1HI6B

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
b'QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
molecule tags Immune system/peptide
publication title Crystallographic Analysis of Anti-P24 (HIV-1) Monoclonal Antibody Cross-Reactivity and Polyspecificity
pubmed doi rcsb
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B02
2D4FA 1XZ0B 4ZS7L 1H3TA 2UZIL 2EIDA 3IAGC 1VENA 4ODUA 2B4CH 3L95B 3O2VH 3P30H 2VDNL 1OAKH 5T5FL 3U9PL 4UILH 1OW0A 1T7WA 4HIXL 2Z8SA 3UJIL 3WHE0 2KBGA 5DJ8A 4JRXD 2P5WE 1OARL 1CI5A 1L7TL 2YPKB 3CGTA 2JJSA 5IV2A 3QEQE 4PJCE 4DGYL 2EO9A 4O9HH 3CU7A 1IL1A 3KPNA 1YY8A 1MCBA 1HSBA 4LNRA 3FFCD 2YPKA 1RVFH 3WFCL 3W81A 4K7FA 4YDIH 3IRPX 1EPFA 3KPNB 4DGVL 3GB7A 1QPPA 2W92A 4RQQA 5HHVH 2QKIB 2A83A 5L7XL 2A2QT 3VGHA 15C8L 3OKDB 4GRLC 4L8DA 1QHPA 3ZO0A 4YXLL 3RWGB 4Y1AE 5E03A 4XC3L 4KQ4L 2Z35A 3HMWH 4KJQD 4WY7H 4JN1H 4QNPF 1RD6A 3GUTB 3UJTL 3B4NA 2F5BH 5HI3C 1KPVB 4HWEL 3O0RL 5GISL 2HVJB 1A22B 4HX1B 4AH2B 3EO9L 1P84K 4MCYB 4J3SA 4W4NA 1HZHH 4GO6B 2VDPH 1KLUA 2V2WA 5DUPL 3RX5A 2R4SL 4OIAA 5E8NA 2ADFL 1DBAL 1N0XL 4OZFB 2AKRB 2NZIA 5GS1A 3EOBA 2QHLA 1F02I 4JKPL 3RWFB 3GMOB 5HHXL 3CCHB 3EOAA 3H9SE 5T1LA 3TVMD 3N85L 4YR6A 4ONFL 5JXEC 3LQZA 7FABH 3ULUL 2E7LA 4XVUC 3H0TA 4PPTA 1LP9F 1KJ3L 2FATL 1DDHA 3O4OB 3AREB 4O02H 5BZDB 4F9LC 2VR5A 4XBGA 5D6CB 3AAZA 3OJ2C 1ORSA 1U41A 4KKAC 4R2GD 4YXKH 4OLUL 2HT3C 1B0WA 4PRDB 1NSNH 4HJJH 1UA6H 3WUZA 2XKSA 1EXUA 3V6FA 3QCTL 1AD0B 1AO7B 1NFIA 1P1ZB 1H8SA 4NRYA 2VDQL 1QLFA 4Y4KA 4MQ7B 1AHWA 3JSSA 2OI9C 2F19L 1LEKB 2AJUH 1Z9SA 4OZGF 4CNIA 3FRUB 5F7HA 4LLQB 3PWLB 4DVRL 3U82B 4HCRL 1ETZB 3GK8H 3OX8B 1R3LA 4Q0XL 3HAEB 2H32B 5DYOA 2R2HB 2XY1A 3VFUB 4PJ8B 1IGCH 3SKJL 3ULUD 5DD5L 3FT4A 2X4QA 1CL7H 3F5WA 1AY1H 2VR9A 2ZSVB 4BH8B 3M1BB 5LWYL 3ZE2E 1T2QH 4GW4A 1SVCP 1K85A 1A9EB 1RZKL 4NM4H 1BD2D 1P2CA 3MLXH 1FVDA 1KB5A 4M03A 1OD7A 4FN0A 2OXGA 2D0HA 3F7VB 4GKSA 3A6CH 3B3IA 2WUBL 3CFIC 3GBNH 3RUGE 3S7GA 2CJUL 1QKZL 1IEAB 4KJYB 4XXCA 2XZCH 1QSEA 4KKAD 4BSVA 4BYHA 3V5DA 1F11B 3EKCA 4U7SA 3GSUB 3SDXE 1QP1A 1Z3GL 2E8ZA 4NP4H 4OKVB 5TGBB 4QXTA 5ID1B 3MTRA 1YEFH 4IRSB 4OZIA 4FQXD 1HE7A 1DR9A 4X99A 3OKMB 5D8JH 5HBBA 2XZQH 2H3NA 2J4WL 4OF0A 1AXSA 5FO7A 3AXLB 3UC0H 1RK0B 4FXGA 1L0XA 4BM7A 3IS0X 4XB8A 2D7MA 4JKWA 5I19L 1O0VA 1FNGB 1A6AA 3TA3A 1I7ZB 3QIUD 3O3AB 4KVCH 5JNYB 5HGBA 1WFUA 1DP0A 2CO7B 3OF6A 3RPIB 1P6FA 1T04A 3EJYC 3GMNA 4NNYA 1A4JB 1PY9A 2G2RB 2RQ8A 4N0YH 4ZYKA 3NIDF 4U1HA 2VISA 3MR9A 4RIRB 3RRQA 4ZUSA 3TGXA 1MHCA 5HI3D 3I75B 3U2SA 5CEXA 1ZMYA 3HNVH 3X3GH 4M1GH 1P69B 4IMKA 2OL3A 4CL7A 1NMBH 5E8PB 3LQAC 4G8IA 2HTKC 3DVGA 2NZ9D 2V2TA 4NT6B 1AGCA 2AV7B 4KTDH 5D2LB 1C12A 5E6ZA 5K9KB 5F93C 1MLBB 3ZKMD 1RUML 3TH4T 1J0JA 4OF8A 5ANMA 3HE7A 2DF3A 3U4AA 5DD0H 3PDOB 5T33H 1DQJB 3L3GA 1HZHL 2P5ED 2PW2B 3G5VB 4CDHA 4EI6A 5F70A 2BNQD 3HE7B 4IRZH 4L3CA 4NQCE 4NPYB 5JDJA 3WEXA 3TM6A 3Q48A 2ESVE 2VYRE 2DQGL 4TULH 1U92B 1RMFL 1O7SA 3MRDB 2WWMC 4C56E 1VCAA 3MV9E 3S35L 1U8KB 2XNAB 5EZOH 2HJLA 3BH8B 4MSWB 1MFNA 3I02B 4NKDA 1TJGH 2A73A 2HKHH 2YHGA 3FQUA 5ITBL 1DQQA 3GI8L 5I1EL 5IF0B 2MTPA 4K3EH 5CJQH 3T2QA 2ERJB 3NZHH 1IAIL 3NA4A 3ILPA 4Z7UE 3IU3A 1S9WA 4ONHA 4K94H 1OPGL 4UV4H 1H3XA 4P2OC 3KYNA 3PGDB 5GRYA 3BD4A 3MRNA 4G9FB 4XPBL 5DSCA 3SY0B 1NCDH 3KYMA 5IEHA 4XCYA 3MLPA 3RNQB 5D6CA 1MI5B 4PG2C 2XA8L 4R26H 3RWGA 3GBMH 1TFHA 3SY0A 5IT2L 2Q7YA 3A0OA 1T89A 2PYED 4POZD 5HGDA 3THMH 1WWAX 3QT2A 2J6EH 4JFQA 2Q7YB 3QFJB 4OFDA 3ZE0E 4U3HA 3H6JA 3C5ZA 3QI9B 1G9NC 1AQKL 3U9UA 4UDUB 2AEPL 2HLFD 4PJHE 1U8NB 4D2NA 3K8LA 2HVKA 4MA7L 1F2QA 4WI2A 8CGTA 4GAGL 2FX9H 3TBTA 4FFYH 1GC1C 1ZT7B 3WUWB 4IBLT 2P8LB 3LOWA 5HYJB 1A6PA 1CFNB 1NFDB 3NFNB 4HQQH 5KSAD 3V7MA 4POUB 3MO1A 1IKFL 4KJPC 4X9HA 2D9CA 1S5IH 4ODVH 2V5TA 3H2WA 4HIHA 4HAFA 3F5WB 3MJ8B 3FKUS 1GOFA 3VWJB 3RGVA 1KELL 2Q8AH 1K5NB 5C07A 3GSNA 4XVJH 1YQVL 4PREA 1A9EA 3OGCB 4M6NL 4S0SD 2BRQA 4P23B 2VZ1A 5KVMC 1CXLA 4OTXL 3V5KA 2L0DA 4XBGB 3T0EC 2CLZB 1XF4B 3VWKC 4MHHG 3UJJH 3VXOB 4KXZH 3GJEB 1RZ8B 1HINH 1MCPH 2FX8H 1NUDA 2XN9D 3ARVA 4NZDA 4Z0XA 2MMXA 1CK0H 1LMKA 4G43A 4IOSD 5F9OH 2C5DC 5GGQL 3Q3GB 2V5YA 4YWGH 4YBLB 1EBPA 5DFVC 3TCLA 1E6JH 3MA9H 5CD3B 3QUYC 3U1SL 3QQ4A 5C86A 5ITFA 1IFHH 3DTXA 5A2IH 2D7TH 1HHKB 3NGBC 4YHYB 3KPLB 4FQLL 2IAND 3VG9B 1ZSDA 4RWHA 5GRVL 2I24N 5D1XC 3B5GA 4JLRB 1CIUA 2R1WA 4EI5B 3C5SA 3OR7B 1S78D 7FABL 2VN4A 4ODWB 4ZYKB 3VI4E 5IB2B 3TFKD 4LNVA 1QQDB 5DHVA 1KXQE 4Q9RH 5DWUH 2X4RB 1F4YH 4LVHB 1S7TB 3RUGF 3UTOA 3EYOB 5B3NA 3IRZA 4HWUA 2LAAA 4PGZA 2YD7A 4PJAA 2BDNL 5GRWA 4WGWB 1IARB 2Y36L 1SYVB 4QYOA 1MLBA 5CHNB 4DJMA 1RUMH 4MQTB 4W81A 4DZ8B 4KK9D 3RA7L 5E1HB 2ZSWA 4AZ8A 2SEBA 4UUJA 3BE1L 3ELAT 5C0BA 4CBPA 4OCNC 1EUUA 5KAQF 4RSVA 4LSTH 4AENA 4AL8L 2GJ6D 2HTKD 3BZ4B 4PS4H 4APQB 3RNKA 3BIBX 1JGVL 5CWSA 1P7QB 4OCMC 1INEH 4WU7B 5IJVB 1ND0A 4ELKA 2P43B 3L7EA 3FHAA 1T7ZA 5TF0A 3MRPA 5JUEH 5C9JA 3TZVA 3FQUB 1INDH 3LCYA 4JFYB 1LEIA 4K3EL 4ZPVB 3NZHL 3ARGD 4HKZA 1MF2H 2QBWA 1HH9A 1R5IA 4O00A 5T1KD 2JJUA 3SKMA 1T1WB 4E41E 3HZVB 2FECL 4OZHE 3U36A 3QIUC 1MRDL 4X98A 4UINH 1YEHH 1OWWA 1OQOA 3ZKNC 3T3PF 5D71H 3TT1L 1FNEB 2RIKA 3HPJB 3KYKL 3FFCE 1F6LL 3W11C 3VRIB 4RWYL 1YMHB 3OAUL 4Y4FD 4HUVB 1T5WA 2VWEC 4Z7NF 4KQ3L 2MPAH 2R4RL 1E27A 3D6GA 4NKOA 3KR3H 5I9QB 4UDUA 3QXUA 5BW7C 3D85A 3E0GA 3M8OH 3VD3A 5ISZA 3D69B 3W0WD 4X9FA 3BPOB 5FM5O 5IVXB 3HLAB 1PBYA 1XGQA 5GQBA 3HR6A 5DMYA 3JVGA 3MLTB 1D6EA 3VFVB 3QJFB 5IVXA 4A2MA 5IB1B 4IOIB 4OJFH 4X8JB 1NGQH 5EUOF 1KPUA 2EDXA 3ZHLA 3VFVA 2BNRE 4HK0B 4JFOA 4U6VL 4I3SL 5ESVB 4XBPA 2ICWJ 2NY7L 5IFJB 1M4KA 4LIQL 4NNXA 4M43H 5ESVA 5D7LE 1KUMA 2VABB 1NLDH 4XCYB 5CD5C 4GG6B 3QWRD 4MX7B 3F58H 3F7YB 4XP1L 4RAVB 1ULVA 4S1RH 1CL7I 4EUPA 2IBZX 2GSIB 3KPMB 3MFGB 5LGJA 2A6IA 5TH2B 3PGCA 4PY8J 3F12A 1MY5A 4TOYH 3AUVA 1TJGL 5T3XH 3LEXB 1IGYB 3FOLB 5INDA 2EYTB 5F1KC 1FO0H 3BN3B 3KPRD 3SKNB 3QRGH 4S2SB 4BK4A 4HEME 1U8NA 4P0DA 1IGYA 2R39A 5E2UL 1W8NA 3QIBD 4PYHA 3OXRB 1KBGH 4KROB 1AH1A 1QLRB 1A4KB 3B8SA 3INUH 3RL2B 1E4XL 4QRRB 1FORH 2P8LA 3WLWD 4HGWB 3BPCA 3MV7B 1WEJH 1S9VA 2R0WL 3KNBB 1CZ8H 3OKKB 3CFDB 3U83A 5GGSA 2EYRB 1GPOL 5DRWA 5FCUL 1VFOA 2Y25A 3DX8A 4HDIA 4P4KB 3KPPB 4P9MH 1BREA 3SQBA 4MVBD 2W60A 4Q6YA 3QUXD 5DK2A 3OGCA 4R4FH 4J4PD 5DRWB 3GSOB 1R5VB 5E2WH 4LCIH 3EO0B 1XEDA 4IRJB 2N1KA 3BH9A 5IEKA 3O81A 2YMXH 4AEIL 1LGVA 4R0LB 5AYUH 4Z18A 4JFXA 4RGNE 3GBML 4OI8A 1FL5A 1FYTD 1GGIH 4W4OC 4M6MH 3AGVA 5HJ3A 1I1YB 1AGEA 4CADA 3HC3H 3TBYB 4RISH 3K4ZA 2E7BA 2AS5M 4OLEA 5I1AA 5D72H 4PLKC 4QWWD 3SE8L 5CZKA 1G1YA 1WAAA 4K94C 1BBDL 2EEBA 2MCG1 1HEZA 5BJTA 1JTOA 4F15B 5DMIH 2OI9B 1CWVA 5ACMA 3NABL 4YAQA 1GCFA 3MA7B 4WHCA 1K6QL 1PQZB 5AUMB 4QCIB 1WZ1L 4F58H 1Q0XL 4JRWA 4K7PH 5BOZG 3O3EB 4UU9A 3IAQA 1PQZA 3D0VB 2CLRB 3L5HA 4GKNB 4XAWH 3HB3C 1MVUA 4LPTA 5FYKU 1T1WA 4OBRA 4D9QD 2DBLL 2NNAB 1YC7A 1S7TA 3BKYH 4OCXL 1MVUB 4ZQKA 5CGYD 5EZJB 5KSAB 4N9GB 3C08L 1TQCC 4U7MA 1SQ2N 1QYGH 5GSVB 1AQDA 3QCVL 1MAKA 3ROLB 5BQ7B 1ZLVH 5IJKC 4MNQB 4NUGH 3OAUH 4Y19A 2AK4B 4ZS7H 3UTQB 3QDME 3ZE1E 1YYML 3BQUA 3O6FD 1A7RH 1DANU 5FM8A 3VD5A 1T4KB 5ENWA 4MNQA 3N9GH 3OSKA 1FG2B 1T21A 4QRPE 5DEFA 2YKLH 4BZ1L 4H1LG 3DBXA 3HG1D 4OGAC 3ETBF 2QSCL 2PYEB 2MCPH 4FQQB 2B1HH 4RNRB 1G7QB 1R5WB 2HTLD 1FYTB 3IJYB 4IOIA 1MY7A 3RDTA 1E4JA 1ND0B 4ELKB 3O8XD 3B9AA 2PN5A 1KPUB 4I77H 3ARRA 1WBXB 4GRLA 3S35X 3QNXA 1TITA 1ZOXA 4CGTA 4OLUH 4PJBF 1RVFL 4HKZB 1VHPA 2NY3B 1H3GA 5EO0B 1CT8A 4H25A 4L8SB 5F7KC 4Q58C 3QDGA 4UILL 4ZUTA 3PXHA 3LRSA 5HVWA 1Z5LA 3QG7H 5EUOA 4H25B 2IJ0C 3SO3B 1LDPL 1QHOA 1Q0YL 1D6VH 1NC2B 4G8FA 4YHNA 3G9VA 2ZJSL 1NGQL 3B2UC 4X6CA 5CJOL 1YN6A 1JYVA 4XXDA 3QXWA 2WWMD 3WIHH 3VRIA 3LZFL 3MGTA 4HUWB 4WV1B 1ZLSL 1G6RH 4IS6B 4PTTB 5IBLC 4NGHH 4FQ1L 4N90D 1AKJD 2ED8A 1HXYB 1CN4A 4P2CG 5HYQA 4UT7L 1H8NA 3VFMA 5L0QB 1RJYA 1A4KA 1C7TA 5IW3A 3CD4A 4X5WA 2VJXA 4C83B 3RIAK 3QQNA 5F44A 2VUYA 5IB1A 2BOBA 1S7SB 3VE0B 3DO7A 3CU1A 1IGIH 4FXLA 5IJKA 1RJZA 2CD0A 4OFVA 1CZ8L 3PQYB 1J7VR 2DN7A 2OMBA 3ZKQD 1N5YL 3UJTH 1GGBL 5FYKL 5IK3B 3LKPB 3KG5A 3BDXA 3ZSTA 3LQAH 3T65B 3GRWL 2VR4A 3VFOB 4AG4L 1MF2L 4PY7B 4YIQB 4G7YL 3WXWL 1T0NA 1GZPA 4DW2H 1IQWH 3E6FB 2JF1A 5CINL 3AS3A 1YEHL 1IZJA 2O5YL 1CFBA 2E3VA 4WFEE 3ISWA 3U0PA 2LTQC 2X89D 5BS0E 5HHME 3EO1A 4J4PA 3QZWA 2YD4A 4OD3H 3U0PB 1FFQA 1FE8L 2CDFA 2PUQT 3KLAB 1J12A 4Y2DC 1TVHB 2Z93B 5IMMA 4JGMA 4WI5A 5ID0B 3ZDXE 5SV4A 4M5YH 4PRPA 4O4YL 5J9PA 3DIFB 4IM8A 4LHUB 4PJIF 3VXNA 2H1PH 5DQDL 4E42A 1OSZA 4V1DD 1BBDH 4MJ5A 2L7UA 5DUML 4DVBB 2FWOB 1HIML 1QRNA 3RZCA 5E7BA 3WE6B 2DMCA 2GTWA 3VD9A 2VDKL 2VZ3A 1XGTB 5DA0B 3H7BB 2EKSA 2XV6B 5FHAH 4TUKL 3OZ9H 1DE4B 1FGNL 1X5KA 1QFPA 2EKSB 3TZVC 1I7TA 3BH9B 4Y5XA 1A7NH 4OFYA 4HULB 4RBPH 4PJDF 3VRLE 1OP3K 5KVGL 4GQ9L 1I3GH 4FQ2L 4WTZA 4PB0L 1RMFH 3IJSA 2ZUWA 3B6SB 3OQ3B 4QXWA 4Y19B 3LKRA 3WDJA 3TNNB 4EOWH 3I2CH 1LNUB 2R2BA 4UT9L 3QNZA 5E6IC 1FG2A 2W9EL 3GI9H 4WHTA 4ZFZB 3T04D 3UAJC 3Q0HA 2VXQH 4XC1H 5C8JA 1T5XB 4YPGB 5FB8B 2AXGB 3QNZB 2HG5B 1RZJL 1R3KB 1FORL 5C92A 1HHHB 5C8JB 3C8KB 3DURA 3ALPA 2HG5A 1OHQA 3BWAA 1OTSC 4H1LH 4NNPL 3BKCL 3MJGX 4LPWA 3G04A 4ODSH 4OT1L 4JHZA 3ARBC 1B2WH 3N1FC 3NCJL 4LLMB 1T7VA 3T08A 2X9YA 1F3JA 3KXFD 2EDNA 5C0GB 1KJMB 1N5AA 3NIFE 3CSYA 3KPRB 2YPLA 3CXHK 2Q8BL 4Y2DB 4HIEA 3VWJC 3HE7C 3ORJA 3BP6B 2B2XH 4MMXC 4Z0BH 3UBXA 4D3CL 1AKJB 3IS1X 3EDKA 1NCAH 3PJSB 2GSGA 3SQOH 4L8CA 4EN3B 2EDDA 3GHBL 4F7EB 4BH7A 3TNMB 1EMTL 1GSMA 1HKFA 4DQOL 3S88L 1GGIL 1YEIH 2FGWH 4LP4A 2CDEA 1JPFB 3IDXH 1LE9A 5HYSA 3A6BL 3GJFH 2EDQA 3JUYA 3MOQA 3DBXB 3GJFK 4GAYA 4X6CE 4WTWA 1I8KB 2ZG1A 1DLFL 3TT3L 1NANI 4PJ5A 4WW1A 1U8MA 1LK3H 5IKCB 5F97E 2EDEA 1OAXL 5DJ6A 4JQVA 1CF8H 1U9KA 2EO1A 4LFHG 2XT1B 3QNXB 4AEHL 4JQIH 3EHBC 4NJAH 3REVA 3GSNL 2BOCB 5B4MD 4IMKC 3O9WB 4NIKB 3ABZA 4AEFA 3O6KH 5HYSG 3QIBA 1FL3A 5DJXA 2GK2A 5I1DA 1MRFH 4Z7OE 3VWJD 1QLEL 4RX4D 5AWNL 4N5EC 4MJ6B 4R4BA 2AJSL 5KVFH 3GMQB 1H15B 1IGFH 3T2NL 1GIGH 4L3EE 3HI6L 2XZQL 5HI4D 1CFVL 2WMPA 2DQEL 4HT1L 2J88H 3MACL 2DYPD 2Y6SD 5E8EB 2BNQA 1MJ8H 4FOMA 3G5YA 3WO3B 2VL4A 4UQ3B 4NN6B 1ZT1B 2ARJA 3QUXA 4R9HA 5T1KB 1IEHA 2AJ3A 1MJ7H 2ZUUA 5HYQB 1VB9A 4S1DC 1YYMH 5KBNC 3PV6B 3OKLA 2ITCA 3MXWH 3KXFE 2XQBH 1JWUB 1KF9B 2OBGA 4KRNA 5SWQB 3UAJD 4ZXBA 1EFQA 4XWGL 2HA1A 5KW9L 5GRJL 2Y07L 3TYFB 4GKZA 1CD8A 1YJDH 1N2RA 1JMZA 1AFVL 2I26N 1F2XK 4RMTA 5C07E 5I0ZA 4JAMB 1I9JL 1U58A 3VFGH 3V0AC 1U3HB 2BP3A 1M7IA 1QEWA 1BWWA 3GGWA 3DHJA 5H35B 4ZD3H 5FAAA 3T0WA 2IBGA 1TZHB 2V5SA 2R8SL 3O3BA 1LO3H 4JDZB 5DUMH 1ZANH 2G5BB 2PTUA 4PRIE 4XPHL 1EEZA 1F13A 5JA9A 1MFBH 5CIPH 3S5LG 1JZ6A 3NCFB 4Z6AT 4K3DL 4P5TB 5H37H 4OCYL 3VXTB 5I1CL 5IV2B 3EDEA 2ZCHH 2P5EB 3BGFC 1X4ZA 4ZAKC 2AK1H 5IB4A 2R69L 4Q9QH 3HG1E 4MXVF 5D7KD 3FO1A 3NA9L 5KVDL 3HZYA 2H26B 4YE4H 3BQUC 3I6KB 5JOPE 4Y5YB 3P30L 1PG7X 4DVBA 4LOUC 2P4AB 3BUTA 1UWGL 3RVUC 2GHWB 3LPGA 3UPAA 4NQVA 4OAWB 3P0YH 1IL1B 2YD6A 3CFBB 1G84A 4RDQG 1CDHA 5KTEL 1KLFA 3MRKA 5GJSH 4YHPA 3LN4B 1NGXA 1GGBH 3GB7B 5FYKH 1FZJB 3W9EB 4DGYH 4PGDB 4GQPH 1CIDA 2W9EH 4QRRD 3ZTJH 5JW3L 4D9QE 2G60L 4DGIH 1H0DA 1NGXB 3DO3A 1JBJA 5T1DH 1GYAA 4J3VA 4HKJB 3V6OE 2JIXA 4XH2A 3GJFB 3OKNB 1C5CL 2YEZB 1D5XA 1U6AL 2BJMH 2EEDA 5KSVA 1UZ8B 4JO1H 3CK0H 1J1PL 1T7XA 5KANG 2DTSA 1BZQK 3BGMB 5CGYC 1SBSH 4QRPA 4PJ9C 4UAOB 1NC4B 2BNRD 3I6LD 3CH1B 1PY4A 4WW2C 3S37H 1NDGB 4WY7L 4HKBB 4L4VB 2JKXA 2BERA 3BIKA 1VFBB 5MEOA 4P5KA 3ARFD 5DHYB 4V1DE 1T20B 4FFVD 5KS9A 2Z8WC 4Z7VF 1NL0H 4ZDHA 3ARSA 3C8KA 4P5KB 4ZTPL 1SEBA 4OZHA 2IH1B 5I8OL 2XRAL 3ZE2F 5HVFB 1FG9C 1HHGB 3GHBH 4R7DA 4F2MA 5E2TH 4ZUVA 4JFPB 3BVNB 4HF5L 2NY4B 2DB8A 2DQHH 5F7DB 4DFIA 2VDMH 3CSYB 5DJDA 4JDVA 2FRGP 1RHFA 5IOPA 4MA3B 3BZFB 3AREA 2EIEA 5H94B 2OJEA 1BD2E 3L6FA 5GIRB 2P8MA 5K9OA 3FO2B 5TFSH 1MUJA 3ULVC 3BZFA 3QO1A 2UYLA 1QLFB 2OJEB 4Y4FB 3S34H 2HJKB 4KUCD 4D0DB 2J88L 3KPOA 2R2EA 3LKOB 5E4EB 2Y5TA 3L5XL 3EYSH 2Z4QB 3STLA 5IGXH 1R3IH 1DVFD 3H3KA 5C71A 4KUCF 2CDEB 1C5BH 4YDVB 2R2HA 3PWPA 1FRGL 4ZOAA 5HYSB 3CX5J 3I2CL 4LSDA 1N6QL 2HLAB 4OZGA 1WLHA 2MQ3A 3AVEA 1UCBL 4P4KD 5EC2B 1UENA 2P42B 5CP7B 4PJ5B 4ZXBB 3UBXI 2JB6B 4R2GB 5INCA 2IGFH 1FBIH 2HT4D 5C0AD 1T89C 3HTLX 4BK5A 4HIXH 1OAQL 4N90E 1H8OA 3GSVB 3NFPA 2E9BA 4PFEA 1HILB 1C5DB 1F45A 2BHYA 4UIMA 5DD6A 3SQOL 1A6VL 2XN9A 1I9JH 1QBBA 1ZHNB 1UT9A 5TPWH 4Q2ZA 3QIBB 1C5DA 1TTGA 3WHE1 1ED3A 4G80B 3A6BH 3TO4C 2FHCA 3QG6A 1D5MB 3ARPA 4X4XA 3QA3B 5EPMB 2YWYA 1DLFH 2WANA 2C1PB 4Q6IB 2AEQL 2A6DB 2NXYD 1PX4A 2DIBA 2XPGA 2R9HD 2YRPA 3K7UA 2Y23A 4I0PA 1U8PB 2HFFA 3DRTB 4IDJL 4UQ3A 3OB8A 1A7QH 5KSAC 2A6DA 1KEGL 5DF0A 5FYLE 4OZIB 4OCYH 1GZQB 4XPFL 4BSWA 5T3XL 4HAGA 4FABH 1QVOB 2WUCL 1IGJB 2LABA 1EEUA 1B0GA 4OGXH 1KCRL 5KJRH 4PRNA 4KZEL 4LF3A 2UWEB 5KSBE 5MI0C 2QHRH 4X4ZA 5FUZH 3MNZA 2ED9A 5E2UH 1QBAA 3G6JE 5B4MC 1DN0B 3DETC 3SJVB 1G7HA 4JANA 2DQEH 1ZLWH 4B0MM 4F7PA 2Q76B 2Y7QA 4YZFF 5EZIH 1JGLH 1I7RA 2XZCL 2CRMA 4G8GB 1N0XH 4PUBH 2X10A 5D96C 4YK4C 4L1DA 5SX4I 4L8DB 4W4OA 4O58H 4TNWF 3ECBA 4JKKA 5HY9A 3QO0B 3I3DA 4OB5L 3RWIA 1WIPA 3SDAD 4AQOA 5HDBF 1A6UH 2DLIA 5J6GA 4XMPL 5F9WB 3MV01 1S9YB 4M9OA 1LEGA 4DOHB 2X4NB 2Z91A 3WIFA 3V95A 4JHBA 4J1UB 3CNKA 1C7SA 3Q6GH 4QHUA 5C0AA 1WWCA 5JQ6L 2YZ1A 3QP3A 2B7DT 4M1DL 1G6RA 1WCBB 4HUKB 2DI7A 4X6DB 3TO4A 4EI6B 2X4TB 4CN4A 4KDWA 4BQ8A 3NIFF 3HZYB 3C60A 2FGZA 5I2IA 1T20A 1UM5L 4FZ8L 4E0RB 1HSBB 5IIEB 1BIIA 1WK0A 5GGRA 2C26A 5T1LB 3WFEL 3LEYL 3L5WB 2P24A 5CBEB 1LDPH 3BKML 1JNHB 5IB3A 5JOPD 1BF2A 1KJVA 4KTEL 4L9LC 4U1NA 1IC5H 5CJOH 4HUUB 1I8MA 3H9SB 2ICEA 5FGCE 3QUZA 1RZGA 5D7LA 5F7DA 4ZSOE 5I30H 4RISL 1I8MB 2KUTA 3DGCR 1OGTA 1J05B 5T3XD 4LCYB 5TF1L 4ZTOH 2X4SB 3FO2A 2Q1EA 3ULSB 4H8WH 4BFIB 3MYJA 1SJHB 2CGRH 4DEPB 5MI0B 2VZVA 4JFFE 3TESA 4MCYA 1BMGA 1SJHA 2Q86B 4Y4KB 4MXWL 4YDVA 3KGRA 2LTQB 5FHBL 4JPWH 2N7BA 4JHAL 4MGXA 5T1MB 4LCCA 2XG5A 2ZOLA 2ICES 4X7TA 1W0WA 3E8UL 2DM3A 4L8SC 3BP4A 1CGWA 1OCWH 1Z3GH 4WDIA 3MUY1 4FXKA 5T1MA 1OW0C 5BRZE 1A7RL 3GMOA 3TCXA 4P59L 3TZVD 3SO3C 4XHQA 5EU6E 3QDGE 2ICCA 2Q3ZA 5LAXA 1BP3B 3T0AA 4XCCL 1GXEA 4GW4B 4S1SL 5HPMA 1YNKL 3QXDA 3KWWA 4KH2A 3MJ8A 1VEMA 4LSRL 4RGOH 4I2XB 4X6FB 5IROA 5SWZD 1YN7B 4MS8D 4NFBA 4ODVL 1CFTA 2V17H 1CGXA 1F5WA 2DI9A 3ZT5A 1AI1H 4QHNB 3RWEA 2HFTA 4PRDA 3K2MC 1AQKH 2YBRB 2GITA 2AV1B 2H6PB 2VDOH 4AK1A 4Y4FA 2XN9E 2BSED 5CCKH 5BOPA 1NEZG 2IFFL 2GITB 2NY6C 3VMNA 4LSPL 1KJ2B 5L2KA 1Q0YH 3D2UD 3JV4B 1V05A 1PKQE 4RAUB 1ETZA 5E99L 1U8HB 1NCCH 2WUCH 2VZUA 1TZGL 3N1GC 5SWSE 5CBAB 2FJGA 3D9AH 4JY5L 4R96A 1NBVL 2WINB 1XR9A 3Q5OA 5DEZA 4X4YB 3BZEB 3RY6A 2FYYB 4LF3B 1ACYH 5JNYA 1IAIH 3DGGA 1EJOL 4N5ED 3QI9D 4K23L 4KJPD 5MENE 3WLBB 1HI6A 3VG0H 1A4JA 2W91A 1I3GL 3FZUC 3RBSA 3C08H 1J5OL 2QQNL 1N5YH 5AZEH 3RZWA 1KYOK 5KVEH 4GRWE 2ARWA 2EXWC 2BVEA 4QRQA 4HIIB 1T0MB 1DCLA 1D5MA 3PDDA 5J6GB 1GGCL 1I1FA 2VLKD 3QHZH 4DZ8A 4E41D 3IKCB 2F58H 2WBKA 9CGTA 4Y5VB 3QXVA 1LEGB 3C8DA 4RMQA 4WU5B 1J1OL 5DS8B 4Y2OA 4MA7H 5TE6L 2CXGA 5EO9B 1FNSH 4HUNB 1R3IL 2SEBB 4UUJB 2X7LA 2VSDA 4PJIE 3VH8B 1BQLL 3GMPB 1H9VA 1NMCC 4DUVA 1KEMH 1QUNA 2MNUA 2IC2A 2Y1VA 5ICZA 2Q8BH 3LS5H 5GGRY 3OMZA 1HHJA 3X3FL 2F53E 4BUGA 4LSQH 2PXYC 2CKBH 3SCMA 5JOFA 1SJXA 5DJCB 3S37X 2AEQH 1RFDL 1TJIH 2W0LA 4XPGH 5LG1A 2DM7A 2BMKB 5J57B 1YUHA 3QUZB 1NCTA 4JQXC 2ESVD 5F3HB 3AS1A 4YH6A 5E6IB 3GSXB 4NCDA 4P3CH 4WTZG 4EI5C 1DSFH 3REWA 5I66A 2EE6A 4M5YL 4JCLA 3VFPB 3LKSB 5IQ7L 1WVZA 3MLZL 4NKOB 1QRND 1SEQL 1RIHL 2MOVA 1G7MA 2Z91B 3ZYZA 4JR9L 5BXFA 1WWWX 4LVHC 4NJ9H 4MJID 5JW5A 2UVFA 3QI9A 1OP9A 3KS0J 4PY8I 3WHXB 5E6ID 1LP9B 5TDOA 5F3BA 4HUXA 3QEGH 5CLTA 4I18B 1PX3A 1LP9A 4KI5F 4P2RD 2CUMA 4JQIL 2BCKB 3T1FA 1FGNH 4FQLH 3BP7A 4JRYD 3C60B 4NN5B 1VPOH 4FNLL 1JK8A 3G5XA 4NQUA 5IFJA 1D9KC 5IWLC 2W9DH 3LD8C 3MLYH 5HVHB 3L5WA 1S9WB 4ONHB 4B41A 5AG8A 4XVTH 3RU8L 5B3JE 2F5AL 4YR6B 4KHXH 4GG6A 3SE9L 4L4TB 3MA9L 4ONGL 1NQBA 4TVPL 5D71L 2I60H 2O5XH 1KJ2L 3BMVA 1XIWD 2HFEA 1MI5A 1Q9LB 3KPMA 4FQIH 4MDIB 3MXVH 4XP9L 2B4CC 2Z31C 1OGTB 1QG3A 4OD3L 5M95B 2OXHA 4KXZI 1G9NH 5BZWB 4MX7A 2Z8RA 3KYOA 1NMCB 5D7SL 4P57A 3SKNA 4M43L 3DYOA 1G7LB 5C0FB 3QFJA 3T4YB 1KTKE 3X12A 4ORZC 12E8H 3C5JA 1EAPB 2P7TB 2R1YA 4HZLB 5HHNA 1A5FL 1AD0A 1AO7A 1B9ZA 1JTTA 3Q6FB 4Z76B 2JJWA 3VXUB 2ZP0T 1ZT7A 4MQ7A 5E08L 4XCFL 1U0QA 4ODTL 4U6VH 1LEKA 4JHWH 1CICD 1U3JA 4XB7A 4HIJB 2WQRA 2K9UA 4R6UA 4I0CC 3HAEA 1Z2KA 1E4WL 2BXYA 3HMXA 3SKOB 4NQTA 4TSBH 2WQ8A 3ULUE 2WNGA 3RP1A 4MA8L 3T3MF 2EE3A 2R1WB 1JGEB 1W72A 2GY5A 5HYIA 3D2UA 4NRXB 2K3TA 4QXGH 4Z7UF 3FB5B 3QDGD 3U7WH 4YX2H 4CMHB 4EZMA 4JFEE 5DHVB 4PRHD 3D2UB 2FIKA 3ZL4H 1X5GA 4KAQH 3PWNA 2QADD 1MCKA 1L9MA 1EUTA 2PNDA 3FT2B 3RWEB 2ZCLL 2FX7L 3G6DL 5TGBA 5I18H 1AP2A 3NH7H 4DKFH 4JRYE 1ZLUH 1A6ZB 3EO9H 2DWDB 4R97B 1JNJA 1YEJL 1YPZF 5AWNH 2XYCA 3FN0H 5L2KB 2DMKA 1EHNA 2DQJL 3KLHC 1UADC 5DO2C 4NC1E 3BPNC 5AUMA 3GMPA 3UTTA 4XNZB 4HMCA 5CIPB 2HJFB 3GMNB 4PJXB 5JW3H 1HEZB 2WBWB 4V2CB 3ULUH 4U1GB 5DLMH 1CFSB 4AT6B 4Y16D 2XWTB 3O2VL 3MRGA 2VDOL 5HGBB 4PJXA 1PW3A 4AM0A 4NQDA 4ELMA 3RPIA 3C8HA 4GW5B 4OZFH 4XNUH 4O2FA 4YEEA 1RULL 3C09C 3HZVA 4N9GA 1DEEB 2FHFA 4ZOBA 1YECH 1EHLH 3S88H 4QRQB 3DX7A 2W0PA 1I9IL 1FNEA 1RURH 3BEVB 1QACA 4E41B 2RJMA 4F33A 2BC4B 3IDUA 2ADJA 5EBWB 5DURD 5A1AA 1ZANL 5GJTH 4F9LA 4EXPX 2I07A 4K23H 1D5BA 3T4AA 2XACC 4O51A 5FYJL 3BKYL 4KGJA 2EXWD 3UYOD 3MSPA 4QRSB 4I5BA 2VZOA 4W6XB 1DBBH 1D3CA 3MRCA 1HYSD 2AGJH 3VDBA 3D25A 3AY4A 3SGJC 1JRHI 3HMXH 5JO5A 2BFVL 3WLWC 3SE3C 3GNMH 1VGEH 3QRGL 4OLYH 1Z6JT 4RNRA 2NY1D 2X9WA 3LHPL 3U30C 5DQ9A 4L5FL 3V5HB 2FJHB 3CVIL 4KKLD 1RZFH 1XFPA 1QNZL 4LSVH 3B5HA 1E4KC 3HI6H 2WK2A 1X5AA 3RNQA 3INUL 1JNLH 4R2GC 4QTIL 5C08D 1XR8A 2R9HC 3P0YL 1J11A 1CTNA 1MQKH 3SPVA 3KYNB 5IGXL 4P46A 1CBVL 1BPVA 5E6IA 3QUYA 1MNUH 3B2VL 3HE6C 3BPNB 2N4IA 3GUTA 3KYOB 4GG6E 4MNGB 1WBYA 3MLYL 3N9GL 3PWJA 3VRJB 3T4YA 3T0VA 1EAPA 1CVRA 3WUWA 4PGCB 1H5BB 2ZPKL 4P4RA 4TVPE 1HQ4B 4CJ1A 1HXYA 1HYSC 3WS6A 2QQKH 1FNSL 3R0MA 4N8CL 3VFTB 5D7JC 4JM2D 3LEVL 2IEPA 4JFDA 4M7ZB 4JO3H 4OCSH 2GCYA 3GSNB 4ZD3L 1XIWA 2BVYA 3DSNA 3HS0A 4NZRL 3VE0A 4UNUA 1HCFX 4ORGB 3RVWC 4YHZL 2NW3B 4WWKD 5I71C 5J0BA 5C0NC 2DYPA 4PJGB 3GSOA 1EZVY 4N0RA 5CEYB 1NBYB 1MFCL 3RAJL 4ORGA 5ETUB 4OCXH 5DZLA 1BECA 5JHDD 1IQDB 3VJ6A 3FMGH 3LZFH 3DROA 3BSZH 1YMME 4EUPB 1RIUH 4FABL 1AGDB 4MXQD 3LDBC 5D7KE 3NACL 1CYGA 4ZFGH 3IDIA 5EU7E 5FGBC 4HWNA 1B4RA 3WMSA 2AXFB 3V4UL 2YN3A 2LU7A 4MCZB 1I1YA 1YEJH 5D93B 3DIFA 2X1QA 1JGUH 4LHUA 2A6JB 3S34L 4D9LH 1I8LA 1T1ZA 2VDRH 4LLQA 4JFZH 2OK0L 4ZNCD 2A0LC 5F88A 4ZUUB 3VXNB 2HKHL 4I77L 4ACPA 3T77A 4JZOA 4MJ5B 4DKFL 3GRWH 3ARBA 4QEGA 3C5SB 4BA8A 1PKOA 2FO4B 4ZUUA 1I75A 4KK9C 3BEWB 5EU4A 1FIGH 2EH7H 2OYPA 3QEHA 4OLWH 1CICC 3OAYK 3SDCD 4GLRI 3SE9H 3MRIA 1DE4A 3SDXB 4Z7WF 1ITCA 3WXVH 1S7QA 3JTSA 5MP6L 4Y1AB 4TUKH 1NUFA 1AQDB 3RHWF 3FOMA 5HJ3B 1KN4L 1MCRA 4CMMA 1B90A 3FQXA 4KK6D 2XZAL 3VDAA 1DVFC 5EUKA 3T4AB 3DUSB 2NX5B 4OQTA 6CGTA 1BM3L 1L0YA 4H0HB 1RK0A 2C1OB 4TTGA 3DURB 5GSRA 3WNLA 1BFTA 4UV7H 1OP3H 3TVMA 4Z7WB 2NW2B 2C1OA 4M6OL 1I7ZA 2QSVA 4LLMA 2AERT 4C56D 4K7PY 1I1AA 1XMWA 3P4OA 1JF1B 4FFWC 4MLIA 3LKQA 4L5FH 5DJ2B 4LKCA 4WFFD 4UB0L 4NKIL 1Q94B 1KN2H 1FNHA 4PJHF 3KHQA 2VOTA 5TFSL 5EOTB 4GKNA 4FP8H 1DBJH 5GZOC 4LKCB 1YNTA 1DBKL 3BISA 4HWBH 5I75B 4N68A 2DLEA 3IDJB 4I1NB 4I4WB 2BNUB 3CDFA 1S7UB 1FZMB 3QNYB 4OT1H 4HIEB 1NAMB 3DVGB 4LASH 1X4YA 2BC4A 1T3FB 4NQCB 1JL8A 4MNGA 3GI8H 3MC0A 3PP3K 1ZK9A 5I1EH 4IS6A 3UTTD 4OBSA 3U0WH 4PLJD 5LGHH 5FA4B 3GIVA 3HI1A 3OWEA 1PAMA 5E5MB 3WS3A 1U8QB 2GTZB 1P4BL 3KLSA 4KMLB 3WEXB 2W0FB 2DQIL 1U8MB 2XKUA 4QHKJ 4FFYL 4HH9A 1U42A 5CINH 5ISZB 4KMTH 4PJ9D 4U1LB 4WI8A 2PO6B 3LEVH 5EA0L 3IFOB 1TLKA 2J8UE 4C59B 4CN1A 2F54E 4OLZH 5FDWB 3MLTA 1RJZB 1HNGA 1ORQB 4EIZC 5C2UB 5DQ9B 4GXVH 5ESAB 3IU3B 3BP5A 5GJTL 4NRZB 4F8QA 3VFOA 4G6KL 4FA8A 4PRHB 3LB6D 4LDOB 2PXYA 3PHOA 5JW4M 2A6IB 3DPBA 1BOYA 1YEKL 3QFJE 4HQQL 5TH2A 4WFHD 4YHNB 4IMLA 2JLLA 4KTEH 1H3PL 1P4LB 2DS4A 3WN5A 3RVTC 2C3VA 3WCYA 5INDB 5I0DA 2FX8L 5TQ0L 5J6HB 4RRPA 3PWUB 4H1LA 2OQJB 4JM2A 5CJXC 3OXRA 5FA3B 3R8QA 4UQ2B 5DMGC 5DK0A 2AJVH 5IQ9B 1S9XA 1QFWH 4H20L 4MXVE 1GIGL 3OAZK 4ZMAT 3RKDD 4FQXA 3EFFA 4Y1AD 5JOEA 1GHFH 2F15A 2NY2C 3VFTA 3OKLB 1KG0B 4LEOA 1AGFA 1JWUA 1R3JA 4PJIA 1UYWL 5KVEL 1YC8A 4RGMB 1S7RB 3A67L 2J12B 5DTFA 2CIKA 2R23B 1MOEA 5EC1A 3QIWD 1AGFB 2H45A 2V7HB 1QEWB 4ERSH 2UZIH 3HC0A 3VXRA 1D5ZB 3CFKA 4XMPH 3EJYD 3I50L 4KDTC 4Z5RB 3MV8D 4XRCA 3QEHB 3RGVD 1K8DA 1RQ5A 3JWDH 3NZ8B 5HGAA 1J1OH 1CGYA 5ETUA 5F1SA 5FKAA 3PHSA 4XZUB 2EH8L 1HKLL 3L3IA 2CUIA 4XTRC 1OY3B 1Z9OA 5FHBH 3RVWD 3VI4F 4JHAH 4RWYH 5E1AA 3IDMB 4JFHE 2WWKO 5MERA 5KSUB 1YEDB 2B0SH 4LEXH 2ATKB 2G5BA 3UDWA 4G6JL 3VGAB 1V3LA 4LLDB 2F54D 3WFCH 4PV9A 5D7JD 1AGEB 3I6LE 3ARBD 1HOCA 3CFJB 3MLWH 3S6CA 1J8HD 4YAQB 1OSZB 1RUKL 3H42H 1QTYT 3DUHA 1OARH 3WN5C 3JXAA 1CF8L 2JCCA 4N0UA 4O9HL 3BRFA 5JHDB 3MV9B 5MEPB 3ARBB 3H9ZA 3RVUD 2GUOA 1NCCL 4NC2B 1RU9H 1QSEE 4XX1G 5IHUH 2YA2A 1WBZB 3G08B 1DUYA 3BE1H 5J13C 5CKGA 4YC2C 4P5TD 4MD5B 5EIIA 1M7DB 4NO3B 1SJVA 1L7IL 2OR7A 1PSKL 4PJAB 5F1OB 1Y6KR 3GSNH 4XNQA 1MI5E 2FD6H 1NAMA 2NNAA 3T0EA 3UPRA 1B3JA 4GW1A 4BZYA 4AEHH 3UTQA 4L8CB 2C7UA 3MV11 1OSPL 2W07A 3MV8B 3QPQC 3QPQD 1R3HA 5CZVH 4M7LH 4JKPH 1WZKA 2CRIA 2G75B 5J1AA 1ZTXH 3HI1B 3RVXC 4YHML 5D70L 4K3GA 2AK4A 1FZKA 3CH1A 2HT3D 4H0GA 3IDYC 1PLGL 4PJHB 4HWBL 1JF5A 1I3VA 2HRPH 1UZ6E 4WHYH 5CWSB 3BRGC 3DNKA 5CZXC 3I3EA 1UACL 3TT1H 3SDAA 3WSQH 5DMGD 3FONA 5EU6A 4OD1H 2J8UA 4QHLA 2EZ0D 3E3QE 4LSSL 1BQLH 4OZHB 5F9AC 1Q94A 4G6ML 5C0DB 3GZKA 3JTTB 3HC4H 3X14A 4EQ3A 3D5OF 4OLVH 4JFPA 3IDGA 5IW1A 3FFCB 2F19H 3JTTA 3X14B 1UJ3A 5ECJE 2IPTH 3KPOB 1TJIL 3LRSB 5FIEA 5DGQA 4PTTA 5EA0H 3LSOB 1SVZA 5EUOB 3WN5B 3C60C 2UZXB 3MJ9L 5I1LA 4L3EB 2P46B 2IG2L 1MWAA 4KZDL 5CEZL 5CFHA 2YA0A 4Y4HB 3CC5A 4G8EB 5EU5B 3TO4D 4XPTH 3D69A 1P7KA 5SWSD 4HG4J 1KPRA 1Q72H 3C5ZD 4PJ9B 3F58L 2X40A 3QJFA 4NDMB 1J5OH 1CLOL 3IFOA 5B3JF 2MSPA 2FEEL 1S7RA 5T3XE 1FFPB 4X6EA 2QL1A 1SBBA 1OAYL 1T22B 5DR5L 3VU2A 3U7YH 2F5BL 3HC0B 1U3HC 4P9ML 4LGPB 2IQAB 4LHUD 3D0LA 4Z5RA 2ERJC 5LGHL 3T2PA 2BNQE 4NJ9L 4KUZL 4NQCD 3FT3B 1UXWB 1MCLA 4N8VB 2IH3B 1FYHB 2VZSA 2PXYB 2YOCA 5I8CA 1HKLH 3FB8B 5KTEH 3ESVF 1QYGL 4RMRA 4XP9H 4F9PC 1MHHB 3SGKC 3QFDB 4S1QL 1IVLA 4ZFFB 3JWDC 4P5TC 5EU6D 4GUPA 4PJEE 4FFWD 4WUUB 1KEML 5E4IA 4KK5D 4S2SA 3EO1B 4MNHA 2M8XA 3VI3F 1G9EA 2UWEA 1HOCB 4LSQL 2KH2B 3GMLA 5DZOA 3EFFB 4BSWB 5DD3L 1NUGA 4K71C 3HN3A 3MGAA 1MCOL 4UOW1 3SJVA 3E1F1 5EOQL 3MFFA 1MFDL 2Q76A 2Y7QB 4NQVB 4HWZA 5C0CA 1ZLVK 5C09E 5E95B 5E2TL 1RK1B 5D1ZB 2NX5D 4OLZL 3WNMA 1FGVH 1ITBB 2C3GA 2VDLH 1NL0L 2Z31D 3ZT6A 4YHKH 1XIWC 1XCTA 5T33L 3ULVF 1TZHA 3WJJA 4R0LA 5C70A 2YD2A 5E1AB 2ZG3A 5TDPA 3UTZA 3SN6N 3O4LE 1IAOA 1LO2L 1IC1A 3UO1H 3MJ9A 1EBAA 4ZXBD 3QIWA 4QTHB 1VDGA 1JZ8A 3B8YA 3KJ4B 5MEOB 5I8EA 3ZTJG 5DT1L 3V52L 4ZODA 4ZFZA 5F8RC 1YMMD 4QTIH 1NFDF 1CXEA 3VXMA 3P0VL 4MWFB 2GYSA 5HGHB 1CBVH 1LO5A 1HHGA 1RZGB 2RFXB 2J6EL 1RV6X 4ODHH 1FRGH 2YPLB 5ALCL 1K8IA 3D0VA 5D7SH 4LBEB 4GSDH 1JPSL 1I8IA 4FFZL 2DDQH 4IRSC 4Z8FH 3LH2H 1H0DB 2FNBA 3FFCA 1NCDL 5D7LB 2CR3A 4J6RH 5CJBA 3MPCA 5IBLD 3R4DA 4RX4A 2O5YH 1MCDA 4LAQH 1D6VL 1NLBH 2UYLB 1X5JA 3SJVD 2A6KB 2HJKA 4G42A 4QRPB 2WLZA 4WI7A 1FL6B 2HH0H 2X70B 3ULSA 3QDJE 1QOKA 4I3RL 2G75A 4G42B 3W39B 1LO0H 3O6FC 4M1CC 1HYRC 1HWHB 1FL6A 1RIVL 4XVJL 4CAGA 5BVJB 1FYTE 4F3FB 4L8BA 3MUZ1 1FZKB 3RTQD 4U0QB 2ZNWA 3W39A 3FQRB 4TRPH 4YFEA 3MUJA 5FV2A 5FGSA 2ADGB 4HKXA 4D0BA 4U1MA 3U7WL 1YDPA 3O8XC 2WAHA 4I9WE 2FJFA 3BESR 1IAMA 5EZIL 3QSKB 5EU7C 1J8HE 1ZLSH 3P40A 3OXSB 3I3BA 3BVNA 3PXJA 4W6WB 4QT5A 1JWMB 3F7VA 4KZEH 2OTWA 3CSGA 4ETQB 5F9JA 2Y9RT 3H3PH 2XFXB 2HRLA 3H9YA 1QNZH 2P48B 3FT3A 4HBCL 1QSFD 2R0LH 2CDGB 1JFQL 1G9MC 4LVOB 2VAAB 4U1GC 5E8OA 2OTWB 3KPQB 4J12A 4XPBH 3WJLC 4JPVL 4BQ6A 4MS8C 1AJ7H 1JGLL 1FL3B 3QULA 4QRTB 4WI4A 1IM3A 3VXSA 2HYMA 2H8PA 1CD1B 1Y0LA 2H2PD 1E6JL 1EGJH 1IGML 1YN6B 4JRYA 5E7FA 2A0LD 2JE8A 4XCNB 2J1KA 2ZOKB 3P9MB 4H88H 3C9NA 3OHXA 5F9OL 2BK8A 4X0KB 2ZOKA 3CVIH 4DKAA 4XC1L 1OPGH 2WINA 4X4YA 2X41A 5DLML 4X6BA 4FQJH 1B0GB 1JNLL 4LPUA 4RAUA 3NAAH 2MKLC 3TBSB 1A7OH 2ITCB 1X5LA 3UJIH 3ALXA 4NC0B 2DLFL 1KACB 4RFOH 1SY6A 4XMLH 5F1IB 3RUGB 4XNXH 2MFNA 1EHLL 3RDTC 3VXUD 1QBLH 5C09A 5KSBB 2P45B 4KRLB 2V17L 1H3WM 3AS2A 3RQ3A 4MVBC 3U46B 4JE4B 5J3HC 3QEUB 3SJVE 2MJWA 1LD9A 5J12C 1E28B 3O3BB 4JDZA 2VXVL 1BF8A 3QO0A 3RWIB 4FFVC 3QI9C 1U3HA 1GZPB 3MUGA 4G8GE 2BRRH 5FYJH 3VH8G 5BS0B 5H35A 3VG0L 5DS8A 4WO4D 1W2KT 3WNNA 1U2HA 1JE6A 4PTUA 1FQ9C 4LCCC 3QQ3B 1KFAH 1YEIL 1XAUA 3FTGA 3V8OA 5L8KB 4GUPB 4WUUA 3WO4B 4DKEL 3VMPA 2NLJA 4WI6A 5DZNA 3SGKA 5ESQB 4UDTA 5DJZB 2OTPA 2AJSH 3LD8B 4YWGL 5KVFL 5CILL 2J3SA 3OJVC 1MRDH 2NY0D 4FG6C 4M8VA 4P2OA 5JXAH 5DO2D 4JFZL 2OK0H 3IXAA 4PJ7A 4P23C 2Q6WA 2C4FT 5I1KL 3S96B 3NTCL 43CAB 1A1NB 4ESKA 1U8OA 4ODSL 5LXGL 1DUZA 4D8PB 3BO8B 2QJDA 1KXVC 3T2OA 5MHSE 1NCBH 3M8OL 3ZZ1A 5AD0A 2JIXB 4KI5E 3FO9A 1YUHB 3RY6C 3KAAA 4BZ2H 3X3FH 4P3WA 4PLOB 2ARJQ 2IADB 5JORB 1KJ3H 2FATH 3O9WD 3UROR 1MH5B 4YQXH 5TE6H 5JPMB 3GM0A 4KY1L 1LHZA 2E9WA 2ESVB 5MP6H 2B39A 4NZTL 3MRMA 2XTJC 2HVJA 2I27N 5CP3A 5CD5D 1Q9OB 4X83A 5BXFB 1EX0A 5HPOA 4XNYH 1DBML 1RIVH 1WIUA 3BUYB 4JN1L 4X4MA 1Q9OA 2ZOLB 4OLWL 1NDGA 1KTLB 3VFSA 2YK1H 4H8WC 15C8H 4PGEA 4G9FE 3EOBB 4MB3A 1BZ9A 4HS8H 4YHLH 3GM8A 1J88A 1X6NA 4OUOA 5IROC 4HCRH 1HDMA 3O41A 1YEKH 5BZDA 5KS9E 5DDHA 5C7XL 1N26A 3H9SD 4U1NB 4KDVA 4WGVB 3AAZB 4ZFOL 2IAMA 3S8WA 2ICEB 3AROA 3H0TB 4XC3H 2YR3A 4JFDE 1OGAE 3L6FB 1TZGH 1EZVX 3NA9H 1F6FB 2X44D 1YN7A 2FEDD 3P9LB 5D2NE 3RA7H 5KVDH 3FQNA 1NLDL 1FDLL 3JZ7A 3VXOA 4HCRA 2B20A 4LSTL 32C2B 3K8MA 4PR5A 3T2NH 3VXSB 3UYRL 1I9RL 2X70A 4K8RC 1D5IL 2DICA 2V2XA 5AEAA 1TQCB 1IEBB 5H2BA 3VGDA 4F9PA 5KZCD 3GSRA 3QHZL 5FYJU 3TCLB 4U31A 3CPLA 4NP4L 1AXIB 3O45A 2LU4A 3SGEH 5H2BB 3DJ9A 1M7XA 5ACZA 4LGSB 4WWKA 1WFOA 4AQ1B 3CLEL 4RFEA 2W0KA 4ZUWA 4XP6L 5E2WL 1N8ZA 1R24B 4R90L 2GY7B 1R3LB 3RU8H 2F74B 3DGGB 1LQSR 1K4DA 3RWDB 3LN9A 3IDYB 4EKXA 5E2JA 3N50A 2HWZH 5BVPH 4F37K 1FVEB 2EC9T 4NN5C 2E9IA 4F7MA 3UYPA 3W0WB 1T6VN 3K74B 4ODTH 4OZIF 3P4NB 5GRUL 4LEXL 4GXVL 1W72B 5IHZA 2OL3H 3ZYOA 2P5WD 4FZEH 3MXWL 5CKAA 2XQBL 2VLME 3TO2A 1T1YA 2C1PA 4Q6IA 3BRDA 1ODAA 1MFAH 3WV0A 1IEAA 2YBRA 3D1MC 3NN8B 4LRNL 2AV1A 2H6PA 2VXUH 4KVNH 2NY2B 1CXHA 5FUOL 4QXGL 1U91B 1YJDL 4GG8A 4MDJB 5SV3A 3TN0D 4XMLL 4BFEA 4LU5H 3S4SA 1MAML 5DMIL 5CS7A 4LKXA 4J2XA 3LY6A 4DZBA 4ZNEE 4M7LT 4NOBA 4DKEH 3L5JA 3RPKA 1INQA 2NY7H 3HNTL 3NCYP 4JN2B 1TETL 2FECI 4BQCA 3O3AA 2AK1L 1BQSA 4HXBH 1IM9D 3H9HB 1I3UA 5HD8D 5SWQA 3AXLA 3OB0K 1QPXA 4Y2DD 1J1XL 5D7IA 4EDXA 4YE4L 5J8OA 4EVNB 2APTA 3HZMB 1UEYA 5JIPA 2VLJD 4XVTL 1QFWL 4YDKL 5D5MA 1N2RB 2E7CA 2DQJH 2X5PA 4PRNB 5ABDE 4S1RL 3MRHA 3VXRE 2YA1A 1GC1H 1MHCB 1DN0A 5EBLB 3B9DA 1EA9C 3QPXL 4ZFOA 1U95A 2VIRB 3N85H 5MEND 4UBDC 5BMFH 5EBLA 4OIBA 1KNOA 3CLFL 2O61B 3BMWA 3KPRE 4PP1D 3GHEL 4XNMA 3KLDA 5BS0A 35C8H 2DQTL 5C07D 1W8OA 4BZ1H 5GS0D 5EN2A 1FBIL 1A6TA 5E00A 3FO0L 3PNWA 3X17A 4KY1H 4JO1L 2P5EE 4KHXL 2X05A 1A9BB 5E9DE 1RHHA 2J7LA 1V3MA 4MD4A 5ALBH 1ERNA 4Y88A 4NUGL 2KKQA 2HLFC 4HUXB 5DVNA 1RPQA 1VADA 4OFKA 3MBEC 5A16B 5E8NB 1A7BA 1FAIH 1GOGA 3I02A 3QUMH 2DMBA 5E6YA 3T1FB 1VADB 1CE1H 5LVEA 2H26A 4X8JA 3V5HA 4IJ3B 1DFBH 3EYQC 3MOAH 4UNVA 1SJEA 5JO5B 5K59F 5IVOA 4M93B 1F4WH 4MAYD 1YYLL 4OAWA 4Y7MA 4BUHA 3ARDA 4XBPB 2A74B 3HI5H 5CMAB 4DCQA 1CGSH 3H42L 4R4NC 4ALAH 4P46B 2P24B 5HHOA 5JR1H 1CDBA 1VKXA 2LQRA 1S9KC 3GRWA 3OPZH 4PRAB 2F54A 3DUUB 3Q2CA 5HHQA 4TNVK 3B9KB 2JK5B 3QHFL 4OCWH 3SE8H 3PGCB 3U9UB 4ZTPH 3L9RA 4OF6A 1U8LB 1XCQA 4IDJH 5FYJD 1FC2D 2ORBL 4R8WL 4JFQB 1Z0NA 5TDOB 3K2UL 4XPFH 3ULVL 1P6AB 1AHWB 4V1DB 5F21B 1R0AL 4WFFE 1NEZB 4I18A 1DL7H 3BUYA 2OR9L 1MSPA 4HGWA 4UOW0 5D1XB 4G7YH 2VERN 3MX0A 5LAXB 3QUXC 3KXFB 2EKJA 2FBOJ 2L7JA 3FN9A 5HYJD 4F2MB 1D5IH 1BQHA 2R1XB 3GBLA 4CMHC 2E6PA 1RULH 3ZDYE 1A6VH 2A1WH 5C07B 4KVCL 3D3VD 2FIKB 4NYLB 2BSRA 5IHZB 5L2JA 4UTBH 2B5IB 2BSTB 3U48A 2D7OA 1N6QH 4XCEA 4PLKD 4BSVB 2YWZA 5JMRA 5SX4H 2DQFB 4G43B 3HC4L 4U33A 4CU6A 4QHNA 1ZHLB 4QXTB 5DD3H 3ZE0F 5F7UA 3IFPB 1RUKH 3EZJB 3LQMA 5D9SB 4OTXH 3BDYL 3MV7E 1UVQA 3P77A 4OD1L 1N4XL 1BVKB 2Y5EA 5F88B 3FRUA 3QDMD 3MJ9H 4HUMB 1INQB 4XP5H 4ZNEA 2DIAA 1TETH 4ZFGL 2HLAA 1DN2A 5DYOB 5DVLA 1KC5H 3JV4A 4M6NH 2H1PL 5DQDH 4EDXB 1R24A 5JW4N 4WNQA 5JW4Q 2D7NA 1QBML 2VXTH 4GBXC 1T04B 4WNQB 1PD6A 1MFCH 3RAJH 5AZ2L 2I5YL 2VAJA 4I48A 3MRBB 1IGIL 1JIBA 5GS1C 3ZKSD 2ZUVA 4JB9L 1GAFH 3QWOB 3U7YL 3NIGF 5KN5A 4NQEA 3PWNB 2H32H 4UI2A 3VA2C 4KJYA 4KKCC 1SMOA 5J3HD 3VXPA 2ZKHL 4J4PC 5GPRA 3V5DB 4UT7H 5CHNA 5I71B 2QHRL 3DI3B 3MV9D 1JZ4A 4OKVA 5ID1A 3RWCB 4LVOC 1PLGH 1VFAB 1YNKH 2EYSA 3DRTA 2CPCA 2I07B 2ZPKH 1V5JA 2HT2D 1B0RA 4IOFD 3QH3B 3SE3A 3D39B 1T21B 4WU5A 5HDQH 3KPSD 5HXMA 4M7KH 3HCVA 1T2XA 1IGJA 1OCWL 4LLYB 1J8KA 1A3LL 1R5WA 3D85D 4KROD 4DK3A 4U3CA 5D7IB 4NHCL 5C6TH 5E9DA 3HCVB 4OLXL 2DDQL 2OR8A 3TVMB 4S11A 4NSKB 5I1IL 5IF0A 2OLDA 3HE6D 3FQTB 2FJHA 2XWTA 4LSPH 2YRZA 4OZ4A 3OJDA 4R0LC 5FUOH 4XTRD 3Q6GL 4XHJC 3S97C 1UM4H 4WJ5B 3OPZL 4NO0B 2R0ZH 3GSWB 3HE6B 1JUFA 3DMMD 4NO0A 1YPZB 2YSSA 5JXED 5DD1H 4AMKL 1E27B 4JGJA 1S9YA 4IIQA 5F3BB 4LRNH 5I76B 1EO7A 1BLNB 3GFUA 4GQ9H 1BAFL 1A0QH 1G0DA 4O51B 1ES0B 1V8HA 2NXZD 2GT9A 4F15C 1MAMH 3D39D 4QHUB 5C0AB 4L3CB 4NPYA 4JDTL 4ZO8A 1BFVL 1TVBA 3DV4B 5GS1B 2ZUQB 3IDXL 4X6DA 1U8IB 1DL7L 2EDTA 1TPXC 4NWUH 1CFNA 1NFDA 4KWUA 2D3VA 4IRJC 2IPKB 3BP7B 3ARDB 1E4XH 4PJ5E 3PL6B 4CVUA 1DBKH 5C0EB 1T80A 2QQNH 1FVCA 5HHOB 4MAYC 2D03L 3PL6A 5IW6A 2FO1A 4LRIA 2C4FU 1NBZA 3QPXH 2X4UB 4TUJA 1JHLH 1FFOA 3DLQR 4JPIA 2MHAB 4N0FA 1B4JL 4G9DA 5J89A 3TBWA 2AXJA 4YFLF 2HP4A 3X12B 1DJSA 2LU3A 2I9LA 2RCSL 4FTVA 5HGDB 3LKNB 4NQSB 1NGZA 1MIML 3JUZA 1YQ2A 3BD3A 1OAKL 5T5FH 5K9QI 1F4WL 5L88L 2I9LB 4JM2F 3MACH 1RJCA 4Z7NE 4CNIB 4S1SH 2CDFB 1G7LA 3IT8D 5ELIA 3BKCH 2HT2C 3QXAA 2A1WL 5K33A 1T03L 1VEOA 4ALAL 3L5IA 4KHTH 1OB1B 5HYJA 1A6WH 5EC1B 3SGDI 1F58L 3ARFB 1P4IL 1SM3L 2EYRA 3W5NA 4LIQH 3EOTL 1UEMA 1ZSDB 4HIHB 3WE6A 3M45A 2ICWB 3EO0A 5AZ2H 3ILQC 4PBXA 5FKAB 3B3IB 3OR7A 5DJAB 5DMKA 2CJUH 1FH5H 1MFBL 5IB2A 2JJSC 4WFGE 4XGZB 4WO4B 3B2UD 5JA8B 3CUPA 1OWRM 5CLWA 3SDXA 2DQCH 1NANH 3NZ8A 1IGCL 1CDUA 3V7AG 1S7QB 1W0VB 4FNLH 3BHBA 4NWTL 1AGDA 4P5MB 3AFLA 5FO8A 1W72L 1ZGLA 4HMDA 3RWCA 1AJ7L 5FGRA 5FO8B 4JKLA 4JQXA 2YPVH 2XWJB 3KVQA 2QLVB 3Q3GA 4HT1H 3U0TB 3VGEA 3V6ZA 1CLCA 1KENH 5TE7L 3TBYA 3PABB 1KXTB 4FQIL 5CD3A 1A6AB 5JW4R 2FLRT 3BQUD 3O6FA 3RNKB 1ADQL 2OTUA 4WFGD 4YXKL 2X89A 4UTBL 4E5XA 4LIQE 5E56A 4NHCH 5C6TL 4KK6C 3MR9B 4RIRA 5JHDA 1BJ8A 1EGJL 1FCCA 2GUOB 1M7DA 5T5NF 1KIPB 2CKBA 1KCSL 3TA3D 4OJFL 4QLRA 2CRZA 3MREB 1YNTB 4M6ML 5I75C 4WCYH 2Q3AA 4JPKL 1SBSL 4QHKI 2AQ3A 2ZUYA 1OLZA 4APQD 4Y19E 4YFLI 4G6FD 5SWZE 2BNUA 4ZSOB 1X9QA 5D5MF 3WFDH 3BXNA 1HQRA 1R3HB 5C1MB 4KKBC 1SYVA 2EDFA 2HN7A 5EZLB 4TRPL 3VA6A 1U6AH 1HQRB 4Y4HC 5IESL 5C9KA 2APXA 4M7JH 5L0QC 5A2FA 1S7VA 4GRMA 1KTDA 4HV8A 3CVHL 1JPFA 3H8NA 5C09D 1LE9B 1UXSB 4G6AD 1KFAL 1JV5A 1Q1JL 3WNOA 4HBQA 4GRMB 1QBLL 1S7VB 1WZ1H 3QJHA 1GHFL 5FUCC 4F58L 3VCLA 3HLAA 1KOAA 1A7PH 3BZ4A 5GSRB 1NBQA 1Y6MR 5TQ0H 4Z7WA 3RTQB 1DSFL 5IG7A 2ED7A 1A2YA 1IM9B 1KC5L 4YDJB 4HK0A 5ISZE 5BRZB 3P73A 3V0VA 3I50H 1OD9A 4ODBD 3HNSL 5EU6B 1ZT4A 3TPUB 3IF1A 3UZEA 5FO9B 4RFNC 2VLRA 5C0IB 5I1JL 5DJXB 2RR3A 1M6OA 5EZOL 2G9HB 3S3SA 3NGBB 5F3HA 3L3HB 4I2XE 2X4UA 5KS9F 1MHEB 2ZCHL 3QR2A 5IHBA 1FFOB 4H88L 4JPIB 4LP5A 5FECA 4RDQF 4X7SL 1UFUA 1WF5A 3VFPA 1A3LH 2IANA 4N1HB 5HD8C 1IKNA 4WUUD 1NGZB 3EOYG 2EECA 4X6CB 5JXAL 4Z9KB 2IANB 5D8JL 5DRNB 2OQJA 4JM2B 5DVKA 1ZT1A 4RAHA 4LQFL 1ES0A 4ZS6C 2J4WH 5I15L 4K71B 2W0FA 2WP3T 5EFIA 2NY4D 4YNYA 5ICXA 5GS0H 1PYWA 3N0PB 4XNYL 2BVQB 4JZNB 2PO6A 1PKQB 1QFHA 4LARH 1UG9A 4GKZB 4KTDL 4IHOB 3MBEA 5SWSB 1V7MH 3OR6A 4PJXF 3LV3B 3GSQB 3BZDA 3AMLA 4YQXL 4JAMA 4Z77A 3G6AB 2BRRL 1FFPA 4GAGH 4X6EB 1U3ZA 2W60B 3G6JA 3HS0B 4L4VD 4JY6B 1HIMH 5CJ8A 3ZDZE 4YHYC 1XF4A 2LAGB 2XG4A 3DROB 3G6AA 2XIDA 3PIQA 5IEKB 5F71A 1NBZB 4QGTA 4YJZL 3ALWA 2ZNXA 3CZFA 5CEYA 4IMLB 4G9DB 3PIQB 1KGCD 1U36A 4OF7A 5E0QA 3NBNA 3VJ6B 3VGFA 5FKPB 1RU9L 4OGXL 3IDNB 1RZFL 3PWUA 2O5ZL 4O5LH 5EBGA 1F8TH 3QFJD 4GXUN 3F7PC 2AXFA 3U0TA 4K8RH 5IMKA 3QIUB 3O2DL 3KPSB 1CDYA 3UJJL 3VXUA 2GJ6E 2X6MA 1QLRA 3ARQA 4R26L 2BFVH 5EOCJ 43C9B 1ZV5A 3M07A 5ID0A 3QEQA 5F7EL 4PB9H 5JIHA 3QQ9C 3PL6D 1F4XL 2E7MA 4JLRA 1EK3A 1FZOA 4JCMA 1RAMA 1BVLA 1MFEL 4LHJB 4MQXC 1ZVHA 4KI1A 5HYEA 1CDJA 2EDBA 4GAJL 1KIPA 3OAYH 2FL5B 3LIZH 4J8RB 1OAQH 2OSLA 5DGRA 5ALBL 5JPNA 4NZTH 3OKEB 1ZHKB 2FL5A 4M4RA 1AR1C 3FT2A 5JQ6H 5TPWL 2A9ML 5KSVB 5L2KE 3ZYIA 2DRUA 4NZRH 3BN9D 2C7UB 1JVKA 5DMJB 5C08E 3MLUH 3HB3D 2IPTL 4QXUH 4Y1AA 4XPTL 1NKRA 4D3CH 2XWJA 5L88H 5H37G 4DN4H 3BW9A 4ZPTB 1MCOH 1CQYA 2XWBB 5GGVY 2F53D 2HWZL 1FV1B 3D3VE 1L4IA 1A7QL 3MGOB 3BW9B 3G9AB 2OTUB 2VTFA 5C9JB 2UVEA 5CEZH 4JFYA 4XNZC 1BJ1J 1RUAH 3RVVC 3QQ9D 4AT6A 2MQ0A 3KPRA 5FUZL 4HHAA 5GGQH 1UJ3C 2VUOA 4JO4L 4X98B 4JDVB 2NY1C 2PYFA 1IGTA 1QRKA 1X3DA 4DAGH 1FHGA 5C0GA 5D1ZC 3F6IA 3ET9F 2PYFB 2ZCKL 4EN3A 3UPRB 3F8UB 3IDJA 2O26U 2VLRE 4HC1A 3CVHB 3D85B 1G7IA 4KTYA 2Y06L 3WFBL 3BGAA 4KUZH 5LCVH 5D1XD 4LLVA 5EUOE 1BEYL 4TNVF 1I8KA 4HH9B 2YPLD 35C8L 4PJDB 4JKMA 4NM8L 4PJ7F 1N64L 1VGKA 4RGOL 2PYEA 2QQKL 4F7TA 4PUBL 4A6YA 3LS4L 5CP7A 1TQBC 1S7SA 5BS0D 2Y36H 1F4HA 5ICYB 2VC2H 4LMQE 3AU1A 3L3OB 3RVXD 5ERWA 3KR3L 1G1CA 4NNXB 3O9WA 4GSDL 4FQCL 4MD0B 3TC9A 2AXHA 2LVCA 4U4BA 5E8OB 4LQFH 4KJQC 2IFFH 4J6RL 4PRHA 5F9WC 4M7JL 5GRJH 4Q9RL 4R4BB 1KT2B 4QT5B 3DWTA 3BKMH 1EIBA 1UXWA 2HMIC 1IM3B 5IM7A 1Z5LB 2BY0A 4LU5L 2G9HA 4M48L 1RJLB 1NC2D 1S3KL 1PDKA 5I8CB 2PCPA 4TSCH 3TFKC 1FGVL 1I4FA 2BNQB 1NDMA 3DHMA 1EV2E 1OAUL 4MJ6A 3WNPA 4GS7B 4I0PB 3PWJB 1YEEH 4NKIH 4JRYB 2QSQA 4YDLC 1J1XH 3LPFA 4X6BB 2EDKA 3KLAA 5F8QC 5L7XH 2JB5L 1OAXH 3MBED 3PWVB 2NTSP 2VXSL 3D18B 1JGVH 3R1GL 1KB9K 1E6OH 4J23A 4K55A 4KV5F 3MFFB 1K4CB 1QRNB 1D5ZA 5LBSL 1GGCH 5DQJA 4UT9H 1XGUB 4ZS6D 5M7QA 4YHIB 5DK2B 4YGAB 1KB9J 1MRFL 5DTFB 5HGAB 5B39G 4U1SB 4MNQD 5DUPH 4XZUA 5IBUG 1Q9KB 2FBJH 3TVMC 5BO1H 2P49B 3ECBB 5HY9B 5ISZD 1F90L 4Y4FC 3IB4A 2GK0A 4J8RA 1MPAL 4MXWH 3PGFL 3SDDA 4TUOB 3C2AH 4LRIC 1KTRL 3DVIA 3U4EB 4JRXA 4BJLA 1OOAA 2VLJB 4DN3H 1TQBB 4ZFFA 1G0XA 2E27L 3T3ME 4LCIL 1XF3B 3QDJD 1AR2A 5DFVD 5I73B 5GRZA 1MREH 2H2SC 3B9KC 4ZO9A 2UWEE 3LS5L 1JMXA 1CDIA 1JGDA 1MJJB 5IVXF 3O4LB 4NN7C 3TYGH 1J1PH 2Z92A 1FV1A 3FL7A 2GJZB 4JG0H 4NHUB 5M94B 4N0UB 1JGDB 1MJJA 4RFOL 4JG1L 1Q9WB 2A9NL 1XH3A 3WL9B 4E0RA 5IMOB 2PR4L 2P5WA 5KG9A 4AIXA 3P4MA 3PP3H 4LHUG 3LN4A 2FO4A 2Q6WB 3S98A 3SEPA 5DJYA 4HUUA 5AD0B 4HHAB 1K8IB 2F53A 1JN6B 5EIIB 2A77L 4FRWA 4XAKD 4XPGL 4KDTA 5GGUA 5DJYB 4PGBA 1AD9A 2QKIA 4P46D 4DOHE 1UWXH 3JWOH 2HTLC 3MRJA 4G3YH 1WBZA 5JPNB 1N7MH 4PGBB 1DBAH 2ENYA 5GSVA 4OGAD 1TMCB 3EYUL 4YGVB 1NGWB 4MAYB 2VDML 3RL1A 1MH5A 5HHXH 4F7EA 4HBCH 2W59A 1UZ8A 2DM2A 4GW1B 4MB4A 2OZ4A 1PEWA 5E5RB 4PP1C 5EUKB 4K9EH 5D1ZD 3VFNA 5I6XC 4LCCB 5J1AB 2R4SH 2ZWLT 3MGOA 5A3ID 1ZXQA 3RWJB 2BJML 4K8RD 3VFNB 4HKBA 4WDIB 2ADGA 4HKXB 3VMOA 1WBXA 4GRLB 5DVMA 3WO4C 2NW2A 4WW1B 3JWNC 2FB4L 1IC4L 5GHWL 2IQ9L 5ICYA 4XP4L 1EVTC 3G04B 1ZS8A 2RHEA 4G9FD 4U0RB 2FLBT 4A6YH 1ACZA 5MEQB 1MFEH 3IDGB 5IW1B 1JWMA 2FSEB 4JREC 3OAZH 3OBAA 3OL2A 3CK0L 4LPCA 4NBZB 3T8XB 5K9QG 4CVZA 4Q6IC 1VACA 2X1WL 3P11L 4JFFB 4KRPC 2E8YA 5I19H 1MCEA 4CVZB 5HDQL 4TTDD 2VLKE 1S7UA 5ANME 5T3ZL 4QNPE 4LPXA 2V2XB 1BBJB 2BX5A 5FOBA 3CX5K 5L9DH 8FABB 2GQHA 1NKOA 4Y5XC 1KPRB 5F7LB 2C9AA 4OZFG 4A2LA 1ZA6A 4WEMB 4JVWA 1SMAA 5E5MA 3WS3B 4F3FA 5I8OH 4L3EA 3PV6A 4GAYB 2C3WA 1DVFA 1A1OA 4NDMA 4KK8C 4OFPA 3C6LC 3PWLA 1CLYL 3S9DB 2NR6D 1FSKB 1XR9B 4FQHB 5KOMC 1A02N 1TXKA 4WWKB 3ZL4L 4PJ8A 4PJ9A 2QTEA 1ORQA 3T65A 5DD5H 4PJBE 3E2HC 5C0CD 3GMRA 3MCLH 4HPYH 1XGPA 2WW8A 3HR5B 5IHUL 3AB0C 5IVNA 5LWYH 3MZTA 3U30B 4MA8H 2JELH 1WZLA 4ETQA 3WFBH 5EWIL 1BFSA 1FVEA 4U1KB 2FBJL 1BVZA 2VXSH 2XN9B 2VAAA 3NN8A 4NQDE 4GKSB 5KZCB 3KPQA 2FCBA 4Q2ZB 3SGEI 1FAKT 4QRTA 1WAAF 2AABH 1AGBA 2VL5B 4N8VA 4D94A 3NFSH 2R29L 4OV5A 5T1LD 4UNTA 4B7IA 3PWPE 4JFED 2NY0C 1OQXA 3NCEB 1CFQA 3WIHA 5DK3A 4OZGE 2RCSH 2ARJB 2XPGB 1JZ5A 1PGRB 5B39B 1TCMA 5TQ2L 1CFQB 2DQDL 5FM5M 2X9XA 5ESQA 2EZ0C 2NX5E 4PGJA 5EO1A 2XA8H 4PJEA 4ONGH 4FXGB 1P7QD 1IJ9A 3WNKA 1KG0A 3EIFA 3GMLB 5TDNB 4PJFB 2YC1A 1EHAA 1CR9H 5IFHL 1KEGH 3T0XA 4Z7WE 5GRUH 3SCMB 1JJUA 4RZCB 4G6MH 3CFBA 1QSFA 1C1EL 5FYKE 4TPRL 5C0CB 4MZ3A 1YEEL 3BN9C 5CGTA 3TWCH 1MHPH 3CH8A 3V2AR 4XRCB 4HZAA 3HFMH 2QADC 1CD0A 1FPTL 1A3RL 4LVEA 2IMMA 4G8GA 4KJWC 3GO1L 5F7WC 2DQGH 4TULL 1FLRH 1N7ML 2IADA 1A9BA 4M48H 5LKNA 2DOCA 3EBAA 3IJSB 1XCTB 3U4EA 5F96H 3VDCA 5IP4A 4XCFH 3S35H 1G7MB 1EFXA 4WWKC 4KV5E 1BX2B 1P4IH 1SM3H 3BGMA 1A8JH 2NY5H 5E9DD 5B38A 4M00A 3LDBB 1XF3A 4LK4A 2PTTA 5F89B 1KLUB 3CAFA 1E4WH 1E0OB 2NQCA 1DLHB 4ONOA 1T5XA 5FB8A 1FJ1B 4KGLA 5IB4B 1JCKA 2K7QA 5JHDE 2ZUTA 3VXMB 4BFGA 4G3YL 3LB6C 4OM0H 3BWAB 5DI8B 2D7TL 3R1GH 3RWFA 5I1JH 5IB3B 5I8EB 3EYUH 4JFDD 3L3JA 1MNUL 1U8KA 2GEEA 3B2VH 3P3YA 4OB5H 1JPST 1A1NA 5J4MA 2VLMD 4HLJA 3EYFA 1BIIB 2F54B 4R7DB 2UUDH 2V9QA 5CJQL 4MWFA 5I16B 3QWQB 3WD5H 3BKJL 4YUEL 3BO8A 4G7VL 2E27H 2BVPB 4CW1A 4PGDA 1AD9B 4H5SA 1UQSB 2C4XA 3FN0L 2WIIA 3WFEH 4FMKA 4YC2B 4WVRA 5GIRA 5BZWA 2VXUL 4KVNL 2VQTA 3GJFA 3OKNA 4HS6A 1IC4H 5GHWH 3Q1SH 5DFWH 4HX1A 2XA3A 4QOKA 1MQ8A 5GGSY 4NO5B 1T7YA 4WENB 1AI1L 1QFWM 3BYYA 3CIQA 4Y8AA 4JO3L 1W0WB 2CQVA 3MLRL 3QUKB 4LCUA 2VLKA 5KAQG 4P9HC 5DWUL 1DVFB 4UTAL 1VERA 5DEGB 3ES6B 4L8BB 4RFEB 3I85A 3FQRA 3EOAB 4LCWB 2XTJD 1IRAY 4OV6F 3F7QA 2WWKT 4OCSL 3HMWL 4QHLB 1YDPB 3IJHA 3MOBH 3GMRB 4JY5H 1X6LA 2IAMB 3HNTH 1CFTB 3RGVB 5FYLD 2FSEA 3E8UH 5GISH 4P49A 3MODL 4O2CB 3ULUF 1RUPL 4HEPG 3FQNB 1UKTA 1CGTA 3EUUA 4HW6A 1CFVH 1MJUL 4NO2B 4O2CA 4UINL 4EDWH 3SCMD 5F9JB 4K8RL 1ZAGA 2VH5H 3OJMB 1FO0A 1AE6H 3S36H 5B8CA 3O2WH 2VWEE 1S7XA 4MDJA 3ARGA 1BVKA 1ADQH 4S1QH 1WZMA 5T1KA 1U8PA 2HFFB 2Z4QA 3STLB 4DUXA 4EUPH 5C3TA 3LHPH 1MWAB 1Y6NR 3IFPA 3WJJC 1I1AC 5GRVK 2ITDA 4Y4HA 5C0JB 3HUJE 1MCHA 1BQUA 1I3RA 4XVSH 5EG6C 5F6IB 3H9HA 3DYMA 1YNLH 3MOAL 2VDNH 4LSRH 3V79C 1OP5H 3TYFA 1BZ7B 3U9PH 3RUGA 3MZGB 5I74B 5E24E 4Z7QF 4L4TD 4OSUH 1MQKL 2F74A 1UB5B 3P9WB 5EORH 1WITA 5TDNA 3C6LA 2NYYD 1ZWIB 3FQWA 4ODHL 1CQKA 4NNYB 3QEUA 5KN5B 4GT7A 5A3IC 5GZND 2VISB 3LRGA 3W0WA 1QSFE 4OIIL 4HLZG 2CO6B 3VXPB 4F8TA 4I48B 4Z7VA 3MUGB 4OQTL 4PYGA 5CEXB 1QSEB 4JZJB 2XZAH 3IKCA 4YHZH 4P2RB 1KNOB 1O7VA 4YBLC 2O61A 2ZZUT 1JHTB 1T83C 5D1QB 2HAZA 1LD9B 2VB5A 1DQDL 3M17B 4ODUB 1AGBB 2VL5A 2PO6D 1VFUA 1T0MA 1X5ZA 1MEXL 2BY2A 5EBWA 1ZA3B 4KPHH 3K1KC 4PJAE 1EFXB 3N1MC 4I3RH 4ZOEA 3W5MA 1BGXL 5DUBB 3SE4C 4ETYA 1D9KB 2PTTB 4KK8D 2R2CA 5F89A 3MV8E 2AJZA 1S78C 4PRIA 4U1JB 1WFTA 1QVOA 3MRCB 5E9DB 3FCTB 3V4VL 3MRDA 5ICZB 4J3TA 3HHRB 4UIKH 4JPVH 4UDTB 5DJZA 3FQTA 5JDSA 4OZ4B 5DJCA 5ADPH 1U8OB 5A43C 1JZ3A 4K3DH 5I1CH 5IJVA 4LVNB 4RZCA 4RMWA 1JNHA 4U1HB 4RGMC 1XF5A 4ZPVA 3RKDC 3PGDA 2OJZH 1E4XI 3H9SA 3O6KL 1MRCL 5HHPB 3RJDA 1YEFL 2C3XA 4N5UA 5IEHB 2VIRA 2VRAA 5JORA 3VFRA 3T0EE 3EJZD 3F7RA 6FABH 2P8PA 4PV8B 4WJ5A 3DX9A 4LLWA 5D93C 2ESVA 2Y4SA 1IMHC 4LSUH 3T09A 1C12B 1WBYB 4HS6B 3VWKD 2HKFH 3UTZB 2X4NA 3DV6A 4M62H 1J9CT 1L7TH 3LS4H 3SDCB 3RBGA 5A2LH 1JYWA 1OF2A 2K7PA 2BHZA 3TBTB 5AAWA 2VDQH 1SY6H 2AVGA 4XMKH 4GS7C 3TO4B 2JCCE 4GMSL 4F57L 2YMXL 5IB5B 3TWCL 3CFEA 1RFDH 1TVBB 3BT2H 1HH6B 4UTAH 2NY1B 5E4EC 3LIZL 3ES6A 4FXKB 4Z95H 4LHQB 4KMTL 2YPLE 3L3JB 1NAKL 1AFVH 4ZUVB 4GRWF 4TN9A 5E08H 5A40E 2XOTA 4TSCL 2DIJA 3S5LA 5IFAH 1BQHB 2R1XA 1GAFL 3VFGL 3UTSA 5C0BD 4P3CL 4X7FC 2B5IC 3DI2B 3KYMB 3TBWB 1DEDA 3IGAA 1F42A 4NYLA 2N7AA 2QQLL 2YZ8A 1EO8L 5BV7C 1T66D 1EDQA 1QBMH 1A1MB 1JWSA 3O2DH 1SHMA 1IAKA 1AE6L 5FYLL 3MMEB 3QXAB 4QOKB 1IAIM 2WBJB 4OI9A 3QCUH 3CPLB 5LXGH 3K3QA 3MMEA 4CUCA 4YK4B 1S5HA 25C8H 3O4LD 2VITA 5GGTA 5B38G 2LE9A 1VPOL 3E6HA 4HSQA 4C55A 1A14H 4LCUB 4ZUWB 4ERSL 3NFNA 1JFQH 5HSFA 3CSPA 3E6HB 4M8QB 5I73C 4X7CC 2FJGB 2XY2A 2ZSVA 4BH8A 3WBDA 4EN3D 3C09B 4GBXB 1KCVL 5AYUL 2AAVA 3FHQA 1QSZA 3S36X 3ROOA 2ZUQC 4CKVX 4XNXL 3ZDYF 2CKNA 2ICWA 1VSCA 3DX8B 4P4KA 2M26A 4FQCH 1CXIA 2YKLL 4Z7VB 1K3ZA 2F9BT 3JWDL 2BSTA 4NQEB 3UTPE 3ARDC 4IRJA 3RDTD 5MENA 5DD1L 5J1SC 3GJEA 4GRLD 1MELA 2NZ9C 4Y4KD 3C6LD 1CD1A 1GGYA 1Y0LB 3BHBB 2YN5A 3CDCA 4NFDA 1F11A 1FH5L 3MRLB 4UT6L 5IMLA 3FZUD 4B50A 1DQLH 1OAUH 1JHKH 4U1IA 5KSBF 3DUSA 1UB6B 4K7PL 3C9NB 1YEGH 3HC3L 2VE6B 1UB6A 5CIPA 3HKFA 3OB0H 4I0PD 3SBWA 3GKWH 5CUSH 2CK0L 4WU7A 1P9MA 4JO4H 4GMTL 3RVVD 2EIZA 3L7FB 1S3KH 3NMEA 1FNGA 2CKBB 3NABH 2JTDA 3C6LB 1HXMB 5JOFB 4MZ2A 2WM0A 4HF5H 4LLAA 3MRBA 5ITBH