1HI6B

Anti-p24 (hiv-1) fab fragment cb41 complexed with a peptide
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
213
structure length
213
Chain Sequence
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAYNQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)
publication title Crystallographic Analysis of Anti-P24 (HIV-1) Monoclonal Antibody Cross-Reactivity and Polyspecificity
pubmed doi rcsb
molecule tags Immune system/peptide
total genus 45
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2001-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hi6B02
2BHZA 3EYVB 1N59A 1UM6L 3HG1B 4ZUWA 1N4XH 1U8KB 3RA7H 4YX2H 4GT7A 1AR2A 4YGVB 3TBYA 1XGUA 3PL6D 2ZCLL 4NM4L 4UBDD 1A7NL 5HHNA 3TPKA 4MXWH 5I66A 1XZ0A 4JO3L 3BMVA 1NEZA 3DXAB 5D71L 1AXTH 3FQNB 5CZKA 5GS0D 4GUPB 2EEDA 1E4XI 3VMNA 3ARDA 4KROD 2ESVD 2X1QA 4NHUA 2P5ED 3IGAB 4OFKA 1AIFA 3MROA 1FZKA 5I9QC 2XWBA 2MKLC 3DVFA 3FO0H 5BOPA 1BGXL 4G7YL 3WL9B 5IVXF 4KTDH 4M1GL 4Z7VE 1VADB 3WFDL 1I8MA 1Y18A 4WFGD 5TQ2L 1I1CA 4GBXA 4ZODA 3VI4F 4YWGH 3T4YB 1B2WH 1BMGA 3F7QA 5F70A 4M7ZC 1RIHH 1BX2A 4FQXC 1IC7L 3FB5A 3IDYC 1I8LC 3EFDH 2VDPH 1FV1A 3I6GA 4NDMB 5CD5C 1WT5C 2Z9TA 2BOCA 5F9OH 5HYEA 1F4XH 1CFNA 1GIGL 4DW2H 1BQLH 5AD0A 2IALA 2X41A 2WWMD 3I6KA 4JAMA 4FFYH 2DB8A 1QACA 5JR1H 5ETUB 5GGRB 4KMQA 4O4YL 3REWB 1JK8A 1I9RL 4JG1H 4OT1H 3HLAB 5LKNA 1DBJH 2I5YH 4LKXB 4HWEH 1ZWIA 3ZT5A 3IKCB 3MRBB 1RMFL 4FQ2H 3KHOA 4JDVB 5B38B 3QUZD 5E99L 4KK8D 4PBWD 5HI3D 5AEAA 5HI5D 3GIZL 4P4KA 5JMRA 1U8MB 5H2BB 2VNCA 4X7DC 1HH6A 1HEZB 1WBYB 1MVFA 3LEYL 1Q94A 3J7HA 3VXRA 4EOWL 3IFLL 5EU7C 4K3GA 2UZYB 4MB4A 3HC4H 3IU4L 3QP3A 3D85D 4ZD3L 3BUYB 5LAXB 4NWUH 1PZ5A 2IFGA 4IOIB 5DUBB 4Y5XC 1EGJH 3MGTA 1H8SA 2EDRA 1PGRB 3BPCA 4HK0A 3STLA 1DLHA 4YBQC 3VGGA 1B4JH 1ZGLB 1HE7A 4NKIH 1WCBB 3W11D 3E8UH 1SHMA 3HZYB 2FH8A 5M94B 3UROR 1AQDB 2R4RL 4P48A 2V17H 2WLYA 1DCLA 4CMMB 5HVWA 4JCLA 4S1QH 2BSSB 3WNMA 3VFWA 3DHJA 3HC0A 3HE7B 3ROOA 5F7YC 3MRJA 4N8VG 1AP2A 1FYHB 3DSFL 3CSYB 4NKOB 4ZTOL 4N5EC 1CWVA 3OKLB 4KUCF 5EO1A 1QLFA 4LP4A 4WUUE 3GB7B 4TUKL 3X14B 1VADA 4XX1E 1P7KA 4PIRF 3I6LE 3BIBX 2I60H 4LIQE 1ITBB 1CDUA 5E6IC 2JIXD 4IRSA 3CSGA 4ENED 2XWJA 2J8UE 2LQRA 4XNQB 1IGJB 2C3WA 1DVFC 2AV7B 1D6VH 1UWEL 5EBGA 3IDNB 3U7WL 3IFPB 5HBBA 2NY1C 5C0FB 4NO3A 1VESA 4PRPE 4PJHF 5DQ9A 4GRWF 4KDTA 3W81A 5ACMA 3OQ3B 4RQQB 5L7XH 3CDGA 3QQ3A 3CDFA 3DLQR 1VA9A 1PQZB 5L8JB 3FB7A 2Y6SC 2NR6D 1D5MB 3T77A 1CS6A 1MF2L 4XNXL 3GMLB 1SVZA 3IDGA 3LKSB 5GGRA 3REWA 4HIXH 1XGTB 1KN2H 4MDJA 1QEWB 3DHMA 3HLAA 4KJQD 3MLSL 3OKNB 1G7IB 3HTLX 3TBTB 4QHKJ 1T3FB 4MAYC 3QWRA 1ZANH 3EO1B 1ROWA 3BQUB 2ZSVB 2Y7QA 5JW5A 3RY4A 5LQBL 2F54A 1YNKH 4Z7UE 5JZ7C 4X9FA 5JLZB 4LPVA 1U8MA 4XC3L 5H2BA 1FE8H 3D9AL 5I16A 4L8SB 5JOFB 3DYPA 4OB5L 1FYTE 2YD4A 5JPMA 1HEZA 1N5AB 1AFVL 1WBYA 1F6FB 1K4CB 4DZBA 3ARBD 4H1LA 4LU5L 4K94C 3HZMB 3OAYK 3BKYH 4TQEL 1BJ1J 2IQAB 4HSQA 5KN5B 3VE0A 1V3JA 2EE2A 3B9EA 1KCSH 2ZKHH 3DRTA 3PV6B 3ZKSD 4OCRL 1W72B 1KJMB 4ZFGH 5E9DE 1MSPA 5IGXL 1ZGLA 3KXFD 4MWFB 5DGQA 4WJ5B 5AAWA 4YFDB 1UH4A 1RIVH 2EIEA 3TBSA 4Q7DA 1FAIH 4MXQC 4AEIH 5TE4H 3I9GL 5FO7A 2V9TA 1VCAA 3D25A 3SDCB 4LL9A 5FV2A 3QUXA 3V4VH 2BP3A 1Q9WB 4JM4H 3CVHB 4YQXH 3CSYA 2X4NB 4HLZG 2X9WA 4LSVH 4WI8A 2Y9RT 5L2KD 1VFUA 3FT3B 5D4QA 2IPUK 1GZPA 2X44D 3X14A 1GHFH 5DRNB 2H6PA 4UT6L 2AQ2A 3NTCH 4PJIB 3T0EB 4JKPH 3BDYH 3QDJB 3KYNA 1LEKB 5MEND 1LO5B 3FAXA 5T33H 4XNQA 4NYLB 2OI9C 5DS8A 2AV7A 5ENWA 3HI5H 4F7MB 2NY3B 1I75A 2B5IC 4MQ7B 2CIIB 4MSWB 3U0TB 3QXVA 2SEBA 4HEME 3NCBB 4X80L 2YA1A 3MTRA 4HK3J 2YUVA 1ACYL 5JMOC 5IHLB 5B3NA 1A7OH 1S7TA 2W91A 1I1RA 1TQCB 3HZVB 1X5JA 1YEEL 5ISZE 1MIML 3LKSA 2CUHA 4P2OB 5C86A 3BXNA 2NX5E 3CC5B 3DTXB 1XGTA 2PXYC 1CU4L 3OKNA 4LSTL 4QRSA 2B2XH 1YQVH 3GMRA 3KLSA 1G7IA 3TBTA 3TP4A 3U2SB 3GI9L 1JHLH 3D3VB 4M6MH 2BNRE 2NXZB 4LDLB 2ZSVA 2HT4D 1YEKL 2D9CA 1S7XB 4JGMA 5DQJB 1CR9H 3C5JB 1OW0A 4ZS7H 4BZ2L 4LSQH 4XC1L 5JLZA 5JOFA 1LMKA 3S88L 1K4CA 4HV8B 4TSCL 1I8KB 3HZMA 3TZVD 1U8NB 1TCRA 1X5KA 2OQJA 3WSQL 5D1XA 3BZ4B 5KN5A 4G5ZH 5F6HI 2X9XA 3PV6A 2OLDA 3BIKB 2J88L 2EIBA 4FN0A 2JCCA 2IGFL 1JGVL 4U1JA 4N9GB 1D9KC 1FNFA 1PW3A 1QSZA 5F3HB 2DN7A 4XP6L 2EO9A 5GS2H 4UDTA 5A2JH 5GGVL 1R5WB 2KBGA 2FIKB 3TO4D 5J1TC 2BHYA 5C0IB 1B0WA 2VAJA 4G9FE 3QAZC 3SDDD 4ODHH 5IOPA 1N0XH 3QRGH 1BBDL 2FEEL 1XF3B 3P0GB 1IT9H 3MFFB 1G7LA 1HHKB 5DQDH 2OP4L 1PKQA 1TITA 3CVHA 2X4NA 3QFDB 4HAGA 3FT3A 3L3JA 4WU5B 4WFFE 2XZZA 4IDJL 1QPXA 2EKSB 2ICWI 4Y4FD 3VMPA 1KLUA 5ADPH 1TPXB 1VFOA 2CUMA 2PO6C 3PNWB 4JFFE 4Y1AB 4UV4H 2P8PB 3QIUB 4XTRD 3UTSB 5GZOD 1MAKA 5FYKU 4DN4L 3T0EA 4GS7B 1LO5A 2WQ8A 1G0DA 3JBG7 1MCPL 1HXMB 4TYUA 2DM7A 3GSNL 1QBLH 5SV4A 4OZFB 4YHKH 1T04A 4PJBE 1PLGL 3OAZH 4R0LC 1MPAL 1RJCA 4KWUA 3MBED 2A83A 2CIIA 2LE9A 4MSWA 4P3CH 3U0TA 1KTDB 3L7FA 3ZT7A 3TCXA 3MLVH 5TDPB 3TT1L 1ERNA 3INUL 5AZ2H 2IANE 2H1PL 4WUKL 5DURD 1X3DA 1YEDB 2AJSL 5KBNC 3HZVA 5F7EL 4HXAL 3VGAC 4LHUA 1AQKH 3VXSD 3IRZA 4O2CA 4MZ2A 3G6AA 4PBXA 2FCBA 3MNZB 5LGHH 1YEGL 1MCWW 3D3VA 4HDIA 1S9VB 2C9AA 4Z7VB 1QQDB 1WEJL 2BRQA 4UMGA 4XPFH 5D1QD 3S3JA 4BK5A 1TETH 2NYYD 3EFFB 4JJ5A 3KPPB 5GGTH 4JDZB 5F1OB 3ULUF 4PGDB 2OR8A 3QQ4B 4GQ9L 4H20L 4RGNC 1I8KA 1CCZA 1X4XA 5EU3B 3FN3A 4L8BB 5DD5H 1U8NA 1IEAB 2BY0A 3H9HB 1RZJH 1IGML 5C0BD 4AG4H 4JPWL 4P59H 4LCYB 3BIKA 5ID0A 4AY0A 2GITB 1INEH 1RK0B 3MREB 4L8CB 2A6IA 2X42A 3CLFL 1HIML 1WZKA 5CUSH 5GGSY 4HT1L 3QDGA 1QFUH 4U49A 4WI2A 5F3HA 5BS0E 2BRRH 2C4XA 2FIKA 1OCWH 1UH2A 3FO9B 3FRPG 4ZSOE 1TTGA 5DMYA 2YRPA 5B39B 1XF3A 5ESQA 3CFEB 5E5RB 4TSAH 1I9IH 1BQUA 4MMZC 4BKLB 3QFDA 1FO0L 4QXGH 2G75A 4ZFFB 5C2BH 4WU5A 4W70A 5AZEH 4JPIB 4I48B 4GKZB 2D7TH 4KRPB 5FYLL 1T7ZA 2OTUB 4KJWC 4DN3L 4KK6D 5JQ6H 4NN5B 4J3OC 4HIEA 1BAFH 3MV7A 1CLZH 3EOTL 1MQ8A 4PJEA 3SOBL 1MRDH 5A2IH 2B1AH 1CBVH 2VLJE 5I0DA 4OZFA 3PWVA 4YXKL 3P9MA 1L9NA 3TGXA 2GCYB 2MHAB 1LP9A 5E08H 2IFFL 3QUMB 5ICYB 2APWA 4OLZH 1KTDA 4Z7WF 2XQBH 2GFBB 1ETZB 3WDHA 5TDPA 3GHEL 2FHBA 2MWCA 2A77H 1JN6A 4QWWD 3RGVD 1YEDA 1MHCB 2AXFB 4MJ6B 3H42H 2Y5EA 3VXQB 5E00B 2F5BL 5J6GB 2HFEB 3NMEA 3MNZA 4K3DH 2V2WB 3P9WB 4HUXB 3O4LE 3P77B 2X1PA 5ILTL 4CBPA 1S9VA 4OM0H 5FA3B 1AI1L 4Z7VA 3L1OH 1WIOA 4X98A 4ZUSB 2AXHA 3KLHC 4GH7B 5B3JE 4H5SA 2EXWC 2J8UB 2ENSA 4IMLB 5E5UB 2D0FA 3IFOA 4RZCB 1TFHA 4KKCD 1BIIB 1CGSL 3EOAB 4XMKH 3WJJA 4CDHA 1ZVSA 4ZMAT 2FGWL 4OV6F 3UAJC 5DFTA 1MFDH 1A3RH 3H9HA 3BE1H 5CMAB 3RWGB 4PRPB 5C0GB 3O4OB 4LCYA 1A0QH 4RMUA 2ICES 3KVQA 3SDAB 5IB1A 2QKIA 1I7RB 1RK0A 4HZLA 2XOTA 3UPRB 2P24B 4MA8H 3MREA 4I0PC 3KG5A 4JFED 3SBWC 5I1HL 1FNSH 4L8CA 4PJ8C 2BOBB 4L9LB 5IEHB 1T7WA 3QHFH 2DKMA 3U30B 4OF3A 1Z5LB 2ADGB 4OLVL 1RUKL 2Q3ZA 2ESVE 4FTVE 2P5EE 1WWBX 1A3QA 1FG9C 1Z9OA 5CHNB 1WVZA 2GK0A 4LPWA 4XPHH 5CIPB 3V4PH 5IVNA 1UB6B 2CR3A 3N85L 1EFXB 5KS9E 1S3KH 4LGRB 4BKLA 1EJ6A 3T8XA 4QGYA 1EO5A 1FYTB 3ARPA 3UYPA 1T22B 4I48A 2XT1B 4GG6A 3BEVB 4ZTPH 2C7UA 5BO1H 1EIBA 5E4IA 4JGUA 3BKJH 1FFNB 1U8HB 2VSCA 2OJEB 1MRCH 4PGCB 1H15A 2APTA 3VD7A 3O3EB 4EVNB 1WFTA 4JM2D 2CUIA 5F7MC 3VG9B 3B9KC 4MNGE 1ETZA 2W0KA 1DFBL 1LE5B 1QO3B 4LF3A 5GISL 2X70B 3ZKXB 3DX6A 4OD3H 4LCCB 4Y5VC 2AXFA 2GTZB 4MJ6A 3R8QA 4NT6A 2NY0D 3A6BL 4RISL 1IGIH 4PJDB 3MODL 4X4ZA 2OJZL 1A1NA 4NO2B 4S10A 5KSUB 5F9DC 3CDCA 2IQ9L 2JELH 1UZ6F 2DYPA 1FVEA 1I9EA 1WFUA 3KPLA 5FA3A 1YEFL 4H1LH 4WUUA 2PETA 5HDQL 4DTGL 4ZUSA 1YNLH 4Q6YA 3U82B 1KC5H 5T5NF 2J8UA 3ALXA 5E56A 5A1AA 5C0EA 4IMLA 1I3VA 2YXMA 5T3XH 2AABH 3EOAA 2FR4B 3F7VA 1ZE3C 4PJ9B 4ZFZA 3FT2B 5JDJA 4D9LL 1KSRA 3MUGA 1MUJB 5DJCA 1MLCB 1A6WL 4PRPA 2YWYA 4MCYB 1DL7H 2VABB 4Y19B 1GGTA 4HMEA 4NNYB 1RD6A 1HHGA 4H26B 1PY4A 2NY2B 4E41E 2RQ8A 4DUWA 1LDPL 5IEHA 1U8IB 1J1XL 5J4MA 3SKJL 2KZWA 2NY4C 2NX5B 2FEDC 4KZEH 4EJ1C 4KVCL 4HKJA 4QHMB 1VEOA 1ADQA 1P5VA 3WLWC 2DQGL 1OAYH 3JTSA 5CHNA 4L5FH 1QFWI 4L4TE 5CIPA 5E8DL 1UB6A 1A02N 1EFXA 4Z7UA 1KXVC 4KY1H 3SQBA 1X5YA 1YJDH 1UXWB 2CSPA 1Z2KA 4JHWL 1LO0H 1T22A 3BEVA 5DVNA 3GJFK 2R2BB 1WT5A 5EZOL 3TN0D 1FFNA 3OKDB 3U7YL 1U8HA 3G9AB 4MNQB 1JWMB 4PGCA 2VC2L 2EEBA 2WUCH 3PP3K 3GSVB 2ERJC 2G9HA 5E9DA 1VACA 4DGVH 3C8HA 4R4FH 4N90D 1T1ZB 3PIQA 4LSSL 4EI5D 4AEHH 4DAGH 2QADB 2WIMA 3UTPD 4YAQB 3VMOA 4BSVA 5DJDA 1QO3A 4ZAKB 3QEHA 4NRXB 3EKCA 3VH8G 2DTML 4KRMB 2NY3C 4H0GA 5HGDB 2R69L 1P6AB 5K9OB 4G9FB 2UWEE 3GSRA 1DANT 4FQQB 1OTUC 4K8RC 4QT5A 3H3PL 2R1YA 4NJAL 4JCMA 4BZ1H 5KSUA 4DK6A 1TQCC 4MS8D 1UM4H 4HIIB 1A21A 4XNUL 1MREH 3O11A 1V05A 4R3SB 3EW3B 4U1NA 1CL7L 3BRDA 1KIRA 4JY5L 2VDNL 4LPTA 3HC3L 4FFWC 5EU6D 5SWSE 1QRND 3FQXB 1S78D 4QTIL 1P1ZB 5C07D 4JLRB 2YMXH 2YHGA 1X6LA 2FR4A 1G1YA 1RU9L 4C59B 3HUJE 2EZ0C 4PJBB 1DR9A 3L5IA 4G43A 2HTLD 3FT2A 5HVHB 3KXFE 4XBPA 1A6AA 4YHPB 3WUWG 5EZJB 5IVZB 3QI9B 2IMMA 4H26A 2W92A 4OCSH 1FHGA 4OJFH 1OAZL 5ISZA 1U8IA 5A3IC 2BSED 2QHRL 2NX5A 2WM0A 3VGFA 3MV9A 3O41A 3CVHH 3C8KB 1KPRA 4M7LH 2BNRA 1UCBH 2HTKD 2XZQL 5E6IA 1JGUH 3TJHC 2MCPH 3M45A 5CILL 5ICZB 1DQQB 3LN9A 2VYRE 3IU3B 5C7XL 1J0KA 4IS6B 5F8QC 2Y1VA 1DVFA 1H8NA 2D7MA 1LHZA 1QPPA 1C5CL 3VCLA 3ARGB 5CS7A 2YD1A 1NBQA 4UILL 2HMIC 3BPNB 1IC4H 1BVKB 3LAFA 2GY5A 1J0HA 2ID5A 3B4NA 3DMMD 1JWMA 3BT2L 5CZXD 1P4IH 3GSVA 3PQYB 3AREB 4YBHA 1CGUA 1HNFA 4NKDB 4TSBH 1G9NL 1T1ZA 1F11B 4KGJA 5TDNB 2FECI 3GBNL 5BS0B 1IBGL 1MHPH 1FL3B 1GAFL 2P8LB 2XQYK 1EVUA 4PLJC 4AT6A 4ZSOB 3BP5B 4OCYH 5EIQA 4YXHL 5JXAL 4JFDD 4M03A 2QHLA 3PGCB 2VXSL 1AGEB 5DVMA 5BV7B 3O6MH 2RBLA 2ADIB 1AGFA 1J05A 4L1HA 3C6LA 4FQQA 4K71B 1VGKB 1INDH 2HN7A 4W68A 3W2DH 2YPVH 5TPWH 5L8KB 3BEWB 3FO2A 5IQ7H 2ED8A 2I9LB 1JJUA 1A6ZB 3QT2A 4HIIA 5ABDE 4R3SA 4XNZC 4JFFA 1IAKA 1JP5A 1OTTD 5ACLA 1IAOB 2FNBA 4M02A 4QXTA 3EJZD 3CXDL 4YE4H 2ZG3A 1TJIL 2IC2A 3TH4T 5I73B 3O6KL 5CSGA 1A9EB 4E5XB 3OSKA 1P1ZA 2VLJB 4KKAC 1KPVB 1MI5E 2UY7A 1M7DA 2R2EA 4PJBA 5C0DA 3SGKC 2YN3A 4KAQL 2KUTA 1WCQA 4YHPA 2ARJB 1JIBA 4MJIE 2M1KA 1PX3A 2IANA 2PF6A 4S1SL 4L4VB 4EIZC 1M05B 4X8XA 3U0PA 3CLEH 1KYOK 1BQHA 5D8JH 3UBXI 1NCBL 4QRQB 2EH7H 4JHZA 1EV2E 4PJGB 5J9PA 2NXYC 2EICA 3KWWB 4YHLL 4XP4H 5E4EC 4JB9H 5IB5B 3O4LB 3FZUD 4P9HH 4JGJA 4CVXA 4OLXL 5EO0A 4O02L 5FKAB 2YK1H 5DUMH 1E6JH 3S7GA 1DQDH 1JI1A 2EC9T 3IU3A 4UIMB 4GRLD 2Q87A 4OQTL 5DD1H 4U4BA 4HJJL 1ODAA 1AKJB 1OP5H 3U0WH 4OZFH 2JB5H 2XZAH 5FYJH 5CJOL 4KVNL 3O6LL 2XQYG 1KB5A 2EE3A 1ZGLP 3NN8B 2AKRB 5IBTL 4LARL 1FL5A 1FC1A 4PGZA 1SYSB 4LKCB 3PL6B 4GLRH 1UENA 3OGCB 4YHOL 2VTFA 3AREA 4OZHE 4GAYB 4FABL 5DRZA 1OGAD 3QNXA 1D7FA 3ARYA 1F11A 3MFGB 4RGMB 2HVJA 3ULVD 1V7NH 1BLNA 1DEDA 2PXYA 4OKVB 2F53A 5IHUH 2J12B 5BS0A 1HKFA 4U1HA 4G8GD 4WWKD 4KROB 4XH2A 2ESVB 5FYJU 2P5EB 3S98A 4M7KH 4PD4K 3WFCH 4M43L 2RR3A 4LVNB 1KNOA 1E6OL 3LQZB 4WWID 3PGCA 2XWTA 2OR9L 1QOKA 2DDQL 1U3JA 4NC1C 1ZEAH 4XCFH 5EIVA 3PF2A 4KDVA 3MRNA 4MYWB 2O5ZH 3AB0B 4KUCD 1JZ6A 2WW8A 1RJYA 1JPSH 1A6ZA 5A16B 3KAAA 4QRRD 4N8VB 4P46C 1IM9D 1S7QB 3LN4B 2R29H 3C5ZC 1TQBB 3WHE0 3UYRH 2EE9A 3KPTA 4LLQB 2EDWA 3MJGX 4X6BA 5C0BE 2VLJA 5C0JB 1A3LH 5E24E 2HJLA 5CJXA 3UTQA 1WISA 1WLHA 4Z7OE 4RAVA 2WWKO 4MNGB 4X9GA 1ZTXL 1EHLL 3TA3D 4ZFOB 4P2RD 4ODUB 5D2NC 1YY8A 3VWKD 4DKFH 4YFLI 3VFUB 3B9AA 1QUNA 3F58H 4FQCL 4FFZL 4GW1A 5CGYC 1NMBH 3MRHA 4FG6D 3CVIL 4KMLB 2G5RA 1KG0B 3MLYL 5SX4I 1YYML 4ZXBD 5IB5A 3IDUA 3D2UD 2L7UA 1S7WB 3CU1A 2PO6A 2W9DH 3QNYB 1RIUH 1J1PH 3DRQB 4G3YL 3S35L 4PRHD 4R26L 1CXHA 3HR5B 2CK2A 4PRDA 5ICXA 4WY7H 2V7NA 3ZT6A 5D70L 4OI7A 3N9GH 3VFPB 3D85B 4GMSH 4POZD 4LEXL 1AKJA 1BP3B 5DWUH 3V0WL 3U36A 3IF1A 1LK3H 1MRFL 1F97A 2DL2A 4NC0B 4F37K 3G6DH 3TV3L 4Z0BH 3UJIL 5DMGC 3NN8A 3TF7C 3KPSA 2Y23A 3C60D 4P5KA 5DO2C 4EN3C 4F57L 3UTZB 4KH2A 3OGCA 4JR9H 1MOEA 5TE7H 1BEYH 2XTJD 4LVOC 4LAQH 2E9JA 4FFVC 4OF6A 4GXVH 4XCNB 2R56L 4PB9L 5C0ND 3X3GL 1E4KA 1GC1H 2ZOKA 4Q0XL 3WNNA 4PP2A 3N0PB 4F33B 2ESVA 1UZ8B 4FTVA 5CJ5A 3VG9C 3DX8B 3KPQB 3BN3B 1P4LB 1RK1B 1A4JB 4OZIB 3E2HC 4KZDL 4YBLB 4QF1B 4JFZH 3SGJC 3WFBH 1KXQE 2B4CL 4EBQH 5EOCL 3EUUA 3MOAL 1GGCH 4U31A 5KS9A 4LIQH 4U1KB 3LQAH 3P73A 1JPGB 3KYMB 2OTWB 1N2RA 4GW5B 1KJ3H 5A16A 5GRVL 1BZ7B 2D03H 4HKBA 4PJAB 3TFKD 3NBNA 5L0QB 5C6TH 2CDFB 5EZIH 1RI8A 4LLQA 2DQFA 2R2HA 4FOMA 3RX8A 4UAOC 5C0JA 1ZA6A 5I8CA 4WIQA 5E95B 3MRCA 3KPRD 1FJ1A 4KQ3H 2QJDA 3NZHL 4R2GB 3ET9F 3TJEL 3GKWH 1DBML 3QJHA 4I0KA 1EXUB 3JWNC 1M7XA 3PWNB 5T3ZE 2GQHA 1QFHA 3JWDH 3MNWA 4J23A 4HKXB 3LN5B 4ZFOA 3SCMC 4OLUH 4Y16C 5BRZD 3RL1B 3MACL 3VFUA 4WW1A 2R23A 4JZNB 1ADQH 3DETD 3FMGL 4Z9KB 2L0DA 3GMOA 1NL0H 5B22A 5KVGH 5CIPH 4C58B 4JN1L 1KG0A 3ILQD 4K9EC 2XG4A 3AC0A 3QHZH 2NY2C 1CT8A 1S7WA 3WBDA 12E8L 1NLDL 5DHYA 3QNYA 3V6BR 1CVSC 3W9DA 3NGBC 3EYUH 2QR0A 5TFSL 3ARBB 3STBA 3UJTL 1NCAH 3LKOA 1Z0MA 2VWEC 4N0YH 5CD3B 4PS4H 4R90H 3MLWH 4OV5B 1I7UA 2VOTA 5SWSB 4GKSA 3LKQB 4EDWL 4E42B 3WHE1 2PCPB 3QIWC 2WNGA 3KYAA 4OD1L 3HUJB 4U7MA 5ADOH 2R0ZH 4PJEF 3WNOA 1QYGL 3KXFB 2FD6L 4I3RL 3UTZA 5D2NE 1NGZA 3QCTH 1URLA 3OJDB 3WNPA 1OM3L 5DVOA 3WE6A 1IQWH 4E41A 1H3TA 1LP9F 3P4NB 5DRWA 3RWFB 2Q8BH 2P1YA 2ZCHL 4F7CA 1MEXH 3KR3L 2B1HL 4UTBH 3DX8A 3MCLH 5I15L 5L2KB 3NFPB 3DX9B 4L4TA 1K8IA 4JO4H 5C08E 3V4UH 2V9QA 1MNUL 1KLGA 5DLML 1JPGA 1DTUA 1F3DJ 1G7MB 5I8OH 4KU1A 2Q8AL 4Z7VF 5GIRB 5FXCH 2XKUA 5MENB 1FCGA 1EUTA 4M7JL 5JO5B 4U1LB 2NQCA 2HT3D 4X6DE 2CDFA 5DJAB 1B3JA 1U3HD 1D6EB 3G04A 1KT2B 1XCTB 5GSVA 4PJ8A 5I30L 4N8PA 3S34H 1R3IL 4H88L 5F96H 3MLZH 2OMNA 3I50L 2XA3A 4HBQA 3OV6A 3DO7B 4KKLC 1YDPB 1MHHB 5JXEA 5I2IB 3R06A 2FB4L 5BW7C 1FGNL 4ZNEE 4HKXA 5HI4D 3NPSC 4LASL 1K6QH 2FZ3B 3D69B 2IMNA 2WBJC 2QQKL 4I77L 3BP6A 3CFDB 4PFEA 2XIDA 3TYFA 2UWEA 4K3JL 2UZIL 1OPGL 2A9NH 1KN4H 5IFAL 1FH5H 3SQOH 3F7RA 2VZVA 1WAAE 1QLEL 2WLZA 4WI6A 2H2PD 4KJPD 3DV4A 1UQSB 2FATL 4RGOH 4ZOEA 2DLFH 5K33A 3NACL 2VMFA 4TVSa 1AC0A 4G6KL 4Z0XB 4M48H 1T1YA 3ARVA 3HB3C 1DBAH 3BUTA 3RWHA 5SWSA 4RMWA 4XVSH 2HH0H 4P2QE 3EJJX 5E0QA 3PWUB 1L6ZA 4E42A 1RURH 1MI5B 3KJ6L 1N6QH 1JHTB 2H32B 5IV2B 1LNUA 4KMTL 4N90E 4IJ3B 1C5BL 2VLRE 5JIPA 4W81A 5IP4A 5MEPA 3E6HB 2DWDA 2VXQL 3CK0H 4OSUH 4XVUC 4U2YA 1HWHB 2YKLL 3RWFA 3TO4B 3KLAB 5I75C 2YZ1A 1QSFA 3SDDB 3BJLA 2W0FB 4ZDHA 1ED3A 3RU8H 2VDRL 1T2QH 3NCMA 1U8OA 5DEFA 5L6YL 1D3CA 1O7VA 2G5BA 2AS5M 15C8L 4J3VA 3SE8H 2FO4B 2VN7A 1ZVHA 4XMPH 3DX9A 3O3AB 2ED9A 5ESVB 4K2UH 1S7RA 1G7MA 4JEGB 5GIRA 1DSFL 1OSZB 1T5WA 2EDJA 3OPZH 3O8XD 1IZJA 4MZ3A 4K55A 4U1LA 5J11C 5JW4M 4Q9BA 2W0PA 1F4XL 1U0QA 5DJAA 2J8UF 4AENA 2V5MA 4P5TD 2IBZX 3W9EA 3FB6A 3MBEB 1CFTB 2X4PB 3GIVB 1NQBA 3MUJA 4C57C 3JWOL 5K59E 1HXYB 5HD8C 1NCDH 4OZHB 1X6NA 1ZT1B 5EBWA 2ZOLA 1IGFH 2GUOA 1YN6B 5DURB 4U05A 5DFWH 3DO7A 3GHBH 5EBMB 2OYPA 1JMZA 3LB6D 3VXSB 4YJZL 1XCQB 2P8MA 2FZ3A 4Z18A 3VFMA 3D39D 4E0RA 5F7DA 3GSQA 2GJZA 4NZRH 5HYJE 1KIPB 2VQUA 1CFQB 2ZPKL 3V5HA 4UQ2B 4RFOH 3T65B 3HC4L 3K2MC 3H7LA 3UMTA 1CF8H 2BXYA 3ECBB 2LAAA 3DBXA 4Z7UF 1JI2A 5BZWB 4FMKA 1CE6B 5D1ZC 4JKMA 1MFBL 2WP3T 3MOBL 2PTTB 1KB5H 1TJGL 5AYUL 1PYWA 2CDEB 2DF3A 4LQ1A 2VH5H 3WHXB 1AO7A 1T03L 5C0BB 4OZ4B 1MI5A 4OI9A 4FQLH 1PFCA 2H32A 1ZK9A 2BMKA 5DTFB 5IV2A 4NQEE 3D0LA 2BCKB 2OM5A 1GPOL 1ZV5A 2ICWA 4WEUD 5HGBB 4MJIA 3ZHLA 3E6HA 3RPIA 4AYFA 2VITB 4XP5H 3QHTC 3BESR 5TF1H 1NMAL 3SJVD 1P7HL 2Y07L 5IG7A 2DQUH 4XP9H 3KLAA 3T3ME 5IESL 1LE9B 5BV7H 5IROC 4JFDE 4D0CB 3RWDB 1CFVH 2CJUH 3BI9X 1QTYT 4HZAA 1RJLB 3R1GH 4HIHB 3P0YH 4Y89A 2B20A 5KSBE 2WUBH 3QBTB 3QXAB 2P49B 3V95A 3HFMH 5GS2D 3SE9L 3P40A 3HA0A 1OWWA 3UTTA 1QSEA 1S7UB 3O2DL 1G0XA 3O3AA 4R97B 5ESVA 3FQTB 1JPTH 2OL3L 1UKTA 3DJ9A 4XAKE 4M61A 4JFHE 1NC2D 4KRNA 2Y06L 1T4KA 4NKMA 1CLYL 4ODXB 3RL2A 4LHQB 1OSZA 2F74B 3PJSB 2JB6B 2HFFB 3QEQE 2YSSA 2W9LA 3VXOB 1SM3L 1AE6H 5D7KD 4NBZB 2X4PA 1SJXA 5I1GH 1V5JA 1BVLB 1SJEB 1YEHH 3ZYIA 2XN9E 1ZT1A 4XZUA 3RGVB 5BXFA 4UB0H 2EIDA 3B3IA 4IDLA 3GI8L 1XIWD 3ZE1E 3ULUL 3DSNA 4WTWA 5H94B 1OSPL 3G5ZA 3X3FH 3RVUD 4JZJC 3MV8A 1RUQH 2X89A 3ZMRA 4ONHA 5IMMB 4UQ2A 1EJOH 4LLWB 1MH5B 1L6XA 3MRLB 1KENH 1E4XH 3D18B 3ECBA 1T0NA 1WUNT 3C08L 2VXUL 4WHCA 5BZWA 3SE4A 3QUZC 2ZKHL 3QO1B 5IUSA 3W5MA 1A47A 5HI5C 3MLUH 2Z31D 4OTXH 2ICEB 2CDEA 3ILPB 1MFNA 3VFGL 2VLMD 4OZ4A 4TPRH 1I1AD 3V6ZB 2P5WD 3GKZA 3OWEA 1ZGLM 1ZT7A 3Q0HA 4JFEB 2E8ZA 3MRFA 3ULVE 4AEIL 1P84K 5DFVD 2VITA 3PP4L 4N0UE 4X5LA 3V4VL 5DYOB 3NIGE 2Z8RA 1YEIH 3W11C 2MPAL 2PR4L 3LS5L 3FQWA 1NLBH 2QEJA 3QCUL 3HNSH 1U8JB 3ARDD 3QXAA 3L9RB 1FNEB 3FFCE 4M9PA 5DEZA 2IH1A 1S7UA 1H3GA 3FQTA 4RAUB 1AHWB 3C9NB 5JORA 5DA0B 1S5HB 1IL1A 1FN4A 4RFNB 1RJZB 1CLOL 5FFLA 3SGKA 2F74A 4L3CB 3PJSA 4GBXD 1D5IL 5CJQL 1ORQA 3TT3H 5LCVH 3TWCH 1TZHA 3EHBC 3GK8H 4JM2B 3VXOA 4E9LA 1YPZA 5I1CL 4KQ4H 2D3VA 3IS0X 3O9WC 1BVLA 1GOGA 4YUEL 3FTGB 1SJEA 4PJBF 3VXNA 1T1XB 2PYEE 4S11A 4P2RE 4Y4KC 3OKOA 4KHXH 4K94L 5H8DA 3W39B 1SJVA 3L3DA 3RVWC 4OGAC 2GJ6A 1LD9B 1DUYB 5C3TA 3WIFA 2NY0B 3LHPL 1TLKA 3L5XL 4D9RE 4MXVE 3P11H 2HAZA 3L5WB 2RGSA 5EA0H 1CK0H 1OARL 4PRAB 3F7PC 3PDOA 5KVEL 5I6XB 3VH8B 4PRHE 5C08B 2DQTH 2X4TA 4LSUH 4M62H 5ANME 1CD1B 2BY3A 4HFUH 4X7EC 3OX8B 3ISWA 3EYOA 3CDYA 3P30H 1QHOA 4P4KD 1W0WA 4HUVB 5CGTA 4G9DB 2VXVH 4G5ZL 4JFXB 5HJ3B 4X6DB 1RVFL 3GSUB 2EXYD 4ZO6A 4DUVA 3VXRD 1HINL 1RULH 2ICEA 3ILPA 2EE6A 3WO4B 3T2PA 4OAWB 4LAJH 4S1RH 1JZ2A 3BGMA 2UVEA 1EH9A 2W1NA 2FDBP 4POUB 3VU2A 2RAMA 1XGPB 3SPVB 5FYKL 4FQPA 3KPMB 4F7EA 4YNYA 2DLEA 5D7JA 3S4SA 3PUCA 3MLRL 4NZTL 4Q9QL 1MJ8H 2DM3A 4TTDD 2HFGL 3WUWB 3VRJA 4G8EA 5C0RL 2FYYB 3WD5H 1LO3H 4DFIA 3RVVD 1U8JA 4BSWB 4P46A 1C5DB 4YC2B 2HKFH 1WC7A 1I1YA 3C5ZA 4RAUA 5CINH 1FFPB 1ZKAA 1S9WB 1Y0LA 1WF5A 1RZIA 3C9NA 3RIAF 3HRZB 5C2UB 2I9TB 1S5HA 2H3NA 3TN0B 1M4KA 1Q72L 3AFLA 4IRSD 1OAQH 5E2VH 3WFEL 5CLTA 1QR1B 4JM2A 1I8IA 1MWAA 1T21B 3QUYC 2VLRB 4UINH 5D2NA 4NWTH 3RWIA 4O9HL 4EI5B 1RFDH 4UT9L 3Q3GA 2WZPD 1RZ7H 1FBIH 2W65B 5FCUL 1KIQB 5GJSL 1JGEB 5BRZE 3W39A 1B0GA 4HCRA 5EUKA 4UV7L 2UZXB 3TIEB 4BFIB 1JPFA 3OXRA 4X7FC 3BP4A 4BFBD 3PABB 5IR1A 1B90A 5F1IA 4U6HB 3RNKB 2WINB 5IBLD 2GI7A 3L5WA 1PG7H 1FPTL 2QSQA 3BZFB 1TTUA 1WFOA 4PB0H 3QWRD 4R6UA 1QBMH 4UZGA 3NH7L 5C08A 4AQ1B 4MNHB 1M1SA 3OAYH 5CEZL 3L95B 5B8CB 2DMBA 4K7PY 1KCUH 2F54D 5EU6B 5H37H 1Q9KB 1KBGH 1A7QL 1UWGL 4XVTL 1CQKA 4G8FB 3BHBB 1J5OH 4O51B 3GSUA 5B3JF 2VLKA 3BP7B 4QY8B 1IEHA 4ZUVA 4U6VH 3TCLA 4OAWA 5CUSL 1I9JH 1E27B 6FABH 5GRUH 4UU9A 4LPYA 4OCXH 4DGIH 1ZOXA 4YHIA 5JIIA 5T3XD 3TZVC 4APQB 1QR4A 5E7FA 3CZFB 3QG6B 4WHYG 3KPMA 4U6XB 1NBVL 1CI5A 2X10A 1RZFH 4ZNEA 4P0DA 3SGJA 1NFDA 1SYVB 2D2OA 4IJ3C 3LDBC 3ZLQC 3MRGA 2JLLA 2R9HD 1XF4B 3M8OL 5IF0B 2A0LC 1G7HB 1WAAA 2HVKA 4JQIH 3IDIB 1XGQA 3MNVB 3BZEA 1QKZH 3LPWA 3O3BA 2Z4QA 2F19H 1SJHB 3QUXD 4IIQB 1FVDB 4HXBH 4M93C 1JWSA 3GJFA 4BH8B 5KS9F 3RZCC 2ZUYA 1FFPA 5E2WL 3NA9H 3HRZA 2FHFA 2I9TA 1CXLA 1FIGL 3KGRA 4P2QA 4RWYH 3S37X 3DMMB 1NAMA 2CKBA 4PPTA 2CK0H 4QHUB 4Y4FC 5L2JA 3WMSA 1XGYH 5EORL 1CGYA 2W07A 1CYGA 3DI2B 1QR1A 4QTHB 1XF5A 2C4FT 4JG0H 4NQEB 4XTRC 5JHLH 3UEZA 4OLYH 2VLRA 3SCMA 3KNBA 4Y16A 3CFJB 5KVFH 3FAWA 5TDOB 1SY6A 1Z3GL 2W65A 3GMQB 3LKPB 1KIQA 4G8IB 4U1IB 2IADB 3VWJC 1L7TH 1GXEA 4ZNCD 4JFDB 2HJKB 1VEMA 3L3IA 1OVZA 4I18C 4RBPK 4P2CG 3WUZA 1R3JB 2O5XH 4U6HA 3RPKA 4WCYH 2NTFA 4NZDA 4NP4L 5KSBB 1RAMA 2LV4A 5T5FH 4H1LG 5JHDA 4KK9D 4LSRL 3T0DA 5TQ0L 3FB8A 5HGHB 1IC1A 4ONGH 3IDJA 1BIHA 3GRWA 3MR9B 2ORBH 1QBAA 3QIWA 2UUDK 5KSAC 4JFQB 3GNMH 5HHXL 3TYGH 4F58H 5K9QI 5KANI 5FUOL 3NPZB 4G8FA 3BHBA 2CGRL 2H32H 4XBGA 4O51A 1ACZA 4DZ8B 5D1QC 4ZUTB 1J8HD 4QY8A 2EDQA 3VDBA 3GUTB 4LSPL 3DURB 5D1XD 4OM1H 1P7QA 3AMKA 4D0BB 4APQA 3B2VL 1U91B 4K8RH 5DRXA 3CZJA 2C3XA 3QG6A 1KTLB 2RB8A 4CL7A 4U6XA 1G7JB 1JV5B 4LLMB 5FYLE 4B7IA 5GRJL 4CN6A 3LQMA 1A7PH 2VR4A 3NZ8B 1EEYA 2AEQL 1MJUL 2I27N 3BH9A 2PW2B 1C1EL 1A9BB 4UNTA 5HYJA 1MCKA 3C8DA 1QNZL 4FRWA 4NJ9H 5IF0A 4O2EB 3C2AH 5TJWK 1G7HA 1GRWA 1A6UL 5I8EB 3IDIA 1IFHL 3N1MC 2E7LC 4GRLB 3SE3C 1II4E 4Q6IB 3O2WL 1YQ2A 4P9ML 4XB8A 5FGBC 4BQ6A 5CEXA 4PUBH 4IRJB 2NY6D 1UA6H 1K85A 5CBAB 1OB1A 4U1GC 2BVPA 4POYA 3MA9L 5INDA 5DDHB 2FSEB 4HGKC 4ACPA 4NQEA 4R7NB 4RNRB 4XNYL 4OD3L 1T7YA 5KG9A 4WEBH 4U3XA 3CFJA 1JGDB 2WBJA 3QFJA 4PREA 4LQFL 4Z76B 1ZSDB 2DIJA 1BJMA 5HVGB 3BVNA 4G8GB 4WWKB 4N0UB 4F7TA 4PTTB 3O6FC 4GAJH 7FABL 1W0VB 2HFTA 4LVHC 1N8ZB 2QL1A 2VL5B 1KEGL 1E4WH 1FLRL 1VPOH 1OAUL 2DQJL 4LLUA 4LHUD 5EH1A 4XHJD 4HF5H 4NNXA 2UWEF 4DGYL 5KSBA 3U46B 4AMKH 5CEYA 4EQ2A 2H2SD 3KJ4B 3GJEB 3N1QC 3LS4H 4HLJA 1MLBB 1YUHA 3LRSB 3D3VD 3VD9A 2APBA 1HH9A 1GOFA 3V2AR 5BZDB 2NXZD 2J4WH 3OG4B 3MR9A 1NANI 4NIKB 5FDWB 4JFQA 3U4BL 3IJSA 2C1PB 3M1BB 3OF6A 3IETA 3QEQA 4NHCH 4DZ8A 4NFDA 4PRIA 4ZUTA 5DJYA 3VFTB 3HCVB 1MQKH 5IB3A 3GUTA 1BOYA 3HUJF 3MJ8A 3TA3B 2XN9A 1DLFH 3HPLB 1U41A 4G6MH 4P2RB 3VWKB 1UACL 3EBAA 4B5EA 3MJ7A 3PWJB 3AXLA 4J8RB 3BRFA 1DBKH 1JV5A 1ES0A 4LLMA 1FZMB 3QUKB 3QDGD 2ZUQC 4PJFE 3IT8D 3NZ8A 5EC2B 3MC0A 2DS4A 3P4OA 4H8WH 4KY1L 4GSDH 1N26A 3U6RB 4PRHB 3ZZ1A 3WIIH 4YHYC 4M5ZH 4GRLA 1ND0A 1IM3A 2MMXA 3T0XA 4NRYB 1FQ9C 3IXTA 1C8PA 4PGBB 5LWYH 4IRJA 4YR6B 3S36L 1XF2B 4KHTH 1AJ7H 3G5VB 3WEXA 4WHTB 3C60B 1CGWA 3Q1SL 4ZUUB 3ZKNC 4HC1L 3MV7D 1JE6A 4G80A 4WFEE 5DDHA 2XTJB 5MHSE 2DQHH 2OBGA 5DSCB 5MI0C 2NZIA 4LHUG 3ZO0A 2HKHH 4CU6A 5FYJD 1OP5K 1C08B 3WLBA 1ZSDA 4X99B 4Q2ZB 3DROB 2VDLL 4N0UA 1OOAA 1I7ZB 4LOUD 1W0VA 1N8ZA 3SDYH 3VJ6A 5DZLA 1VGEH 5DJZA 4F2MA 4CJ1A 1L0QA 3U46A 3SGEH 5C1MB 5D1ZA 3FFCA 1H9VA 2DQEH 5F44A 3P0VL 5DJXB 3FO1A 2FX9H 2A6KB 1TNNA 2C1OB 2F8VA 1W72L 4MD5A 3OXSA 5FDWA 4NUGL 3M1BA 1WZ1H 3EOYG 5GGUA 1IGYB 2VLME 1TZGL 1GGYA 4GG8A 3H7BA 3KPRB 4JPKL 2ZUTA 1AD0B 4M00A 3M17B 1D5XB 5T3ZH 2NW3B 4W6YB 3FRUB 3PXHA 1HQRB 2DQIL 2VUOA 4L4JA 5BMFH 2PYEA 4GRMB 4P2RA 1T1WA 1CIDA 4JRYA 2QBWA 5BRZB 5FO9A 1BD2A 3ULSB 1YECL 1FZMA 1MFEL 3V6OC 3RUGE 3H3BC 1JGUL 5HPMB 2AJUH 3NOIA 5J89A 3TNMA 1BFVH 4FQIL 4N1EA 3U6RA 5D72L 1QLRB 3EYSH 5ANMA 4MA1B 4P23C 1NJ9A 4HJ0D 5IW1A 3Q6GH 2LABA 4AH2A 2VR5A 4NRYA 1ZA3B 4MAUL 4G6FB 3VFRB 4Y4HB 4YR6A 4ODTL 3U48A 4Z78A 1MWAH 5HHVL 4NQCA 8FABB 3HAEA 4G42B 5MEQB 4ORGB 4WHTA 2EKJA 4QXUL 3OKKB 1TTFA 2QLVB 3DGGA 4P49A 1HDMB 5DSCA 5HDOA 3IJHA 3RX7A 4GMTH 1LQSR 1K8DA 2YUXA 4HCRH 5EWIH 3GEWB 3WXVH 4R96B 1F90H 1BREA 1C08A 3IDMB 1K4DB 4PJCE 2YUZA 4OZHF 4Q2ZA 5IT2L 5DHXB 2ZCKL 3DROA 2NY7H 2NY5C 3HE6C 2R8SL 5DJ8B 2E6JA 1RHFA 1LWRA 1AD9A 2XRAL 3GSNB 5I18L 3MBXL 1RUPH 3DIFB 5JDSA 5ACZB 5DD6A 3MPCA 2AQ1A 2F8XC 4YDKH 4H25B 4DCQA 4MA3A 5F7UA 2EECA 1Q9LB 1V3MA 3F7YB 5DJXA 3QXDA 2DYPD 2C1OA 2VZTA 3HI6L 1ZHBB 1SEBA 1YA5A 4WUUD 1MIEH 3B6SA 3L3GB 1QZ1A 1NCWH 5IEKB 4FQHB 4MVBD 1QFWH 2RCSH 1U3HB 3ARSA 5JA9A 3CMOL 3QH3B 4OGXL 4DVRL 5KZCD 1AD0A 3KHQA 4BH7A 5IMOA 2DQDL 3JV6B 1UB5A 2B0SL 4Z8FL 4JQXC 1HQRA 1S78C 4MX7B 4Z7OF 2FJFA 4PRPD 4GRMA 5BRZA 2OK0H 5FM5O 2HTLC 3K2UH 1CE1H 1VHPA 3SY0B 4KV5E 4QYOA 2DWEB 5F88B 4JN2B 1NSNL 3BPOC 1U6AH 1JNLH 4OCWH 5ESAB 1YZZA 1MCJA 1V3LA 3VRLE 5F9JB 3RY6C 3GJFH 4DVBA 5E8NA 4P5MB 1X5HA 3BAEL 3UC0H 4GKNB 3DOSA 3L6FB 4LLYA 3EO0B 4FNLL 1EFXD 1UJ3C 5CWSB 3PP3H 3VFRA 3ROLB 4J3XA 1Q1JL 1NAMH 2CKBH 1JMXA 1NCCH 4Y4HA 3O9WA 4WI4A 1HILB 4PBVC 2BVOB 2BDNL 8FABA 5GS1C 3T2QA 3MJ9L 1KFAL 2X1XR 4Y4KA 1HSBA 1SY6H 3TPUB 1FSKC 1HDMA 4I1NB 4RRPA 5CSBA 1FO0B 5BVPL 4R96A 1PD6A 5E9DD 2P7TB 1MFCL 5ALBL 1PSKL 3HMXL 25C8H 2H9GA 5CZXC 4OLWH 2IAMB 3F8UB 4NNPL 4ALAL 1ZEAL 4NO5A 5IQ9A 4CUCA 3CXHJ 1X5IA 3F6LA 5D2LE 4UUJA 3DV6B 4OIBA 3RY5A 3GSNA 4XX1G 3HR6A 1ZHKB 3NCJL 1FRGL 4D0DB 3O2VH 3GRWH 4R8WH 2D4FA 3U4EB 1IC5H 4JHAL 1WBZB 1EEQA 3CH1B 2F54E 4G6AD 5DK3A 5J12B 2CLRB 4X6FB 4F15B 4P5TB 1Q9OA 5IEKA 4NN7B 4RWHA 3MYJB 1AGBA 1IGCL 3Q48A 4Z7NE 3GGWA 5JQHC 1R3HA 4X7SH 3SKNB 3QH3A 5IFHH 4FA8A 3TH3T 1EDQA 1OTTC 5JOPE 5KJRL 1F3JB 5T3XE 5FA4B 2D31A 1UM5H 3IDXL 1WTGT 5I1IH 4XPTH 2B4CC 3D39B 1CFSB 4XXDB 4U1MB 3C87A 2DWEA 5KVDL 1BZQK 3WCYA 2YXFA 5ISZD 1J1PL 4XI5C 5CBEB 1UM6H 2UYLA 4QHNA 4WW2B 1IEBB 5E1HB 1S9XB 2ZCLH 3BGFB 4JRXE 4N5ED 4NM4H 1A7NH 3MV9D 4ZPTB 5F9JA 3G5XB 5D7SL 3UO1L 2BNRD 4JO3H 1A1MA 5E6ID 5FK9A 3SO3C 2A2QT 4I13B 5D71H 2EEAA 5LXGL 2GK2A 3MV01 1DVFD 2BVEA 3QUML 3QUYA 2OX5A 1U58B 3HZKA 1SBSL 2X4QA 5ALCL 1FC2D 1HILA 1MHEB 1R5IA 2BVOA 1BGXH 4G7YH 2QSCL 4U6YB 3TVMB 1J8KA 3VG0L 3KYOA 4FXKB 2MNUA 3TO2A 4M1GH 4XMLL 2AAVA 2CMRL 3J8F7 1IRAY 3WFDH 1B6UA 4JM2F 5E8EA 1U8LB 5TQ2H 4CGTA 1FO0A 3SJVB 2Y6SD 3W0WD 4HX1B 3MCKA 4P3DA 5SWQB 1IC7H 3IKKA 3OTTA 2Q76B 5EPMA 2IAMA 2IEPA 5D7IE 2XV6B 4PJFB 3O45A 4L8DB 4Y5YC 1S5IL 4LIQL 1NGXA 2F5AL 3V5DA 3MYZA 3PWLB 4I4WB 4MHHG 2I26N 1GIGH 1ZHKA 2D03L 1F4YL 4WWKC 5I71B 1GSMA 3C6LD 1JRHL 4MQXC 1NC2B 1WBZA 4JO1L 4O4YH 2YRZA 3CCHA 3UYOD 2YD6A 1I9RH 1BFOA 3LSOB 2CLRA 4WFFD 2EYSB 4X6FA 3I02B 2BJML 3OR6A 4JFFD 1FFOA 1J8HE 1RMFH 4JQVC 4K3HA 4BQ8A 1NKOA 1C7SA 5E99H 4X6DF 4CVUA 2MJWA 3GIZH 4X5WB 4HG4J 3VGBA 32C2B 4YXLL 4XPGL 1KPUB 2X7LB 4WU7B 4Y2DC 3ORJA 5BJTB 3LEYH 4MCZB 2JCCE 4EOWH 2ADJB 3IFLH 4Q9RL 3BW9A 4MXQD 1XIWB 3IU4H 4V2CB 3DVNB 4ZD3H 2CIKB 4LGPB 3RHWK 4WI3A 4NN6C 4XCEB 3X17A 2IAND 4PYHA 4JFPA 4BELD 3PGFL 5F8RC 5CBEA 3PHOA 4LHJB 4WW2A 3PG2A 1S9XA 3KS0H 2EDEA 2R4RH 5HHPA 4YDIL 1G7QB 1WAAF 2VJXA 4YGAB 4YHML 3QEGL 2GIYA 4WV1C 4ZXBC 2Z31B 4IRZL 1MCQA 1YYLH 3KYKH 5FB8B 2NNAA 5EBLA 3MRKB 5K9JL 3DSFH 1A5FL 4KKBD 3UJJL 4U6YA 4ZTOH 3TVMA 4NCC1 4Z77B 5TGBB 3H9ZA 2QQNL 4TUKH 3VWJA 4PJ7E 1UYWL 1U8LA 3TBYB 1M7IA 4I18A 2V9RA 5FM8A 3ARED 5HHNB 3ES6A 3MCLL 1CG9A 3BWUC 5F72S 2PXYD 3RUGB 1G6VK 4KJYA 2F53D 4I0CC 4PJFA 1MCIA 4MA7L 3T1WA 3U7WH 4Y2OA 2QQLL 5D5MA 2R0WL 5BS0D 2V6HA 3ARDB 4FP8L 3PWLA 4ORZC 2NZ9D 3V8OA 1WICA 2R1WA 4LCUA 3MROB 3BKML 5KSAA 4WO4A 5I74C 1YMHA 2FJGB 1EMTL 1QVOA 4XNXH 1HKLL 4GBXB 3MLSH 5C0CD 3P2TA 3I02A 4PY7A 4K9EL 2XY1A 1BX2B 5J13B 1PG7W 2OTPA 3FB5B 4ZOBA 3HI1A 4P57A 2DICA 5LQBH 2DAVA 4X5WA 3AAZB 3RVXD 2NMSA 3RDTB 4XC3H 1F58L 1KPUA 1H5BC 1BQHG 1RZGA 2R0LL 2BOCB 2J7LA 4WU7A 1AFVH 5EG6C 2KKQA 3BN9C 1CFNB 2I07B 5K59F 5EC1B 4PJCB 4LU5H 2ADJA 3STZB 2IALB 3I6KB 2A9NL 2YN5A 3MLXL 4JAMB 1CICB 4P3WA 4TVPL 3QDGE 3DVNA 4TQEH 5BOZG 2JKXA 1T7XA 4A2MA 4XCEA 1N7ML 1JK8B 2EIZA 4OCRH 5B21A 1MAML 3A6CL 2E7LA 5IGXH 1F4AA 5FGBA 3QQNA 1F02I 3DETC 4OLEA 1G7QA 4P4KB 3CFBB 2PO6D 1HH6B 3ILQC 3I9GH 3LEVL 3ZKMC 1Q94B 3HAEH 3HPJA 3VXRB 1T0MB 3T4AA 1LK2A 2HJFA 2P47B 3G08B 1WIPA 5ID1A 1AKJD 3MV7E 5T1LA 1PZ5B 4UTAH 1NGYA 3LV3A 4Z77A 3BPCB 3STLB 1DLHB 5TGBA 4CVZA 2WANA 3KPSD 3F5WA 3O6FA 1CDBA 1LP9E 4UT6H 1PX4A 2FECL 4NGHL 3AY4C 2Y5TA 4ETQB 3UDWA 3RUGA 4RMTA 4JFYA 3T3MF 3VFWB 3BOVA 4K2UL 3HC0B 3ROOB 4FTVD 3MRJB 4X80H 1AP2B 1ACYH 1RUML 4PLKC 2OR7A 5KSBF 2FJGA 5KTEL 1YEEH 4IOFC 5EO1B 1QLFB 1MIMH 1X7QA 1P7KB 3O81A 5E8OB 5L88L 4NQTA 1XR8A 1EO7A 4M1CD 4RGND 4IRSB 5F9AC 1CU4H 1AGCA 4LSTH 1QFOA 2XWJB 3VRIA 2BVTA 3GI9H 4KTEL 4OFPA 1VKXB 1OT1A 3U9UA 2BX5A 1XF1A 3BWAA 1YEKH 1CGVA 4BZ2H 4DKDC 3RQ3A 4XC1H 3AAZA 3T04D 3RDTA 4NO3B 1VDGA 4FQ1L 3IFNL 2YRLA 5DQ9B 3S88H 3CDGB 4X6EA 2I07A 3QQ3B 5EC1A 4PJCA 2Q1EA 3STZA 2VISA 5EOTA 1CICA 1G6RL 3FB7B 3CFKA 3WSQH 3T77B 3B5GA 3IDGB 3V9FA 3P9LB 4ZO9A 1ITCA 2AJ3A 4MDJB 5D2LB 3LPGA 1D5ZA 4WGWB 1TVBA 5C9JA 2J88H 1JVKA 2IF7A 3ZE1F 1HYSD 3VFVA 3W82A 2IGFH 3BD5A 1JGVH 2VXTL 3V5KA 5HI4C 2HG5A 1BZ9B 1I7TA 3E3QC 3LMJH 4HS6A 2VAAA 2Y7QB 3N1GC 5TH2A 3Q5OA 5JW5B 3ARFB 1MJJB 2F54B 2QSTA 4XP6H 3CFBA 1HQ4A 3QNZA 5GGVH 5I16B 3ZE2E 2WIIB 4OIAA 5JPMB 1JNJA 1S9YB 4FQLL 4DZBB 4GG6E 4H1LB 1BBJA 1FDLL 1BBDH 4XB7A 5KAQF 5K9KB 1T0MA 2KPNA 5IIEA 5ITBL 4OZGE 4JREB 5DMKA 3RFZC 1A14L 3G08A 2OP4H 2JJSC 1U95A 3VE0B 5LBSL 1EBAA 3DRTB 3ULUC 1EO8L 1R0AL 4IDJH 4CU8A 4LVEA 3EZ8A 3PGDA 3DUSB 3EDEA 1ZLWK 4DN4H 3LCYA 3QISA 4RMSA 3TNNB 3ULVF 5CJ8A 2EC8A 1X4YA 3TBSB 1MCPH 4E41D 3DECA 3GSNH 4ETQA 3HFML 3OKYA 1PLGH 1MPAH 5FO7B 3FL7A 4TULL 1KIUA 3D25B 3NIGF 4LCIL 4XPBL 5D6DC 3T3PE 1YNTA 4JRXB 3QUXB 4FXGA 3TT1H 4MDIA 3INUH 1IARB 1LGVA 4XCCL 2VDKL 4DKEL 2EDKA 2H1PH 2AJSH 3KLHD 4NRZA 1KCVL 1UH3A 5F7EH 4L4TD 4ZPVA 4HXAH 2JJVA 1GZPB 2EXWD 1KCRL 5E8OA 4BQBA 4F9LC 2H6PB 2GSIB 4NQUA 3U83A 4K23L 2JJUA 1HK6A 1YEGH 3KYNB 3VFSA 1VKXA 4QLRA 1KELL 5DS8B 4HK3N 5I1AB 5ENWB 3NFSL 35C8L 3T08A 4CMHC 2Z8WC 3O8XC 3AS0A 4N0RA 4I0PD 2SEBB 4PJ8D 4IEFB 2PKDA 2FLBT 4GQ9H 4H20H 1SEQL 1F00I 2BXZA 1T7VA 4R2GD 1S7TB 1YN7A 1T66C 5D7IB 5JXED 3OZ9L 2BNQE 5FHAL 1IGMH 3P9LA 4OCLC 4TUOA 3BXNB 1AXSA 2F58L 2MQCA 1N3NB 4JPWH 3QJFA 1NC4A 5D2LA 2I24N 1EJOL 3GZKA 4P23A 2AERT 2HLAA 4QRSB 3GMRB 2P42B 4MXVF 2V2XA 3D1MC 3Q6FA 2KL6A 3ZSTA 3RZWA 1BZ9A 3CLFH 1HIMH 1E28A 4HT1H 1ZHNA 2DJSA 3MRPA 2BNUB 3ARFA 1MJJA 3MLUL 2DMCA 5JIKA 2CKNA 2IBBA 2I25N 2WIIA 1QHPA 3QIBC 4RA3A 1S9YA 5EU5A 5SWZE 1J8HB 2GAZB 5A43C 1BOGA 3V0VA 5IJVA 1X5AA 3BGFC 3SKUD 4F37F 4P4RA 5K9KA 4HUWB 1TCRB 2OQJB 4PY8I 5SWSD 1U2CA 5D1XB 3MXVL 3NCYS 5GS0L 1FO0H 1IKFL 3L3OA 3SDXA 4PYGA 5FGCB 1NUFA 3HE6A 3VGHA 4DFHA 4C54A 2JCCB 1X9QA 1MCOL 5FYLH 4U1JB 3DUSA 4DN3H 4X6CA 3GSXA 4OQTA 3TNNA 2YUWA 3EOTH 3SOBH 3EDJA 1NGPL 4X7TB 3EZJB 3H9SE 4UDTB 5CFHA 4YXKH 1U8QA 1QSFD 2VLLB 1UXSA 2A73B 5IOPB 1UKSA 2IFFH 4JRXA 1G7LB 5FHBL 2DQCH 2G2RA 3GHEH 1PKQB 4NOFA 4O00A 5EU7E 4NO0A 3ESVF 3FQRA 3C09C 3L3JB 2NY6B 3FOMA 5CZVL 1WBXA 1KLUB 4QO1A 1VENA 2F5BH 2IPTL 4QKXB 2GSIA 4KQ4L 2Z93A 2D4DA 5F9WB 5I76A 5IKCA 4YK4B 3NFNA 4ZFOL 4RCAA 5ILTH 4U0RC 4IMKA 1AI1H 5I1AA 1CXKA 4KHXL 1T04B 4HPOL 4D8PA 2A83B 5GRWA 3GFUA 4MB5A 4M5YL 2P46B 2NLJA 2D0HA 3L7FB 1YEJL 3RTQC 1T89C 2C3VA 2EYRA 1CGSH 4K7PL 2NY4D 2EDBA 2FEDD 1CK0L 4ODSL 3S96A 2FGWH 3UZEA 5D7IA 1S7SB 5TF0A 4C56E 4LHUB 4UIKL 3WKML 3RY6A 3WLWD 1I4FA 4O2CB 2VE6A 1N3NA 3G6AB 3A67H 2AJZA 3MV9E 4YDLB 3O0RL 3GO1L 4KKNA 5IK3B 1CXIA 5I1HH 4HDIB 2FL5A 5H37G 4O58L 2BNUA 4N0FA 1N0LA 4OLVH 1R3LB 4JJ5B 1A7RL 3REVA 1RUKH 4UQ3B 1GGBL 3QRFM 1FNGB 2Y72A 1J8HA 1AC6A 2GAZA 4OIIL 1OLZA 4HUWA 1UWXH 3N85H 3VXUD 3U1SL 4LRNL 4Y8AA 2DD8L 2NW2A 1AO7D 5A2FA 1A1OB 1MI5D 2ADFH 2D0GA 3W0WE 5ID0B 3EYQD 4WNQB 4OUUA 2ENYA 2A6IB 4MJID 2HRPL 3QDGB 1I1AC 1TCMA 2YD7A 2IPUG 4QRTB 3R0MA 4X7TA 2K7PA 4EIGB 5DT1L 1OTUD 4K8RD 3VFNA 2VLLA 5M95B 1T6VN 2A73A 4HS3A 5ESQB 2LTQB 3WNKA 2PNDA 1JF6A 1VSCA 1DFBH 5GISH 2FO1A 4I8DA 2G75B 3UTTD 1QSED 3VXPA 1IILE 1RZ8B 4LGSB 1JYVA 4FFWD 4PP1C 3A6BH 1JF5A 4J4PC 4JE4B 4RISH 4UINL 2OJZH 4XWGL 4HIEB 2EZ0D 3MV7B 1ZS8A 2WBKA 4PJEB 2IQ9H 1F5WA 4PJXE 1YEFH 3PWVB 1N5YL 4LNVA 1IAIL 3D48R 3P9MB 4XP1L 4PJ7A 4QEGA 5FKPA 5HDQH 4GW4A 3WS6A 3WDJA 4DTGH 1LP9B 3IVKA 3D5OF 1NUGA 3OKEA 5ERWB 4FHBD 3WN5C 1JN6B 1A6PA 1Y6KR 5CKAA 3N50A 1S7SA 1BHGA 4D9LH 1PBYA 1A6VL 4I2XA 1A6WH 5HHQA 3I85A 1NFIB 5IK3A 4JHBA 3E0GA 1V3KA 3MV8D 3ZL4L 1LDPH 1J1XH 2X89D 2A6DB 4X98B 3SKJH 4WTXA 5EOQL 1R3LA 3MGOB 3PWPA 4UQ3A 4KVCH 4DEPB 5J0BA 4H5SB 1BVZA 1FNGA 4M8VA 3QYCA 2DQGH 5GRUL 5D96C 5HYIA 3IFOB 2MTPA 3MXWL 4Y8DC 5D7LE 2CQVA 1QFWM 1ZVSB 2DM4A 5E8DH 5F6IC 5HHOE 3NIFE 1DUZA 2R15A 5BVJB 1A1OA 4ELME 1TNMA 4JHWH 5IB1B 4NUJA 4WNQA 2QKIB 4M7LT 2XKNB 4HZLB 5DZOA 4Y5YA 1MCWM 4ONFL 3FOLA 1NMCB 1QRKA 5DEGA 5EZOH 3BPLB 3HHRB 2F53E 4PLJD 5I1DA 1J0YA 4C83A 3U7YH 4QRTA 2VC2H 1DQMH 1NDMA 1EERB 3B83A 4LSSH 2GK0B 1U8PA 4KXZI 5SX5K 4MD0A 1C12A 2ZZUT 4TTDC 4HPYL 3OHXA 3T8XB 2DTMH 4JQVA 4LDOB 5C0CE 2R69H 3BKCL 1RZ8A 1U93A 1XGYL 5HYFA 4GG6B 3RVVC 5C3LD 1X5ZA 3QEUA 3SKMA 4QGTA 2Z8SA 2C7UB 3H3PH 2DL9A 4NJAH 5M7QA 2UY6A 2XY2A 4HWBA 1H15B 5LJYH 1UGNA 4XNUH 4HUUA 1B0RA 2CR6A 5J6HA 1CL7H 1N6UA 4HQQL 3K4ZA 5CEZE 4PJHA 3ZE0E 2A6JA 1INQB 2VDNH 4JY5H 4V1DE 2CO7B 3HC3H 1CD8A 3G5YA 5ERWA 4QTIH 4LF3B 3DX6B 1RU9H 1P2CA 3WS3A 2YPLA 2BFVH 2GJ6D 2NXYD 4J3TA 4NT6B 4Y0GA 4AL8L 1OAXL 3K3QA 5FAAA 1A1NB 3TYGL 1NFIA 4F58L 3LVEA 3OB0K 2DYPB 4WW2F 1FVEB 3KPLB 1OAZH 2GT9B 4HAFA 2A6DA 4OFDA 4WUUB 2QHRH 2W60A 2CDGA 3MGOA 5C8JA 4KPHL 3JV4B 5I19L 1MCCA 1TENA 5IW6B 5C0EB 1P6FA 4UNUA 2XZQH 5H35A 5KZCB 4H0IA 5IBUG 4QHKI 4OUOA 3HMWL 5CILH 3F7VB 4ESKA 5FOBA 4ZFZB 3KPSE 2R0KL 3MUGB 3QPXL 5DJCB 3WIHL 5BVJA 3LKRB 1M71A 1C5CH 2LU3A 3S37L 2AJVL 2XKNA 1HHGB 4UILH 5J1AB 5EZLB 5DD3L 5HYQA 1JBJA 4JKKA 2CLVB 2BNQB 5T3ZD 4PR5B 5I9QB 5D7JD 4YDVA 3BT2H 4WHYH 1LDSA 1NEUA 1LO4L 4HKJB 4PJFF 1R5VA 1G9NH 3JTSB 3VW3L 3U79A 2G60H 1NGWA 1OTSC 3GBNH 2VL4A 4Z7UB 1IBGH 5J3HC 4M7ZB 3LEXA 3HNTL 4HS8L 1GAFH 2XNAA 4P46D 4RGNE 1QBBA 4YXHH 5JXAH 3MRDA 1F4HA 1H3PL 3C5ZD 2VXSH 3HE7C 1ZLSL 2F8OA 3QUXC 4OZGA 5DJ6B 3MUHL 3U9PL 2NPLX 5CP7A 5KW9L 1U2HA 2G9HB 2V7HA 5DJ2B 5E9DB 1VACB 5FV1L 4M1DL 1FFRA 2B7DT 2OL3B 2N1KA 3CXDH 3PIQB 1INQA 3MQIA 4BUGA 1TJIH 2E7MA 1HHJA 3O6KH 5DK2B 4BSVB 3DUUB 3HG1E 5DJDB 3HKFA 3QEHB 3CPLA 1G9ML 5CGYD 1Z9LA 1L7IL 4KAQH 4NFBA 3GSRB 1CN4A 2X4RA 2OSLA 1J1OL 3AS2A 3EO9L 3RX5A 3DXAE 4QT5B 3ZDYE 3T2NL 2R1YB 1JF1A 2QV2A 2XACC 2YD9A 3DVGA 4S1SH 1RPQA 1QA9B 2A9ML 4S1DD 2GT9A 4XBEL 1JRHI 3O11B 5C08D 4EI6A 1DN0B 1NCBH 5DMJB 2O5YL 1WWWX 4U1NB 1KIRB 4Y5XB 2ZSWB 1S8DB 3B9DA 3JV4A 4YHLH 1JNNL 2AJYL 2AXGA 5IW6A 3BQUC 5GSRB 4WEMB 5DO2D 1OW0C 4OLXH 4O02H 3IJYA 2VLKD 2IPKB 4PGEA 4R7DA 3S4SG 4G43B 5F7HA 1VFBA 4XBPB 4L8SC 1A6AB 3AY4A 4OQTH 5FECB 2YD3A 3LKRA 4FFVD 4TOYL 5MERB 4HJJH 5INCA 5EFIB 2PW1B 1FAKT 1UG9A 3PE9A 2GYSA 3HNVL 2Z35A 5J1AA 3WXWL 5KSVB 5EZLA 3WKNA 2H45A 5CJOH 4KVNH 5I1LB 2CLVA 4OGYL 5ISZB 2BNQA 5IBTH 4PR5A 4LARH 5HGAA 1SVCP 4GQPH 4YHOH 1P4BL 3I84A 3RUGF 3MV9B 3O41B 4XNMA 4FABH 4AIOA 1KPRB 1HCFX 3S35X 4XPAL 2BNRB 5E6IB 4ZOCA 1GL4B 1IAMA 5F3BA 3LZFL 3QB7C 4FQXA 4PV8A 1DVFB 2AI0L 4U7KA 5FEBA 4GO6B 4M43H 1I8LA 3VCLB 5SWZA 1E6OH 3SDCC 1CTOA 3RJDA 2NY1B 2OR9H 2DDQH 4LBEA 4K3EL 4HBCL 5DJ6A 1J12A 3H3KA 3C5SB 4P2QD 1RHHB 3W0WB 3QDMA 2A74A 5DJ2A 2BERA 2ZWLT 2VDOL 4ODWA 4RBPH 3O2DA 4AJ0A 4GAGL 1KUMA 2OL3A 3QWQB 3T0EC 2VLRD 3SCMD 4Y16D 1GZQA 5TE6L 5DK2A 2CH8A 3AUVA 3DUUA 4PJCF 1JUFA 4MAYB 5C92A 3H9SA 4G6JL 4AT6B 5HPOA 1BFTA 2DQEL 5F93C 4F3FA 2UUDH 4TRPL 4LLDB 1AGFB 1J05B 1K2DA 1ZTXH 5GGRY 3C6LB 4M6OL 5DHVA 1EHLH 1NAKL 1UT9A 3EYFA 1T2JA 2HN7B 1BWMA 3FO2B 1QA9A 3E6FA 3RJQB 4P2OC 4FQCH 1DN0A 2GHWB 2JJSA 4JFFB 4FFZH 1IAKB 5JW3L 2WMPA 4QXTB 1HZHL 3CVIH 4Y5XA 3QIWD 2ZSWA 1S8DA 2H2SC 3MLYH 5F89A 4WI7A 2GSGA 1I3RA 1YYMH 1EAJA 4V2BA 2NXZC 5GSRA 4FZ8H 4WDIA 4G3YH 3S35H 1G7PA 4R26H 1M7DB 2R2EB 1PEZA 1FGVL 5C0DB 2IPKA 3AS1A 2HWZL 1U3ZA 5FCSH 4B0MM 5D70H 5FECA 1CFBA 5MERA 4LEXH 1P7QD 5EFIA 2PW1A 5GGSB 2J8OA 3V0WH 2IANB 2Q3AA 5JUEL 1MRFH 5KSVA 4APQD 2AJXL 5DUPL 5ITFA 1JYNA 4CADA 5D9SA 3TV3H 5I1LA 3U0PB 4C56A 1BQHB 3UJIH 2DIAA 1QSFE 4ODVL 3RKDC 3P4MA 4KV5F 5EB9A 4F57H 1ONQA 4BZYA 2AK1L 5J9PB 2Z0BA 4A6YL 1FCCA 4F9LA 2ZUUA 4X8JB 1DQLL 4CVXB 2H26B 5HYJD 2R56H 3X3GH 1F8TL 1DBBL 3QXUA 4Q0XH 5EO0B 4NPYA 1X5XA 3VRLF 3LKNB 3O3DB 1RZKL 5DR5L 2OI9B 3BJ91 2FX8H 4KI1A 1FZJA 4I5BA 1UC6A 5J56B 4KZDH 2B4CH 5EWIL 3TESA 1CZ8L 1KJ2B 1EZVX 5EOCH 3MOAH 4P99A 1Q0YL 4AM0A 2EDTA 1KB5B 3QWOB 5SV3A 2EYTA 3C5SA 2OXHA 1Q0XL 3MX0A 1NANH 4P9HC 1FL5B 1RHHA 4HFWB 5IMKA 2VUYA 3W0WA 3ZTNL 1TPXC 5DRZB 3QIUC 4NQED 3QNXB 2IG2L 2HVJB 1BLNB 2PXYB 2WBJD 3QFJD 4GS7C 2F53B 1JNHA 3TIDA 2PTVA 4YZFE 4MAYA 4U1HB 1EX0A 4I9WE 4J12A 4KC3B 4XH2B 3RI5K 4DWHA 3NZHH 3CGTA 1KNOB 4RX4A 3TJEH 1DBMH 2XWTB 4LLDA 5D2LF 5GHWL 3KPOB 5I17A 1HI6A 3QIBA 1I1FA 3MRNB 5E2JA 1QFPA 2KQNA 4NQDA 2DIBA 4ISVA 3HB3D 3MACH 1RJYB 5C0CB 3THML 3AU1A 3FMGH 4M3JA 4XAKD 2YC1A 4JFHD 4JN1H 3WNLA 3VXUE 4D9QD 3B5HA 12E8H 1AO7E 1NLDH 3OF6D 4X6BB 4PJIE 3QEQD 4PJXA 3FN0L 3U7AA 4Z7NF 2HJLB 1NUDA 1D9KB 4PRID 3UTQB 4J7RA 3UJTH 4RAVB 1FG2B 4XVUD 4DEPC 3GMNA 4NQSA 2XN9D 5EDXA 5GGSA 5T1DL 4M6NL 3QAZB 4EDWH 1OP3H 1TXKA 1YY8B 4QOKA 4OD1H 3K0WA 3VFOA 1AGDA 2BVYA 3EJYD 4OI8A 1QYGH 1V8HA 2NTSP 1T6WA 2FD6H 4GW1B 4I3RH 3MRHB 4BM7A 3UC0L 2APVA 1C16B 2N7BA 4ZYKA 5L9DL 5DVLA 1OM3H 5C70A 2PO6B 1RV6X 1IVLA 4X8JA 2H26A 3UTTE 1QSEE 2NY5L 1KJVB 2ZCHH 3QDHA 3LKNA 3O3DA 4PRDB 2BVQB 5ICXB 5FUZL 1TJHL 2V7NB 3MLPA 3MCG1 2B1HH 4HWBH 1NFKA 5I15H 4JDTL 3U36B 3IF1B 4IRJD 4HJ0C 4WFHE 5D7LA 5I8KL 3IAGC 3DUHA 1KJ2A 1EBPA 3CIQA 5HHOA 3QWOA 4HWUA 4LEOB 1MNUH 5HD8D 3KPSB 1T89A 4HWZB 4P5KB 1ORSB 5DLMH 3VXME 3MLTA 3QZWA 4ELMA 4HFWA 2Q8AH 2AEPL 4KRPC 1ZHLA 3VGAB 2VQTA 2FJHB 4M7JH 2OZ4A 2AV1B 4NN5C 2EDHA 2ZOKB 4KDWA 4PP2B 1J7VR 3ARZA 2LAGB 4FTVB 5I30H 5D7IF 1R3IH 4H88H 2EO1A 5I1KL 1F6LL 5HXMA 3I50H 2J6EL 5GJTL 1X44A 1QG3A 2KZ1B 3UBXG 3MV8E 2XFXA 3KPOA 1M6OB 4QXWA 4YHZL 5FM5M 4J2XA 5KS9B 2FB4H 1FGNH 3P73B 2XZCL 4L3EE 4LASH 4Q97A 3I2CH 4RGNB 1N2RB 2QQKH 4I77H 3FFCD 5D1ZD 5F6HJ 3V8CA 5C0CA 1GC1C 3AROA 4K3JH 2UZIH 1OPGH 4HKBB 1GOHA 4XGZA 2APFA 2XI9A 1WGOA 1GGIL 1QLEH 2E6PA 1UM5L 5HY9B 5I1EL 1JGLL 4Y1AE 2FATH 5DMIL 2DQFB 1SMOA 2R2HB 1ZA6B 3NACH 3SO5A 5I8CB 4G6KH 1D9KA 3MRCB 3V6FA 1FJ1B 5EN2A 4ELKA 3LH2L 3LQAC 1FG2A 4JY6A 4RA0C 2HT2C 3QJHB 4V1DA 2A1WL 1DDHA 3QG7L 5I1JL 4XCYA 2JCCF 2PYED 3MNWB 3PHSA 4JRYD 3KJ6H 4WW1B 2R23B 3RVTD 1BD2D 4FZEL 1L0YA 4KMTH 2ICWJ 3GMOB 4KUZL 1C5BH 3O4OC 3QO0B 4D9RD 1RUAL 2ITDB 3SDAC 4EQ3A 3GSWA 1C16A 2VXQH 5KAQG 3CSBA 1CT8B 4PJ5A 4U6TA 4L9LC 4JO2L 2YKLH 5DHYB 3RP1A 3VXTA 4J4PA 4X9BA 1EZVY 1T20A 3K8KA 3L3HA 3W9DB 1KJVA 3U30C 2QR0B 3S8WA 3JWDC 2BVQA 1NBYA 3LKOB 2VDRH 4YH6A 1I7UB 1MFAL 3ZYJA 1OAKL 1UJTA 4GKSB 5L6YH 4R0LA 15C8H 5K93A 4PG9A 4NQCD 4LEOA 1YPZE 3WN5A 4HWZA 1ORSA 1NGZB 4WVRA 2D7PA 5AWNL 1NCTA 2C5DC 2CLZA 4Z6AT 1DSFH 4PJ7F 3RWEA 3NAAL 2FJHA 1ZXQA 2APXA 2R4SL 3WE6B 1KEML 4E41B 5DRWB 2AV1A 4QRUA 1NGQL 2GJ6E 5C09D 1MJ7L 2MCG1 4F7CB 5DD0L 4JY4A 3JWOH 4LK4A 4D3CL 2GTWB 4XVJL 1L0XA 3KDMB 4RAHA 5DK0A 4L4TB 4R4NC 5CCKL 1M6OA 1K8IB 1JYWA 3ZKXC 4UNVA 4I3SL 5T1KA 1KLGB 4MJ5B 4LCCC 2WV3A 1VERA 1ZLVK 4BYHA 1F4WL 1WTLA 1UKQA 3UX9B 2X5PA 1W8NA 4CKVX 1N64L 3CX2A 4KI5C 1SMAA 2VDML 1UVQB 1FORL 2ZPKH 4XAWL 3LY6A 5HY9A 4G6AC 2ATPA 3G04B 2DMKA 4I0PB 5GSVB 4PJ8B 5MP6L 5JNYA 4OD2A 2Q20A 4HJGA 1HSAB 2BSRA 1MFBH 3MOBH 2H8PA 4L29B 1TJGH 5AYUH 2IH3B 3R06B 3EYVA 3HG1A 2PN5A 1U8KA 1T03H 4WI5A 4YGVA 1JTPA 4EDXB 3BP6B 4PJ9C 4NC1E 4M6AA 4YO0B 3TYFB 2UWEB 3GBMH 4C4KT 1GPOH 3QO0A 2ITDA 1MY7A 1WV7T 3DXAA 4N0CD 4M9OA 3FQNA 4GUPA 1BM3L 3JTTB 5JIHA 2YA2A 3DV4B 1EHXA 1YYLL 3KYKL 1UFUA 1NMAH 2YBRB 2Y07H 2EDLA 3BSZL 3HAEG 3IGAA 3K46A 5IESH 3CJJA 1T1YB 4J6RL 4QRPE 5EU4B 3WL9A 5B4MC 3ULVL 3MGAA 1AY1L 1V7ML 3RWHB 2DBLL 3EHBD 4G6FD 3PDGA 3SE9H 4Y4HD 3B9KB 3O9WD 4W4OC 1JFQL 2WWKT 3T4YA 3O2DH 2ZJSL 2OL3H 1LNUB 3NABL 4JPVL 2DTSA 1OGTB 1J86A 4Y4KD 3ZTJH 2Y06H 4FQJL 1CLYH 1A2YB 5MEPB 3RVWD 2DWDB 4OGAD 3RBGA 4Y5VB 1TMCB 4NDMA 4Z95L 4WRLA 1I3GL 1SM3H 1QSFB 4ZDHB 1ED3B 5DHVH 5ETUA 1U8OB 5DEFB 2GTWA 2G5BB 2X4UB 2AK4E 3KDMA 5E2UL 1LO2L 2ED7A 4DJMA 3RIFK 4MLIA 4ERSL 2QADC 4LKXA 3GI8H 2DLGA 3C2SA 4ZAKC 3IKCA 3MRBA 5BQ7B 4MJ5A 1S7RB 4JDVA 2Y36L 3ULUH 1U42A 5B38A 2VDQL 3OAUL 4F7PB 1OSPH 3JVGC 1T5WB 3CFCL 5J8OA 2Z8VC 3C6LC 4CU7A 2XXMB 1UVQA 2DKUA 2VLKE 4AENB 4KK5C 3V52L 5CSZB 1FIEA 3W9EB 3FB6B 3SBWA 4I0PA 4W6WB 4PTUB 3BUYA 5LAXA 1IAII 3C08H 3OBAA 5EBWB 2VXUH 4IOIA 5DUBA 1Z9SA 1HSAA 2ZOLB 2NY4B 2GUOB 3B5TA 4L29A 2R39A 1HN1A 2IH3A 3ARTA 3VFGH 1WCBA 2P8MB 3HZYA 3VFMB 4EDXA 3JSSA 1NFDE 1AQDA 4E0RB 5F7DB 3GSQB 4YO0A 5HVHC 4UDUB 5J7CC 2GJZB 2FBJL 4CMMA 4HWNA 3QI9C 2BSSA 3DNKA 3V5HB 3JTTA 4XHQA 1PJ9A 3PP4H 2V5SA 3HE7A 2YBRA 4KI5E 3QCVL 2FX7L 4PJDE 1Z9MA 2XA8L 3D87B 3DBXB 3TC9A 4XWOC 4AQOA 2MPAH 4NKOA 5AG9A 2PR4H 3LS5H 5EU4A 4UTAL 3ZE2F 3OKLA 1EA9C 4RRPG 3NIDE 1PYWB 2ERJB 3GB7A 3QCUH 3VXUB 4GG6F 1LILA 3FN9A 3RA7L 1N4XL 1AO7B 4JJHA 4YX2L 3QUYD 3B9KA 3DO3A 3DYOA 4OZGF 2BMKB 2VR9A 1IGJA 2YWZA 4O5LH 4MXWL 3D0LB 1OGTA 5IFJB 2ICWB 4NKQB 3ARGC 3BX7C 3QQ9C 4MJIB 1A2YA 1CLOH 4KKBC 3RPIB 4NZJA 3IDNA 1AXTL 4Y5VA 4JZOB 3IFPA 5HDBE 1D5IH 3BPNC 3NA4A 5CJQH 5C0FA 5AAMA 3CD4A 4N8CH 4B50A 5IG7B 4RQQA 3ARQA 4Y19E 5KOMC 2X9YA 1P9MC 5I1CH 3FO0L 2Y4SA 5FYLD 2IAMD 1PQZA 4R4BB 4XXCC 3AREC 1D5MA 4YUEH 4KTDL 2Y25A 3GMLA 4HC1A 4DUXA 1E0OB 4NQXB 2X4UA 1T0PB 1QEWA 4K94H 2VWEE 3T3PF 3UTTB 1QSEB 4YWGL 1B2WL 1T3FA 1RIHL 5BQ7A 3EO1A 3LHPH 4M61B 2NZ9C 3BQUA 1HHHB 3L5XH 3EFDL 4TVPE 1T4KB 2VDPL 4NKMB 4F7PA 3RL2B 3N1PC 5BV7C 1OARH 3GMPB 5KVEH 4L8SA 2IBGA 4K71C 5F9OL 1N5AA 2YSSB 3Q2CA 4DW2L 1BQLL 5CSZA 3VXMB 4FFYL 5JR1L 4PTUA 2IQAA 2V5TA 3CH8A 1JTTA 4MNQE 4XZUB 4JG1L 4OT1L 1RVFH 5BXFB 5I73C 1DBJL 1W72A 1KJMA 2I5YL 2W38A 1T83C 4HWEL 1HINH 3RVXC 3B3IB 5KVMC 4MWFA 4FQ2L 3LMJL 4WJ5A 5CJXC 5GZND 3R4DA 2A0LD 3G5ZB 4UDUA 3MV8B 5FYKH 2N56A 4ONHB 5CGMA 4L3EB 3RZCD 3MLRH 4NZTH 3SDCA 1Q38A 4Q9QH 2HFGH 1Q9WA 1T0NB 1RQ5A 4BFEA 4NWUL 1TVHB 5C0RH 1F2QA 1KJ2H 1EGJL 3VD3A 3TH2T 2M26A 3MV11 3VXUA 4ETYA 4Z5RB 1B4JL 4NKIL 5DRNA 2BVUA 2JK5B 3E8UL 4PJIA 3QDJA 5DVKA 1LEKA 4NYLA 3TVMD 3UCRA 2OZ4H 3MRRB 1ZT7B 2V17L 4LPUA 5IFJA 3MRFB 1VFAB 3VWJD 4F7MA 3QFJE 2DLHA 4TNWK 4S1QL 5IBUB 4X9IA 4JZOA 1UWXK 1Q72H 2OXGA 4MQ7A 5CJBA 2ZUSA 3WFEH 2IJ0C 3S3PA 4G7VH 3PL6C 2MOVA 1TDQA 3FQWB 4R4BA 3MRIB 4O9HH 4UBDC 4S2SB 4UT9H 4P2OA 4A2LA 1Q8MA 4XNZB 4NQXA 4RGMC 5FCUH 3CC5A 3DTXA 5GJSH 2I60L 1ZVYA 4CN4A 1X5LA 4UV7H 1E4KC 2IH1B 1MCFA 5GS0C 5KSAD 3U2SA 4WO4D 2OCFD 2VB5A 4KROC 4UI2A 1HHHA 5JORB 1S7XA 5DQJA 1D6VL 3C5JA 4N68A 1IL1B 1FN4B 1VEPA 1EAPB 4LVNC 4HHAB 4D9QE 1FPTH 3GMPA 3QULB 1ORQB 3TM6A 1QD0A 1TZHB 5L7XL 4PRIE 3NH7H 3AB0C 4HV8A 5CEZH 1YPZB 4M1CC 3VXMA 4WFED 3VXNB 5MHSD 1A7QH 1UWGH 3BZ4A 4XVTH 2X1OA 4HIXL 3OKOB 1KN2L 4PLNC 3L3DB 3PQYE 1TQBC 2GJ6B 2NXYB 5C6PB 3