1HI6B

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
publication title Crystallographic Analysis of Anti-P24 (HIV-1) Monoclonal Antibody Cross-Reactivity and Polyspecificity
pubmed doi rcsb
molecule tags Immune system/peptide
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B02
1AO7B 5SWSA 3FB7A 4IM8A 2EZ0C 4UQ3A 4GT7A 4I0PD 3F7VA 4YXHH 1S7UB 4QRUB 4CL7A 3I6LD 4H0IA 1T7VA 1KB9J 3PG2A 4LLAA 1KEGL 4WGVB 4WW2B 1ITCA 1I7RB 5DD1H 5KSUB 4X4ZA 3SDCD 1EHAA 4BKLB 1BFVL 2ZCKH 2DBJA 3FFCA 3H3BC 3L9RA 1X4YA 2BVTA 5K93A 4XP1L 3ULVC 2DKSA 4N5UA 3V6OA 3GUTB 3EYOA 1S9VA 1C08A 4IDJL 1BQHA 2H32B 2P24A 3F5WA 4YHIA 2B4CH 1DQML 1RPQA 4LCWE 4CVZB 4UMGA 1KIPB 2DLHA 4W4OA 4OD2A 4Y16A 3VH8A 2G9HB 5FV1L 5KZCB 1JWUB 5CINL 1J8KA 3BGMB 4M7LL 1E4JA 1OD7A 5D1ZC 1P7HL 4WIQA 2VKXA 2Z91A 4YPGB 1C5CL 3HC4L 5GGUB 4CNIA 2AVGA 3L3JB 3BT2L 4ZG1A 2A1WL 1XR9A 4PRHD 2A6IB 2BOBB 3OJMB 4QRSB 3MGOA 3AXLB 2H9GB 3T0EC 5IVZA 3FONB 3W9DB 2X4QB 4RISH 2J5LC 5LG1A 1IM3B 2OR7A 4MA3A 2VXSL 1KN2L 1N59B 3JWOL 3QDGD 3BD5A 1RK1A 3OKKA 3NVQA 4Y1AD 4UNVA 3OKNA 3B2VL 2CLZB 3RI5F 2MKLC 2DS4A 2LQRA 4MLIA 5ESAB 5KS9B 5FYLD 4MJ2A 3QQ9D 5GISL 1UEYA 1G7JA 1YPZB 1KULA 1LNUB 1M6OA 1WZLA 4JFDE 1UJ3C 3N9GH 4XP9H 3SGEI 4F7MB 1DLFL 1N7MH 4NUJB 4HS3A 1A9BB 1K4DA 1YNTA 3OX8B 1LQSR 1DEEB 4XMLL 5EUOA 3MRFB 1FZJA 1S7SB 4ZS7L 1Y18B 1PZ5A 2NY0C 1N5YL 4MJ6A 3EDFA 5JHDE 4RGMB 1FZKB 4AIZA 1N4XL 1B88A 1NGYA 3W81A 5T1MA 5D6CA 4HK3J 1BLNB 1CDBA 2XA8H 3ECBB 3DLQR 2AGJH 4U31A 4H1LA 4NNYB 3V4VH 3VA2C 1MFAL 3GEWB 5GS1B 2OTWB 4NQED 4BELD 2ZKHL 4HK3N 3NFPA 3RAJH 5EBWB 5I8KL 3AB0C 4S1SH 2X7LA 4IS6B 3DJ9A 4E5XB 4O00A 2GCYA 4YFLF 1CICD 2Y6SC 3V6FA 5C0RL 2HFGH 1BZ9B 3LS4L 1EFQA 2D9QB 2DWDA 2EDQA 1VFUA 1XCQA 1AI1H 5A2JH 1YY8B 1W72H 1MHEB 4JO2H 4M43H 5IOPB 4FXGB 4BSJA 1PG7W 4QRRB 4X0KA 3QDJD 4DGVL 4L4VE 3L3IA 1HQ4A 2EIZA 1MRCL 4HIIA 1U8OA 5FGBC 2BSTA 2I60L 4ZPTB 4XVJH 4NHCL 2DI9A 2Q7NA 1OPGL 2HLFD 1N2RA 4TTDD 5DQDL 4R4ND 3SE9H 2K1MA 2PKDA 4X80L 5DHYA 3RWDB 4N0FA 3GSWB 4YDJA 1S5IH 3VXRB 1NSNL 3VFRA 4KTEL 3MNWB 1WTGT 5HHQA 4D3CH 2Q76B 2JIXA 1JGVH 4ZOAA 3HZKB 4PBXA 4QNPF 1J11A 2DQEL 12E8H 4XNYH 5D1ZA 4Z6AT 4F37K 5IB1A 1Z6JT 2X4PB 3H9YA 4NWTH 2FWOA 2NY5H 3BN9D 1JK8B 2ZG3A 1D6VH 1YEKL 4DGYH 1S9WA 1RJZB 5IW1A 3MXVL 1QD0A 4LLVB 2G75A 3VFWA 2EDXA 4BH8B 3T0EA 1MFEL 1P4IH 2GTWA 1ZGLM 5DK3A 4Z0XA 4NQSA 4KHXH 5HHOB 4RAUA 5B39G 2D7QA 4PJFB 5DQJB 4NQDB 5DQ9B 1ADQH 1NMBH 4JPWL 5IMLA 1S8DB 2PYEE 4OKVA 1DQJA 4CBPA 1JCKA 4XAKD 3MV8B 4WUUE 1MH5A 5DRXA 3C08H 4NRZA 3OJDB 2VZSA 5E8PB 3E8UH 1UJ3A 4NFCA 4OB5L 1MCDA 4WCYH 1NBYA 4PLKD 4M00A 5B21A 3QEQA 5CJOL 4MZ3A 3FRPG 4MSWB 3MZTA 4KJWD 2Y5TB 2UWEB 3VWJC 5GS0L 1Q9KB 2R2CA 3MBEC 4XBEL 4F2MB 4M9PA 4PGDB 3D1MC 3QXDA 3QH3B 5IHUH 1PQZA 1I8IA 4JY6A 2DKMA 4HS6B 5DD6B 1JNLL 4OZGF 5FA3B 1AGEB 3P4LA 1M05A 4ERSH 5GZOD 4LKCA 5IBTL 2CRMA 3CPLB 3X14B 3GMRB 1KT2A 1NLBH 1HEZB 2WBJD 4FXKB 1MUJA 3D2UB 1LE5A 1DE4A 2NXYC 2OCFD 3B2UD 2YRPA 5B39B 3GJFH 1HHHB 4XC1H 1EAPB 5ESQA 4N0YH 4GW5B 3UTQB 4MD0A 3GMQB 1YMMA 1OB1A 4P2RD 4HPYH 4LSVL 5J0BA 5EO1A 4KTDL 32C2A 3QUMA 1ED3A 2C7UA 3MLZH 4LU5H 4G8EB 4MA8H 1L0XA 5DXWA 1OW0C 5I8OH 4G5ZL 5F72S 1TIUA 2BNRB 3KAAA 4I9WE 1JWSB 4MS8D 1I7UB 4NPYB 4Z7NF 2VLKD 4NO3B 3GSUA 3H7LA 4PB9H 1U8LB 1KV3A 1NMAL 1JF5A 2VXTL 1A47A 4P9HL 4CMHC 2DJ4A 1A1NA 4MCZA 4LKXA 3OXSB 1IM9D 2YD5A 3DGGB 3VXOA 4PV8A 5DUML 1OAKL 5IW6B 1T4KB 3IGAA 3LMJH 3GBNH 5EZOH 5FGBA 1EPFA 5B4MD 1QBMH 3F6IA 4JFQA 4OCRH 4FP8H 2G2RA 2DIAA 4EVNB 3BSZL 3VGGA 1JPSH 2QLVB 4U4BA 1CDUA 4DN3L 4JRYB 3ILPA 3WFHB 1FDLH 1PAMA 3INUH 5C09A 2X1XR 4NOFA 3QZWA 4FQXD 4HWBH 4XCCL 3LKRB 4KJPD 4P46C 1U8PA 1KB9K 1IZJA 4YR6B 5GJTH 1VDGA 2CXGA 3VGHA 3HLAB 4HFWA 2X1PA 1MLCA 1MPAH 2R9HD 1GRWA 4Y19B 4H0HB 4AYFA 2OK0L 4OD3L 2WUCL 1BFOA 2E27L 3C6SB 3IXAB 3HZMB 3VXUE 4U1IA 3QUXB 4HUWA 2YZ1A 1AE6H 1CF8L 1JTPA 1JL8A 1YEGL 1IRAY 4ZUTB 5HVGB 1IGCH 4AEIL 3SCMB 3FFCE 2P8MB 3HR5A 2W9DL 2XICA 3ZE2E 2VDNL 3I75A 4CAGA 3P4MA 4CW1A 4OM0L 2XWBB 5F9OH 3UTOA 1X7QA 3BGAA 5IVNA 1UZ8B 3MLYL 4AIXA 2ADIB 2JK5B 3P9MB 4WFHE 1FL5B 3D85A 1GGCL 1EHXA 1MJJA 2RGSA 1QVOA 2UVEA 3QUZC 4K7FB 4MNQE 2ATPB 4HC1L 3TLRA 1VFBA 5A16A 5D96B 1S9YA 4Z7VB 2GSIA 4ELMB 1YMHA 1L6ZA 1M7XA 5C9JB 1TJHL 3QG7L 5C0BA 1DBBH 2YD3A 2NY1B 2R29L 1KJ2L 3G6AB 2NY3C 3VWJA 4NDMB 3EYQC 3MBEA 5T1KD 1V7ML 1W72B 2Y9RT 3HPJA 1UQSA 1CL7H 1ZHKB 4JGJA 3RVWD 3WL9A 4LSUH 3J7HA 1J05A 1NLDL 2AXFA 4UTBH 3KXFB 4LCWD 2R4SH 3P0VL 3TBVA 4O2FA 4EN3C 3LN5A 4UI2A 2PW2B 5CGMA 4B50A 3HHRB 1MOEA 3I2CH 5IVXB 4WWKB 4LHUG 1DFBH 1MEXH 3VFUB 1K3ZA 4PLNC 3THMH 5D1QC 5DFTA 1AR2A 3QXVA 2MQ0A 4IOFC 4JE4B 3B9VA 5DMIL 4XPBL 1ZE3C 3OQ3B 5ITFB 4U0RC 3MLXL 3SQBA 4OCYL 4MXVF 4PTTB 5D7IE 4UAOB 5DJZA 3T0AA 3FHAA 2ARWA 1ULVA 3HRZB 4PP2B 1Q94B 3GIVB 4H88H 1AGCA 3RPIB 3RVTC 4OLXH 5EUOE 5E70A 5C0EB 1GIGL 1YEDA 5D2NA 5DRZB 1OW0A 5DK0A 5I1KL 3O3EB 5ETUB 4L8DB 1TZIA 1SJHA 3C8DA 5K9QI 4BH7B 4FQHB 4M5YH 3S35L 4I4WB 2XWTB 3VFMB 3LVEA 1BQUA 1VPOL 4X5WA 5FYLH 5C0IA 2W38A 2Y36H 3SE3A 1F2QA 2DJUA 4FQ1H 3KLHC 3QCVH 1J0KA 3VFSA 1FV1A 4F57L 4JFDD 4L5FH 1CE1L 3V79C 2VR9A 4NKQB 4M7KH 3ZZ1A 1RUQH 4U1MB 4LHUB 4K94C 1P4BH 5B8CB 2EC8A 2DJSA 5TH2B 4BQ8A 1J1OH 3P40A 4GXUN 1QFUL 4GAYA 3U48A 1NCAL 3CVHH 3T0VA 1IFHH 4QXUH 1C16B 5JHDD 3KYMA 3WD5L 1XF2B 4I3SL 3WS6C 4IEFB 4HG4K 3F7RA 4JZJC 5DC4B 4P46A 2NY2D 3BPOB 4HD9A 2OR8A 1WBZA 4ODUA 1KTRL 5FKPB 4WRLA 2V2TA 3WEXB 1ZANL 4BK4A 3IDGB 1FPTL 4PV9A 3C5SA 1U8HA 2NX5A 3QB7C 4FQIH 5ICZB 2PO6D 3QO1B 5TDOB 3VXSB 3BIKB 2HJKB 1WITA 2WQ8A 3D9AH 3QPXL 2D7PA 1YUHB 3EYFA 4OUUA 5E56A 1HIML 2PR4H 4ZYKA 3GSXB 1Q72L 1FH5L 5FYKH 2Y06L 3ULVE 3X13B 1MVFA 1QKZH 5SWQA 1UM5L 5J9PB 1MHHB 3AS3A 1TZGH 4LSPL 4LIQE 1R5VA 2EDFA 1FQ9C 1BZQK 1DP0A 5DJ0B 3WBDA 4XXCC 2JKXA 1KJVB 4K8RL 3GMMA 2YWZA 3GJFB 4JO3H 3IJHB 3Q0HA 1R3IH 1A4JA 3T2PA 3IFOB 5CJXC 5JW4Q 1I1AC 3MLSL 3QUZA 1F6AA 3IJYA 4PJ9A 4L4VD 4GRWH 2F8OA 3LDBC 5GS0D 2F5BL 2LV4A 4O9HL 1WCBB 4LBEA 3SE8L 4P59L 1FFQA 1JN6B 1XF1A 3H42H 4OF6A 5JZ7C 3MRIA 3DXAE 2NMSA 2MNUA 1F4AA 5A2IH 1X5LA 3I3BA 3T0EE 1QZ1A 1T66D 4OZGA 5GGSB 3B83A 3U4BL 4M8VA 1XF4A 4NC1C 1DL7L 1T7ZA 1CXEA 4P3DA 3W39B 1S9XA 3EZ8A 4PD4J 4UUJA 4OLWH 3HNSH 5ICYA 4EN3A 1V8HA 5SX4I 4AL8H 5J6HA 1B4JH 4F37F 5AAWA 3EOYG 4KKAC 3D69A 4RRPG 2Z92A 3WLWD 1MAJA 2Q6WB 4NBYB 5I1DA 2WLZA 4JANB 2VZVA 1VACB 4HUKB 4WI9A 2ITDB 5D1QA 2FX8L 1FIEA 3O3DA 5ICXB 2P8LB 3CUPB 1EK3A 2DQJH 3GGWB 2J88L 3K4ZA 3ZKMD 4RCAA 3FB5B 3VFPB 2AV1B 3QEQE 3CFEB 2UYLB 5LAXA 1PKQE 4S10A 3TBWA 5I1LA 3G5XA 4MD5A 1FORL 4O2CA 1SEQH 3ZSTA 4Y5XC 2GJZA 5C0CB 1NAKL 1V3MA 1LEKB 3NGBB 4X7SL 2AXGB 2KPNA 4UNTA 5MENA 1UEMA 1EEYA 2AJVL 1KCSH 2GK0A 5IB3B 3MFFB 3ARQA 2MCG1 4YPJA 5EDXA 4W6YB 1V5JA 3BIBX 1E27A 3ULVL 1BMGA 2PYED 5E2WH 4LIQL 1FNEA 4WUUD 2O26U 4XNZB 4HF5L 3HZVA 3D87B 2WBKA 2FBOJ 1YECH 3KS0J 3CX2A 1NMCB 1KTDB 1YMME 2DBLL 4D94A 4U6XB 2FGZA 5DRNA 3FMGL 1UB5B 1RUAH 4OGZA 5H35B 2E6PA 3TBTB 3HS0A 3QUKA 5I1HL 5EZIH 4I0PB 5EU3B 1TVDA 4YBQC 1WTLA 3DGCR 1Y6MR 1NBZA 1H15B 3N1MC 3WXVH 5FA4B 1CVSC 5ILTL 3T0WA 4ZUUA 3ES6A 1WFTA 2EE2A 4FMFA 5FHBH 2A6JB 3WS6A 1QP1A 4RAVA 1A6ZB 1CCZA 1ZGLA 4UT9L 4OZIE 3C2SA 3DVFA 4HH8A 4DVBA 1WAAF 1MIML 1KB5L 1CIUA 1VKXA 3GDBA 4PJBB 1FFRA 2XIDA 4ALAH 5F3BA 5L0QC 4WDIB 4Z77B 1WF5A 3VMNA 3KPQA 1MFDH 5FM5M 1T1ZA 4PJ5E 3CFKB 3IDYC 2IQ9L 3RGHA 4DK3A 1ND0A 3QQ3B 3HCVB 1OSZB 1G6RL 4P2OB 5EC2A 1UG9A 5C09E 2GY7B 1SBSL 1KEGH 3CCHA 4WI3A 4XXCA 5KSBB 1OL0A 1NFDF 3NPSC 4U6TA 4PG2C 1BFVH 1BF8A 3NIFE 3QFJA 3E3QC 2EDYA 3VCLB 5CJXA 1F02I 1I1AA 2WWMC 4XP1H 3WFBL 1AKJD 1QRNB 5DJ8A 5ID1B 3P4OA 4IDJH 1JYXA 1WT5A 1SYVB 4X4XA 3KPNA 1DQMH 5HHXL 1J0ZA 2EDLA 2YA1A 3IXTB 3MTRA 3QSKB 1JHTB 4Y1AB 5CINH 5T1LB 4M7LH 1WBXA 3FO2B 3KDMB 5CBEA 4GAGL 3U79A 4N9GA 4JFXA 3HPLA 2X4OA 5FYKU 1C5CH 3HC4H 3LEYL 2AKRB 3BT2H 3O8XC 2FHFA 3H3KA 1CFVL 2A1WH 2Y23A 1DN2A 5E2TH 3CJJA 2Z93A 4XGZB 3QUML 4KHTL 3PGCA 4H5SB 4U3HA 1QO3B 1BOGA 2R2EA 5K9OA 1DQLL 4ODSH 1RFDL 4CJ0A 4YHLL 4Y5YB 3MLRL 3EO0A 5CKGA 4P57B 3VXUD 4NZUH 1M7DB 2VXSH 1KN2H 3JWOH 4FXLA 4D9RE 4DUWA 1R6VA 4ZDHA 3B2VH 5DZOA 5C0BE 4WTZA 4WHTA 2P5EA 3FFCD 4NM8L 1WZ1L 4LLMB 4Y5XA 5GISH 4JAMA 3AVEA 1NFIA 2OSLB 2EEDA 2W59A 3DPBA 5F1IA 3OKOB 1DLFH 1OTSD 3SDXF 1YC8A 5I71B 4WFHD 4BSWA 4OZ4B 2BNQE 4MNQD 4XMLH 4G9FA 1REIA 4ZS7H 4OF7A 5ALCL 1OSPL 3IDJB 3LEXB 1LP9B 4AENA 2B7DT 1LVEA 3MV9E 3OKDA 1N4XH 1E28B 4N1CA 3ZKXB 2DLIA 4F15B 1U8IA 4MNGE 1MJ7L 2AK4A 1HOCB 1FL6A 4XPFL 5J1SC 43CAA 1MFAH 2XACC 2Y5EA 5C3LD 2ZKHH 1JJUA 4NRYB 1T3FB 2HLAA 4ZO6A 1A0QL 1R5WA 3FKUS 3MRLB 1JBJA 3BWAB 3RQ3A 5I8KH 2EH8L 3QYCA 4FOMA 5DTFB 5IP4A 2NZ9C 4NC2B 1KNOB 1H0DB 3TV3H 1R24B 3MOAL 2ICCA 2ZSWB 3P9LB 4BJLA 2VN7A 3CH8A 5DJ6A 5C0RH 3RKDD 3LS4H 3VMPA 4NGHL 2GEEA 4LLDA 4N8CL 3QO0A 3ARRA 3MGTB 4PGCB 4Z7QE 4Y4KC 3WKNA 5DRWB 4FRWA 1T83A 1HCVA 3M17A 4KQ3L 5F7MC 2LTQB 3SKNA 4DGVH 1YQ2A 4K8RD 3G04B 3MRJA 5DD5L 2F15A 5F97E 2F8XC 2G5RA 2HTKD 3GMPB 4G9DB 1MRCH 4BM7A 5EO0B 3BEVA 2I60H 1Q1JL 3C87A 4E41A 4NHCH 4KU1A 4YWGL 2DQFB 1OPGH 3VFTB 5DQDH 4OT1L 4PG2A 4HFUL 2W65B 3BH8B 1HXYA 4LVNC 4M03A 4X80H 4UOW0 1VGKA 4Y4FC 4GG6F 3FO9A 5D1XC 3B9KB 1NSNH 4KTEH 4ZPVB 2FJGA 5TE4L 1D9KA 4KVNH 4E0RB 5HGHA 3B6SB 2H3NB 2X5PA 3O3UN 2EO9A 3HMXA 3EYUL 3PHQA 3ZE1F 2DQEH 2QQLL 5E8NB 1CGXA 3REWA 4HKBB 4MMXC 4ZSOE 1MCIA 2OJEA 5IB4B 2ICEB 2XXMB 1YEKH 4YO0B 5HYJE 3O8XA 1TVBA 1X5HA 4R7DB 3MXVH 3PHOA 2DL2A 4DW2L 4XP4L 2EZ0D 1MFEH 2YPLB 5CJBA 1CD0A 2HN7B 2E6JA 5MEOA 1ACZA 1ZWIA 1YEEL 4KI1A 4RFOL 3KG5A 2MPAL 3C5JB 1U3HB 2H2SC 3T3ME 4AH2A 1BPVA 4PD4K 3AS0A 5DVKA 1KPVB 2ZWLT 4P5TC 3PQYE 4JPWH 3GZKA 5F7WC 5IR1A 4HGWB 3FT3B 1HDMB 3HI5L 3ULVD 1T1XB 4GG8B 4LSQL 1RJYB 1FYTB 4OB5H 5F89B 1GOGA 4I5BA 5CJOH 2I07B 1F90L 4X7DC 5DFVD 3BISA 2JIXD 3RWFB 2V7HB 4L8CA 5ESVA 5GS0H 1LK2B 4XBEH 2BSED 3IU3A 4H25B 5D1ZD 4CU7A 1AR1C 4Z5RA 4HWNA 2P47B 5D7JB 1JNLH 2H8PB 3S35X 5FO8B 3DXAD 2VLKB 4TQEL 1PYWA 1PY4A 2EIDA 2Z8RA 3PDGA 4LGSB 5IBTH 1ZT1B 3GMOA 5CJ8A 4QTIL 4O02L 3T0ED 3PL6C 5BVJB 3G6JF 2D31B 1NDGA 5KG9B 5H94A 3STBA 4OCXL 2NY6C 2QSCL 5F1SA 1OGTA 3HE7D 1A7RL 1JF1B 3S36X 3V0WL 1OF2A 4NKDB 5EO9B 1F4YL 5KS9F 1JYWA 4QRQB 1MCJA 4S11A 2B1HL 3KYOA 3JV6A 2P8PB 3UZEA 5I8EB 1VSCA 3DMMB 2KH2B 4KTDH 3O2DA 4WO4A 5GRVL 4O51A 3K0WA 2D9CA 3HNTL 1XZ0A 2FIKA 4ZMAT 5HY9B 3OB8A 4G5ZH 5GRJH 2ZSVA 5IROC 1T1YB 3MQIA 3NA4A 4FFVC 3RWJB 1EA9C 4Y4KA 3QEQD 2XOTA 4P4KC 3CDCA 5ADPL 1NMAH 3KWWB 3L1OL 3BGFB 2VXTH 3IAQA 1R3JA 3HKFA 4P9HH 1NBVL 4R9HA 2X4UA 4I48B 1EJ6A 2FZ3B 3QNYB 1FAIL 1BGXL 2NY0D 5DUMH 1OAKH 3DVIA 1NFDA 4FQQB 5IFAL 4NNPL 4UILL 3PIQB 4XBGA 4DJMA 2GUOB 3AAZB 5FHAL 5CUSL 5F6IC 3BSZH 1EIBA 4KVCL 4PGEA 4DN3H 2HFFB 5DK2A 4NO5B 1QEWB 1VFAB 3NIDE 5D1XA 1BWWA 3PWNA 5B22A 4XCCH 1ACYL 2AERT 3UTSE 1UB6A 2RR3A 3NH7L 1YMMD 5E7BA 4Z18A 5DJXA 1KPRB 3VDBA 2AK1L 2BFVL 3WFEL 4V2BA 2X9YA 4POUB 2ZUYA 4OD3H 2WUCH 4KK5C 1S5HB 2Y6SD 1X6LA 1NC4A 2E27H 5C08B 3GJFK 4WW2C 5DI8B 1IAOA 5BQ7B 2PN5A 1G7QB 2Y25A 1YEGH 4MVBD 1I3VA 3H7BB 4AEIH 2ZJSH 3U36A 5J3HC 3IS1X 5J11B 4BQBA 2V9RA 2W9DH 4GXUM 2VDNH 3BH9B 3T65B 5FGCE 5GZNC 4LVOB 4OM0H 3LEVH 1C7SA 3U7AA 1HHKA 4PJ5D 2VLRA 3V95A 4KPHL 3WUZA 5HTSA 3A6CL 3MLYH 3MNZA 2M26A 1ERNA 1FNGB 2VO5A 3O3BB 1GGCH 4P5TA 1G0XA 3U9PL 5TDPB 4HC1H 1DN0B 3BKCL 3SDXA 1KLGA 2WIIA 1A1OA 4L1DA 4NC1E 4Z7WF 3SEPA 4WI5A 4JFPB 5K9JL 5C09D 4K94L 3U6RA 3MRDA 2CDFA 1SYSB 2VLJA 3PV6A 5I8CB 1TJHH 1WCQA 3QG7H 4JM4L 5F9AC 4CMMB 2JB6A 5IG7B 4J2XA 1XR8A 3TZVB 2R29H 1KJ2H 5MHSE 4S1QL 4KH2A 1V7MH 3C6LB 3WHXB 1U8NB 2FX9L 5IESL 1NLDH 2VZTA 5F7HA 4GMTL 1U91A 2HT4C 1NC2D 2IANE 4OFKA 3CDGB 5E8OA 1XCTA 2WV3A 3WO4B 3BAEL 3DHJA 2VQTA 3S5LA 3PL6A 4XB7A 2FJHA 4GH7B 3MNVB 4I18B 2EE6A 5DMIH 4XPBH 5FGRA 4MCYA 1X5IA 1MCWW 1DANU 2E7BA 5LBSL 5KANI 3RL2B 1EBAA 3MLXH 1X5FA 4OCYH 3MUGA 1U3JA 4L9LB 4LOUD 4J1UA 3IS0X 4YHNA 1G7HA 1CDHA 3MOBL 4HIEA 3D85D 1X5JA 2FCBA 3VE0B 4I3GA 1GIGH 4QF1B 3MRHB 5I1KH 1BHGA 4RGMC 5L8LB 5IHLB 5IMOB 4HKZA 1KGCE 3S35H 4EI6B 4OAWA 2NY2B 2C3WA 4P4KA 4D9RD 1VPOH 1C1EL 2CIKA 2J8OA 5C0BD 2VDOL 3GSOA 1CK0H 5E0QA 3VWJD 5I17B 3QBTB 4ONGL 4F80A 4X5XB 4LF3A 2OLDA 8FABB 1MLBA 1LMKA 4F57H 4G8IB 4R0LB 1MI5B 4BSVB 4RIRB 4YHYC 3DSFL 1CE1H 3Q6FB 5E95B 4DTGL 5HJ3B 5INCB 3NN8A 2YPKB 4QHLB 4DEPB 3K80A 1QG3A 2V2XA 4GG6A 2ADGA 1L7TL 4K23L 2BNQD 4G8FA 2R23B 4KKCD 1QFUH 1WFUA 3VRIA 1EUUA 1UYWL 1EEZA 1I7ZB 3D0LA 3DX6B 3MUZ1 4JFEA 2LE9A 1CI5A 1NCAH 5J6GB 4ISVB 5C92A 5HYFA 4XNQB 5D9SA 3D3VA 2MHAB 2NXYD 5KSAB 4XH2B 3WD5H 1MJUL 3KHOA 3MV9D 3PGDB 5C0DA 4I3SH 1JGUL 1AO7A 4I0KA 4OI9A 3EDKA 4YJZL 4EI5C 3HE6B 4MWFB 4D8PB 3FQWA 4PJAB 1ZANH 1CE6A 1A9EB 3MLWL 1FFPB 1FPTH 2PTVA 3L5JA 2N4IA 1E4KC 2EEBA 3QPXH 3K8LA 4WW2A 5KSUA 4KAQL 3LKOA 4ODVL 2I9LB 4ZFFA 1HIMH 1P5VA 4POZC 4U2ZA 1QSEB 3E3QE 3LQMA 1Q72H 1J8HB 1FH5H 1X44A 3DUUB 2Y06H 5IUSA 1UM5H 2H32A 3UTZA 4LSPH 4CVZA 4KFZC 3KPOA 3ZHLA 4KKLC 4ODXA 2DQUL 5C2UB 4GXVL 4K8RH 5BRZE 2V7NB 4X7CC 2F74B 1G84A 3BGMA 4NNXB 3QIWC 1I1FA 5MERA 3U82B 3NFSL 3MLSH 1DDHB 3Q6GL 2VDKL 1FZOA 3TIEA 3L7EB 1DQDL 2F5BH 4O9HH 3SE8H 3L3JA 1OP9A 3BKJL 4P59H 1URLA 2H1PH 5IFJB 4XC3L 4H1LH 1R3KB 1W0VA 3AXLA 3QXAA 4JFZL 3FONA 2C1OB 3U4BH 3BWUC 1DL7H 2ZUWA 3ARDD 4L3EA 3VXQB 5DMKB 4OUOA 5C0GB 5JW5A 3RIFK 4LCUA 3G6JA 5IB5B 4K71B 4H0GA 4XRCA 5F7UA 5C7XL 4C4KO 2X6MA 1N6VA 4D2NA 1DQQA 1T7YA 1IAII 5KS9A 2FX8H 4YDVB 1YPZA 4N5EC 3O2VH 5EN2B 5HYJD 4RX4A 4F7MA 2J88H 4LLWA 1FL3A 1X5XA 4NUJA 1A9BA 3GRWH 3EBAA 1Z5LA 1FORH 1CN4A 3HFML 3QUZD 1U41A 1NAKH 4X7SH 3KJ4B 5DS8B 5F7LB 3B3IA 4R6UA 2VITB 2FHCA 1XGYL 1F11B 4LSTL 5T5FL 3BRGC 2AJVH 2BVPA 3QPQC 1NJ9B 1YYLL 3VGAB 4JDZB 3JXAA 4G7YL 4G6FB 3FQUB 4YHPA 2RAMA 3ULVH 1VADB 3KPMB 3ARUA 3CFBA 4LIQH 3EYQD 2I24N 5EU6B 2CRIA 4OGXL 3OR7B 1E6JL 2OTWA 5IVXF 4GAFB 4HF5H 2DN7A 2DMKA 5L7XL 2FIRT 3HMXL 4FS0A 3KPSA 5LKNA 3U4AA 4E5XA 2DBLH 3BJ91 4XVSL 3FMGH 4F7PB 5I1HH 1A7OL 1YEFL 2XN9B 3H6JA 5JNYB 4R96B 3BP6B 5D1QD 4LSSL 3W0WB 1BZ9A 4KK6C 4LL9A 1Q0XL 2ED7A 2C1PB 5ILTH 2RQ8A 1RZGA 4UDTB 5IV2A 2P5WB 4P5KB 2LU4A 1YY8A 1OP5K 4GKNA 4UT9H 1MHEA 4EI5A 4FXGA 4OGYL 1MIMH 1KB5H 2C3GA 3ARBC 3U0TB 3BKML 3VXME 3O4LA 4IMLA 3IFPA 3RPKA 4U1LB 3RVTD 4AJ0A 2YUZA 1KJ2B 5JOPE 3CNKA 4UOW1 4X6CB 1E4KA 4ZPTA 1BJ1H 4GW1B 1DR9A 4RMRA 3ARYA 3MXWL 5K9QG 3BW9A 4J3WA 3O4OB 2IQ9H 3VH8G 1INQB 5EU5B 3DURB 2UUDK 1G6RH 4PRPA 3RWDA 2VAAB 2WSKA 3JTTB 1SBSH 1CGVA 5HHNB 3EJZC 4QT5B 5IQ7L 3HTLX 3JV5A 5SWSB 3VGEA 3IDMA 3LPWA 5CGTA 5E2UL 1QOKA 4Z7WA 1RZ7L 1UM6L 4UQ3B 3QIWA 2B2XL 4K9EC 1QYGL 1J5OL 4K3EL 2BSRA 3F7VB 3WFBH 1EDQA 2JJTA 4KUCF 3AU1B 2X4PA 3I84A 5HHXH 3QUXC 1BREA 3O9WA 4G6AC 1QSFE 5HYEA 1SY6A 1L0QA 1R3HA 4GAGH 3SCMC 3ZKNC 4XB8A 3CLFL 4UU9A 1ZHNB 4XCYA 1C08B 3LEYH 4LK4A 4LLQB 3F5WB 4YHIB 1CFVH 1Y6KR 3VFNA 3UTSD 3QUMH 4KHTH 4Y16B 3O2DL 3Q3GB 5I19L 1MCFA 5DQ9A 1DQLH 1RFDH 1S8DA 4L1HA 4XT1C 2ED9A 4YHLH 3KGRA 3MLRH 4QLRA 4NM4L 5D96C 4JFOB 4BZ1L 5I15L 3C5ZC 1EH9A 1JRHI 1OQXA 3E2HC 3GSVA 3MJ9A 1ZLSL 4ZNCD 4MSWA 2DI8A 3MGOB 4PFEA 4L4TA 2NY1C 2Y5TA 2UWEA 2GFBB 1WZ1H 4XCFL 4QWWC 1BJ8A 4F2MA 4H1LG 3PWUA 5HYQB 4HS6A 1S7TA 2HJLB 4PJXF 1AGEA 2D0GA 2YKLL 3U9UB 5JZ7D 3OKKB 3TNMB 3GMRA 3PWVA 5A2FA 5J13C 1I9IL 2KDGA 1P9MC 4FXKA 1QSVA 5ALCH 1OSPH 3X12B 4X8JA 1G7JB 5LJYH 1UVQA 4PLOB 4K3JL 4IIQA 2IH3A 3UTQA 2IMMA 3GMQA 4KZEL 3PABA 3SKOA 2A6DA 4RFNB 3FN0L 4PJDF 2J3SA 2BHYA 4UAOC 4KKAD 1YNTB 3QISA 5MHSD 1MJ7H 1U3YA 5JMRA 3OF6A 4XPFH 3C8HA 1PZ5B 2R8SL 1NEUA 5HI5D 1A0QH 3EDDA 4LCYA 4GS7C 2BNRA 4OJFL 4K3GA 3S37L 4AIZB 2RB8A 2EH8H 1NGYB 2IAND 5T1MB 3CK0L 3GHBL 4Z7OE 1LILA 3ARBA 2B5IB 3RHWK 2BMKB 3MOAH 4H1LB 3OXSA 2X4SA 1Z9OA 3DGGA 2BOCB 4Q6IB 4NGHH 1T4KA 4HQQL 3NFPB 4PJGE 4N8CH 2CR6A 1QFWI 4HMEA 1HQRB 1XGUA 2X7LB 3O3AB 3AREB 2X1QA 3RX7A 5GQBA 2GCYB 3RUGF 5I1JL 1A2YB 4WI4A 4KQ3H 4UT6L 1QNZL 4JRYA 4MAYC 5DD5H 1F3JA 2YUVA 4M9OA 3D3VE 3V6FB 4MJIA 1CDGA 1Q1JH 2L4OA 2DWDB 4YWGH 1KGCD 1AO7E 1KIQA 1XCQB 4MHHG 2HA1A 5D7SL 4AIOA 4EUPG 4YBLB 4Z7UB 4RAHA 4YHML 4OT1H 4HFUH 4X0KB 3ET9F 3HLAA 2YA2A 4LEOA 2APFA 5JPMA 3MJ7A 4YBQD 2IG2L 4Y19A 5TQ0L 4Q97A 3L3IB 1QFOA 4NN6B 2EIZB 1J0JA 3BPLC 3ISWA 1HSBB 4PJBF 3C6SA 5TE4H 3IXAA 3HZMA 1U8OB 4WI2A 3TT1L 3UJJL 4LGPB 4HHAB 5FEBA 3EYUH 3LS5L 4ZUTA 1N2RB 1HXMB 4F7EA 3VD9A 5MEPA 3SCMA 1FNAA 5DHYB 1FNFA 2P8MA 1X4ZA 4N0FB 4YDJB 5AG9A 3MV7A 2KBGA 1HILB 2XWBA 3VFRB 1GZQA 3QT2A 1AP2A 3VRJB 5HDQL 3EDJA 1NEZA 1KJ3L 2BNUB 2JIXB 1K85A 4UIMA 3NABH 2VR4A 4D0BB 4XP4H 1FL5A 2M8XA 2VRAA 4NN5B 4LNRA 4X6EA 4XNMA 1AXTL 1XH3A 1ODAA 3UJTL 4NFDA 1YEEH 4RFOH 4WEBL 2HAZA 2MPAH 3C5ZA 5FDWB 4X5LA 4EUPB 2DQCL 3RKPA 1BQLL 2G75B 4R26L 2GTWB 2W1NA 5EBGA 3HI5H 4Z0XB 2I9TA 2WWMD 4LSQH 5F6HJ 3KXFA 4R97C 3OAZH 4ONFL 1OGAA 1D5ZB 1GYAA 4ZAKA 3S97C 4Y8AA 3X17A 1F90H 3M8OL 5BRZD 5IVXA 1VGEL 2BVUA 5SWZB 5IMLB 9CGTA 5CIPA 3PP3H 1DQJB 1P9MA 1RHHA 2VISA 1IE5A 1QRKA 4YUEL 5KS9E 2UV3A 4CKVX 1YPZE 1CDIA 1UJ3B 2IPKA 3ARWA 3FN3A 1AC0A 4HWEL 3O8XD 2FRGP 5DURB 4UBDD 1NBYB 3U4EA 3QIBB 4TQEH 3SOBL 5HVHB 4V1DB 2D03L 4QTIH 4O02H 3HRZA 2LVEA 1FC1A 3BI9X 4HIHA 3RPIA 1TITA 4OCXH 4KI5F 4PJHF 2QSCH 5DHVA 4M6OL 1A7RH 1I8IB 3O3EA 5ETUA 3V0WH 4JY6B 3DX9A 1F4YH 2B1HH 1HKLL 3VFMA 3FQXB 1UZ6F 1KT2B 3HNTH 1LE5B 1DE4B 2VTFA 3GNML 4ZO7A 1PY9A 3ROOA 1WISA 3SJVA 4MD0B 4LHUA 4PS4L 1IT9L 5ADPH 3L1OH 4G8GA 4X4ME 2C4XA 32C2B 1A5FL 1ED3B 1NBVH 2C7UB 3EJJX 4JJ5A 3JZ7A 4MAYA 5DSCB 5DUBA 5HDLA 1FAIH 1BGXH 1C16A 3FB6A 4NQTA 1KYOJ 4NNPH 5IFAH 4UILH 2HVKA 3T1WA 2N7AA 4CU6A 4LMQE 2C3HA 5FHAH 5CUSH 5FIEA 4KVCH 5JQ6L 4QRRE 1IC1A 4J12A 1A1NB 4MCZB 2XZZA 5AD0A 3VXOB 5TPWH 3UYPA 5TDOA 2EKJA 3BIKA 2HJKA 3IGAB 3SDDC 1MJ8L 1ACYH 3NH7H 1YUHA 4JFQB 2ZZUT 5HPMA 5SV4A 2G2RB 2F54A 3FO1A 2AK1H 2NZ9D 1H5BB 2BFVH 3NCEB 1KJMA 1CS6A 3WFEH 3ILPB 4WI8A 3X13A 3ABZA 1NQBA 1MHHA 3VXRE 1AFVL 5DJ0A 4Y4KD 1JZ6A 4ORGA 4X4YA 5TFSL 3ZYIA 3VXMD 4KXZI 4HFWB 4I2XB 2VDQL 1QLRB 3AC0A 5JOPD 1H3WM 1WCBA 2WBWB 1A64A 4HLJA 1NUFA 3F58L 4KPHH 1TXKA 3WHE0 5BCAA 4U1IB 1F4HA 3A6CH 4HUWB 3T09A 2F53A 4IJ3B 4EIZC 5KTEL 4RZCB 3DYMA 4QXWA 1VERA 4OF3A 2IPUG 3U9PH 4R7NA 5GGSA 4PJXA 3MRMA 1UH4A 1MCLA 5DVLA 3BKCH 3HR5B 4Y4FD 3PWPB 3NZHL 5BJTA 5K9JH 4GLRH 4K94H 1NCTA 4CW1B 4C56B 3CDYA 5HHOE 3A0OA 1CLOL 4JM4H 4PJFE 3RDTD 3TN0C 3MLVL 2JF1A 4NQDE 2Q6WA 4S1QH 3D85B 1FIGL 1MJJB 1QVOB 3AMLA 3MV8E 1P7QA 3RVVC 4BFBD 2XZAL 1VFBB 2FX9H 5E94A 5IESH 3K46A 4PJDA 1BJ1J 2P8LA 5ICXA 1GGTA 3HC3L 1FAKT 1JIBA 1RZKC 4L29A 5A16B 4GMTH 2GSIB 3FB5A 4OIIL 1QSFD 2NXZB 2UYLA 3OGOE 5C0BB 1KTLA 2X70A 4QEGA 3BAEH 2UWEE 2W0FA 3VWJB 3MBEB 4QHNA 1MY5A 3HPJB 3QXUA 1UQSB 3KJ6L 4ZOCA 5GHWL 2YD8A 1J05B 2AXFB 4W4NA 5LBSH 1GVIA 4O2FB 5IB3A 3MFFA 3GI8L 2RFXB 3LN5B 2VN4A 1KIRA 2H2SD 1RJCA 3UTPD 3K4DA 3MOBH 3BHBA 2JCCF 4TVPE 1F4XL 5D7KE 4RGOL 1FG2A 3LHPH 3GI9L 4PUBL 3RUGA 1IC4L 3A6BL 1KTDA 3ZKXC 2FYYB 3H9SA 4PJ7F 2XG5A 4OCMC 1C1EH 1UB5A 5H35A 2AJYL 1YDPA 3JTSA 4NBZB 3GJEA 2VDOH 3VXNA 2XKNA 3K2UL 2NQCA 2BK8A 4JQVC 4ONGH 5SX5K 4AMKL 3O6KL 1YEDB 1AR1D 5D2NB 3MRCA 3CU1A 5FA4A 1SY6L 4DTGH 1SEBB 1TZIB 1SJHB 2BNRE 3UPAA 5JLZA 3WSQL 2D0HA 1T03L 1X9QA 1L7TH 4K23H 4LQFL 4X5WB 5C0IB 1UYWH 4PJBA 1VHPA 3PL6D 3QRFM 2EIEA 1WZMA 2XT1B 5JDJA 3ULUF 1ETZA 4HPOL 4PJIF 3VFSB 1FV1B 1MJUH 4Z77A 2NY6D 2QR0A 1JGUH 3SDDA 2D7NA 5BO1L 1WC7A 5E9DA 3H8NA 3CFIC 1NAMA 4KC3B 1EO8L 1F4WL 4JRYE 3R0NA 3MLWH 4AQ1B 5JXED 3KYMB 3LPFA 3MJ9L 4M1DL 3IDXL 2BCKB 5FAAA 1G7PA 4KAQH 2X05A 3DO3A 4FFVD 1WGOA 4G42A 4ODVH 4P46B 3QQ4A 5T33L 1WBZB 1MHPL 2NPLX 4ODUB 2K3TA 2V2TB 3DIFA 4P49A 5ID1A 4R4BA 3TT3L 1ORQA 4Y19E 2BY1A 5TQ2L 3FOLB 3ORJA 3WS3A 2NX5B 4N90E 2BC4A 2DOCA 1MQ8A 2JELL 2DQUH 1Q9LB 4NQCA 3VI3E 4TVPL 4GXVH 2LU3A 3P11L 4QHMA 3N50A 4OUUB 5T1LA 3FO2A 3EAKA 3NFSH 4ZYKB 3Q6GH 1IARB 4WI7A 5C6PB 2VDKH 4PRIB 1DQDH 1HH6B 4TN9A 4KK9C 3D3VD 1IBGL 2AKRA 3FCTB 3BKJH 3TP4A 1R5VB 3KPPA 1D7FA 2A77L 1INDL 1AO7D 3W9EB 4XC3H 4H5SA 3GMMB 4DVRL 1KXQE 4QCIA 4JFZH 3TN0A 4H20L 1MCNA 2DM7A 2YOCA 1DBJL 1F6AB 3IJYB 2MWCA 4PJ9B 4AT6A 2YD2A 4LBEB 2IADB 3BP7A 4Z7VE 1U3HC 2OZ4A 2HVJB 3NCYP 4ELME 2AABL 2YSSA 5L8JB 3CXHJ 3TPKA 4PJHA 5C7XH 2XY2A 3MREB 4ZODA 3X3FL 4OZGB 2NY3B 1JE6A 4LLMA 1XF4B 4DUVA 4JHAL 4X9GA 1K4CA 3R4DA 4XMKL 4P3DB 2IC2A 2EKSA 2UZIL 1S9XB 3KXFE 3OKOA 3O0RL 2IMNA 4OCLC 4QHKI 5DYOA 5ICYB 4EN3B 4EJ1C 1H8NA 3D69B 5KZCD 5IVXE 2Z92B 3HFMH 4HEPG 5I1DB 3TVMC 1QBBA 3IDJA 4B7LA 3LEXA 5D1QB 3BZEA 3O3DB 1XGYH 1FJ1A 4LSTH 5T5FH 4WWID 1YYLH 3FHQA 2Z35B 5FV2A 3P4NA 4IOIA 3W5MA 1AH1A 3FZUD 4G7YH 5CP7B 4K9EL 3WV0A 3Q2CA 2VZUA 5LAXB 1KCUH 3TBWB 1GGYA 1IGIL 5TE6L 2O61A 1G0YR 2P46B 1HOCA 2JLLA 4MD5B 4JQVA 1T0MB 4O2CB 2EE3A 4OGXH 1E6JH 2GJZB 5MENB 5L7XH 3HMXH 1EEYB 4TSAL 2AAVA 2G60L 3HB3D 4XVSH 5DTFA 3P2TA 4JLRA 3ULUC 1KNOA 1E6OL 1A7OH 1YEFH 3MO1A 2DIJA 4KY1L 4YBHA 5GGRB 4KRMB 1R24A 2ZSWA 1FNEB 5GGSY 4JKWA 1ZAGA 5BVPL 4LSSH 2BVOA 1Q0XH 1I85C 4BFIA 1ZK9A 3VXPB 3MGTA 4NO2A 4YFDB 4K3DL 3K7UA 1UH2A 5CZKA 5EUKA 3BGFC 4PGBB 1FSKC 4OGYH 35C8L 3BKMH 3HS0B 3QUKB 3G04A 5DJ2B 5EA0L 2QL1A 1QBLL 3GMPA 1FVDA 1HHJA 2CUMA 4C4KT 2ZOKA 5EO0A 4JO4L 3CD4A 3ES6B 3ROLA 4NQXA 4Y2DA 3RVUC 5ID0B 3MYZA 2DQFA 1ZGLB 3VFTA 3VD4A 2OR9L 1K5NA 1A21A 4XNXL 3BH8A 4DVBB 2XQBL 3RY6C 1VKXB 1MELA 5F3BB 1VENA 4RFEB 4P2QB 5ERWB 1LEGA 3VXSE 5IQ7H 1T1ZB 3B6SA 3CC5A 3KPSD 5I66A 5E2UH 4ETYA 2WIMA 3QJFB 1RZ7H 1UM6H 1CD8A 2B2XH 5E8NA 1QYGH 1J5OH 4K3EH 4OZHF 1HK6A 3TJHD 1T04B 2VLLB 2E7MA 4YO0A 2VXVL 2CPCA 5EC2B 4R7DA 2IEPA 3CCHB 4XHJC 2FH6A 1RI8A 1S7VA 3EHBC 2YPLA 3QFJB 5JPNA 1NGXA 4O58L 4MQ7B 4QRRD 2DMCA 5B3JF 2HT3C 2HN7A 1NUGA 1I1AB 3CLFH 4WTZG 5DJ8B 3TJEL 1B3JA 3TO2A 4XXDB 4LVOC 4X4XB 2ADJA 3KPNB 3C5JA 3DROA 4HXBL 3N85L 1U3HA 1R3LA 3O2DH 2MQ3A 1AD0A 1A7BA 3DX8B 5I19H 1A6PA 5D93C 4AK1A 5CBEB 3F62A 5EOCL 4POZD 4FQCL 4N9GB 4JFXB 3HPLB 2EDWA 1S7QB 4NM4H 3VXRD 2R69L 4BZ1H 1FYTA 5I15H 1RU9L 5FO7B 2WMPA 3U0PB 4Q2ZB 2JCCA 1H3PL 2LAGB 3RP1A 1ZLSH 3T4AA 2Z93B 3RWFA 3PGCB 2V7HA 4JHWL 5KAQF 3TZVC 2DM3A 5K9OB 2MJWA 3GMLB 2EDKA 3C6LC 4XCFH 3RWHB 3ZMRA 1PSKL 4PPTA 4FFWC 3TVMA 2B0SL 2YXFA 1KCLA 4E42A 3EO0B 4PJ7A 2R0ZL 5JW3L 5FCSH 5DVNA 4MGXA 2H8PA 2YKLH 3NTCL 4PLJC 1BF2A 1WQVT 4ZTPL 3VGBA 1ZT1A 1I9IH 2C9AA 2D31A 5KG9A 4WHTB 2P5EB 4Y5XB 5C0CE 4OD1H 4BYHA 4K3JH 4JAMB 4PY8J 1CQKA 4NKDA 1NFIB 5HGAA 3ALWA 4ZQKB 5HHOD 2W92A 4KZEH 4Q9RL 2I5YL 4NO0A 3FN0H 4EKXA 5I8EA 4CVUA 4BSWB 4NQDD 2AI0L 5ANMA 1HN1A 4G9FB 3MV8D 5T3ZL 4JRXB 2R8SH 3RZCB 1CG9B 3PP4L 4J3XA 4AENB 4N5ED 1T1YA 4OJFH 4HWUA 3S37H 4U33A 2IBZY 4NYLA 3TYGL 3CFDA 3CSYA 4HXAL 3LKNA 4HZAA 3CK0H 3GHBH 5D5MF 4YH6A 1DVFC 2AK4B 1AQDA 43CAB 1ZSDA 4NC0B 2DRUA 3QNZB 4HT1L 2FZ3A 3QNYA 4R0LC 3DRTA 2HLAB 4HQQH 4FQQA 3TFKC 1E4XL 3LOWA 1TJGL 1I1YB 1FGVL 3A6OA 3QPQD 3UBXI 3U46B 2GUOA 5C6TL 3BP5B 4JJHA 5I1JH 4WFEE 5IKCA 4UT6H 4QTHB 4TVPD 1B0WA 1QNZH 3RY6A 4PJBE 4FQJL 4HW6A 5A2LH 1RZJC 4HDIA 5D7KD 3WLBA 1VFAA 3KVQA 1JPGA 4ODWB 5L0QB 4LPXA 4KTYA 5I1EL 2WUBL 1P4LB 4IOSD 3TBSB 1XAUA 5D7SH 4GOSA 4ONHA 2W07A 2Z4QA 3HE6C 4YHMH 4XX1G 3CVIL 3MACL 1AHWC 2D7OA 3SKNB 3O6LL 1CDYA 2IG2H 3RTQC 5TQ0H 2HMIC 5IQ9A 4KK6D 1T6VN 2QSTA 5C08A 2BNRD 5DMGC 1O0VA 3TT1H 5DI8A 5BQ7A 3UJJH 3RFZC 2EE9A 4E41B 5KSBE 1UFUA 3LS5H 3LAFA 3NPSB 2FJFB 4ZNEA 4OQTA 3ZHDA 1EHNA 1HXYB 3ZTJH 1WEJL 4XBPB 1FLTX 1QRNE 1J88A 4PYGA 3WFDL 4KJQD 3FO9B 3OKYA 1JI1A 3Q1SL 2FJGB 4HK0A 4NFBA 1D9KB 5HDQH 3P73B 5IM7A 5HGHB 1KJ3H 15C8L 2QKIA 4I3RL 3SQOL 2WLYA 3OAYK 4PJEF 2NR6C 4Y1AE 2HFTA 3O3BA 3D25A 4X83A 7FABL 1AXTH 4JRYD 3REWB 3UJTH 1DN0A 2OJEB 4PJ8A 1CGWA 4WEBH 3RI5K 5EIIA 4JFPA 5I73B 3O8XB 4U3XA 1TVBB 5F9WC 2DQCH 5IF0A 1SYSA 1BQLH 3EJZD 2FEEL 2OM5A 4R26H 4CMMA 1IVLA 3PHOB 4G7VL 5IG7A 3TZVA 3IFLL 2BERA 4F8QA 1MIEL 3EYVA 4YQXL 5BS0A 3C6LA 3CXHK 2UZYB 3WHXA 3WNKA 3MJGX 1SJEA 5MEOB 4Y19D 4JREB 4EZMA 3EO1A 3VRLE 3QUXD 3M8OH 5CKAA 3UROR 4G6AD 1VGEH 5H8DA 2A74A 3HAEG 1YNKL 3RRQA 3T2QA 5IR1B 2X42A 5KJRL 3SCMD 2V17L 3MNVA 5L88L 3QA3A 1UJTA 2IPUK 3RL2A 1UZ6E 2J6EA 4I5BB 3MRBA 3SOBH 1NAML 1CIDA 2D03H 4HV8B 5EU7C 4ZD3L 1R5IA 4A2MA 3MA7B 5ESVB 3W2DL 3R06A 3IU3B 4HLZH 5KVMC 4M6OH 4N1HB 1LP9E 2LABA 4M3JA 3UDWC 4AM0A 3PF2A 3H2WA 3VWKC 2A83A 5EPMA 3C5ZD 4G6ML 5FYKE 3VGAC 5C0JB 1DSFL 4EI6A 1HKLH 2IF7A 1I1RA 4ZO9A 1OWWA 2KZWA 1CGSL 1PYWB 3L3HB 4MDJB 3MYJA 1D6EB 2R1YB 4DUXA 2H32H 1E4WL 2NY1D 4GW4A 5I17A 2VSCA 1DVFA 3GKZA 1NDGB 4X5XA 3FQTA 8FABA 4QWWD 5H94B 3GNMH 1T22B 4G8IA 1MI5A 1OGTB 4P3CL 4IRSB 3Q6FA 3KXFD 5HJ3A 2YPKA 4U1GB 4PR5A 3HAEB 3KYOB 4PS4H 1IT9H 4LLYA 3V0AC 4WWKD 2R23A 5I1IL 2ED8A 1A5FH 2AEPL 4WO4B 1IEAB 3DX6A 4PY7A 5F1OB 4ISVA 4O51B 2F8VA 4XNQA 4ZUSA 1XZ0B 2FIKB 1TTUA 1ZHBA 4HJJL 1CD9B 2ZSVB 1K8IA 2HG5A 3PWLA 4NRXB 5HI3C 4OZHA 1CLYL 2Z8VC 2DIBA 2AW2A 1R3JB 1AHWA 5CJQL 3ZDYE 1P53A 1RZKL 4OLZL 2FECL 3RTQA 2X4UB 2OZ4L 5E4EC 4Y5VC 1BQSA 1NFDB 2ENYA 4XPGL 1RMFL 1TVHA 4XBGB 5E8EB 2J8UF 3O4OC 3GSNA 3C8KB 2C26A 4YC2C 1J8HA 1G9EA 2OJZL 2ATKB 5D1XB 1W8OA 3PWNB 3MCKA 1AFVH 2PXYC 2E9WA 4HEME 1UB6B 4LHUD 1HYSD 2F74A 5TFSH 2GAZA 4UB0L 3KNBB 4G8GD 5HYSA 1T89C 5E24E 4EEEA 4PRAA 2VDQH 2GHWB 2OS7A 3ESUF 4HBCL 2MTPA 1NC4B 2QSQA 3LKPB 3F58H 1IAOB 5IFJA 2ZPKL 1A6UL 5KTEH 3L5WA 4J6RL 2YPLE 3U36B 5J89A 3V6OC 3BQUC 3VG0L 3S5LG 1J12A 3VXQA 3VXSD 2VLRB 1CLOH 2DLFL 1F42A 3MNZB 4JFFA 3VI4E 3MLVH 5J06A 1I9JL 4P5TB 1FIGH 1WSST 4WHCA 3F12A 5F7NC 2XZAH 3BUYA 3SDXB 1KLGB 2WIIB 1A1OB 3BJLA 3HC3H 1T80A 1FVEA 5E2JA 1FYTE 3U6RB 5T3ZD 1B90A 2CDFB 3MRDB 4OIIH 1CFSA 2VLJB 3BFOA 3PV6B 2HKHL 4U0QB 4UDUA 2QHRL 2JB6B 1OTUC 1XR8B 1AY1L 1WZKA 1Z0MA 4U7SA 2DM4A 3KJ6H 5GHWH 4OF8A 5FUCE 2V5RA 2VB5A 5D5MA 3UDWA 3VWKA 3GI8H 4MNHA 2VLKE 3FQUA 3HR6A 1RUML 2F53D 3H0TB 5E8OB 1XCTB 3ARGC 5IJVB 2ESVA 2R0WL 1K6QL 1F4XH 1V3LA 3NA9L 4RGOH 5C2BL 3GI9H 1DTUA 4PUBH 1CGUA 2EYTB 1IC4H 3K4AA 4MCYB 2B39A 4LFHD 2NY5C 2GK2A 3A6BH 4RFNC 5KW9L 2BRRL 2AJYH 4J1UB 5JDSB 3G08A 1G7HB 4HIEB 1F97A 4R96A 3QQNA 4AMKH 5IIEA 5KVEL 3O6KH 2YBRB 1P7QD 2C1PA 2MKWA 4HBQA 4P5KA 4PGJA 4HKZB 4HLZG 3WSQH 3ZDXF 1T03H 4NIKB 4P4KB 4LQFH 2CIKB 3U0TA 2B5IC 3GSOB 3Q5TA 1GAFL 1CTNA 4LF3B 5C0CD 2Y7QA 4HPOH 1MLBB 4Q6IC 3DV6B 1CDCA 2AV7B 1LO4L 4Y5VA 1QLEL 1HWGB 4X6CA 4GW1A 1EO5A 3NN8B 5ENWA 3AREC 5BO1H 5D7LA 4ZS6C 2V2XB 4GG6B 2FB4L 2ADGB 5F6IB 3WJJC 5C9KA 1FNSL 5IBUG 1IMHC 1EO8H 3VRIB 4NKMB 4HUVA 5EOQL 3D0LB 1F4WH 1PG7L 4JFEB 4TSBL 3N1QC 1G6VK 1A7QL 2DLTA 5IMKB 5D9SB 4QY8A 3OR6A 4EDWL 4PJEA 3MJ9H 4M1DH 3IDXH 5C0DB 2R2HB 1RZFL 3BEWA 3FRUB 2PXYA 3U1SL 4XNUL 4G6JL 4YBLC 2CQVA 3H9SD 2IQAA 5T33H 1MHPH 1T89A 2VXQL 5EBLB 3FQWB 3AU1A 4Y7MA 3TT3H 4NN6C 1CE6B 5TQ2H 1N64L 4U1KA 2CLVA 1ZTXL 2JELH 5C08E 5C3TA 4TVPH 4HGKC 1N0XL 3FB8A 3C9NB 3LKOB 3P11H 4M7ZC 4UV4L 2VMFA 3B5HA 4A2LA 5LGJA 2D7MA 4ZFFB 2ZNWA 4WFED 3O11A 4BK5A 4ZNEE 1SVCP 4YXLL 3HI1B 4EDXB 2EDDA 1ZHNA 3BQUA 4LLQA 1IBGH 3UTZB 4J4PC 3KPOB 3ULUL 1INDH 4AG4L 4M48L 4ODXB 3QUYA 3MV11 1V7NL 4PRNB 1JYNA 3Q3GA 2W9LA 4DVRH 5IBUB 4Q9BA 5D4QA 4H20H 5IB2A 3HRPA 1I1FB 1AGBB 1DBJH 1YA5A 4NN5C 4U3CA 5MERB 3UYOD 4P2OD 3BP4A 4J7RA 5HGGS 5FB8A 1FZOB 3TIEB 4JFOA 1G7IA 5HD8C 2VDPL 4I13B 4KROC 1OAQL 4YGVA 4WHYG 3QDMB 2AABH 1A6AA 1W0VB 3QXAB 1L0YA 3X3FH 2GFBA 4X6BB 5GRUL 1QRND 4XMKH 5HYQA 2HJLA 2UZIH 4L3EB 2YUWA 1FN4A 3D5OF 2NLJB 4WFFD 2ZUQC 3QR2A 5IK3A 3O0RH 5JW5B 4LCUB 3G6JB 1QSZA 3U9UA 4XRCB 1BX2A 3TNMA 3OHXA 3DYPA 5T1LD 4YK4B 3ARGA 1IGFL 4N0UA 4KWUA 1DQQB 4LNVA 4DZBB 1MVUA 3X12A 4LP5A 1LD9A 1RD6A 3SGDI 3QIBC 4LLWB 4URTB 3ZE0F 5HVHC 1FL3B 4L9DA 4K9EH 1PX3A 2I25N 1IGIH 2Z0BA 3MLTA 5E6IC 3STZA 1Z5LB 3FFDA 3QRGL 5CD3A 1RQ5A 3RJQB 1B6DA 1RULL 1K9TA 4GO6B 2Q1EA 3B3IB 3MJ6A 4HS8L 1EV2E 2BVPB 4TSAH 1D5IL 2G60H 4L8SA 4OQTL 4LCIL 4HGMA 3RIAF 4YHPB 4Y89A 1E6OH 4KY1H 5CEYA 4KGJA 2BMKA 3CFBB 5HBBA 5BVPH 1CD1A 4IMKA 4KRPC 1EJOL 2BOCA 3ZSSA 5I75C 4Q6IA 1MI5E 3P9WB 4YHYB 2EIBA 4WFGE 3I85A 3DRQB 1HQRA 5IWLC 2YD1A 1KCKA 2WAHA 3KPSB 3AREA 3O3AA 4K3DH 3SDCC 3VFOA 4DCQA 2NY4B 2GSGA 3QIUA 4GRWF 35C8H 1A2YA 4NT6A 3WJJA 1LDSA 5D2LF 4RMUA 1JHKL 2PTTA 5EA0H 2PTUA 1QBLH 3B8SA 3O6ML 4IBLT 2PYFA 1UT9A 2UY7A 2E3VA 1RZGB 3EJYD 4PJCF 5FYKD 5IV2B 5K59E 4Z7UA 4GKNB 5CHNA 4ETQB 2OR9H 4EI5B 4XNXH 2XQBH 1EZVY 3CLEL 5DJCB 3O4LB 4KKBC 5LXGL 4IMLB 3IFPB 4PJAE 1U95B 4HUUA 1OP3K 2V2WA 4HG4J 1HSBA 3KYNA 3ARFB 3OWEA 2H6PA 4Y88A 4HHAA 3BPNB 5B3JE 5CIPH 2DL9A 3LSOA 4HWZA 5DJAA 1SJVA 1BIIA 3BW9B 2WANA 1HXMA 1HSAB 2B1AL 1H5BC 4DKFL 1RK0A 1QSEE 4PRPB 5D8JL 4JRWA 1J8HE 2HYMA 5IBLD 2RIKA 3TA3A 3A67L 2H26A 2J6EL 2BHZA 2VXVH 3L7FA 1HILA 1U8JA 4J4PA 4QRTB 4B41A 3VRJA 3SPVA 3JBG7 4DAGL 2BNUA 4ELKA 4DOHB 4RWYL 1X3DA 3IDMB 4D0BA 5F7KC 4Z7WB 1OOAA 1TTFA 4O58H 3QHFL 5DHVH 1DUYB 3QIWB 4R8WL 5TF1L 4OFYA 3OXRA 2BSRB 3QQ9C 3AROA 2E9IA 1PLGL 3TJEH 1OY3B 5EOTA 4HUMB 4FQ2L 3IF1A 1NCWL 4HXBH 5FDWA 4PB0L 4EUPA 4GUPA 1LO5B 1SQ2N 1QFHA 3O9WB 2YUXA 3QCTL 4IJ3C 3KS0H 1R3HB 3QFDA 1W8NA 5EOCH 4FQCH 3CDFA 4UU9B 3O6FA 4XCYB 1X5YA 2R69H 3GK8H 3SDAB 3MFGB 3B9KD 1RU9H 1D5ZA 1KXVC 3VFNB 1G0DA 1H3PH 1MF2L 4HKJA 3SKMB 4JHWH 1SVZA 4HWBA 3FN9A 1RZJL 5SWZA 3TH2T 2CK0L 3IDUA 2B0SH 3ARSA 2A38A 5ELIA 2R0ZH 2GTZB 5JW3H 5DMJB 1YNLL 4FG6C 3HUJF 5F9JB 4YIQB 2CSPA 3NTCH 1H8OA 1K2DA 3QIBA 2NXZC 4HMCA 3GSVB 4GQ9L 4RMSA 4V1DA 4ZTPH 3T1FA 4L4TB 1EEUA 2YPLD 5E6IA 1KCRL 5EU7E 1CICC 5HI4D 3UZVB 3S96A 4YNYB 3RNKA 4RA3A 3PWUB 1S7TB 1CFQA 2DICA 4JVPA 4MQSB 4NQUA 4Q9RH 1OARL 1U3HD 2I5YH 1CYGA 1H3VA 3L5HA 3FQXA 1MCBA 4LPCA 1JPTL 4ZXBB 2AI0H 4ONOA 2Q87A 3PWVB 2PF6A 2GT9A 4JZNA 2IBZX 4X6DF 5EU6E 5T3ZH 3BZ4A 3FT2A 3PP4H 3GKWL 4X8JB 1UVQB 3B9DA 4OKDA 1FYTD 4KV5F 1ZVYA 4IIQB 2IH3B 3FT4A 5EIQA 1Y0LA 5IWLA 3PABB 3SKOB 3SDCA 1XGTA 2A6DB 4HXAH 3DVNB 2XN9E 4M1CC 1FE8L 5D70L 1IGJB 3TVMD 4HT1H 3NIGF 5DSCA 5D2NC 4TRPL 3W0WE 4LCYB 1E4XH 5D7JD 1ZV5A 1TJGH 1FGVH 1F6FB 4YX2L 3MRKA 2P5WE 5IHZA 5C6TH 5KSVA 2X2YA 4W68A 3SE3C 2X41A 3EFDL 3ARBB 3ARTA 4FQJH 2X4SB 1R0AL 3BN9C 3JV4A 5I1AB 4KRNA 5I1EH 4PRHA 2WUBH 1XIWB 4X6CE 2N1KA 3BD4A 1XGUB 4K2UL 3CVIH 3MACH 1NEZG 1OT2A 4JHZA 3DMMD 1H5BA 4JG1L 3O6LH 2CDGA 2QQKL 3IDNA 1TNMA 1NCBL 4P3WA 4HH9A 1F3JB 4HJGA 3EO9L 2X4TB 4MJIB 5IHBA 3VXTA 2YZ8A 4U6HA 3QDGA 3TYFA 1KIQB 5E08L 5SWSE 2HWZL 4H8WH 1VEOA 2APBA 3OKLB 1BWMA 4M6ML 1WEJH 4LEOB 4I2XA 3GO1L 5JPMB 1QLRA 3MJ7B 3WFDH 5F21B 3EFFA 2CIIA 3Q1SH 5JA8B 5B3NA 2VC2H 2ZCLL 2D4DA 15C8H 4I3RH 2ZUXA 3SQOH 3X11B 3RVUD 4KJWC 4RZCA 3PDOB 3OAUL 5IT2L 7FABH 4F7EB 5MEPB 4XCEB 1OAUL 4CN4A 5CFHA 3V6OE 3PWPA 3MV7B 1KLUA 1IGYA 4C56A 1GZQB 3CVHA 1AP2B 2YC1B 2YA0A 4Q9QL 4XI5D 1NEZB 1FZMA 2NZIA 4D0CA 1EAJA 4G7VH 5CEZL 4LLUA 4UIMB 5F44A 3IFLH 1J87A 1LO0L 4PRDB 3TPUB 1MIEH 2WBJC 4YQXH 4PJ9C 4LNRB 4X6EB 5EULV 4XNMB 3OKMA 1PX4A 1XH3B 4NQEA 2EXYD 3ZYJA 4CVXB 2QEJA 1BAFL 1IAIM 2GQHA 3C5ZB 5C08D 1H3UA 3E2HB 4E9LA 4U1SB 2WW8A 3DYOA 1T2XA 1GC1C 1VEMA 5LCVL 1YNKH 2EYSA 5TDNA 2A2QT 2P4AB 2UY6A 5KJRH 5HHVL 1CICA 1IQWL 2V17H 5DEFA 2I9TB 4N68A 3UO1L 5L88H 2IH1B 1Q9OA 4XP9L 5J4MA 1LDPL 4Q74A 1OGAB 1A7NL 4HAGA 4U1JA 4ZAKB 2RFXA 1NAMH 5H2BA 1RUKL 4ZD3H 1KOAA 1LEIA 3ZDZE 1M4KA 2X40A 3VG9C 3W2DH 5J13B 2FO1A 5CIPB 1MQKL 1RHHB 2VISB 2X1OA 5KN5A 3LN4B 1U2CA 3SKUD 2EDOA 4GKOA 2QADC 3WIIL 4RGNB 2IPKB 5DUPL 5KVFL 1CLCA 4G6MH 5D2LA 1DSFH 4JKKA 3U4EB 2FYYA 4OQ1A 1CGSH 3EOTL 4TTGA 3P30L 3TZVD 1E4WH 4HIHB 3C6LD 3D18A 5DHVB 2NNAA 4P3CH 2HP4A 1SEBA 1P7KB 4MD4A 4GS7B 4KJPC 2Q8AL 3DX9B 4GBXB 4NCC1 4PLJD 1T1WB 5DF0A 2EDRA 1OWRM 4NUGL 5AWNL 3QWQB 5I1IH 5JR1L 4BQCA 2AEPH 3X3GL 3WO3B 2Z31B 3KYKL 3P0YL 3ZL4L 4PTUA 1UKTA 1Q9WA 3ZKQD 3F7YA 2C4FT 4HJJH 1IEBA 1I1CA 5C07B 3ROOB 1WFNA 3SJVB 2YEZA 1OT1A 1YJDH 1G7MB 3HMWL 4HMDA 1CLYH 4G8GB 3CX5J 5FCUL 4YZFE 5CJQH 4L8BA 5L8KB 4JJ5B 1RZKH 4OLZH 5F7YC 4MAYB 1RIHL 1ZT4A 2OZ4H 4JB9L 4P23B 5DUBB 3FB6B 2HJFA 3T3PE 2BCKA 5F96L 1L6XA 1KENL 4XPGH 1RMFH 2HVKB 4FTVB 4U1NB 4NJ9L 4Z7UE 3ARPA 1F45A 3D0VB 4KQ4L 2O5YL 2VYRE 4MLSA 5ACMA 2OJZH 5AD0B 3FOLA 1ONQB 1JMXA 1OAYL 2XNAA 3QCUL 1MI5D 3BPLB 5EU4B 2WP3T 3TFKD 3I02B 4WFGD 1Q9LA 1HHGA 4XWGL 1JYVA 2E9BA 4LFHG 5HPMB 3HZYB 1IKNC 3MV01 4UB0H 3UBXG 2P1YA 2F54B 3FO1B 2HFEA 2CRZA 3O45A 1KJMB 1S7RA 3R8QA 3WFCL 4PRIA 1QLFA 1HH6A 1K3IA 4HBCH 5TF0A 2NY5L 3FCTA 5KSAD 5HGDB 1BVKA 3QDAA 3W9EA 2ZPKH 1A6UH 4TVSa 3UP1A 1YEIL 4CRPA 1IQDA 3NACH 3HE6D 4ORGB 4X4YB 4HSQA 4J6RH 1P4IL 2WBJA 3VG0H 1WT5C 3L5XL 2IADA 2HMID 3MA9L 2XA3A 4FNLL 2HVJA 4OFIA 3LY6A 4IRZL 5DMGD 2DLFH 4OLUL 3AFLA 1FYHB 3V4UL 1SMOA 2F53B 3TESA 4JDVA 1I9JH 3MREA 3L3KB 4G6KL 4JKLA 1QSED 4R7NB 4PJXB 2LAAA 3MRMB 1SM3L 5DO2C 1J8HD 3S3SA 5BJTB 5GJSL 4R97B 3G9VA 4P9ML 4M8QA 5F7DA 1OP5H 2CMRL 5I9QB 3UBXB 1LHZA 2Q7YA 1T5XB 2QHRH 1ZVSB 2NR6D 1IKFL 1AY1H 1Z9LA 4NQVA 1QFPA 1MCRA 1M7IB 5SWZE 1NANH 3MR9B 3VJ6A 1P7QB 3T2NL 5E94B 1A4KA 4PJDB 4L29B 5GRWA 1TCMA 2Z35A 1GGIL 4EXPX 5CP7A 1A02N 1RUMH 2FH8A 4V1DE 4C83A 2UUDH 1KTLB 2X70B 1T0MA 2W0FB 2R0WH 1S3KL 1K6QH 2AEWA 4QHNB 4ZUWB 3NA9H 4LRNL 5C2BH 4AEEA 4FQXA 1X6NA 4UOJA 4LRIC 3OG4B 5D72L 4U2YA 1KIRB 3P0GB 2BRRH 3MJ8A 3K8KA 4JFFD 1BOYA 4I8DA 4LHQB 2APWA 5GGRA 3BHBB 5AYUL 1SMAA 5KVEH 4MA8L 3RZCC 1FGNL 1YZZA 1FG2B 2PO6C 3NMEA 3RUGB 3VXPA 1XT5A 4KMTL 4QHUA 3OSKA 3H9SB 1BP3B 4PB9L 5EOCJ 1QFWM 4PGBA 4OIBA 2BJML 1JV5B 1MAML 1YDPB 3JTSB 3GJEB 3VXNB 3VW3L 3B5TA 2XKNB 5DJ2A 1GAFH 3GHEL 1HH9B 4MXWL 4P99A 2Q3ZA 2BDNL 3MRCB 3V5KA 3PGFL 1QLEH 2Q86A 1P1ZB 5ID0A 4GRMB 5C1MB 5JLZB 4G6FD 1FNSH 1ZGLP 2VUYA 5EOQH 1PG7H 4TSBH 1T0NB 5EU6D 1A7QH 1P6FA 1ETZB 4RFEA 3QAZB 4EDWH 4OLYL 4P2QA 5ERWA 2QR0B 1I9EA 1RZFH 5A2KH 3CIQA 4TPRL 3SDDB 3U1SH 4XNUH 4G6JH 3I3EA 1WC7B 5E9DB 1T83C 1EMTL 3UCRA 3QJFA 1IKNA 5F1NB 2OL3A 2Z9TA 5T1KA 2XN9D 2WNGA 1NAMB 4DK6A 4LPYA 2VXQH 2M2DA 1J9CT 3LQAC 1GOHA 1T04A 2VLLA 3W0WD 4LCWA 1N64H 1ZTXH 2XXCB 3KLSA 2AJXL 4Z95L 1G7PB 1N0XH 2P5WD 4UV4H 4RMQA 3MROA 1M1SA 4G42B 1C5DB 2QTEA 5HI3D 3QQ4B 4YDLC 1U93A 4MQ7A 3TO4B 4YXLH 4TNWF 4J3UA 3DIFB 3CZFA 4I2XE 4R4BB 2ZP0T 1ORQB 4XXDA 5M7QA 3WS3B 3ZKMC 4OGAD 2BC4B 5T5NF 1D9KC 3ULUH 2V5TA 4AG4H 4M48H 1V7NH 4NQCB 3DX8A 4QHMB 2CGRL 1QQDA 1J86A 5LQBL 1KFAL 2RBLA 1KPUA 1TQBB 2PUQT 1FG9C 1S7QA 3PWPE 2VDML 5I73C 3DI2B 1CL7I 2VDPH 5FO7A 1OAQH 3U0PA 3KPPB 3R0MA 3IU4L 4Q2ZA 4C56E 3T2OA 3ZE2F 2O93L 1T0PB 2KKQA 3NCCB 2COQA 4UIKL 4N0CC 5SWSD 1FVCA 4QCIB 4WVRA 4Q6YA 3TN0B 3GMLA 2B20A 4QYOA 5HHPA 3RWHA 3SBWC 5GRUH 1G9MC 3U2SB 4F7CA 4JFDA 4JREC 4AT6B 1X5ZA 5IFHL 3BP7B 3OJ2C 4NHUB 1G9NC 3OBAA 5ISZB 2YSSB 4PREB 4P2CG 4PJHB 3UTTB 1LE9A 1A3QA 5HHMB 1CVRA 3MRQB 4HX1A 2K9UA 3AS1A 1F8TL 1IGFH 2NW2A 2VLME 1K4CB 4ZFZA 4MXQD 2EKSB 4ZQKA 1TNNA 4LRIA 5DYOB 1UADC 4TUJA 4Y16D 3WKML 4D9LL 3QRGH 1GPOL 2V5SA 2IJ0C 5J8OA 1RULH 2PNDA 1P84J 4JRXA 3SGEH 3GB7A 1N5YH 3BZEB 3RZCA 1CG9A 2HKFL 2PO6A 5K9KA 4HS8H 2CLRB 1FJ1B 1D5IH 4OQTH 4LCIH 3P4NB 4IOIB 3KPTA 1JNNL 5CD5D 4CVWA 2O61B 1UXSA 4NZRL 4OCNC 3QNZA 2YD6A 5D7IF 4Z8FL 1EJOH 1N6UA 1ZHLB 2AEQL 5D2NE 4IRSC 4MDIA 1I1YA 5EUOF 2CRYA 4U1GC 1JGDB 3U46A 4OV5A 2NYYC 3BP5A 2YS4A 4JLRB 4WO4C 4QTHA 3MO1B 1JHKH 1XF5A 1EX0A 5C71A 2XZQL 3EIFA 3O6MH 3CX5K 3CVHL 4ODWA 1MREL 1IFHL 5DJYA 4BQ6A 2BVOB 1EZVX 1U0QA 4BFIB 4RDQG 1P4LA 3MUHL 3TBSA 4NO2B 3DWTA 1U92B 5EUKB 1C12B 3CLEH 5HVFB 3H9HB 5LXGH 1UKSA 1BZ7A 1FVDB 1HHJB 1YN7B 2ZOKB 2WM0A 2VERN 1CU4L 3ROLB 1GXEA 4QNPE 4NQXB 5MP6L 1D5BA 4Y2DB 1G7LA 1EXUA 1QBAA 3IDIB 2FJFA 2B1AH 1K5NB 4DKFH 2QV2A 5D8JH 4XBPA 1CQYA 3OKEB 1U58A 5BMFL 3V0VB 3A67H 4HUXA 2J6EH 5KOMC 3FQNA 2NX5E 4WTXA 4XAWL 3SGJC 1LEGB 3DVGA 5L9DL 4HIXL 3P73A 4DAGH 1T2JA 1CBVL 3CC5B 2C3VA 3ARED 4RWYH 5I66B 3TH4T 4ZS6D 1TZHB 3QHFH 4R8WH 1IC7L 3KPLA 5TF1H 4OCWL 4N0RA 5GGRY 3D48R 1PLGH 3VD5A 4PRIE 4JN2A 3QG6A 4FQ2H 5GS3A 1NCWH 4PB0H 3ULVF 1B0RA 3W11D 3QCTH 3RY4A 1S7VB 4LDOB 3E6HA 4OF0A 3C2AL 5JPNB 1NGXB 3UXFA 5TGBA 3SBWA 2FLBT 1J0HA 1D3CA 4P0DA 3TO2B 1JWMA 2FEDC 1UWGL 2ADJB 1T7WA 4P5MA 3DROB 1NUNB 1U8MA 3S8WA 1MF2H 1R3LB 2DAVA 4WV1B 4R3SA 1EFXB 1AD0B 2FR4B 3I9GL 4NCC2 2E9JA 5C8JB 1Q0YL 1I75A 2AJSL 2CK0H 4OZGE 5ECJE 2ZCHL 3K1KC 5DFWH 4QOKB 1YNLH 1DLHA 4KKNA 4X6FB 25C8L 4J4PD 2OI9C 3EDEA 2JCCB 1FFNA 4GQ9H 3T4AB 4HV8A 1ZA3A 3MA7A 1KCRH 3G5ZA 2Z8SA 2E7HA 4JM2F 1U6AL 2IGFL 3TVMB 4OFYD 2YK1L 1I7TB 2QSVA 1UACL 4E42B 4PJ7B 4W6WB 1HINL 3V5DA 3JWNC 5GS2D 5HD8D 4NN7C 5C0JA 1OARH 3L3HA 4MDJA 1D6EA 2R1YA 1JPTH 1P5UA 4APQB 2P43B 2HTKC 1AXSA 5GGVL 1T22A 2YR3A 3GKWH 4Z7NE 2EC9T 4IRSA 4IHOA 5MENE 5HGAB 1WAAA 3G5YA 1NH6A 1YECL 2DQTL 4QGYA 3HAEA 4LSVH 4NO0B 3RGVB 4JKPL 1SHMA 4PJIB 3NOIA 5SWZD 1IEAA 1FE8H 1AKJA 5ANMB 5D70H 3DO7A 3STLA 3MBXL 4TRPH 4S2SB 3LPGA 5J1AA 2AEIT 4YX2H 5DURD 1CTOA 1N8ZA 5E8DL 3QIBD 4NRXA 4NYLB 2Z8WC 3CFDB 3CSYB 4V1DD 3LKNB 4WENB 3LZFL 1FSKB 2FDBP 3EFDH 1N3NA 1AQDB 6CGTA 1ZSDB 1R0AH 1BVZA 3M1BA 1CXLA 3DRTB 4J3TA 5JORA 3CSBA 1W0YT 3OMZA 5EC1A 2MSPA 3S88L 3CGTA 1GC1L 4NZTL 5E8EA 1AIFA 4K2UH 1B2WL 5AYQA 1DUZA 3C8KA 4JG1H 5IKCB 2YPVL 2QQKH 4DWHA 1NCBH 2KZ1B 1NCDL 4OZIF 3TGXA 4HDIB 3WLBB 2ATKA 2M1KA 3EO9H 4KRPD 4PIRF 1JPGB 1RIVL 3VXUA 4JQXC 4P2QE 4LCCB 2VWEC 3SGJA 5EZLA 3LV3B 3IFNL 5E08H 2DYPB 1EVTC 2HWZH 4ONHB 2Z4QB 1T20B 3KNBA 4M6MH 4YDIL 3VA6A 3GO1H 4L3CA 3MX0A 2OK0H 3HI6L 2PETA 5IQ9B 2ZCLH 3LKPA 4U49A 5HGBA 1W0WA 5DFVC 3VMOA 4MX7A 3F7PC 1CF8H 3OAUH 5IT2H 3QFJE 2XKSA 4MNQA 1OAUH 1XFPA 3V52L 4KKBD 3NIFF 4MA7L 4ZUVA 5TE7L 4HK0B 4NKIL 1F58L 5E2TL 4Q9QH 5IM7B 3GSRA 2BHUA 5IMMA 2QKIB 1NL0L 3EW3B 5CEZH 1MCCA 5BZWA 5CZVL 1LO0H 4ODSL 1RZIA 3LKSB 3D25B 5D93B 5SX5H 4LHJB 4KJYB 3RWEA 3GIZL 1BM3L 4RBPK 2RCSL 3HE7C 1ZLVK 4PJ8B 1CR9L 5EIIB 1BAFH 2OQJA 4A6YA 4NZUL 5BOZG 4G80B 3MCLL 3OB0K 5IF0B 4JM2C 5DJDA 5LCVH 3PXJA 1K8DB 2AJ3A 3EYVB 5EZJB 4IDLA 5HHVH 1IQWH 1MCQA 5BS0B 3UO1H 2D3VA 1LO3L 1SJEB 5DZNA 1LDPH 4MXVE 2EDEA 3P0VH 2VQ1B 1A7NH 3JV0A 3DUSA 3EO1B 5CZXC 1ZS8B 1RUKH 5D7IA 3H0TA 2A74B 4YK4C 1I8MA 1MSPA 5IJVA 3EUUA 4DKDC 1J10A 2WQRA 1MQKH 2P5EE 2MCPL 3PWPD 2EYTA 3WIIH 1HYRC 1BECA 2R4RL 3QA3B 5DUPH 5KVFH 1P84K 4C56D 2OL3L 3CH1B 3EOTH 3MRBB 3DI3B 2XTLA 5JDSA 3P30H 5BXFA 1WBYA 5I74B 4QXTA 2ID5A 4W70A 1R5IB 3R06B 3VGDA 2YBRA 1DCLA 3QI9C 2X4RA 4G9FE 3ULSA 4JRXE 1KF9B 4AM0B 2Q8AH 2A83B 4FG6D 5EPMB 5GIRB 4ACPA 3D39B 2NXZD 3MYJB 3BDBA 4JFYA 4NUGH 1VB9A 5AWNH 5JR1H 4XP5L 5MEQB 2AXHA 2VLMD 4GW4B 4UQ2B 3X3GH 3KYKH 1DVFB 2AK4E 3MBED 3P0YH 3TV3L 3ZL4H 3FQTB 2CDEB 3VD7A 3DV6A 4XZUA 5A40E 2AV7A 1INEL 1YEHL 3PUCA 4TULL 3N06B 1UH3A 4R2GB 2NY4C 4PR5B 1BFSA 3B9EA 3F8UB 3NBNA 3OTTA 3HMWH 4MVBC 4LLYB 5FCUH 4NKMA 1MFCL 5EBMA 3GRWA 1YN6B 4PY7B 4JPKL 5HYSG 1MFBL 1RIHH 1XEDA 2W60B 5IMKA 4JB9H 4ZUSB 3WN5C 3RWGB 1ZHBB 3T4YB 2R2HA 5F96H 3CU7A 4JQXA 1KENH 4HCRA 1K8IB 3FRUA 5KAQG 1UXWA 2HG5B 3PWLB 4JY5L 1NCCL 4L4JA 4NJ9H 3FAWA 1HI6A 4OZHB 2N7BA 4WU5B 3MRGB 5C0AB 3TNNB 3G6DL 4MQTB 1RIUL 1O5DT 4Z7QF 4OI7A 3UZQA 4KQ4H 1AHWB 2O5YH 5EBLA 1EVUA 4M1CD 1BIHA 1ORSA 3BVNA 3RTQB 1OAYH 3QCUH 3UYRL 1JNJA 3MLPA 3DX7B 4XHQA 4Y4HB 3ARFC 4HIJA 4KVNL 3SKJL 3BPNC 3P77A 4XWGH 3C9NA 4E41E 1TVHB 4NKOA 5GRZA 3GSNB 5E5UB 1ZLUK 2YXMA 3J8F7 3HI1A 3QWOA 5GSRA 1KEML 1CT8A 1JGEB 3WFCH 4EDXA 2P45B 3TCLB 1Z9SA 4I0CC 2GW5A 2ZUTA 3MCKB 3DXAA 4PRNA 1I4FA 4N9OB 1YEIH 2GAZB 5FOBA 1TCRB 1AGBA 4YAQA 5HYSB 2VNCA 4U7MA 2JJTC 4PRAB 5KVGL 1KB5A 5IEKA 3HE7A 3DARA 3L5XH 2ORBL 3MA9H 1A8JH 4FNLH 3O9WC 3QDMA 4EOWL 4IRZH 5F9WB 5H37H 4OLUH 1TQCC 4JM2A 4LOUC 4XX1E 1V3KA 3V4UH 4P46D 2BP3A 1GGUA 3L5WB 4GAJL 4G6KH 2E6QA 4X6BA 4JPVL 1SM3H 4TYUA 4B5EA 4DZ8B 1G6RA 3SDAC 5GJSH 2NLJA 3FOMB 2NX5D 2JE8A 4NOBA 3RWIA 4P9MH 3LRHA 2CMRH 5JOFA 4WJ5A 5CSZB 2IAMB 1L7IL 1PKQA 1BBJB 2P7TA 4JFFB 4JPIA 5FYJE 1IKFH 1N5AB 5FK9A 3T3MF 4RQQA 1JZ3A 2HRLA 4DZBA 2XZCL 3V9FA 3F12B 4PRID 3BUYB 3T2NH 4DN4L 5SX4H 1FVEB 5JHLL 3S7GA 3PNWB 1GGIH 2FNBA 2KUTA 2GJJA 1CFSB 1DZBA 2ARJA 4UDUB 3S3PA 4KKCC 3JVGC 1IAIL 2CD0A 2SEBB 2DTML 3LQAL 2A9ML 4FFZL 3TIDA 1S3KH 4PJ9D 2OTUB 4LRNH 1LGVA 3QI9A 3EKCA 4EQ3A 2VL4A 4XTRC 4RNRB 5D5MB 3VWKB 4X98A 2H41A 5D72H 4MNHB 4M6NL 3SHSA 4UZGA 4S1DC 4ZXBC 3GM0A 5AYUH 3WMSA 1GGBL 5HDBF 2NY3D 2ESVB 3VU2A 2FGWL 1FGNH 3EOAA 1QR4A 5GRJL 5D71L 4IIQC 1P2CA 3DRQA 1WAAE 4KMTH 4PP1C 1F3RB 4EN3D 4OZIA 5DR5L 1JNHB 3QEUB 1RVFL 2BJMH 1MAMH 3VW3H 5CILL 3G08B 2PCPA 1NGZB 5IIEB 3GHEH 4MXWH 5GS2H 4EUPH 3T0DA 1MWAA 2BDNH 1YQVL 4IOFD 3PGFH 2E8YA 3WN5A 2QADD 3RA7L 4PJ5A 5BZDA 1YYML 1PD6A 3BMVA 1WIOA 4ETQA 4S1RL 4MJ5B 1G9ML 1CFNA 5DJCA 4BUHA 1U95A 1V05A 1MCOL 2Y7QB 4KMLB 3WUWA 4OLYH 4H26A 3IKCA 1G9NL 1TFHA 5MEND 1WK0A 5E4EB 5FYJL 4BFEA 1NFDE 1XIWC 4Y5VB 4TPRH 3ARFA 4ZOEA 5FF6B 5ENWB 5D7LB 3L95A 1EMTH 3N1GC 1HSAA 5I18L 4HUNB 3GMNA 5L6YL 2X09A 4GRLB 4HUVB 4YC2B 3ARDC 3KLHD 4OZFA 5B38A 4QY8B 3OR6B 1C5BL 4PJEB 4Z95H 2AJXH 4NP4L 4QRTA 3BEWB 3NIDF 2PXYB 1NC2A 3U7YL 3HG1B 1XGRA 3NFNB 2IQAB 3PWJB 5F3HB 1DUYA 2ZJSL 2BVQA 3V4PL 4LAQL 1NDMB 1AGDA 3Q48A 1AJ7L 4LPVA 4F3FB 5C0FA 5J12C 3LEVL 3VDCA 4U1KB 2CLVB 1LO5A 2PW1A 1J0YA 5DDHA 3FB8B 2VABA 3RZWA 2CGRH 5