 4RGNB 5FKAB 3QFJE 2HH0H 3QAZB 3B9KD 4X4YB 2CJUH 4YK4C 2QADC 1ZGLP 3MLPA 5IJVA 4U1SB 5B8CC 4XBEH 4AENA 4KJPD 1J1XH 2IH3A 3TIEA 1G9NL 3HB3C 4MD4B 2ATKB 3DUUA 2JB6B 5FUCE 5CZVL 4XPBL 3BFOA 3H0TB 4HCRA 3KLAA 1B9ZA 1N2RB 3O11B 4ZFFA 5D7LD 4F7EB 4J6RH 3BUYA 5HJ3A 2HLAB 4XBPB 5AZEH 3LV3B 1BEYL 2DTMH 2AEPH 1H0DA 3MRMA 4KGJA 5FOJA 3MROA 4PRIE 5L8LB 3P11L 2NX5E 3VXSB 1NGZA 4QRUB 1S9XA 5FEBA 1FGNL 4RZCB 5BV7L 5ISZD 4MCYB 5SWQB 2HVKA 5C0BD 1HXYB 2DM3A 1FL5A 4XCYB 1MRFH 4HK3J 2FJGB 1WWBX 2CLZB 1IGJB 1VEPA 4XNUL 3TCLB 2BVOB 1QSED 3H6JA 5IV2B 2OL3H 3WFCL 4FZEL 1NGWB 1BMGA 5FDWB 1BF8A 2B0SL 1X5HA 2DKSA 1P9MC 2O5XL 4U6VH 3TJEL 1YPZF 3U7WL 1RZKC 5IFAH 3MNVA 4ZFFB 4M1CD 1JMXA 4NKOB 2CKBL 3L3IA 5T1DH 4OFYD 5FGCB 1HHKB 3RVWD 1LILA 1WZ1L 3O41A 5LQBL 1KJMB 3BZFB 4MD0B 3UTTE 4G7VL 4BH8A 5IROC 2FGWL 5JW4N 4J3TA 4JVPA 2ADFL 4N8CH 5J56B 1J1XL 3KG5A 1E4XL 4JRYB 1CIDA 3FQTA 3MLTB 3OJMB 5TPWL 3FQRA 3OKOA 4IDLA 1UH2A 4PB9H 2CDGB 5GZOD 1MCDA 2YOCA 3LN9A 4GT7A 4JRYA 5I73C 1QBMH 4FXKA 3MJ8A 1KCSL 1J0YA 1GGCH 4L3EE 4G5ZL 1TZHB 4PJIF 2IBBA 3V5HA 3MRCA 4JFFA 4HUUB 5HXMA 4M6NH 3K4AA 1I3UA 3F7PC 5C0FB 1MQ8A 3QDGD 2AV7B 3LN5A 5CWSA 1CG9B 4R2GB 4GG6F 3ZSSA 4G8GE 5E94A 3IKCA 4Y4KD 3UDWA 5KSBE 5DD5L 1KTKE 3B8SA 2MTPA 4HIXL 3U0PA 3A6BH 3IDYC 5E8EB 1A64A 3WBDA 4UT9H 3MLRH 4ZD3H 3HNVH 5ICXA 1YMMA 3S35H 5DJCB 3IFOB 4FZ8L 4QT5A 3OX8B 4XBEL 1FZJB 1FQ9C 3CZJA 1Q94B 4P3CL 3B9DA 2X70A 3BN9D 3JBG7 1N4XL 4M48L 4L8SA 4XNMB 3V7AG 1BAFL 2HJKB 4RMQA 4MNQE 3AMKA 4U1LB 5SWZB 4XCYA 2K9UA 1JGEB 4HKJB 1NBVH 4GW1B 4H26B 5AUMB 4WU5A 3F12B 4U1JA 4LEXH 4DVRL 4BK4A 5BRZA 5EPMA 3B5HA 3DX7A 1HH6A 1CF8L 2YUZA 4UINH 3V7AE 5D1QA 3T1WA 5EC2B 1GRWA 4XP9H 4Y88A 1JPTL 5C0GB 2D2OA 2R2BB 4JFOB 2OR9L 43CAB 3L3IB 5F9JB 3GBNL 2Q7YA 4XCFH 2YSSA 2UWEE 4QCIA 3LEXB 3CX5K 1XGUB 5GRWA 4MB3A 3QH3A 5C8JB 5L2KB 3QIUB 4HWZA 5FHBL 3KPQB 1NGXB 2HG5A 3ULUF 5EWIH 4QHMB 5I1DA 1MREL 4EJ1C 2A77L 4CUCA 5GSRB 1SMAA 3SE9L 4D9QE 2HTKC 1TNNA 5LQBH 1GJIA 1JRHL 2K1MA 5JLZA 1ZEAL 1DVFA 2YEZA 3ULSB 1TZGH 3WLBB 2IGFH 5D7KE 4KQ3L 3MPCA 4JO3H 5HDBF 1KCRL 3LH2L 3VFSA 5FYKL 3F7VB 2YPVL 1RJZB 5LGHL 3O8XA 5AEAA 2H2PC 3RX8A 4ZS7H 1AGEA 5ICZB 3H0TA 1ACZA 4TULH 2F54B 1QFWL 2BCKA 4XCEA 4ELMA 1MCHA 4ZUWA 4WFEE 2R8SL 4BUGA 2I27N 4PJ8C 3P9LB 5E8EA 6FABL 1KBGL 5EUOF 1UZ6E 3A6OA 3UJIL 3BDYH 1WBYA 2MCPL 2NMSA 4OCRH 2DDQH 1NLBL 4QHNA 2NZIA 1ORQA 1CF8H 4JQVA 2EE3A 1WCBA 1IC4L 2MMXA 2BC4B 1B88A 5H94B 5HPOA 5K9QI 3TNMA 1Q1JL 3GFUA 4LSPH 5L7XH 4CVZB 1YEFL 3MO1B 5I18H 2YRLA 1IC5L 4CW1B 3L3DB 1MJJB 1LDSA 3NCYP 2KZWA 1HHJB 4H1LH 4QHUA 3TV3L 3PQYE 4KKNA 1CTOA 5EZIH 5CKAA 2Y5EA 5CINL 1QFWI 2M26A 1QFWM 3QQ9D 2FO4B 1F4AA 3B2VH 3PHSA 3MYJA 2XA3A 3W39B 1A7QL 1I3GH 3DV6B 2EYRB 3WFBH 4PJ9B 4FQXB 1I8LA 3TEUA 3QZWB 3DYOA 2YA2A 3HS0A 1Q9OB 4XP4L 3REVB 1X4YA 1YNKH 2MNUA 2A0LC 3ULUL 3EO1B 3WHXA 4RISH 3G08B 4N0YL 1FNAA 3RY4A 2VTFA 2I60L 5D5MF 1KOAA 3ZKMD 3SGKC 3RWIA 4JFDE 2X89D 2Q86A 3FOMB 3IFNL 2H2PD 4AEIL 3ARBC 1KFAL 5L9DH 4BA8A 4UQ2B 5LXGL 4FZ8H 3TFKD 4S0TD 4YBLB 5CEZE 3FL7A 4F57H 4UOJA 4P57B 2ZUVA 1N7MH 1U2CA 2FD6L 5E8NA 1I8KA 3P30L 1YNTB 3B2UD 3BX7C 1OB1A 4OQTL 1VERA 4GW5B 1XH3B 2P5WB 4AEHL 4EXPX 4S1SL 1IGYB 5JW3L 1MHHA 5BV7B 4WJ5A 4NUJB 3VFWA 5BO1L 2NY6B 3J7HA 1A5FL 4ZFOL 5C0JB 5KSBB 1VACB 4P0DA 2AJ3A 1OPGH 2OLDA 4NO3B 1ZLVK 4PRNA 3EOAA 2ZNWA 5CSGA 3BUTA 3LPFA 3MRHB 5DHYA 1V05A 3JUZA 3OKMB 3Q5OA 1P4BH 1P4IH 3G6JB 5EZLB 4BKLB 1LO4L 1PSKH 2ZCKH 2W0FB 5F7UA 1XIWA 5DWUL 4EN3B 3TC9A 1SJXA 4JB9L 4OCRL 4LEOB 4PJCE 2X89A 4GBXC 1KJVA 1OTSD 5TH2B 1S7RA 4P23D 2GEEA 3ALXA 3BP7A 1VGEL 4LIQE 4FFYL 1MCKA 3L5WB 3MGAA 5FO9B 5L0QC 3VRJB 4PJXF 4Q0XH 1PY9A 2NTFA 3GMRA 5E8OB 2AJUL 3LQAH 5IEHB 3TV3H 2OTPA 5KSAC 5ILTH 1YJDH 3G6JA 3FJTA 4DZBB 2VXQL 3MGTA 2VJXA 4QHNB 1A9BB 1NCWH 4L4TE 4XPGL 1ZANH 5I1GH 1U3HD 1S8DB 1FGVH 2FNBA 2B2XH 5IESL 4J7RA 3X12B 4Y4HB 1SEQH 4XT1C 1KCVL 4HF5H 3R0MA 5J11C 4DGVH 1A47A 3IXAB 3FB5B 3LKOA 4DKDC 1BEYH 4LL9A 1X5ZA 3ZE0E 2Q6WB 3CDCA 1F3DH 5E9DE 4WGVB 1KIPB 4KK9C 4KTYA 4QTHB 3SO3C 5HGBB 2QADB 4W6YB 4EBQL 4O2FB 3FN0L 3CU1A 3WFEL 5CZXD 4QKXB 4Y0GA 4XWOC 5C0AB 3ZHDA 1MJ7L 4WENB 4Z0XA 2PTTB 1YN6A 2ZCKL 4AM0B 2ADGB 2BNUB 3MQIA 3UC0H 2B0SH 5I1IL 3C08L 1KNOA 5TE4H 3LEVH 4PY8I 1QFPA 1BBJB 1JHKH 3UJJH 2R4RH 2WINB 2ZUQB 5IGXL 5SWZE 5IIEB 1JYVA 4P2RE 3DTXB 5E2UL 3O45A 2CLRA 4JO1H 3KWWB 4OF8A 1GGIH 1OTSC 4OT1L 1A4KA 1XIWD 4QXGH 2ARJA 1AO7D 4LCUA 5B38G 3Q6FB 5ADPH 4D3CL 1FVDA 2ADGA 5D5MA 4MXWL 2AJVL 4DKFL 5FCUL 2L7UA 2VLKE 3BPNC 5IVZA 1KEGL 4CN1A 1KEMH 3VMPA 5FO8B 4IRSC 7CGTA 3N85H 3NIGF 1F3RB 2RFXB 1R3LA 4E41E 4N9GA 2DBJA 1OAQH 4ENEC 5GGQL 2F5AL 1BX2B 4FABL 3BI9X 4XBGB 5EOTA 3IDNB 3ZLQC 4UNUA 5D70L 3HNTL 5F6HI 1FZMA 1INQB 3R06A 3G08A 3I6KA 2E9WA 3T09A 1E6OH 4KJWC 2KQNA 5I71C 3INUL 3SJVD 1JF1B 4EI5A 1SJHA 2PYEB 4YPJA 2NW3A 4R4BB 1FZKA 1RK0A 4QRTB 2AS5M 1OF2B 4U1IB 4I0PC 2NY5H 3PHQB 1U8NA 3VFTB 5GGVH 4P5TB 3BRGC 1FE8L 5D1XA 4M62H 5KW9H 4DQOL 3EJZD 1CD9B 4QHKJ 2GFBB 4B5EA 2VL5A 3EYSL 3QEQB 1HOCA 5C0BE 3QP3A 4LOUD 2ICWA 1IM3A 3LRSB 1YMMD 2AJYH 4OF5A 1GVIA 3V8OA 5IR1B 4HC1H 25C8H 4HS6A 2V5YA 4I0PD 1R5VA 2HKFL 1F6LL 3T4YA 3TZVA 1MNUH 5EU6A 4MQSB 5C08E 4NYLA 1U58A 4CJ1A 2HT2C 4KXZH 4OZ4B 4PPTA 3CZFA 5GIRA 1BD2E 1B90A 3RL2A 3DV4A 1KJMA 1KYOK 3BDXA 4HFUL 2P43B 3L7EB 4P3CH 4Y4FC 1T7ZA 1WEJL 4NJ9L 4KAQL 4MXQD 2C4FT 3O4LA 4PJAA 1KPUB 4LEXL 4Z7NF 4GOSA 5EORL 5F1OB 4JO1L 3OKYA 3UAJD 5IV2A 1XGQA 1MI5E 3U0TA 3NCJL 4TYUA 1EO8H 2FO4A 3ULUE 3I9GH 3UCRA 1MCQA 4BM7A 4JFFB 3JWDC 1JMZA 3NZHL 3UTPD 2EXWC 3F7YB 3MRJB 4YDLC 3L5IA 3GHBL 2OJEB 1KLFA 1R5IB 1A3RH 5DMIL 3C60A 1JZ4A 3X3GL 4MQ7B 5FCSH 4Y1AA 4OGAC 5DQDH 3MV8A 1BQLH 5FOBB 4TRPL 1U3ZA 5H8DA 1QFHA 3ULVL 4P2OA 3C08H 4G6FD 1YMMB 4NWUH 3F7QA 4YGVA 2LU4A 4GBXA 1AP2B 1IC4H 1E6JH 1GAFL 4LSVH 4ORGB 3JTTB 1DN0A 4CDHA 2DQHH 4H0GA 1JPSL 4K7PL 4UUJB 3LHPL 1WSST 4N5UA 1ZHBA 3WN5A 1X5JA 4RNRB 4LDEB 4EI6A 4XP5L 3RI5F 1UM4H 5JPNB 3WYRA 2COQA 3QDMB 4BQ6A 2VL5B 5EOTB 4HWBH 3VFUB 4ZS7L 1XR8A 5D93C 5DRZA 1BVLB 5IW1A 3UYOD 1PFCA 4XPAH 2CGRL 3K8LA 4KTDL 1RZGA 3DSFH 5HHXL 3ES6B 4H88H 1NGPL 3P73A 3VFGL 2JIXB 3BRDA 5DJCA 5GRJH 1EPFA 5I18L 4GS7C 4LVOC 3VMNA 4WY7L 4F7EA 1UJ3B 2FBOJ 4K07A 1F11A 5C2UB 2YUVA 2OS7A 1KELL 3J8F7 1NKOA 1MCWM 1BOGB 2LABA 4M8QB 5C07D 4TTGA 3QIWD 4GW1A 2V9TA 1V3JA 1HQ4B 4E5XA 1VSCA 2BY1A 3U36B 2H3NA 4AMKH 3MJ8B 3BSZH 1S7UA 5IMOB 1MCOH 1OP9A 5GISH 2YN3A 4PG2C 3ZKXC 5ENWB 1TTFA 4N8CL 3ZL4L 3QDGA 3GM8A 2IANE 2UV3A 4MNGE 3CFKA 3HC0B 5F1KC 1RZFL 2Q8AH 4N8PA 4YFLI 1UKTA 4KHTL 1U6AL 4NNYB 5EOCL 4BSVB 3MBED 3P4OB 4GKSB 5SWSB 5B4MC 1UM5L 4NIKB 1SJHB 2PYEA 2AJXL 5F7DB 2WZPD 3IDXH 3PP4L 1KCSH 1WISA 3MLSL 5DC9B 1N6QH 4NO0D 1S5IL 1T22B 1A6UH 4HAGA 2FECI 4D8PB 4R4BA 5CBAB 2KPNA 3LKOB 3HUJA 1MCNA 4U6VL 5FIEA 2SEBA 4F15C 1F58L 1P4IL 3C9NB 1DN0B 3VDBA 5KZCD 3GSNL 1H3WM 4TRPH 1BWMA 2A9ML 3BKYL 2IJ0C 4X7DC 3ARGA 1ZHLA 3BZEB 3RTQB 1JWSA 1RK1A 4KRPB 3LKRB 3HMWH 2CRIA 5HYQA 5AZ2H 1SQ2N 2GKIA 3KS0J 4WUKL 1CL7I 4X6FA 4AM0A 1BZQK 1ZS8B 3P3YA 1E6JL 2YXMA 1D7FA 4U1LA 5SWZA 4BUHA 2F53D 2VUYA 3QDJB 4BK5A 3QHTC 1XR8B 1VGKA 4FXLA 4JDVA 4UTAL 3HPLA 4OIIH 1QKZL 4YIQA 4M5ZL 2A74A 3ELAT 5MEOA 3S3PA 1A7RH 4XHJC 1EH9A 2NNAB 4UDTA 4X8JA 1FZJA 2EDKA 1FLRH 1F4XH 1JF5A 3T0ED 1RJYA 4OKVA 4HWEH 3FO9B 4X9GA 2OL3A 1A3RL 4Z95H 1B4JH 4A6YB 12E8L 4LHUD 4JQIL 4FQQA 3CFEA 4O2CA 1ADQH 4Z0BH 3RNQB 3IDXL 3PP4H 1BQHB 3EYOA 1QLFA 3L3OA 1EZVX 1TJGL 1UZ8A 2CR6A 2FJGA 3DYMA 5D7LA 5DJ0B 1VKXA 5FO7A 4CVUA 1KJ2H 4ISVA 4UU9B 3MRQA 5C0IB 1KF9B 1E27B 5DUPL 1UKQA 3GUTA 3ZO0A 4N5ED 5F3HB 4RWYH 4KI5E 1BX2A 1MFBH 4GRLD 1F4WH 5J3HC 1GGBL 4IS6A 4XC3L 3TZVD 1ETZA 1E4KA 4XPGH 3S88H 4PJ5B 3RGVC 1N2RA 2CMRL 5MHSE 4N9OB 4UB0L 3PIQB 1UQSA 2Z35A 3QDJD 5EBLB 3RWHB 2JE8A 5FA4B 1XGTA 1H0DB 3MRMB 2WANA 2BVTA 4YDJB 1CFBA 1VADB 5JHDD 3WEXB 5IVXA 2I9TA 3QA3A 1KCRH 3LH2H 3CVHB 5E5RB 1F97A 4S10A 5GQBA 4LCCC 3OF6D 3PL6C 4MZ2A 5DD6B 4H8WC 3U9UA 3W9DA 4KK8C 5B3JE 4RFNB 3VI3E 4XRCB 3V0AC 1NGWA 1BJ8A 1T89C 4I8DA 1CL7H 1AJ7L 4P59L 3TBTA 2ZKHH 4P5MA 3GMPA 1RUMH 3MRFA 1MRDL 1CFQA 5K9KB 2WUCH 4IRSA 3L5WA 1QFUL 5GGUA 2R69L 1J12A 1I85A 1ZVYA 2YPLD 4QRSB 2HLFD 3QXWA 4I18A 3U82B 4LLAA 3WO3B 3HCVA 3W81A 3CSGA 4ZYKB 1PVHA 4J1UA 5JW4R 4FFWC 3IRZA 1EEYB 1AXSB 4MA8H 1OWRM 2R2CA 3PJSA 4JM2F 4JG1H 5CJXC 3BGAA 2R23B 3L3KA 5DVLA 4PIRF 3CAFA 3D39E 4O2CB 1V5JA 3HLAB 4HDIB 4QGTA 3GIVA 2XZAL 3TVMC 1L9MA 4CL7A 2V2XB 1HYRC 2R23A 5D2LE 3EBAA 4HLZG 3HG1E 3L95B 1U3JA 4PRIB 5DDHB 4JKLA 3K2MC 5D8JL 4Z0XB 3PDDA 4WWID 2FATH 4NUGL 1E6OL 1KNOB 4UV7L 1T7VA 1AGCA 1ZT7A 3DSNA 4HKZA 1IM9D 5JQ6H 4PBXA 1VFOA 3D18A 4BH7B 5C86A 2BY2A 3B43A 2EKSA 5SWZD 1CBVL 1NANI 2WUCL 3B9VA 1DBBH 4GG8B 2J8UB 4NT6A 4PJGF 3PWPD 4ZUUB 2V7NB 2NXYC 2O61B 4PRNB 4M6ML 3MO1A 1UKSA 1A22B 3QXVA 4PJDB 3L3OB 3GMMA 4G7VH 5DJ0A 4ZPVA 4NZUL 2R29L 3RGVA 3E1F1 4Y16A 5KS9E 4FP8H 1P4LA 1D9KA 3MBEA 1XMWA 2XG5A 3EGSB 4ODHH 3IDMA 3QEUB 4KY1L 4P4KB 5I8KH 4WI2A 4J2XA 1IZJA 4Z78A 3FO0L 3LPGA 4EI5C 4FOMA 4NO0A 3BE1L 1U8OA 4V1DA 4GAJL 3DOSA 4MJ6A 4F7TB 1IL1A 5DMGC 2C3GA 5IBUG 1H3PH 2WLYA 2VDPL 1JFQL 4HUMB 5LCVH 1B2WH 1Z5LB 3T2NL 5HHQA 4YFLF 5EU3A 1SYSA 3N1PC 1CLOL 2ATPA 5DHXB 1S7SB 2UZIH 4KAQH 1GGBH 4CDGC 1YQVH 4XWGH 1C12B 4E0RB 4P3DA 3EYQC 2VDOH 4L3EB 3KYNB 3EYOB 2BNRE 5F1NA 5D7LB 3QIBD 1VKXB 3VFNA 4APQC 2F58H 1KV3A 5E6ID 4ZXBC 3UJTH 4Y2DA 3KPNB 3SKUD 4TTDD 1JPGB 4HEPG 5T1MB 3BIKB 1QOKA 3I75B 2CXGA 4B41A 4EN3D 1SM3L 4MNGA 3SDAC 2FX8L 1CLZL 1KB9K 3O9WB 3QXUA 5DR5H 2J6EH 4JHWH 4PGCB 3VI4F 2J1KA 3CFCL 4A6YH 5TDNB 5E8NB 3H3PL 4N0UE 3LD8B 3MYJB 4PJ5A 4JY5L 5C6PB 1DTUA 3IFLH 5E2VL 2Z9TA 1CGSH 5E9DB 1UWXK 4UNTA 4TSAL 2VLKB 5DQDL 1XGTB 1RD6A 2XYCA 5JW4Q 3IGAA 3RJDA 4J23A 1NC4B 4RGNE 1CYGA 3D9AL 3OGCA 5I9QB 1FJ1A 3EJJX 3HE7D 4UT6H 3TNMB 3BJLA 4OM1L 3U9UB 3T2PA 4Y5VB 4FFYH 4Z7QE 2C3VA 5BVPH 3X11A 4GAYA 8CGTA 1QSZA 5C9KA 3ARWA 2YWZA 4QHLA 4QXTA 5HDQH 2NY4B 3S36L 1QR1A 1CZ8L 1JZ7A 5J89A 2VXQH 3C8DA 1ORSA 3PJSB 5KSVA 4LSRH 4JJ5A 2ESVB 4Y1AD 2CD0A 5DHVA 1KCVH 1IKFH 4MWFA 4UQ3A 2ZOKA 4OZFA 3FB8A 3MRRB 3CC5A 5E94B 3D5OF 1S5HB 3T08A 5ID0A 5AYUL 2GHWB 3R1GH 3ARUA 2HJLB 4X7SL 3M8OH 4U1MB 1LD9B 3LB6C 3AC0A 3UTPE 1FVCA 3EYVB 3IJHB 1MAML 3ILPB 5CP7A 3P77B 5H35B 2ZPKL 2GITB 4PJ8B 5F9WB 5C0EB 3QUKB 1G9MC 4ONFH 3BPOB 3CFEB 3KPRE 4AQOA 5EU5A 1XR9B 2X9XA 1AXTL 1BQHA 1UVQB 1JWUB 1VFBB 3RNQA 4D9RD 2F19H 3BKCL 2A9MH 3BKYH 3PWUA 4D9RE 1FIGL 2XQBL 3X14B 2YD4A 2NPLX 4TSBH 5ANMA 4KMQA 1DQQA 2CDEB 4QXGL 3GIZL 4U1SA 4JO3L 1G7LB 3ILPA 5CFHA 4MJ4A 3OG6B 1U92B 4MNQD 2FHFA 1AD0B 1BZ9A 3V4VH 1DE4A 1BVKB 2W60B 5KANI 5C09B 2HMID 3SE8H 1RZIA 3STLB 3WDIA 3KYKH 1BLNA 3BWAB 4GAFB 3NPSB 3H42H 1JI1A 4RIRA 1U41A 3NPZB 3SQOL 5I2IA 4R4FH 4OGXH 2A6JA 3MFGB 3O3AB 3DI2B 4MSWA 1KLUA 5FHBH 1TITA 4MHHI 4CGTA 3TH3T 2AJSL 3DX9A 4L8SC 4N1CA 2WMPA 1IC5H 4TOYL 5A16B 3FT2B 4POYA 5IB1B 4NRZB 5H37H 2JCCE 1QKZH 5K9QG 4Y2DB 2NLJA 1F3DJ 1HXMB 4Z7OF 3I02A 2FBJL 3WO4B 5DA4A 2VDML 1IC7L 5CGYD 1RZGB 2ICWB 3DGGB 3U4EA 3S35X 1K8DB 4JR9L 3DHJA 4TULL 3QJHB 2VLMD 5JXEC 4XBPA 3F62A 4IIQA 2NY6C 4MJ5A 4PRPA 1OP3K 3KAAA 4JPWL 2UYLA 4NCC1 3G5YB 3QNZB 5EZOL 5C6TH 3UPRB 4HHAB 4RZCA 4PRDA 3P11H 1N59B 3FRUB 3Q0HA 2ZG2A 5CGTA 3RUGA 2J5LB 1EV2E 1P7KA 1EXUA 2XIDA 2QSCH 1MPAH 5D7IB 2VH5H 1TJGH 4FG6D 1EGJL 1TIUA 1E4WH 3L6FB 4HQQL 4HXBH 2WQRA 3IDIA 4Q9QH 1OGAE 3QPQD 2VDNL 3BD3A 1K4DB 1QSEE 3V9FA 5FOBA 1ED3B 3V5KA 3QHFH 5E8DH 3IGAB 3PABB 4AZ8A 3TVMD 2R1YA 4BZ1L 3UTSA 2ARWA 4LGPB 1R5VB 4OSUH 3V5DB 3OMZA 1G7MA 1KIQB 5DJ6B 3EOYG 5MHSD 5BXFB 2EDTA 1RVFL 4NRYA 5DTFB 2PCPA 4LRNH 4GFTB 2G2RB 3U30C 2D0GA 4HG4J 4GSDH 1VB9A 5A3ID 4PRHB 5JNYA 4PJAB 5L6YH 2ZSWA 4G6ML 5DHVB 5JHLH 5LGJA 1ITBB 5DVNA 1HHHB 2EYSA 3EJZC 2MHAA 3VXUD 2HFGH 2W38A 5DEFA 1HDMA 5CSZA 4OJFL 3MNWB 3MJ6A 3HRPA 2F8OA 3F7YA 3MRJA 3WJLC 3V6FA 1MOEA 2ZJSL 4QYOB 4OFVA 1QLRA 4LCWD 1OOAA 3CPLB 4N0FA 1UH4A 4XBGA 2BX5A 3BO8A 4Q0XL 3STLA 1T0NB 3QIWA 1KC5L 5EU6E 5MP6L 5C08A 1DE4B 4I3GA 5I8EA 3KYOA 3W82A 4M7LL 1IGMH 4GKZB 4I4WA 1NAMB 3OKKA 1I4FA 2VXVL 4IHOA 3FHQA 5D6CA 1NGZB 4QRUA 5I66B 5D7JD 1LEKB 4N0UA 1TDQA 3ABZA 3TYGL 3BIKA 5ISZA 4XVUC 5C2BH 5T1MA 1RZ8A 4EQ2A 1EUTA 4OM0H 5CUSL 3ZE2E 3FB6A 2AVGA 2P48B 1R5WB 1AD9A 2EXWD 4HS6B 5I1EL 3CU7A 1BFOA 3RPIB 3STZB 3VRJA 1F2QA 5KSBF 2D3VA 4NQEB 2IH3B 3TIEB 5EIVA 1G0XA 1XGRA 4OZ4A 1F8TH 1QSVA 2D7NA 5FF6B 1KPRB 2PO6A 2E7CA 1A3LL 4NJAL 5IG7B 4X98A 3S34H 1OVZA 3CLEH 5E56A 2FBJH 3U83A 4ODVH 1KLGA 1G7IB 4G6JH 3FT3B 4AMKL 4QRTA 3MA9H 1YDPB 5FYJE 4Q2ZA 4CJ0A 5AZ2L 2YKLL 5IWLA 5B3NA 3PV7A 5BZWB 3C60C 4HK0B 1KIPA 1W0VA 4KRLB 3FCTA 5IB5B 2P8MB 1M7DB 1INDL 3WIIL 4ETQA 4P2OD 5EO9B 3GJFB 1FL6A 1S9YB 4NDMB 3D48R 4JAMB 3B2UC 3BJ91 3IAGC 2ZUQC 4UINL 5EBWB 3RDTB 4I0PB 1FL6B 3BE1H 1A4JB 1WQVT 2XPGB 2YD6A 4ZOAA 4LDOB 3QNXB 3QFJA 1S7XA 4LHQB 3RDTA 4HQQH 4UT7H 2BRQA 2P5EA 3BGFC 4M9PA 5HGDB 3VXTB 1HYSC 3WN5C 3MRPB 3ME0A 1R3IL 4LCIL 4Q2ZB 3EO0A 5I1JH 3DURB 4MLIA 3DBXB 5TE4L 4J3SA 5GRZA 1JHKL 3RNKB 3QHFL 5E8DL 3JSSA 3QXAB 3REWB 3AFLA 3D69B 4NQDA 5HI4D 4Y4KC 3BPNB 1XIWC 2H26A 2OBGA 4HIHB 5I75C 1KJ3H 2C1OA 4CW1A 5HVWA 4KJYB 2R1WB 3GNML 4LHUB 1FHGA 4E41A 2Y4SA 1OY3B 3GBML 4NBYB 5EG6C 1EMTL 5TFSL 1S7XB 3QRFM 5HDBE 2GY5A 4HS3A 4Z7WB 1WBZB 5ALBL 2B5IB 4QRQB 1Y18A 12E8H 4KI1A 1N8ZB 1LP9F 1JHLH 2FECL 4J6RL 1HHHA 2EYSB 3BH8A 1OSZA 2DYPB 2XY1A 5KSAA 4HFWA 1CD1A 3PGDA 2QSQA 3BYYA 3QXDA 4WJ5B 1MSPA 1Q9OA 5D71H 1VADA 4YHOL 2DYPD 4IS6B 2NNAA 1FFNB 2R15A 1S7VB 1XFPA 5GRXG 3SKMA 2JJUA 4C55A 4XPTH 3EW3B 5AD0B 1RFDH 2YD5A 4ZQKB 2NY4C 4I4WB 2I60H 4GKZA 4XB8A 3FQWA 1XZ0A 2IAMB 4HH9A 3GEWB 4RBPH 4PJHF 4X6BA 3HFMH 3AAZA 4PRPD 2Q87A 3MJGX 2VLJD 4K7PX 1YEEL 3QWRD 2W0KA 5DK3A 1FBIH 4K3EH 1FH5L 2WW8A 5T3ZD 1CLCA 5D2LF 3ARGB 1EAPB 1FAKT 5CZXC 3EGSA 1D5IL 3M1BA 4JRYE 2AK4B 2HT4D 2BCKB 2BHUA 2HRPH 2HFFB 4NCC2 3C5SB 4MXVE 1BD2A 5I1KH 5GGSY 3QO0B 3QFJB 1LO5B 1NCTA 3VFWB 5C2BL 2H32H 1PQZB 4LPCA 4U33A 3HCVB 2VL4A 1UM4L 5TF1L 5MEOB 3WE6B 5BO1H 4LP4A 2F54A 1IAIH 1AXSA 1JZ6A 4QRSA 2O5YH 3O4LE 2HKFH 3V6ZB 1NAMA 4BFEA 3Q5YA 1DQJA 2VE6B 3U7WH 3RVUD 3BH9A 2KBGA 4XI5D 5IG7A 2V2TB 1YMME 5BZWA 3ARFD 4QHUB 3HE6C 3IJSA 4F57L 1A14L 5I0DA 2VZVA 5HYQB 3UAJC 4L9DA 4LQFH 2HMIC 1ND0A 4LCYB 1HKLH 3IDIB 2W07A 4MNQA 1CDBA 5HI3D 4AH2A 2ZUTA 4ZUVB 5TPWH 3MV11 3P0YH 1HIML 1VGEH 4J3OC 4UIMA 4MA8L 4ETQB 3JWOC 1B6DA 1K3IA 3HI1A 2EZ0D 3EOBB 1FO0H 3U0PB 4GG6B 3VD9A 3NIGE 3QUXB 2HAZA 3LKPB 1EMTH 2OJZH 1WICA 3AXLA 1OAZL 5TE6L 3WHXB 4KZEH 4JFFD 2MKLC 3N50A 3NTCH 3ZKXB 2IEPA 3VWJC 5GS1C 5AAWA 4WUUD 4PREA 1JNLL 2R1XB 1NMBH 4POUB 4YIQB 3X17A 4YDJA 3E3QE 9CGTA 2DIBA 3PHOB 1HCFX 5F6IB 5D1ZD 4HF5L 2D03H 2V5SA 4YPGA 1D9KD 1HNGA 3T65A 4L8SB 4XNMA 1F90H 3NIFE 4RRPA 5ICYB 2DLEA 3W5MA 2X41A 3SHSA 1JGEA 2NXZC 4HKJA 2IG2H 5F89B 2A0LD 3T0VA 5FO7B 4MB4A 4NQCE 3BZ4B 5A2LH 1EVTC 2F74B 4HX1A 3NBNA 5EUKA 3UX9B 1MLCA 1IVLA 4M93C 4ZG1A 5BCAA 5CIPB 2BRRH 3BXNA 2PXYB 2OI9C 3EDFA 4KQ4H 1Y0LB 1JWMB 2F53B 4OCXH 1IBGL 3HMWL 5D9SA 5LGKA 1PD6A 5AG8A 2R29H 3MBXL 4CN6A 1KENL 4U1HB 4NOBA 1J1PH 1T0NA 2GK0A 1FG2B 4Y19B 1U91B 2P7TB 4OZHE 4KGLA 3CXDL 5GGTA 1NFDE 3SN6N 4ALAH 4G42B 3ARDD 3CXHJ 5DR5L 1N6QL 4XC1H 3N06B 1CFNA 4LF3A 4DTGL 1G1CA 3LY6A 5D7JC 2DAVA 3LQZB 4QLRA 4BJLA 3QUZB 5H2BB 4LLYA 3ZMRA 3CMGA 3T2NH 3WLBA 1NSNL 3RIFF 3VXQB 2UVEA 1RULH 4M1GH 2ICWJ 1AQKH 4PTUA 1U93B 4JANA 5HGAB 3O3BA 4PV8B 1DSFL 2EEDA 2VABB 5D9SB 3EFDH 4JFZL 3FB6B 5IROA 1B6UA 1T66C 4OTXL 1OAQL 5BZDB 4ZTPH 2GJZA 1J9CT 3BGMB 1MIML 4Z7UB 1LO2H 5BS0D 4OGYH 1KCUH 4QO1A 4G6FB 1XAUA 4XVJH 3CFBB 4MQXD 4OSUL 3MGOA 5D72H 2DQEH 1QA9A 2FIRT 3LKSB 2ZG3A 3MJ9L 5F7MC 5I1KL 4ZPTA 4MDJB 4PGEB 1F4WL 1XF5B 5CEYB 4IIQB 1IQWH 4PLKC 2BOCB 4NM8H 1C1EL 4L5FL 1WIPA 4EKXA 2YEZB 3ULSA 3K1DA 3QR2A 5MI0C 1BQSA 3FN3A 3HB3D 2A83B 1R3HA 4F7CB 1ZVSA 4U4BA 1RUQH 1JNJA 5HBBA 4YDKL 4C56D 1DLFL 1ADQL 4LCCB 3TBVA 1XGQB 1DUYB 3K8MA 4YXKL 1KN4L 4D0BA 4EI5D 4JFEE 2F5AH 3S97C 5FYLE 4G8FB 4JM2C 4OM0L 5CUSH 4GG6A 4OLWL 2OL3L 1TZIB 3WFCH 1HHKA 4LQFL 2F9BT 3EIFA 3EHBC 4PTTA 4F7PB 4YE4H 4HXAL 2FJHA 1NMCB 2HTLD 1EBAA 1N6UA 2ITDB 1CZ8H 3MOBH 5I74B 2PXYD 1BGXL 4YHKH 3Q2CA 1YECL 3BW9A 3S9DB 4XNQA 5DJZB 1NAML 3P77A 5D7SH 1DL7L 1CFNB 2EDRA 2PN5A 2BSSA 2DQEL 2VDLH 3O6FD 1Z0NA 3JZ7A 1T1YA 2NY2C 4BQCA 3QG7H 4PJ7B 1BREA 1F00I 1F90L 4OLXH 5K9JH 3UTSD 5JPNA 1ZTXH 2CK0L 1KXVC 5E2TH 1U95A 1GIGL 1E28A 1MCCA 1S3KH 1JWMA 1CL7L 5IFJA 1Q8MA 1OP5H 1T2XA 3EUUA 4MD4A 3TZVC 4QNPE 1QBLL 1X5KA 2Z0BA 4OLUH 5KSAD 2XT1B 5IIEA 5IEKB 3MV9D 3PNWB 1B0RB 5E4EC 5INDB 4IEFB 2DM4A 3I6KB 5ADOH 2NY4D 3G6JE 4XXCC 3DMMA 1OLLA 4L3EA 2DLIA 4OZFH 4TN9A 3QJHA 4JM2D 1PLGH 2ADIA 4Q7DA 2Y36H 2P7TA 3LN4A 3QI9D 3ZDXF 2CDEA 4R2GC 5TH2A 2E9IA 3FMGH 3HAEG 4Y8AA 3UPCA 4NQDD 3I02B 1U92A 2HT4C 3Q48A 2OR7A 35C8L 3QUYC 2HWZH 3ZT5A 3KHQA 1OM3H 5I1CH 3SDCA 5L8KB 1K6QL 3I75A 3ZDYE 2J88L 3FB8B 2ATKA 3DUUB 1KULA 3BKJL 2QV2A 5JMOC 1QUNA 4H5SB 5F7EH 4ODHL 1IC1A 4EI5B 5JW5B 5HHXH 1CFVL 3SDYL 4QTIH 4Y4KB 3O11A 4H88L 4QOKE 5IW6B 4JFDD 1FP5A 1BECA 4K9EL 1I3RB 2XXCB 2NTFB 3GMRB 1LO2L 4YXLH 1M4KA 5FB8B 2P46B 3UTTD 2AXJA 4GAYB 4NZRH 2YK1H 3SOBL 4EEEA 1T7YA 4BQ9A 4U1NA 4ZO8A 3LCYA 1DDHA 5DSCB 2YBRA 8FABA 3LSOB 1IEAA 2H9GB 3UBXG 2R4RL 4FQPA 3TBSA 3HZVA 2CIKB 4NN5B 1OGTB 3MACL 4OQTA 4OZFG 5DURB 2JJSA 5EZOH 2VLKA 4DN3H 2R0WL 2UWEF 3CVHH 4RMTA 1RVFH 2X4SA 1G0DA 1NGPH 3NFPA 1MIEH 2HN7B 5D71L 3QCTH 2NY0B 4K8RH 2X4UA 4M03A 5ANME 4TUOA 3O45B 3X12A 2MJWA 3BEWA 4LPWA 4NGHL 2NXYB 4LSUL 2VLKD 4OLWH 4PG2A 3CFIC 5FV1L 4F9PA 4XXDB 1C16B 5F6HJ 5LWYH 2BZDA 3I3BA 3PL6D 3KPMA 5F7YC 3TO4C 1M6OA 1FBIL 1TQBB 4HEME 3X13B 1JV5B 4ERSL 2NY1D 4OBRA 2ZJSH 1ZSDB 1FRGH 3RY5A 3LKNB 2A73A 3LKQA 5GRVL 3ZE2F 1F2XK 3IDMB 1JV5A 2B1HH 3SCMA 3S5LG 1YY9C 3VI3F 3ZTJH 4GXUM 2C3XA 1WGOA 1UWEL 4LSTL 1WT5A 2YPVH 1IL1B 4N1EA 1EO5A 1CE6A 3ARTA 4MD5B 4WTZG 4WU7A 1UXWB 3D39D 1UM5H 5FCUH 4XXDA 5GRVK 4ZFZA 3OB0H 4XP1L 1I1FA 2XWBA 3GB7A 5EUOB 3GKWH 4DOHB 5CMAB 1LP9A 3HE6B 4NO3A 1UXWA 4KHXL 4WGWB 2WK2A 1OM3L 1EERB 1NGQL 4L4VB 5I1CL 4HJJL 5C0BB 3JV6B 3WDHA 1WFTA 4HUVA 2VQ1B 2P1YA 5CD5D 3AROA 5CGMA 5T1LB 2GJ6D 3G04A 3CSYB 1PBYA 3QDAA 3W9EB 1MJUH 1ES0B 4OI8A 1V3KA 3L9RA 1BIHA 3G5VA 4RAHA 5AYQA 5E6IC 2AXFB 4NFBA 4WUUA 4JY4B 4XCNA 2IG2L 1AO7B 4M8VA 5EOQH 3FFDA 3STBA 1RU9H 3ROLB 3GUTB 2QKIA 2ADIB 3H8NA 3TPUA 3TO2B 1S9VB 4P5MB 5DA0B 2OTUA 4LSRL 3HE6A 1AGFA 4MMZC 3C8KB 1I9RH 1NDMA 3H9SD 5INDA 1WZ1H 2DQJL 2ADJA 5IQ9B 1GOGA 4DZBA 1FLTX 4PJFF 3P9LA 1EK3A 5CJBA 1P6FA 3OPZH 3VGDA 5JW3H 1Q9LB 4LPVA 3BIAX 2SEBB 5T1KD 3H7BA 1CR9H 3DXAA 2N4IA 5GGTL 3SBWA 5B21A 1F6AA 4X8JB 1I75A 5DC4B 5I8OL 4K23H 2A6KA 3O6FA 1MFEL 2WBKA 5KVGL 1QHPA 2BVYA 1JHTA 2QL1A 4P9HL 5DMIH 4OGXL 3BP7B 4ZSOE 2EH8L 3RTQA 5FF6A 5C0CE 4NN7C 2LQRA 1PKQA 4JFXA 3SDAA 3SE3C 1D5ZB 1UM6L 3H7BB 4YHNA 1I3RA 2IAND 5B8CB 3E0GA 4WTWA 4XTRC 1FG9C 2AV1B 2BDNL 1JGLL 1T04A 4I5BA 1OTUC 3K81A 3LRGA 2P8MA 2Y6SD 1L6XA 3ALWA 3MCLH 3NZHH 5DJAA 3OR7A 5I16A 5J8OA 3WXVH 2VDQL 2OL3B 5HHOE 3PWPE 3C5JA 1KIRA 2X4PA 2W59A 3VJ6A 2ED7A 4XVTL 1NBVL 1QBBA 3FCTB 3BYTA 3WS3B 5GGVY 5KVFH 4WV1A 2J5LC 3LAFA 1B0GA 5HYJA 1Z9MA 3UROR 4MX7A 4RRPG 4ISVB 5D8JH 1ZS8A 5GS0H 3WLWD 4XHQA 1IAOB 3OX8A 4MHHG 4TNWK 4O9HH 3TBTB 3MJ9H 2XZZA 1WF5A 2YRZA 4HUWB 3VD7A 4O4YH 4C4KT 1LP9B 2R2EA 2CQVA 3LQAL 1YMHB 2R0KL 5F7HA 3CCHA 4MJIB 4YHML 3MLUL 2W9DH 2JB5H 4L5FH 1S7TB 4JN2A 3OXRB 4CNIB 3P73B 1KB5B 4JPKH 3F12A 3I85A 1J8HB 4KV5F 3WEXA 2I9TB 2HKHL 4KHXH 1FC1A 5T1KB 4JZNB 1W2KT 3C2AL 2HJFA 3LN4B 4P2OC 4G9DA 4YHOH 2APBA 4ONGL 2CXKA 1I9IH 2HT3D 3QNYA 1QVOB 4I0CC 4OD3H 5FYJU 1ETZB 3JV4B 3T8XB 4XPTL 4G80A 3MMEA 4JFYB 4AYFA 4P2RA 3WFDL 3UEZA 1U3YA 5DK2A 2WUBH 4Q9QL 2OCFD 5BOZG 4H5SA 3BZFA 4F33B 1JGDA 4JEGB 2P8LB 4R7DA 2C3WA 5TQ2L 3RA7L 3WS6A 4ZFOA 3IETB 4G6AD 5GS0L 2P5EE 3PDGA 2ZNXA 3A6CH 5KOMC 3HTLX 3V52L 4OKDA 1VEOA 2EDLA 4P99A 1EVUA 5MERB 5JDSA 1BZ7A 3VFSB 2Q3AA 1H8NA 3QUZA 5E08L 3CXHK 1H3GA 4TVSa 5TGBA 3SKOA 5CBAA 2BDNH 4KDVA 2PW2B 3T77A 2YBRB 1CE1H 8FABB 3E8UL 1YYML 3PL6A 4D3CH 4WI6A 1KIUA 4X6FB 1AC6A 2CUHA 4M5ZH 3NZ8B 3P40A 1D5XB 5D6DA 4GKNB 5GRUL 3SKNB 5BS0A 2LV4A 1VGKB 4JDVB 4ZTOL 3ZKNC 3ARZA 2BFVL 3PXHA 4PBVC 4HMEA 3KGRA 4IMKC 4BFIB 4OZFB 1OW0C 1JK8B 1CDYA 2VXSH 3QUYA 5HJ3B 3RWEB 3V0WL 5CCKL 5DRWA 5ID1B 4XP4H 1JZ8A 2EDBA 3ZDXE 1JUFA 1MCLA 3I3DA 1IQDA 1DBAH 1YNKL 1KB5H 1CQYA 3HNTH 1G6RA 3MV9E 4OLYH 1MREH 3QQ4A 3FOLA 1HCVA 5MEPA 2JJVA 1K2DA 1PAMA 4Z6AT 1PYWB 5D1XC 3OKEA 5D2NE 2HTKD 3P0GB 5E6ZA 1AR1D 4CRPA 5C08D 2X7LA 2V2WA 4HFUH 4Q9BA 2IGFL 3D0VA 4MA1C 2H32A 1R3HB 4Q9RL 4HUUA 5B38B 2IALB 3NTCL 4CMHC 4DGYH 1B0GB 3ECBB 4DUWA 2ZG1A 4QXWA 3LQZA 3RFZC 1UH3A 4S1SH 3RWCB 2FIKA 5CGYC 3PXJA 3QEQD 4UTBL 3D85B 3O3DA 4JDZA 1BPVA 4J4PC 2FJFA 2FJHB 5ESAA 5AG9A 4JN1H 4XVSL 3QB7C 2EECA 4W4NA 4KPHH 5HHOD 3QCTL 3KPQA 3IU3A 1Q94A 4UILH 4RGMB 5E5MB 3RWGA 4ZTOH 3RY6A 4X6CE 4K3JL 4HUWA 4PJDF 5DEGA 3KYAA 4LVNB 1DQMH 4ODTH 2VZ1A 3SJVE 1T1XA 1D6EB 2W1NA 1F11B 4ONFL 3HNSL 2VAAB 3OQ3B 5E00A 5AWNL 1AJ7H 4P59H 5ICYA 3T0BA 4CADB 3VU2A 1A6VL 5CIPA 4HUXA 3IJSB 3L7FB 4JDTH 4LLVB 4H0IA 4YHPA 5EORH 3BZ4A 2R4SL 3T8XA 2AABH 3WFBL 4DKEH 3EYQD 4LNRB 3WIHA 1S7UB 4KKBD 3QEQA 5C70A 3IDNA 4G9DB 1FNEB 5DEZA 2JTDA 2VLRB 4PJXA 4F9LA 1GZPA 1S7VA 3MV7B 4YUEL 5JHDE 4K8RL 4LKCB 5HYSG 2Y5TA 5DRXB 2PTVA 3O41B 4GRLB 4DWHA 4HJ0C 1HI6B 2Y25A 3VFNB 5HD8C 2ZUXA 4QXUH 4U1GC 4ZNEA 3WJJC 4LASH 3UZEA 4R7DB 4W6WB 2APFA 4E0RA 2KUTA 1D6VH 1T83A 5GGSA 7FABH 4U05A 1G7HB 5JPMB 5IVNA 4XX1E 1LK2A 4ZSOA 3IFPB 3VH8A 3TBVB 2CLZA 2V17H 2YRPA 4PYGA 4YX2L 3SCMC 1C5BH 1UWEH 3KHOA 1ZWIB 2YPLE 3OKDA 4FNLH 5TJWK 4WW1A 4ZMAT 1A1OA 5ESVA 2Q76B 4OZGE 2AI0L 1CBVH 1LD9A 3NH7H 1BOYA 3AUVA 4PR5A 3EHBD 1V7NH 1T80A 2DM2A 3RDTD 3IXAA 2EC8A 5EU7E 4JR9H 4RFEB 1EX0A 1T20B 4NHCL 5SV4A 2O93L 4GRMA 5F1SA 2CUIA 3MR9A 4K3GA 5E7FA 2FATL 4ZUUA 1G6RB 5C6TL 4E42A 4AIOA 1ZLUH 3SY0A 3GMMB 3FFCA 3L3JB 1NFDA 1OWWA 3F65A 3T0EC 3VG0L 3O6MH 4EVNB 1CD0A 5E0QA 4EN3C 1DQML 3LKNA 1OB1B 1DBBL 4X5WA 3ROOB 1OAYL 4X83A 3ZT6A 3KJ6H 3Q5TA 4U1MA 2AEQH 1D5IH 3ZKMC 4JLRA 5E2WL 3RZCA 5DJXA 4G9FB 5BQ7A 1CD1B 4HFWB 1I85C 3F5WB 4NO0B 5DZNA 4Q6YA 4V1DB 5E7BA 3BP4B 5L0QB 1RZFH 3EDDA 4Q6IB 4UBDC 4KMTH 1VFUA 4U7MA 4PG9B 2RGSA 1JBJA 3KWWA 1SBSH 5J7CC 3OXRA 5D5MB 5KVEL 1JGVL 4DEPB 5F1NB 3DVNB 3MCLL 5GS1B 4PB0L 5KVGH 3IAPA 2VR9A 3PGCA 5E4IA 2DWEA 3PUCA 3WFZA 2NY5L 5EUKB 1ZVHA 4C57C 4BYHA 5KVDH 5D4QA 3VRLE 4X0KB 5HY9A 2PETA 1JZ3A 1GOFA 5E2VH 5ITFA 3HFML 3NACH 3MRDB 43C9A 1TVBA 2AJYL 4OIBA 4OD1H 1SY6H 4LARL 1T2QH 2OXHA 2Y07L 1LNUB 3O8XD 3VWKA 5C3TA 5J13C 1JNNH 3MLZL 3GKZA 2N56A 1LQSR 4N0FB 1AGDA 2X4TA 2Q20A 5F96L 3MRIB 2XN9D 5FB8A 3DVNA 3QJFB 1I9EA 2MKWA 4L4VA 4UQ2A 1MEXL 2GAZA 5HI4C 1WEJH 2VZOA 3WNNA 5LGHH 4HH8A 1KXQE 3B4NA 4Z76B 5DD1L 4AK1A 3L3GA 3ULUD 1U8PA 1WIUA 3BPCA 4OBSA 6FABH 2QQQA 3O3UN 1RZ8B 4G6KL 4FQXC 1JYXA 4X5WB 1ZLSL 2EE2A 3JVGC 2XRAL 2YXFA 4KWUA 3LIZH 4O5LH 1H3TA 3CNKA 3DIFB 2R0KH 1FCCA 1KIQA 1BQLL 1RZ7L 2QBWA 2VRAA 1H3UA 4RAVA 1L0YA 2ERJC 4O2EA 1MHCB 4JRXD 4WI5A 1U8JA 4NN6C 3S88L 1QFUH 3MA7B 1WCBB 4OCXL 4OTXH 3D2UA 3UO1H 3TO4A 1CGXA 1MIMH 2QHLA 1X3DA 1G7HA 4LLQA 4YBLC 3MACH 3B9KA 5IF0A 4M5YL 1I1FB 2AEPL 3BPCB 1RUPH 3BRFA 3FFCB 1CGTA 2PUQT 5IJKA 1MH5A 3G6DL 1AFVH 4AL8H 3SDXA 4M6AA 1ZHNA 5C07A 2AK4D 2R1WA 2R0ZL 3GMQA 3TT3H 5IFHH 4NZDA 1HDMB 4PRHA 2DMKA 4XC1L 1PG7L 1P84J 4DTGH 3EFFA 2ENSA 5ESVB 1IM9B 1NEZB 4XNXL 3VD3A 5CLTA 1CXHA 1YNTA 3DV6A 4X9HA 4ZS6C 3UYPA 1S78D 1NBZB 3MXVH 3O2DH 4OCYH 2GCYA 4OD2B 1ZT7B 1DSFH 2A74B 4ZUSB 4ODUA 3V4PH 4H20H 2PCPB 4G6KH 5EN2B 1A7NL 4ELKA 5BVJB 4G8GD 4ERSH 4YQXL 5A2JH 1I1AC 2X42A 2Q6WA 3G04B 2DLHA 1QLRB 2FX7H 3EOAB 2FRGP 3MOQA 1FFQA 5A43C 4OZIE 3L5JA 5D2LA 4OQTH 1QG3A 2BXYA 4PP1C 4YZFE 5I74C 1XGPB 3RRQA 3ARDC 3HG1A 3CVHA 4K94L 4LAJH 5EIIA 1UJ3A 3DETC 5DEFB 1A3QA 3CDGA 4NHUB 1SYVA 4HIEA 5T1LD 2KL6A 4PJGB 1DFBH 4IHOB 2DLGA 5LGJB 5M95B 3SDDA 1OQOA 1IEAB 2H9GA 4PB0H 4L4JA 4U1KB 3TVMA 4R4FL 5ALBH 3VFRB 1JYWA 4GJTB 4LP5A 5JDJA 3WL9A 4PJIB 4KI5C 1K8DA 1R3IH 4WDIA 4Y4HC 1SEBB 5CSBA 2PTUA 4G8EA 4KK6C 1AR1C 3GSVA 4AJ0A 4QYOA 4X99A 1TVDA 1T03H 5TDPB 2APVA 3DMMB 4X4XA 1SY6L 4LCWE 3QQ3A 5EZLA 1P5VA 4BKLA 2GT9B 4JY6B 5IB4A 1J0JA 3JVGA 1IKNA 4F2MB 4K3JH 3D0LA 1QZ1A 4WHTB 4CMHB 1EXUB 2VDRL 5F3BA 4M43H 3W9DB 3NA4A 5GGRY 3D3VE 3T3PE 4NDMA 5C0CB 3TFKC 1TCMA 3HC3L 1HEZA 2DICA 5ILTL 3RI5K 4JM2B 2EDYA 4MQTB 5KN5B 1G7PA 5INCB 1J5OH 2EE6A 3UPAA 5ISZB 3F7VA 1P7KB 2EDEA 2A77H 3TN0D 5JUEL 3V5HB 4JHAL 1A1OB 4KDTA 2P24B 5HPMB 1FPTL 4R8WH 4KY1H 1MCWW 1ZOXA 3HZYB 4LBEA 3NGBC 4FQJL 1KLGB 1HH9B 2E6PA 3QDGB 4P2QE 1JK8A 3QUYB 2IMMA 4HMCA 3IS1X 1P2CB 4TQEH 2P5WD 4OZIF 3ESVF 2PR4L 1CDHA 3GSWA 3KS0H 5I1HL 4LVEA 4GMTH 1ZA3A 5SX4I 3NA9L 1ORQB 5CILL 4OF6A 3HNSH 4RQQB 5JA9A 4JFED 4JQIH 4CU6A 4LLUB 3ARPA 4RA0C 4RGOH 1Q0XH 3BEWB 3E2HC 3MLTA 2C1PB 2HFGL 3WV0A 3HKFA 4UNVA 3L6FA 5CHNA 2ZSWB 3AMLA 2FLBT 5FYLH 1F4YH 4HIJA 1ORSB 4Y4FB 1QEWB 4HS8L 2QEJA 2P44B 3WNKA 2WBJB 1JRHH 4FQ2H 4NRXB 2F54D 4HIJB 4JG0H 1UYWH 3H9SB 2YD9A 3SDXF 4FFVC 4NZRL 3TZVB 3ZL4H 3BEVA 2FYYA 2BVQA 2LAGB 5KOVC 5C0FA 4OGZA 5I71B 2JB5L 5FKAA 5J9PB 1G7MB 4WFHD 3QIUD 4NN5C 1T6VN 1SEBA 3GMOA 2RCSL 4HKXB 2IPUG 2D31B 2KZ1B 32C2B 4HPYH 5T3XH 4LAQH 3SDAD 3IJHA 4AEFA 5JXEA 4PJBA 3W2DL 2R0WH 5MEQA 1N6VA 4U49A 1J8HA 1XEDA 1N0XH 5L2KA 3NAAH 1YEDA 2VKXA 1CIUA 1MCJA 2OMBA 4TUKH 3IETA 2HJFB 3OV6A 2GJJA 1XR9A 4YBHA 3DMMD 1XCQA 4J8RA 5J57B 3VW3H 4U0QB 3LMJL 3PWUB 1EFQA 1P9MA 2YK1L 4HX1B 1RSFA 5CEZD 3KXFD 4PJAF 2XKNA 4HMDA 2FCBA 5ECJE 3ZTNH 2XFXB 4I13B 3IFNH 4G9FE 1NC2A 1TQBC 2AJZA 3MV8B 3MNVB 4PV8A 1T0PB 1IKNC 4Q58C 1QVOA 3HZKA 4BSWB 1F4XL 2JJWA 2FJFB 3W0WA 2ZOLB 1IAOA 1D5XA 4HW6A 2EKJA 4LIQH 1X7QB 3VFRA 2DQGL 1HWHB 1DQJB 5EOCJ 5DURD 5IT2H 5GSRA 1JI2A 3BKJH 1NANH 4M1DL 4W68A 4AEHH 1A6WL 3S37H 3V7MA 2Y6SC 1ACYH 2GYSA 1TCRA 4M7KH 1BZ7B 1K3ZA 4R8WL 2W9EH 1HHGB 3EYSH 1IGFL 2X70B 2DQUL 4HLJA 4G5ZH 1NJ9B 1P7QD 2WWMD 3KPNA 4LAQL 4LVOB 4HCRL 3TWCL 1TMCB 4R0LA 3OAUL 5LXGH 2ZSVA 5I30H 5HHOA 1QR1B 4KKLC 2P49B 3MBEC 2NY6D 1IEBA 4X7FC 1JPFB 5DRNB 1PSKL 4N5EC 1KTLB 1MJUL 4RGOL 1WVZA 1NDMB 5BZDA 3GK8H 4OLYL 4MYWB 4GRWE 4OUOA 4AQ1B 4LCYA 2F74A 4LU5L 5FXCH 2K7QA 1D5BB 1FNGA 2MCG1 1E4XI 1NDGA 2ESVD 4Y1AB 5ID0B 1ZLVH 32C2A 1JPSH 2GUOA 2YPKA 1WFUA 3ESUF 1G9EA 2XA8H 1PZ5B 1X5XA 3QPQC 1U36A 3M17A 4OCWL 4P5KA 4QNPF 4R3SB 3MRKA 1MVFA 4BZ2L 1P2CA 1TPXC 1MEXH 2X4PB 3H42L 5FM5O 3SDXB 1BFTA 1MH5B 2GK0B 4HLZH 4Y19A 1K2DB 4HPYL 3HE7B 4Y2DC 1WWWX 4PLNC 5DJAB 5KVMC 1A7OL 2RHEA 5JR1L 3NCMA 4B0MM 2FSEB 4R2GD 4JKWA 4RAUA 5DMJB 1X5YA 5I8OH 5CHNB 1IQDB 2VXUH 1OAUH 5A3IC 2N1KA 1WC7B 3DX8B 4X7CC 4NOFA 3TESA 3GBMH 4I2XB 2E7LC 4YPGB 4B7LA 2VUOA 1YJDL 2EDOA 3FB7A 2X1WL 4IDJL 4Y16D 3RUGE 5I19H 1AQDA 3DRQA 4G8IB 4Y5XC 1I3VA 5E6IB 4OZGB 5ACZB 1UEYA 3LPWA 3WIHL 2C7UB 4LCUB 4R4NC 4YDVB 1CR9L 4MJIA 4X6CB 4P4KA 1L7IH 3L9RB 4YNYA 1SYVB 2ITCA 2WWKT 3VGAC 5DD3H 3PGCB 2Z4QA 5J1AA 3OF6A 2H8PB 4L8DA 3MRGA 1KB5A 1OSPL 4HWNA 4ZO7A 1G6RH 3SDDB 4GSDL 2Q8AL 4IOSD 4PJ7E 2MSPA 1X4XA 2EDNA 1RFDL 1IE5A 3JWNC 3WD5L 2CLVB 5IMLB 2BSTB 1LEIB 4NZTH 3ZE1E 3I6GA 1EAPA 4QXUL 3AM8C 2D0HA 1NC4D 2IQ9H 2OTUB 1MJ8L 3PE9A 4NNPL 1S7SA 3S5LA 3U79A 4NM4H 3WXWL 4D2NA 4H1LA 3RWHA 1X9QA 2DBLL 5TDOA 4G80B 4JFYA 3WUWB 1CXLA 2VC2L 3U6RB 1AGDB 2X4TB 4QOKD 3LS4L 3FO1B 4Z7VF 3SE9H 4LSPL 5L7XL 3VXSA 4GAGH 2VWEC 1MFDL 1QHOA 2Y06L 4XRCA 3V95A 4DVRH 3KXFB 3V6ZA 4HWUA 1DZBA 2NW2B 3KLHD 4OLVH 1V7ML 1EUUA 5C0CA 4NN7B 1OAXH 4P9ML 4PBWD 4E42B 4ZUTA 2QTEA 1V7NL 1H9VA 1ZKAA 2OR9H 1GIGH 4Y16C 5K93A 4I0PA 1XH3A 4NQCA 3SJVB 4GRWB 4OV5B 5A2KH 3GSOA 4YDIL 2VDKL 4JCMA 1I7RA 4ONGH 2NY3C 2BVPA 3ULUH 4ZYKA 4U7KA 4NQUA