1HIAB

Kallikrein complexed with hirustasin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KALLIKREIN
publication title A new structural class of serine protease inhibitors revealed by the structure of the hirustasin-kallikrein complex.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (protease/inhibitor)
total genus 29
structure length 150
sequence length 150
chains with identical sequence Y
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hiaB00
2BZ6H 2B9LA 4JYVH 2PGBB 1TRYA 3RXAA 1ZMJA 4BANB 3SHCH 2NWNA 1NU7B 3QTOH 1LVYA 1BMNH 5IYTA 2BMGB 2FP7B 2GZ8A 1KXFA 1O5CB 3D23A 1O2TA 1SGTA 3A86A 3H7OA 1WBGB 3KN2A 5DP6A 1ZPBA 1GBIA 4BAQB 1FI8A 3MWIU 4XBDA 1DSTA 4K2YA 1TGCA 3GY3A 2A5AA 1GG6C 5FPSA 1QFKH 1GI8B 3NCLA 3T28A 4AORA 1D6RA 3MNXA 3BEUA 1AD8H 3OY6U 1Y5AT 2GZ9A 1OSSA 3A8AA 1A0LA 1ANCA 1V2QT 2CF9H 1TRNA 1UCYE 1C1VH 4K60A 1O30A 2EI8A 1FY1A 1WUNH 2TPIZ 1LCYA 1MKWK 2M5TA 1TQ7B 2FX4A 3V7TA 1JXPA 1YP9A 3U1JB 1F7ZA 4X8SH 1GVKB 3RU4E 1C5OH 4DURA 1P02A 3GDSA 4B75A 5A09A 3MH7A 2WINI 1C1WH 1XXFA 3RM2H 1F5LA 4MQAA 3M35A 1BCUH 1NRSH 2RA0A 3U8OH 1W10U 1BTZA 5JPMH 1ABIH 1O2YA 1XUIA 4JMYA 3OY5U 3DD2H 2GX4A 1NT1A 4MG3A 4X8UH 1OWKA 3MU4A 4KTUA 3TGKE 3SV9A 1BTUA 1IQGA 1FNIA 2Q6FA 5C1XA 4OS1A 1IQIA 1P2IA 1W2KH 2BQ6B 3K9XB 4OGYA 2B0FA 1O0DH 5PTPA 4X1QU 1EAIA 3BF6H 5E0JA 8GCHG 1L1NA 1SGFG 3C1KA 2A7JA 1HAPH 4X2WA 3ZVEA 1GWAA 2XBXA 1TOMH 3A83A 3SU0A 3LDXH 1K1MA 4WH8A 2LPRA 5ESBA 3N7OA 1EKBB 4TYDA 1DICA 1O39A 2ZU1A 2BYAX 3T5FH 1L4DA 4CRAA 1MTUA 4GSOA 1SPJA 1V2MT 1QJ6B 1MTNC 2F91A 1FONA 3RM0H 2HALA 1BRUP 2AMPA 3U8TH 3M7TA 4AOQA 2XW9A 1HV7A 1P57B 2O8WA 1BMLA 2KAIA 3GCOA 5L2ZH 3GCHB 4NZLA 1C1TA 1OPHB 1HJ9A 1YCPM 1ANDA 4A1VA 2ZTZA 1W12U 3GICB 5DKMA 3M5OA 4X8VH 1GG6B 3OSYA 1GGDB 3UQOA 1A3BH 2R9PA 2XXLA 3CP7A 1NY22 2P3UB 1ARCA 1SC8U 5HYOA 2KAIB 3BTKE 3BTFE 1LHFH 4NSVA 2BM2A 5JYIA 1F92A 1RIWB 3MH6A 4X1PU 1FAXA 1UTMA 3QDZB 1DITH 1C9PA 1SQTA 3V0XA 1ID5H 3RXFA 5F6MA 1CGJE 1THRH 1W7GH 5L30H 3DA9B 3IWMA 1GJ9B 5E0HA 3F9HA 2BDAA 5K0HA 1QJ7B 2A5IA 1C5RA 1OWEA 3ZVGA 2BVRH 1B7XB 1GCTB 1BTYA 1GI2A 4GPGA 1ZOMA 1V2PT 1T8NA 4MPXA 3BN9A 3TJUA 1A5GH 2P3FH 4K8BA 1O5FH 5L6NH 1O3IA 1O32A 2VGCC 3R3GB 4D8NA 1LQEA 1HAYB 1V2WT 4MTBA 4U2WA 4GUXA 2QXHA 1TGBA 1XUJA 2QIQA 4X6NA 1L4ZA 8GCHF 4MVNA 1KDQA 4NFEA 2ZGHA 3SNAA 3LGWA 3LT3A 1UTKA 1NRPH 2Y5GA 2FOHA 3SJ8A 3DHKH 2PHBA 5E8EH 2ZWLH 5EGMA 4ZROA 2A1DB 3S0NA 1L1GA 2ZG0H 1FV9A 3LIWA 3MU8A 3P70B 4ZUHA 2XCNA 1SGRE 1SHHB 1SGNE 2ZFTA 9ESTA 2QXGA 1ELFA 1SR5C 2ANWA 1ACBE 3DFLA 1GMDG 2VVUA 1DOJA 1LVOA 1GHYH 1S0RA 1HB0B 4HI3A 4BAHB 4JYUH 4B2AA 3L3TA 4FVDA 2XC5A 1T8MA 4ZHMU 3ZZ5A 5E2PA 3KQDA 1PQAA 1BOQA 1UTNA 3NK8A 5EQQA 1O3DA 4CREA 2V3OH 1ZTLA 3RMNH 1UK3A 1GJAB 3LGYA 1AWHB 1F0RA 2ZP0H 2ZFPH 4NCYA 3CS0A 4IC6A 5C67A 3L33A 3BTGE 4TWWA 1ZSKA 3HATH 1FDPA 1UMAH 5EW1H 1O3OA 1CO7E 1Y3WA 4FUIA 5DP8A 1LHEH 1L1JA 2BQ7B 4Y7BA 1ELDE 5EOKA 4OS6A 3L6PA 1QRZA 3LGUA 2BQWB 1TNJA 1ESAA 1QBNA 3UPEA 3NPSA 3SGAE 1O3HA 2H9EH 1CSOE 2CN0H 1EZXC 1QRWA 2NU1E 3A85A 3PM3A 4ZKRU 1EAWA 1HAVA 2ZZUH 1DS2E 5AVDA 3RU4T 2FTLE 4BAOB 2FM2A 3TH3H 5JBTA 1E0FD 3SJOA 4DG4A 5JB8S 2ZDKA 3S9AA 4Z6AH 2BLVA 3AASA 2ZGCA 1C5ZB 2RA3A 3VGCC 3D65E 1SMFE 1XUHA 1HLTH 2BTCE 4D9QA 1YCPH 2ZDAH 1GHAG 1U6QA 3P6ZB 2OC7A 2BDHA 2XYAA 2FPZA 4J1YA 1VITG 3VB6A 1O34A 6CHAB 1HAVB 1MZDA 1GJDB 3FZZA 2VU8E 3MYWA 1DWDH 1BBRK 1S6FA 1EB2A 2F9VA 2Z3CA 1UTJA 3ZZ7A 1ZLRA 2A2QH 1G37A 2JH5D 3RC5A 2F9NA 2FX6A 1IQMA 1BRBE 3B9FH 1EOLA 4Y71A 3BTHE 3T2NA 1GBEA 1OP2A 2SGAA 2ZECA 4UFGH 4CRDA 2GT8A 3U8RH 1OKXA 2D2DA 4XBBA 8LPRA 1N6XA 2AFQB 2WPJS 1O3CA 1GI5A 1P2MA 2OXSA 1O2XA 1HPGA 1GMDF 4WVPE 6LPRA 1MUEB 2QCYA 1SHYA 1O31A 3E91A 5C5NA 4WF8A 4O3TA 1UTLM 1VGCC 1DY9A 1RXPA 1Y3VA 2ANYA 1RTFB 2A4QA 3UWJH 2GDEH 4NIWA 4WY3A 3TNTA 3VXEH 2ZC9H 2VINA 2VNTA 2VIOA 1OYTH 3PLBA 1Y5UT 1QQ4A 1C1OA 1DWEH 2IPHA 2W7SA 3PLKA 2XCFA 2WUBA 4A1XA 1O2HA 1QL8A 4AG1A 1O2SA 1QL7A 4ZHLU 5CHAB 1J15A 1IQJA 1RS0A 4FUDA 2CXVA 1QNJA 1TMTH 2A7HA 1LKAA 5A8YA 2PKSB 3B8JA 1G3BA 4TY7A 3PO1C 2QYIA 3RMLH 1GL1A 2QA9E 1TPAE 3DFJA 5F8TA 1HAOH 1E34B 3RLWH 4IC5A 1WAYB 3QGNB 1EASA 2FODA 1CVWH 1SLWB 2SGDE 1G30B 2LNCA 1TRMA 3O8BA 1ZMLA 2FESH 3JZ1B 3UREA 2SNVA 1ZHRA 2ANKH 4UD9H 1NS3A 2GCHG 1AVXA 1K1LA 3UQVA 1GHAF 2FI4E 1BRCE 1VITF 1HAZB 5FPTA 1AMHA 1CBWC 1Z6EA 1NRNH 3S9CA 2Y7XA 2BLWA 2WV5A 4BAMB 1HJ8A 4THNH 2OTVA 2ZCKP 1F0TA 4CH8B 5FAHA 3A80A 3SBKA 1KXAA 4YESB 4ZKSU 1A4WH 4WWYA 1WQVH 4MPVA 4YT6H 4E7RG 1S6HA 2VIQA 4MNVA 3KNXA 2XBWA 2VWLA 1GI1A 1G2LA 1A0JA 1BTPA 5FXLA 1C2HA 1B5GH 3BG4C 3V13A 1QCPA 2PR3A 3VB5A 3TNSA 1TGNA 4ZAEA 1BT7A 1S81A 5C2ZA 1VJAU 1VCQA 3D62A 2W3KA 2OQUA 1UTPA 1THSH 3QO6A 4FUEA 5A2MH 1VGCB 1NROH 1A2CH 1MD8A 3ZZ8A 1SG8B 1G36A 2P95A 2ZHDA 1QB1A 3M5MA 4D9RA 1S0QA 1YPMH 2CV3A 8ESTE 4JZIA 1ANEA 1EJAA 1XUGA 1AZZA 1G3DA 1MTVA 5DGJA 5L2YH 4KTSA 3ELAH 1TPPA 3SOSA 2UUJB 2BD8A 5EG4A 2F9PA 4HTCH 2ZGJA 3W94A 4D7GA 3F9EA 1C5NH 1C1RA 4FUGA 4NA7A 5GPIB 3SNEA 1TGTA 3RXVA 2VIPA 1EJMA 1LMWB 4TPYA 1ANBA 1T4UH 1Z8JB 2GCTC 1AB9C 3UOUA 1QTFA 1Z6JH 2CMYA 2AIQA 3A87A 2D1JA 3KQEA 4Y7AA 4O3UA 1QR3E 1P04A 2IOTA 4Y0ZE 2VB0A 1QBVH 4IMQA 4YTAA 3RC6A 1D3DB 2ZQ1A 4I31A 1S85A 1GHBG 1DUEA 1BTXA 3RXHA 1TFXA 1MD7A 1P8VC 2FLBH 2OD3B 3SJ9A 1C5YB 1FPCH 2ZF0H 1K1JA 1GDUA 1SL3A 4XOJA 3VPKA 4YO9A 3TH4H 1KTTB 2UUKB 2G00A 2GCHF 1C1MA 1E38B 1YPGH 3UFAA 1BB0B 4NFFA 4NGAH 3E90B 1FY8E 3EYDA 3PMJA 1GI9B 1F0SA 2GV6A 3GCTF 2GMTC 3GY5A 3MHWU 2AMDA 1HAHH 1ELGA 1Q3XA 1HIAA 3UR6A 4X0WU 1WTGH 1V2VT 1BZXE 1IHTH 3HK3B 3OX7U 1ETTH 4XBCA 3SU4A 2ZNKH 3RXRA 1A46H 4UDWH 1O2LA 4K1EA 1UTOA 2W5EA 1QY6A 5GDSH 4K8YA 3SU2A 1G3EA 2I6QA 3CENA 4JCNA 6ESTA 2WPHS 2ZEBA 3ZVBA 3ATIA 1A5IA 2F3CE 1P3EA 1C2GA 1V2RT 2PTNA 1HIAB 2VJ1A 1O35A 1FPHH 4DGJA 1W14U 1PYTC 1TALA 1C2JA 2FOMB 1SLXB 2ZFQH 2FOEA 1C1PA 4XSKU 3A89A 2PFEA 3GYMA 1ZHMA 3ODFA 4YM9A 2TGAA 1O2JA 2PUQH 3SO3A 1FUJA 4NIVA 4I8KA 4E05H 1NZQH 2Y5HA 2HNTF 2RCEA 1Z1JA 2BOKA 1HAGE 2ODPA 2UUFB 4IMZA 2VH6A 2ZO3H 3ZZBA 4Y79A 1O33A 4JZFH 1C5UA 1GI6A 1O5EH 2PSYA 4FU7A 2FI5E 3ZYEA 3SV8A 3LC3A 1BJUA 5C5OA 3UR9A 2CGAA 4X1SU 1TOCB 2SGFE 2OINA 5HMAA 2UWOA 2VVVA 4HGCA 3ESTA 5A0BA 3BTEE 4HFPB 3F9GA 3F6UH 2GD4B 1Z8GA 3HGPA 2J94A 1GHBF 3K65B 2BY9X 5LPRA 1AO5A 5A8XA 4WXIA 1AFQC 4FVBA 4KELA 9LPRA 1SGDE 3QX5H 1K1IA 3T27A 4ZH8A 1O37A 2Q1JA 3MNCA 4KKDA 4A92A 2XWAA 3A7YA 3E0PB 1AE8H 1P10A 3A7XA 4H4FA 5FPYA 4I8LA 4I8HA 4U32A 1G2MA 3GY4A 4XFQA 2XWBI 1C5WB 1EAUA 1PPCE 2ALVA 3PTBA 2GMTB 1GHWH 2WPIS 1THPB 2ZCLP 3SU1A 3URCA 1S83A 1GBLA 3I78A 2I6SA 2OUAA 4WMEA 3T29A 4H6SB 4XDEA 3LU9B 1D6WA 1VR1H 2BY7X 5H4IB 4I32A 2ZDVH 1GI0A 1NN6A 1ZSJA 1ZGVA 1HGTH 2BDCA 3M3TA 1QJ1B 1NFUA 1OOKB 4CBOA 3QGJA 1KLJH 2YNBA 1LPGB 4YZUA 4ZKNU 2FOCA 4OS5A 1WCZA 3LC5A 2JKHA 3MU0A 5JBCS 3E8LA 1O2ZA 3FP7E 1ESTA 5DO4H 5EQSA 3B23B 3MFJA 2VVCA 1N8OC 3ENSB 2F9BH 3JZ2B 4ABIA 2Z9JA 3KCGH 3V12A 4AB9A 1IQKA 2GTBA 1ZRKA 2A4GA 3ATKA 5GCHG 1C1UH 1C1SA 1SGYE 3A88A 5B6OA 2STBE 5HXFA 1HBTH 5FCRA 3GYLB 4YLQH 2FDAA 7ESTE 2B7DH 1DXWA 3PWCA 3HKIB 1AQ7A 3MH5A 1QB6A 4INKA 3BTWE 3FANA 2H5DA 1F5KU 1BBRE 1YKTA 4DVAU 1CE5A 1DX5M 1YCPK 2HVXA 2ZIQH 2UWPA 5J4QA 2EEKA 1CGIE 2G5NA 4ABEA 4DOQA 2OLGA 1GVZA 3ZZAA 4AFSA 5AF9H 4H6TA 2XC4A 3ZZ9A 3E16B 3MTYA 3A8CA 1KSNA 1JOUB 2BD3A 4B73A 3EAJA 3OTJE 2H9HA 3Q00A 4ISOA 2ZFSA 8KME2 2QC2A 4INHA 1K1NA 1EPTC 4ABGA 3BEIB 4PROA 1HJAC 3RP2A 1HXEH 1Y5BT 1E35B 1Y59T 5LPFA 5BPEA 1GBHA 1EXFA 3ZV8A 1MKWH 2RG3A 2Z94A 1P06A 1JMOH 4MPUA 3SQHE 3A82A 1L0ZA 2PGQB 3AVZA 4Y8YA 1P11E 1ELVA 1TONA 4VGCC 1C5MD 4NZQA 1Y3XA 4DIIH 1C2EA 1TX8A 4Y10E 1YPLH 2ZPSA 1KXEA 1O36A 4AGJA 3OYPA 4I8GA 1MTNB 5HM9A 2C8ZB 1TX6A 4A5TS 5A8ZA 2A45B 4ABDA 1MU8B 1ZSLA 5DK1A 1YLCA 4B1TA 3SU5A 2CHAC 1H9IE 1UVPA 3W95A 3T62A 2Y81A 1KDQB 2C93B 3CS7A 4ISIH 1T8OA 3RU4D 3T25A 1NO9H 4AYYB 1DFPA 4X6OA 3UNRA 1VZQH 1HCGA 1YPJH 1M9UA 1O2VA 2HPQH 2C8WB 1C4Y2 1ESBA 1BQYA 2FIRH 2NU0E 2HLCA 3RXTA 2QF0A 1O5AB 3EE0B 4YOJA 1LKBA 1KXDA 3UNQA 1A61H 5FCKA 3TITA 1AZ8A 4UFDH 5GIBA 1O2NA 7LPRA 1TGSZ 5GCHF 1ZTJA 2ZU4A 1EOJA 1NFXA 3FFGA 1AGJA 1O3PB 4K69A 2Z7FE 3RXGA 3SUEA 3TK5A 4AYVB 1LPKB 1TQ0B 1AIXH 1ZPZA 2ODQA 3TGJE 1K2I1 1KLIH 4CH2B 1GI4A 1NM6A 1AE5A 1SI5H 1DLKB 2WUCA 4AN7A 3NUMA 1WU1A 5CE1A 2ZDMA 3TGIE 2BY6X 1NC6A 1GBCA 3SQEE 1MCTA 3ODDA 1SGIB 1NRRH 3A81A 1S82A 1TNKA 1JWTA 2TIOA 3RXLA 1EZSC 4IGDA 4TY6A 1RD3B 2P94A 2EC9H 1IQLA 4ABBA 1C1QA 1DPOA 2BLOA 4M7GA 3BIUH 1TAWA 1ZZZA 2BDBA 1XUFA 3BSQA 2Y82A 4U30A 3SGBE 2W3IA 1J9CH 2VGCB 1C5LH 3S9BA 2R3UA 1DE7H 2ZGXH 4Q80A 3QZRA 4CHAC 2ZQ2A 2JETC 2XBYA 1Z7KA 3SV2H 1C5XB 2AGGX 1KIGH 1MAXA 1EAXA 3ZVFA 1GBMA 4DCDA 1KTSB 3HKJB 2Y5FA 2Y80A 5DP4A 2TBSA 1XKBC 4GVUA 2OCVB 2FS9A 1J8AA 1K22H 1QRXA 1GL0E 5F8XA 2P3TB 1TPOA 1UHBA 1O2QA 2V3HH 4UEHH 1SFIA 4Q2KA 5JDUB 3NKKA 2Q6DA 1BIOA 1O2RA 1YGCH 5FX5A 5TCCA 5I25A 1O3GA 1GMHG 3ATLA 1TWXB 2Y7ZA 1UCYH 1P12E 3P8FA 2UWLA 2TGPZ 4BTUB 3AW1A 1MQ5A 1SGPE 5K7RA 1IOEA 1HUTH 2XTTB 3FAOA 5T6FA 1WYKA 3QUMP 1CT2E 4Y0YE 1XX9A 1PPBH 1EUFA 2SGPE 1DWBH 1UHBB 3LONA 2H2ZA 5HM2A 1GJ8B 1IHSH 1QQUA 2BXTH 1PPHE 4WJG2 4RN6A 1HAIH 3LGIA 3M37A 3AW0A 2H5CA 3VFEA 1K28D 4I7YH 1JRTA 1SQOA 1GMCG 2ZHFH 1CGHA 1O3LA 1FN6A 1P3CA 3SJKA 4LOYH 3SNBA 3SI4H 2ZCHP 1EX3A 4FUBA 3K6YA 1P2KA 2EI6A 4AG2A 1EP5A 1ZPCA 2P8OC 1FIWA 1V2ST 2R0KA 1KLTA 1RJXB 2BVXH 3TPIZ 1C2IA 5GXPA 3GCNA 3UWIA 3MI4A 1YM0A 2F9UA 3LOXA 3RXOA 1L2EA 1QA0A 2H6MA 3WY8A 2A4OA 2C8XB 2BD9A 2XC0A 3I29A 4GCHF 1J17T 3U69H 3VGCB 1C1NA 1AU8A 1T7CA 5C1UA 1C2MA 1Z71A 3PROA 3SV7A 3RLYH 3U9AH 1EATA 4BTIB 2DE9A 2QV1A 4TWYA 4JYTA 3SW2B 2O8TA 2ZTYA 3GCTG 4Y76A 3EQ0H 1AI8H 1UVTH 3ZVCA 1LVMA 4Y8ZA 1V2LT 2BDIA 2HNTE 1H4WA 2J9NA 4X2YA 3SV6A 1T31A 1UK4A 4SGAE 3A7ZA 1XVMA 3DUXH 1TNIA 6GCHG 3RXBA 1XUKA 2QXJA 1TPSA 1TBRH 3KGPA 1BHXB 1GMHF 1OWIA 1ELCA 1P2NA 2W7UA 1NTPA 2VWNA 1KXBA 3SUGA 2Z9GA 5HGGA 1K21H 3MO9A 3TJNA 3I77A 2J34A 2C3SA 1ORFA 2XBVA 2SFAA 2QGRA 4FUFA 2TGTA 3P8OA 2AH4X 1AHTH 1BBRH 4R0IA 4ZXXH 4YLUA 2THFB 1BDAA 3ZZ3A 1SOTA 1A7SA 4CRGA 3VXFH 4AFQA 1FQ3A 4JZEH 1SGCA 1XXDA 1G32B 5EXNA 4U01A 1GMCF 2OC1A 1W3CA 1H8IH 3RXCA 4O9VA 3GY6A 1V2OT 2P59A 5I46H 4X1RU 5F03A 2Z9IA 1CA0C 2ZI2H 2OBOA 3D49H 1PYTD 3RMOH 1SGQE 1W11U 1JIRA 1DLEA 1DUAA 1O3MA 1TLDA 3ZZCA 1A3EH 1SVPA 3PO1B 3E1XB 4IW4E 2G4TA 4ZKOU 1GBDA 1LO6A 4RKOB 1XM1A 1P01A 1C2FA 1FZZA 4DJZB 4Y11E 3SNDA 3AAUA 1ETRH 1OYQA 4IS5A 5AFYH 5DPAA 3MO6A 2F9OA 3SJIA 2AEIH 3Q3XA 2FI3E 1GDQA 4BNRA 2Z9KA 4UFEH 5DG6A 1GHZA 1BTWA 4MNWA 1WSSH 1FN8A 1ZGIA 1GBJA 5EQRA 1AKSA 4I8JA 4ZMAH 1CBWB 4NWLA 4DY7B 2C90B 3Q77A 4XE4A 5JB9S 3F9FA 1HAXB 1MTWA 1A1RA 4UE7H 2FEQH 3STIA 1H1BA 4ZHAA 5ABWA 3PV4A 1BTHH 1O2OA 2OP9A 2A7CA 2NU3E 2FTMA 1O3NA 3ATWA 1MQ6A 1Z8IB 2J95A 1VITH 1AKSB 1HXFH 6GCHF 2VIWA 1PQ8A 4FUHA 1A5HA 3MNSA 2QAAA 2FYQA 2W26A 3P92A 4WH6A 4WMFA 1HYLA 3BG4B 3FZDA 1A0HB 4GHTA 2BOHB 1CA8B 5E0GA 5BRRE 3PMAB 5C20A 2QXIA 4K1TA 2R3YA 1GDNA 2FWWA 3C27B 5A0AE 1QL9A 1OWDA 3TJVA 5C1YA 3SN8A 2ZFRH 1SQAA 2Z3EA 3P17H 1AUJA 4SGBE 1YPKH 1ZTKA 1MMJN 1W7XH 4F49A 1QHRB 1OWJA 4A6LA 4CRCA 1K9OE 3MO3A 1O2MA 1GPZA 3FVFB 3RXQA 1AN1E 2FZZA 4E7NA 3GCHC 3OU0A 1RFNA 1W13U 4F4OC 4X2VA 4Y8XA 3ZVAA 1TMBH 5EW2H 2NU4E 1JRSA 1MKXH 1OXGA 2R0LA 1DXPA 4OS7A 4BOHA 1TMUH 1GGDC 4NIYA 1GJ7B 1O3FA 1LHDH 1CA0B 1TBQH 3M3SA 3QWCH 1AVGH 3RXMA 3RXSA 2GCTB 1AB9B 1Z8RA 1C2KA 1XKAC 2FOFA 2ZU2A 3AAVA 4A1TA 1FLEE 5A0CA 2HGTH 2V6NA 3LH1A 2WYGA 2GVFA 3KHVA 1UO6A 1ETSH 1AWFH 5EODA 3E3TA 4X8TH 4ABFA 1RIWC 1GCDA 1LHGH 1GBFA 4JZDH 4Q7ZA 2GV7A 2ODYB 2FS8A 2EA3A 2UUYA 4ISHH 3TH2H 1CT4E 1FJSA 1DANH 1FY5A 3KEEA 2TRMA 2D8WA 4FU9A 2GZ7A 2G4UA 1NU9A 4YOGA 2OC8A 2BZAA 3A7WA 1D4PB 1NFYA 1GCTC 5ESTE 4LZ4B 1GJ5H 1KYNA 3ZZDA 3LJOA 1FXYA 3M5LA 4NA8A 1O5GH 3V3MA 1GHXH 2PW8H 2Z3DA 5TCAA 2EI7A 3SU3A 2ZHWH 1P0SH 2WPKS 4D76A 1YBWA 1RRKA 1AFEH 2ZFFH 1BMMH 1F5RA 3P8NA 2FLRH 1G3CA 2DUCA 2BXUH 1VCWA 1O2KA 1BJVA 1G9IE 3BIVH 1W0YH 3LGVA 2GKVE 3P95A 1Z1IA 1SLUB 1ZYOA 1PFXC 2JH6D 1YLDA 2VIVA 2JH0D 3TIUA 3TK6A 1T8LA 4BAKB 2A4RA 1MH0A 4OGXA 2ILNA 2R2MB 1RTLA 1EZUC 2C8YB 3UUZA 3SZNA 4QT8C 1SBWA 1NRQH 2BD7A 2A32A 3VEQB 1H9LB 1CU1A 1IAUA 3RMMH 1D3PB 4BTTB 1GHVH 1UVUH 3R0FA 1EB1H 4GHQA 3T26A 1JIMA 4GAWA 3MMGA 3BV9B 4NIXA 2HNTC 2ZHQH 1ZMNA 2WPMS 1ELAA 1INCA 1GI3A 4YT7H 4A7IB 4O03A 5ETXA 2HPPH 3GDUA 3Q3KA 3HK6B 3RXDA 2WPLS 1K1PA 4IN2A 1V3XA 4OS2A 3S7KB 1T4VH 3F1SB 4CRBA 3SNCA 3EA9A 4AFUA 1F0UA 3PMBB 4JK5A 1YPHE 3U98H 1LVBA 2G5VA 1OS8A 2B8OH 1XVOA 1V2JT 2YNAA 3PLPA 4LK4A 1P2OA 1QIXB 1UVOA 3BTTE 1AFQB 3MOCA 2VWOA 4TPIZ 2PSXA 3H7TA 1C2LA 2WV4A 3IG6B 3UY9A 1P9SA 3GY8A 7GCHG 1GJCB 2FOGA 4AB8A 3NWUA 1O3EA 2PUXB 4X2XA 1TBZH 2P93A 3BTDE 2ZHEH 3P8GA 1PPEE 1UCYK 3Q3YA 1ZR0A 3RC4A 1PJPA 5J4SA 1Y3UA 1P05A 1EZQA 1O5BB 1QB9A 4FUCA 3QZQA 1AUTC 3A8BA 4NG9H 4B76A 3O8DA 1FAKH 6CHAC 1PPGE 3M7UA 1GBTA 2AGEX 1TYNA 2BD4A 2ZA5A 2FXRA 5G4BA 1B0EA 1MZAA 1OWHA 4H42U 2G81E 1SOZA 1QBOA 2DE8A 3S7HB 4UONA 1V2TT 1GVLA 1GBKA 1UTQA 3UOPA 1TB6H 1KXCA 4X1NU 5EPYA 3URDA 1QGFA 4ZXYH 1GI7B 1K1OA 3LPRA 1NPMA 2FOBA 4KGAA 3LJJA 3SUDA 1WTHD 1DT2A 1OX1A 1UK2A 2ZGBH 1CHOG 1ABJH 3BTQE 4RKJB 1N8OB 1UVSH 2FOAA 4JK6A 1V6DA 2XNIA 1MCVA 2PV9B 3EGKH 3A7VA 4Y6DA 1D9IA 1QA7A 2ULLA 2VH0A 2PTCE 3ZZ6A 2BDYA 1UJ1A 1J14A 2SGQE 4DW2U 2BB4A 4AZ2B 4B71A 2G8TA 1Q31A 1TNLA 2BD2A 1BHXF 3F68H 2AMQA 5T6GA 2ALPA 2A31A 3TJOA 1Q2WA 4FXGH 3NZIA 2IJOB 3PB1E 1GJ4H 2SGEE 5FBEA 1EPTA 1F2SE 5AHGH 1YF4A 3BEFB 1C5QA 1W8BH 2ANMH 3EDXB 2QN5T 2STAE 4R8TB 1N6YA 1BRAA 1ZRBA 1YYY1 2BX4A 2O8MA 4UFFH 4MPWA 3HPTB 3VB7A 3ITIA 1LHCH 2A0QB 5CHAC 4GCHG 3U1IB 3GDVA 1ELBA 4WXVA 4KTCA 3RDZA 2ZDLA 4B2CA 4HZHA 1EPTB 1FMGA 2RDLA 3HGNA 3K6ZA 1ELEE 1HJAB 3MH4A 1O38A 5DP9A 1TX7A 2PKSC 4NWKA 3ZV9A 5JBAS 3M3VA 2CF8H 2BY5X 1NESE 4AX9H 2XRCA 2FMJA 3A8DA 1O2GH 2SNWA 1LDTT 4AFZA 3KIDU 7GCHF 4RSPA 1ELTA 4GLYA 3SUFA 3BG8A 5TJXA 1IQEA 2BHGA 3RXIA 1ZJDA 2J2UA 1TNHA 3TK9A 2FYRA 3ATMA 1EJNA 3G01A 4VGCB 4ISLA 1C5PA 4ISNA 3KL6A 4BXSA 2O8UA 3GY2A 5EPNA 2TGDA 2J92A 1HRTH 1GBAA 1QURH 5JBBS 2Y6TA 5LH8A 2FO9A 1H8DH 2P16A 1P2JA 1PQ7A 5IDKA 3E6PH 1DVAH 1P03A 2CHAB 5FBIA 3BTME 3O8RA 3LH3A 5DP7A 1O3BA 1DWCH 2H9TH 1P09A 1TA6A 2K1QA 1VJ9U 7KMEH 2A5KA 2ZU3A 2Q6GA 1OP0A 1O2IA 1CHOF 5DP5A 1DSUA 3M5NA 4NA9H 4DIHH 5SGAE 2BDGA 3FP6E 3EA8A 3PYHA 1LQDB 1J16A 3RXPA 2ZPQA 3ZYDA 5CMXH 3UIRA 1PPFE 5AFZH 1YC0A 1YPEH 5DJ7A 2BVSH 3E0NB 1EP6A 1JBUH 1P9UA 1MAYA 2C4FH 4D7FA 3GISB 5GJ4B 3KQCA 3TLOA 4CBNA 1T32A 3GY7A 2GDDA 3Q76A 1TIOA 4ABHA 1O3KA 4IBLH 1CT0E 3UNSA 4K3JA 2BLQA 3QN7A 1IQFA 4B2BA 4YOIA 4KP0A 1GJBB 2H1UA 1SGFA 2HRVA 1C4U2 2NU2E 2F83A 1KY9A 2PKAA 5DP3A 1RTKA 1N1LA 2OC0A 4CR5A 3EA7A 2OQ5A 3RXJA 4K5ZA 2A2XH 2IN2A 1DDJA 2O9QA 4WMDA 1LTOA 1O2PA 1GJ6A 2ZDNA 2GT7A 1HNEE 4CHAB 1NFWA 2JETB 3NXPA 3PMHB 4MLFB 1BA8B 2V0BA 2ZKSA 3RXUA 2PKAB 3QK1A 5E2OA 4DT7B 1WV7H 1EQ9A 1C2DA 4O97A 2QF3A 2AS9A 2PWXA 3A7TA 5T3HA 2B5TB 1MU6B 2ESTE 3A84A 4IN1A 1YPHC 4E06H 3PTNA 1HFDA 1S84A 1TABE 3GOVB 2HOBA 3SU6A 2ASUB 1PPZA 2Z6BD 3QLPH 3TVJB 4FUJA 3VB3A 4MNYA 1SSXA 4ABJA 1P2QA 3UTUH 2G55A 4X6MA 1Y8TA 1WQSA 4BXWA 1TA2A 1TE0A 3M36A 1CHGA 1DY8A 1VCPA 1MKXK 2AYWA 3LGTA 1ZHPA 1LPZB 1AY6H 4MDSA 1ZJKA 2V35A 1CQQA 2AERH 1X7AC 3MNBA 1MBMA 4LZ1H 2GGVB 3SGQE 3K2UA 5EU8A 1SLVB 1RGQA 4B74A 3DT0H 1BITA 1O2UA 5LPEA 2PLXA 3MU5A 2WYJA 1B0FA 5EXLA 3SI3H 1C4V2 4ASHA 4ABAA 2J4IA 1ARBA 1Y3YA 3LKWA 2VWMA 4X6PA 1WOFA 5GWZA 2P8OB 2BY8X 1FY4A 4LXBH 4OS4A 1SGEE 4K1SA 5FHTA 4I33A 3KQBA 2GP9B 1FY3A 3M7QA 1W0ZU 1D3QB 1O3JA 2HWLB 3M61U 1TNGA 1S5SA 1GBBA 1SFQB 2G52A 1V2UT 2R2WU 5F8ZA 1E37B 3PWBA 2VIDA 5C3NA 4NSYA 4FU8A 3VB4A 1O3AA 2QY0B 4JZ1A 4Q7XA 2OBQA 3ZZ4A 1OP8A 1E36B 5EXMA 4Z0KA 1FIZA 1V2NT 1C5TA 2ZTXA 2J38A 1BUIA 4MNXA 3RXEA 1C5SA 3O8CA 5LGOA 1AVWA 1HDTH 2YOLA 2ZPRA 3SHAH 3SORA 3ZVDA 3QTVH 1MBQA 1IQHA 5T6DA 2ZU5A 3STJA 3RUOA 4AGKA 1O5DH 2O8LA 1D3TB 3RXKA 1C5VA 1MTSA 1H9HE 1PQ5A 2G51A 4CR9A 4J2YB 3S69A 4ESTE 1SB1H 3MU1A 2CJIA 3IITA 2BD5A 4Q7YA 5FX6A 1V2KT 2AGIX 3KF2A 1BMAA 2Z9LA 1XMNB 1IQNA 1C9TA 1O2WA 4INLA 3FP8E 2BX3A 4CRFA 2D26C 3H5CB 3TU7H 1DM4B 2AIPA
chains in the Genus database with same CATH superfamily
2BZ6H 2KM0A 2B9LA 4JYVH 2PGBB 1TRYA 3RXAA 1ZMJA 4BANB 3SHCH 2NWNA 1NU7B 3QTOH 1LVYA 1BMNH 5IYTA 2BMGB 2FP7B 2GZ8A 1KXFA 1O5CB 3D23A 1O2TA 1SGTA 3A86A 3H7OA 5EJZA 1WBGB 3KN2A 5DP6A 1ZPBA 1GBIA 4BAQB 1FI8A 1SKYE 3MWIU 4XBDA 1DSTA 4K2YA 1TGCA 3GY3A 2A5AA 1GG6C 5FPSA 1QFKH 1GI8B 3F0PA 3NCLA 3T28A 4AORA 1D6RA 3MNXA 3BEUA 1WDIA 1AD8H 3OY6U 1Y5AT 2GZ9A 1OSSA 3A8AA 1A0LA 1ANCA 1V2QT 2CF9H 1TRNA 1UCYE 1C1VH 4K60A 1O30A 2EI8A 1FY1A 4B6FA 3FO8D 1WUNH 2TPIZ 2QF5A 1LCYA 1MKWK 2M5TA 1TQ7B 2FX4A 3V7TA 1JXPA 1YP9A 3U1JB 1F7ZA 4X8SH 1GVKB 3RU4E 1C5OH 4DURA 1P02A 3GDSA 4B75A 5A09A 3MH7A 2WINI 1C1WH 1XXFA 3RM2H 1F5LA 4MQAA 3M35A 1BCUH 1WXRA 1NRSH 2RA0A 3U8OH 1W10U 1BTZA 5JPMH 1ABIH 1O2YA 1XUIA 4JMYA 3OY5U 3DD2H 2GX4A 1NT1A 4MG3A 4X8UH 1OWKA 4DT4A 3MU4A 4KTUA 3TGKE 3SV9A 2M2AA 1BTUA 1IQGA 1FNIA 2Q6FA 5C1XA 4OS1A 1IQIA 1P2IA 1W2KH 2BQ6B 3K9XB 4OGYA 2B0FA 1O0DH 5PTPA 4X1QU 1EAIA 2F4LA 3NRLA 5DSFA 2W6JD 2L6OA 3BF6H 5E0JA 8GCHG 1L1NA 1SGFG 3C1KA 2A7JA 1HAPH 4X2WA 3ZVEA 2W6ID 1GWAA 2XBXA 1TOMH 3A83A 3SU0A 3LDXH 1K1MA 4WH8A 2LPRA 5ESBA 3N7OA 1EKBB 4TYDA 1DICA 1O39A 2ZU1A 2BYAX 3T5FH 1L4DA 4CRAA 1MTUA 4GSOA 1SPJA 1V2MT 1QJ6B 1MTNC 2F91A 1FONA 3RM0H 2HALA 1BRUP 2AMPA 3U8TH 3M7TA 1YWUA 4AOQA 2XW9A 1HV7A 1P57B 2O8WA 1BMLA 2KAIA 3GCOA 5L2ZH 3GCHB 4NZLA 1C1TA 1OPHB 1HJ9A 1YCPM 4FETA 1ANDA 4A1VA 2ZTZA 1W12U 3GICB 5DKMA 3M5OA 4X8VH 1GG6B 3OSYA 1GGDB 3UQOA 1A3BH 2R9PA 2XXLA 3CP7A 1NY22 2P3UB 3N7DA 1ARCA 1SC8U 2V7QD 5HYOA 2KAIB 3BTKE 3BTFE 1LHFH 4NSVA 2BM2A 5JYIA 1F92A 1RIWB 3MH6A 4X1PU 1FAXA 1UTMA 2RFKC 3QDZB 1DITH 1C9PA 1SQTA 3V0XA 1ID5H 3RXFA 5F6MA 1CGJE 1THRH 1W7GH 5L30H 3DA9B 3IWMA 1GJ9B 5E0HA 3F9HA 2BDAA 5K0HA 1QJ7B 2A5IA 1C5RA 1OWEA 3ZVGA 2BVRH 3OEHD 1B7XB 1GCTB 1BTYA 1GI2A 3F2FA 4GPGA 2GJGA 1ZOMA 1V2PT 1T8NA 4MPXA 3BN9A 3TJUA 1A5GH 2P3FH 4K8BA 1O5FH 5L6NH 1O3IA 5T1VA 1O32A 2VGCC 3R3GB 4YXWD 4D8NA 1LQEA 2WZQA 1HAYB 1V2WT 4MTBA 2HLDD 4U2WA 4GUXA 2QXHA 1TGBA 1XUJA 2QIQA 4X6NA 1L4ZA 8GCHF 4MVNA 1KDQA 4NFEA 2ZGHA 3SNAA 3LGWA 3LT3A 1UTKA 1NRPH 2Y5GA 2FOHA 3SJ8A 3DHKH 2PHBA 5E8EH 2ZWLH 5EGMA 4ZROA 2A1DB 3S0NA 1L1GA 2ZG0H 1FV9A 3LIWA 3MU8A 3P70B 4ZUHA 2XCNA 1SGRE 2QE7D 1SHHB 1SGNE 2ZFTA 9ESTA 2QXGA 1ELFA 1SR5C 2ANWA 1ACBE 3DFLA 1GMDG 2VVUA 1DOJA 1LVOA 1GHYH 1S0RA 1HB0B 4HI3A 4BAHB 3OAAD 4JYUH 4B2AA 3L3TA 4FOUC 2XC5A 1T8MA 4FVDA 4ZHMU 3ZZ5A 5E2PA 3KQDA 1PQAA 1BOQA 1UTNA 3NK8A 5EQQA 3WWBA 1O3DA 4CREA 2V3OH 1ZTLA 3RMNH 1UK3A 1GJAB 3LGYA 1AWHB 1F0RA 2ZP0H 2ZFPH 4NCYA 3KYFA 1OHHD 3CS0A 4IC6A 5C67A 3L33A 3BTGE 4TWWA 1ZSKA 3HATH 1FDPA 1UMAH 5EW1H 1O3OA 1CO7E 1Y3WA 4FUIA 5DP8A 2HVYB 1LHEH 1L1JA 2BQ7B 4Y7BA 1ELDE 5EOKA 4OS6A 3L6PA 1QRZA 3LGUA 2BQWB 1TNJA 1ESAA 1QBNA 3UPEA 3NPSA 3SGAE 1O3HA 2H9EH 1CSOE 2CN0H 1EZXC 2EQNA 1QRWA 2NU1E 3A85A 3PM3A 4ZKRU 1EAWA 1HAVA 2ZZUH 1DS2E 5AVDA 3RU4T 2FTLE 4BAOB 2FM2A 3TH3H 5JBTA 1E0FD 3SJOA 4DG4A 5JB8S 2ZDKA 3S9AA 4Z6AH 2BLVA 3AASA 2ZGCA 2J97A 1C5ZB 2RA3A 3VGCC 3D65E 1SMFE 1XUHA 1HLTH 2BTCE 2J98A 4D9QA 1YCPH 1VKYA 2ZDAH 1GHAG 1U6QA 3P6ZB 2OC7A 2BDHA 2XYAA 2FPZA 4J1YA 1VITG 3VB6A 1O34A 6CHAB 2J5UA 1HAVB 1MZDA 2IJD1 1GJDB 3FZZA 2VU8E 3MYWA 1DWDH 1BBRK 1S6FA 1EB2A 2F9VA 2Z3CA 1UTJA 3ZZ7A 1ZLRA 2A2QH 1G37A 2JH5D 3RC5A 2F9NA 2FX6A 2J98B 1IQMA 1BRBE 3B9FH 1EOLA 4Y71A 3BTHE 3T2NA 1GBEA 1OP2A 2SGAA 2ZECA 4UFGH 4CRDA 2GT8A 3U8RH 1OKXA 3N99A 2D2DA 4XBBA 8LPRA 1N6XA 2AFQB 2WPJS 1O3CA 1GI5A 1P2MA 2OXSA 1O2XA 1HPGA 1GMDF 4WVPE 6LPRA 1MUEB 2QCYA 1SHYA 1O31A 3E91A 5C5NA 4WF8A 4O3TA 1UTLM 1VGCC 1DY9A 1RXPA 1Y3VA 2ANYA 1RTFB 4ACBA 2A4QA 3UWJH 2GDEH 4NIWA 4WY3A 3TNTA 3VXEH 2ZC9H 2VINA 2VNTA 2VIOA 1OYTH 4ASUD 3PLBA 1Y5UT 1QQ4A 1C1OA 1DWEH 2IPHA 2KCPA 2W7SA 3PLKA 2XCFA 4P02A 2WUBA 4A1XA 1O2HA 1QL8A 4AG1A 5C94A 1O2SA 1QL7A 4ZHLU 5CHAB 1J15A 1IQJA 3N7EA 1RS0A 4FUDA 2CXVA 1QNJA 3H09A 1TMTH 2A7HA 1LKAA 5A8YA 2PKSB 3B8JA 1G3BA 4TY7A 3PO1C 2QYIA 3RMLH 1GL1A 2QA9E 1TPAE 3DFJA 4Q4LA 5F8TA 1HAOH 1E34B 3RLWH 4IC5A 1WAYB 3QGNB 1EASA 2FODA 2JIZD 1CVWH 1SLWB 2SGDE 1G30B 2LNCA 1TRMA 3O8BA 1ZMLA 2FESH 2YMSB 3JZ1B 3UREA 2SNVA 1ZHRA 2ANKH 4UD9H 1NS3A 2GCHG 1AVXA 1K1LA 3UQVA 1GHAF 2FI4E 1BRCE 1VITF 1HAZB 5FPTA 1AMHA 1CBWC 1Z6EA 1NRNH 2KCAA 3S9CA 2Y7XA 2BLWA 2WV5A 4BAMB 1HJ8A 4THNH 2OTVA 1NBME 2ZCKP 4RT1A 1F0TA 4CH8B 5FAHA 3A80A 3SBKA 1KXAA 4YESB 4ZKSU 1A4WH 1UW7A 4WWYA 1WQVH 4MPVA 4YT6H 4E7RG 1S6HA 2VIQA 4MNVA 3KNXA 2XBWA 2VWLA 1GI1A 1G2LA 1A0JA 1BTPA 5FXLA 1C2HA 1B5GH 3BG4C 3V13A 1QCPA 2PR3A 3VB5A 3TNSA 1TGNA 4ZAEA 1BT7A 1S81A 5C2ZA 1VJAU 1VCQA 3D62A 2W3KA 2OQUA 1UTPA 1THSH 3QO6A 4FUEA 5A2MH 1VGCB 1NROH 1A2CH 4P00A 1MD8A 3ZZ8A 1SG8B 1G36A 2P95A 1H8ED 2ZHDA 1QB1A 3M5MA 3PV5A 4D9RA 1S0QA 1YPMH 2CV3A 8ESTE 4JZIA 1ANEA 1EJAA 1XUGA 1AZZA 1G3DA 1MTVA 5DGJA 5L2YH 4KTSA 3ELAH 1TPPA 3SOSA 2UUJB 2BD8A 5EG4A 2F9PA 4HTCH 2ZGJA 3W94A 4D7GA 3F9EA 1C5NH 1C1RA 4FUGA 4NA7A 5GPIB 3SNEA 1TGTA 3RXVA 2VIPA 1EJMA 1LMWB 4TPYA 1ANBA 1T4UH 1Z8JB 2GCTC 1AB9C 3UOUA 1QTFA 1SQRA 1Z6JH 2CMYA 2AIQA 3A87A 2D1JA 2WV9A 3KQEA 4Y7AA 4O3UA 1QR3E 1P04A 2IOTA 4Y0ZE 2VB0A 1QBVH 4IMQA 4YTAA 3RC6A 1D3DB 2ZQ1A 4I31A 1S85A 1GHBG 1DUEA 1BTXA 3RXHA 1TFXA 1MD7A 1P8VC 2FLBH 2OD3B 3SJ9A 1C5YB 1FPCH 2ZF0H 1K1JA 1GDUA 1SL3A 4XOJA 3VPKA 4YO9A 3TH4H 1KTTB 2UUKB 2G00A 2GCHF 1C1MA 1E38B 1YPGH 3UFAA 3W1EA 4ACAA 1BB0B 4NFFA 4NGAH 3E90B 1FY8E 3EYDA 3PMJA 1GI9B 1F0SA 2GV6A 3GCTF 2GMTC 3GY5A 3MHWU 2AMDA 1HAHH 1ELGA 1Q3XA 1HIAA 3UR6A 4X0WU 1WTGH 1V2VT 1BZXE 1IHTH 3HK3B 3OX7U 1ETTH 4XBCA 3SU4A 2ZNKH 3RXRA 1A46H 4UDWH 1O2LA 4K1EA 1UTOA 1W0KD 2W5EA 1QY6A 5GDSH 4K8YA 3SU2A 1G3EA 2I6QA 3CENA 4JCNA 6ESTA 2WPHS 2ZEBA 3ZVBA 3ATIA 1A5IA 2F3CE 1P3EA 1C2GA 1V2RT 2PTNA 1HIAB 2VJ1A 1O35A 1FPHH 4DGJA 1W14U 1PYTC 1TALA 1C2JA 2FOMB 1SLXB 2ZFQH 2FOEA 1C1PA 4XSKU 3A89A 2PFEA 3GYMA 1ZHMA 3ODFA 4YM9A 2TGAA 2K8IA 1O2JA 2PUQH 3SO3A 1FUJA 4NIVA 4I8KA 4E05H 1NZQH 2Y5HA 2HNTF 2RCEA 1Z1JA 2BOKA 1HAGE 2ODPA 2UUFB 4IMZA 3OFND 2VH6A 2ZO3H 3ZZBA 4Y79A 1O33A 4F55A 4JZFH 1C5UA 1GI6A 1O5EH 2PSYA 4FU7A 2CK3D 2FI5E 3ZYEA 3SV8A 3LC3A 1BJUA 5C5OA 3UR9A 2CGAA 4X1SU 1TOCB 2SGFE 2OINA 5HMAA 2UWOA 2VVVA 4HGCA 3ESTA 5A0BA 3BTEE 4HFPB 3F9GA 3F6UH 2GD4B 1Z8GA 3HGPA 2J94A 1GHBF 3K65B 2BY9X 5LPRA 1AO5A 5A8XA 4WXIA 1AFQC 4FVBA 4KELA 9LPRA 1SGDE 3QX5H 1K1IA 3T27A 3WWFA 2WSSD 4ZH8A 1O37A 2Q1JA 3MNCA 4KKDA 4A92A 2XWAA 3A7YA 3E0PB 1AE8H 1P10A 3A7XA 4H4FA 5FPYA 3GS9A 4I8LA 4I8HA 4U32A 1G2MA 3GY4A 4XFQA 2XWBI 3DSOA 1C5WB 1EAUA 1PPCE 2ALVA 3PTBA 2GMTB 1GHWH 2WPIS 1THPB 2ZCLP 3SU1A 3URCA 1S83A 5CDFE 1GBLA 3I78A 2I6SA 2OUAA 4WMEA 3T29A 4H6SB 4XDEA 3LU9B 1D6WA 1VR1H 2BY7X 5H4IB 2EY4C 4I32A 2ZDVH 2LP6A 1GI0A 1NN6A 1ZSJA 1ZGVA 1HGTH 2BDCA 3M3TA 1QJ1B 1NFUA 1OOKB 4CBOA 3QGJA 1KLJH 2YNBA 1LPGB 4YZUA 4ZKNU 2FOCA 4OS5A 1WCZA 3LC5A 2JKHA 3MU0A 3WW7A 5JBCS 3E8LA 1O2ZA 3FP7E 1ESTA 5DO4H 5EQSA 3B23B 3MFJA 2VVCA 1N8OC 3ENSB 5FL7D 2F9BH 3JZ2B 4ABIA 2Z9JA 3KCGH 3V12A 4AB9A 1IQKA 3EE7A 2GTBA 1ZRKA 2A4GA 2KFWA 3ATKA 5GCHG 1C1UH 1C1SA 1SGYE 3A88A 5B6OA 1EFRD 2STBE 5HXFA 1HBTH 2WHXA 5FCRA 2XOKD 3GYLB 4YLQH 2FDAA 7ESTE 1K0HA 2B7DH 1DXWA 3PWCA 3HKIB 1AQ7A 3MH5A 1QB6A 4INKA 3BTWE 3FANA 2H5DA 1F5KU 1BBRE 1YKTA 4DVAU 1CE5A 1DX5M 1YCPK 2HVXA 3KQ5A 4OM9A 2ZIQH 2UWPA 5J4QA 2EEKA 1CGIE 2G5NA 4ABEA 5EJ1A 4DOQA 2OLGA 1GVZA 3ZZAA 4AFSA 5AF9H 4H6TA 2XC4A 3ZZ9A 3E16B 3MTYA 3A8CA 1KSNA 1JOUB 2BD3A 4B73A 3EAJA 3OTJE 2H9HA 3Q00A 3PRDA 4ISOA 2ZFSA 8KME2 2QC2A 4INHA 1K1NA 1EPTC 4ABGA 3BEIB 4PROA 1HJAC 3RP2A 1HXEH 1Y5BT 1E35B 1Y59T 5LPFA 5BPEA 1GBHA 1EXFA 1QZ8A 3ZV8A 1MKWH 2RG3A 2Z94A 3OEED 4TSFD 1P06A 1JMOH 4MPUA 3SQHE 3A82A 1L0ZA 2PGQB 3AVZA 4Y8YA 1P11E 1ELVA 1TONA 4VGCC 1C5MD 4NZQA 1Y3XA 4DIIH 1C2EA 1TX8A 4Y10E 1YPLH 1W0JD 2YMSD 2ZPSA 1KXEA 1O36A 4AGJA 3OYPA 4I8GA 1MTNB 5HM9A 2C8ZB 1TX6A 4A5TS 5A8ZA 2A45B 4ABDA 1MU8B 1ZSLA 5DK1A 1YLCA 4B1TA 3SU5A 2AHME 2CHAC 1H9IE 1UVPA 3W95A 3T62A 2Y81A 1KDQB 5F53A 2C93B 3CS7A 4ISIH 1T8OA 3RU4D 3T25A 1NO9H 4AYYB 1DFPA 4X6OA 3UNRA 1VZQH 1HCGA 1YPJH 1M9UA 1O2VA 2HPQH 2C8WB 1C4Y2 1ESBA 1BQYA 2FIRH 2NU0E 2HLCA 3RXTA 2QF0A 1O5AB 3EE0B 4YOJA 1LKBA 1KXDA 3UNQA 1A61H 5FCKA 3TITA 1AZ8A 4UFDH 5GIBA 1O2NA 7LPRA 1TGSZ 5GCHF 1ZTJA 2ZU4A 1EOJA 1NFXA 3FFGA 1AGJA 1O3PB 4K69A 2Z7FE 3RXGA 3DSPA 2JJ1D 3SUEA 3TK5A 1LPKB 1TQ0B 1AIXH 1ZPZA 2ODQA 3U28C 4AYVB 1K2I1 3TGJE 1KLIH 4CH2B 1GI4A 1NM6A 1AE5A 1SI5H 1DLKB 2WUCA 4AN7A 3NUMA 1WU1A 5CE1A 2ZDMA 3TGIE 2BY6X 1NC6A 1GBCA 3SQEE 1MCTA 3ODDA 1SGIB 1NRRH 3A81A 1S82A 1TNKA 1JWTA 2TIOA 3RXLA 1EZSC 4IGDA 4TY6A 1RD3B 2P94A 2EC9H 1IQLA 4ABBA 1C1QA 1DPOA 2BLOA 4M7GA 3BIUH 1TAWA 1ZZZA 2BDBA 1XUFA 3BSQA 2Y82A 4U30A 3SGBE 2W3IA 1J9CH 2VGCB 1C5LH 3S9BA 2R3UA 1DE7H 2ZGXH 4Q80A 3QZRA 4CHAC 2ZQ2A 2JETC 3FKSD 2XBYA 1Z7KA 3SV2H 1C5XB 2AGGX 1KIGH 1MAXA 1EAXA 3ZVFA 1GBMA 4DCDA 1KTSB 3HKJB 2Y5FA 2Y80A 5DP4A 2TBSA 1XKBC 4GVUA 2OCVB 2FS9A 1J8AA 1K22H 1QRXA 1GL0E 5F8XA 2P3TB 1TPOA 1UHBA 4XD7D 1O2QA 2V3HH 4UEHH 1SFIA 4Q2KA 5JDUB 3NKKA 5C0TA 2Q6DA 1BIOA 1O2RA 1YGCH 5FX5A 5TCCA 5I25A 1O3GA 1GMHG 3ATLA 1TWXB 2Y7ZA 1UCYH 3UB0A 1P12E 3P8FA 2UWLA 2TGPZ 4BTUB 3AW1A 1MQ5A 1SGPE 5K7RA 1E1RD 1IOEA 3SYJA 1HUTH 2XTTB 3FAOA 5T6FA 1WYKA 3QUMP 1CT2E 4Y0YE 1XX9A 1PPBH 1EUFA 2SGPE 1DWBH 1UHBB 3LONA 2H2ZA 5HM2A 1GJ8B 1IHSH 1QQUA 2BXTH 4Q63A 1PPHE 4WJG2 4RN6A 1HAIH 3LGIA 3M37A 3AW0A 2H5CA 3VFEA 1K28D 4I7YH 1JRTA 1SQOA 1GMCG 2ZHFH 1CGHA 1O3LA 1FN6A 1P3CA 3SJKA 4LOYH 3SNBA 3SI4H 2ZCHP 1EX3A 4FUBA 3K6YA 1P2KA 2EI6A 4AG2A 1EP5A 1ZPCA 1KMHB 2P8OC 1FIWA 1V2ST 2R0KA 1KLTA 1RJXB 4M9FA 2BVXH 3TPIZ 1C2IA 5GXPA 3GCNA 3UWIA 3MI4A 1YM0A 2F9UA 3LOXA 3RXOA 1L2EA 1QA0A 2PP6A 2H6MA 3WY8A 2A4OA 2C8XB 2BD9A 2XC0A 3I29A 4GCHF 1J17T 3U69H 3VGCB 1C1NA 1AU8A 1T7CA 5C1UA 1C2MA 1Z71A 3PROA 3VG8A 3SV7A 3RLYH 3U9AH 4TT3D 1EATA 4BTIB 2DE9A 2QV1A 4TWYA 4JYTA 3SW2B 2O8TA 2ZTYA 3GCTG 4Y76A 3EQ0H 3F0OA 1AI8H 1UVTH 2JDID 3ZVCA 1LVMA 4Y8ZA 1V2LT 2RDEA 2BDIA 2HNTE 1H4WA 2J9NA 4X2YA 3SV6A 1T31A 1UK4A 4SGAE 3A7ZA 3DSGA 2QF4A 1XVMA 3DUXH 1TNIA 2V3MA 6GCHG 3RXBA 1XUKA 3CNRA 2QXJA 4AC9A 1TPSA 1TBRH 3KGPA 1BHXB 1GMHF 1OWIA 1ELCA 1P2NA 2W7UA 1NTPA 2VWNA 1KXBA 3SUGA 2Z9GA 5HGGA 1K21H 3MO9A 3TJNA 3I77A 2J34A 2C3SA 1ORFA 2XBVA 2SFAA 2QGRA 4FUFA 2TGTA 3P8OA 2AH4X 1AHTH 1BBRH 4R0IA 4ZXXH 2LELA 4YLUA 2THFB 1BDAA 2XNDD 3ZZ3A 1SOTA 1A7SA 4CRGA 3VXFH 4AFQA 1FQ3A 4JZEH 1SGCA 1XXDA 1G32B 5EXNA 4U01A 1GMCF 2OC1A 1W3CA 1H8IH 3RXCA 4O9VA 3GY6A 1V2OT 2P59A 5I46H 4X1RU 5F03A 4Z1MD 2Z9IA 1CA0C 2ZI2H 2OBOA 3D49H 1PYTD 3RMOH 1SGQE 1W11U 1JIRA 1DLEA 1DUAA 1O3MA 1TLDA 3ZZCA 1A3EH 1SVPA 3PO1B 3E1XB 4IW4E 2G4TA 4ZKOU 1GBDA 1LO6A 4RKOB 1XM1A 1P01A 1C2FA 1FZZA 4DJZB 4Y11E 3SNDA 3AAUA 1ETRH 1OYQA 4IS5A 5AFYH 5DPAA 1H8HD 3MO6A 2F9OA 3SJIA 2AEIH 3Q3XA 2FI3E 1S6LA 1GDQA 4BNRA 2Z9KA 4UFEH 5DG6A 1GHZA 1BTWA 4MNWA 1WSSH 1FN8A 1ZGIA 1GBJA 5EQRA 1AKSA 4I8JA 4ZMAH 1CBWB 4NWLA 4DY7B 2C90B 3Q77A 4XE4A 5JB9S 4RT0A 3F9FA 1HAXB 1MTWA 1A1RA 4UE7H 2FEQH 3STIA 1H1BA 4ZHAA 5ABWA 3PV4A 1BTHH 1O2OA 2OP9A 2A7CA 2NU3E 2FTMA 1O3NA 3ATWA 1MQ6A 1Z8IB 2J95A 1VITH 1AKSB 1HXFH 6GCHF 2VIWA 1PQ8A 4FUHA 1A5HA 3MNSA 2QAAA 2FYQA 2W26A 3P92A 4WH6A 4WMFA 1HYLA 3BG4B 3FZDA 1A0HB 4GHTA 2BOHB 1CA8B 5E0GA 5BRRE 3PMAB 5C20A 2QXIA 3SZEA 4K1TA 2R3YA 5KEDA 1GDNA 2FWWA 3C27B 5A0AE 1QL9A 1OWDA 3TJVA 5C1YA 3SN8A 2ZFRH 1SQAA 2Z3EA 3P17H 1AUJA 4SGBE 1YPKH 1ZTKA 1MMJN 1W7XH 4F49A 1QHRB 1OWJA 4A6LA 1COWD 5CHBA 4CRCA 1K9OE 3MO3A 1O2MA 1GPZA 3FVFB 3RXQA 1AN1E 2FZZA 4E7NA 3GCHC 3OU0A 1RFNA 1W13U 4F4OC 4X2VA 4Y8XA 3ZVAA 1TMBH 5EW2H 2NU4E 1JRSA 1MKXH 1OXGA 2R0LA 4I86A 3MQKC 1DXPA 4OS7A 4BOHA 1TMUH 1GGDC 4NIYA 1GJ7B 1O3FA 1LHDH 1CA0B 1TBQH 3M3SA 3QWCH 1AVGH 3RXMA 3RXSA 2GCTB 1AB9B 1Z8RA 1C2KA 1XKAC 2FOFA 2ZU2A 3AAVA 1NBMD 1FLEE 4A1TA 5A0CA 2HGTH 2V6NA 3LH1A 2WYGA 2GVFA 1E1QD 3KHVA 1UO6A 1ETSH 1AWFH 5EODA 3E3TA 4X8TH 4ABFA 1RIWC 1GCDA 2OK5A 1LHGH 1GBFA 4JZDH 4Q7ZA 2GV7A 2ODYB 2FS8A 2EA3A 2UUYA 4ISHH 3TH2H 1CT4E 1FJSA 1DANH 1FY5A 3KEEA 2TRMA 2D8WA 4FU9A 2GZ7A 2G4UA 1NU9A 4YOGA 2OC8A 2BZAA 3A7WA 1D4PB 1NFYA 1GCTC 5ESTE 4LZ4B 1GJ5H 1KYNA 3ZZDA 3LJOA 1FXYA 3M5LA 4NA8A 1O5GH 3V3MA 1GHXH 2PW8H 2Z3DA 5TCAA 3OTPA 3DCLA 2EI7A 3SU3A 2ZHWH 1P0SH 2WPKS 5EJLA 4D76A 1YBWA 1RRKA 1AFEH 2ZFFH 5KECA 1BMMH 1F5RA 3P8NA 2FLRH 3AK5A 1G3CA 2DUCA 2BXUH 1VCWA 1O2KA 1BJVA 1G9IE 3BIVH 1W0YH 2JJ2D 3LGVA 2GKVE 3P95A 1Z1IA 1SLUB 1ZYOA 1PFXC 2JH6D 1YLDA 2VIVA 2JH0D 3TIUA 3TK6A 1T8LA 4BAKB 2A4RA 1MH0A 4OGXA 2ILNA 2R2MB 1RTLA 1EZUC 2C8YB 3UUZA 3SZNA 4QT8C 1SBWA 1NRQH 2BD7A 2A32A 3VEQB 1H9LB 1CU1A 1IAUA 3RMMH 1D3PB 4BTTB 1GHVH 1UVUH 3R0FA 1EB1H 4GHQA 3T26A 1JIMA 2WPDD 4GAWA 3MMGA 3BV9B 4NIXA 2HNTC 2ZHQH 1ZMNA 2WPMS 1ELAA 3F3BA 5DN6D 1INCA 1GI3A 4YT7H 4A7IB 4O03A 2F43B 5ETXA 2HPPH 3GDUA 3Q3KA 3HK6B 3RXDA 2WPLS 1K1PA 4IN2A 5EIYA 1V3XA 4OS2A 3S7KB 1T4VH 3F1SB 4CRBA 3SNCA 3EA9A 4AFUA 1F0UA 3PMBB 4JK5A 1YPHE 3U98H 1LVBA 2G5VA 1OS8A 2B8OH 1XVOA 1V2JT 2YNAA 3PLPA 4LK4A 1P2OA 1QIXB 3FN8A 1UVOA 3BTTE 1AFQB 3MOCA 2VWOA 4TPIZ 2PSXA 3H7TA 1C2LA 2WV4A 3IG6B 3UY9A 1P9SA 3GY8A 7GCHG 1GJCB 2FOGA 4AB8A 3NWUA 1O3EA 2PUXB 3OE7D 4X2XA 1TBZH 2P93A 3BTDE 2ZHEH 3P8GA 1PPEE 5HIYA 1UCYK 3Q3YA 1ZR0A 3RC4A 1PJPA 5J4SA 1Y3UA 1P05A 1EZQA 1O5BB 1QB9A 4FUCA 3QZQA 1AUTC 3A8BA 4NG9H 4B76A 3O8DA 1FAKH 6CHAC 1PPGE 3M7UA 1GBTA 2AGEX 1TYNA 2BD4A 2ZA5A 2FXRA 5G4BA 1B0EA 1MZAA 1OWHA 4H42U 2G81E 1SOZA 1QBOA 2DE8A 3S7HB 4UONA 1V2TT 1GVLA 1GBKA 1UTQA 3UOPA 1TB6H 1KXCA 4X1NU 5EPYA 3URDA 1QGFA 4ZXYH 1GI7B 1K1OA 3LPRA 1NPMA 2FOBA 4KGAA 3LJJA 3SUDA 1WTHD 1DT2A 1OX1A 1UK2A 2ZGBH 1CHOG 1ABJH 2IPQX 3BTQE 4RKJB 1N8OB 1UVSH 2FOAA 4JK6A 3F2GA 1V6DA 2XNIA 1MCVA 2PV9B 3EGKH 3A7VA 4Y6DA 1D9IA 1QA7A 2ULLA 2VH0A 2PTCE 3ZZ6A 5IK2D 2BDYA 1UJ1A 3FOAA 1J14A 2SGQE 5KGOA 4DW2U 2BB4A 4AZ2B 4B71A 2G8TA 1Q31A 1TNLA 2BD2A 1BHXF 3F68H 2AMQA 5T6GA 2ALPA 2A31A 3TJOA 1Q2WA 4FXGH 3NZIA 2IJOB 3PB1E 1GJ4H 2SGEE 5FBEA 1EPTA 1F2SE 5AHGH 1YF4A 3BEFB 1C5QA 1W8BH 2ANMH 3EDXB 2QN5T 2STAE 4R8TB 1N6YA 1BRAA 1ZRBA 1YYY1 2BX4A 2O8MA 4UFFH 4MPWA 3KYGA 3HPTB 3VB7A 3ITIA 1LHCH 2A0QB 5CHAC 3UAIC 4GCHG 3U1IB 3GDVA 1ELBA 4WXVA 4KTCA 3RDZA 2ZDLA 4B2CA 4HZHA 1EPTB 1FMGA 2RDLA 3HGNA 3K6ZA 1ELEE 1HJAB 3MH4A 1O38A 5DP9A 1TX7A 2PKSC 4NWKA 3ZV9A 5JBAS 3M3VA 2CF8H 2BY5X 1NESE 4AX9H 2XRCA 2FMJA 3A8DA 1O2GH 2SNWA 1LDTT 4AFZA 3KIDU 7GCHF 4RSPA 1ELTA 4GLYA 3SUFA 3BG8A 5TJXA 1IQEA 2BHGA 3RXIA 1ZJDA 2J2UA 1TNHA 3TK9A 2YMSC 1MABB 2FYRA 3ATMA 1EJNA 3G01A 4VGCB 4ISLA 2KR7A 1C5PA 4ISNA 3KL6A 4BXSA 2KCOA 5HIZA 2O8UA 3GY2A 5EPNA 2TGDA 2J92A 1HRTH 1GBAA 1QURH 5JBBS 2Y6TA 5LH8A 2FO9A 1H8DH 2L74A 1P2JA 1PQ7A 2P16A 5IDKA 3ZIAD 3E6PH 4HG6A 1DVAH 1P03A 2CHAB 5FBIA 3BTME 3O8RA 3LH3A 5DP7A 1O3BA 1DWCH 2H9TH 1P09A 1TA6A 2K1QA 1VJ9U 7KMEH 2A5KA 2ZU3A 2Q6GA 1OP0A 5C0UA 1O2IA 1CHOF 5DP5A 1DSUA 3M5NA 4NA9H 4DIHH 5SGAE 2BDGA 3FP6E 3EA8A 3PYHA 1LQDB 1J16A 3RXPA 2ZPQA 3ZYDA 5CMXH 3UIRA 1PPFE 5AFZH 1YC0A 1YPEH 4ZCNA 5DJ7A 2BVSH 2KX4A 3E0NB 1EP6A 1JBUH 1P9UA 1MAYA 2C4FH 4D7FA 3GISB 5GJ4B 3KQCA 3TLOA 4CBNA 1T32A 3GY7A 2GDDA 3Q76A 1TIOA 4ABHA 1O3KA 4IBLH 1CT0E 3UNSA 4K3JA 2BLQA 3QN7A 1IQFA 4B2BA 4YOIA 4KP0A 1GJBB 2H1UA 1SGFA 2HRVA 1C4U2 2NU2E 2F83A 1KY9A 2PKAA 5DP3A 1RTKA 1N1LA 2OC0A 4CR5A 3EA7A 2OQ5A 3RXJA 4K5ZA 2A2XH 2IN2A 1DDJA 2O9QA 4WMDA 5GNDA 5HKKD 1LTOA 1O2PA 1GJ6A 2ZDNA 2GT7A 1HNEE 4CHAB 1NFWA 2JETB 3NXPA 3PMHB 4MLFB 1BA8B 2V0BA 2ZKSA 3RXUA 3F2HA 2PKAB 3QK1A 5E2OA 4DT7B 1WV7H 1YLNA 1EQ9A 1C2DA 4O97A 2QF3A 2AS9A 2PWXA 3A7TA 4B6EA 5T3HA 2B5TB 1MU6B 2ESTE 3A84A 4IN1A 1YPHC 4E06H 3PTNA 1HFDA 3PV2A 1S84A 1TABE 3GOVB 2HOBA 3SU6A 2ASUB 1PPZA 2Z6BD 3PRBA 3QLPH 3TVJB 4FUJA 3VB3A 4MNYA 1SSXA 4ABJA 1P2QA 3UTUH 2G55A 4X6MA 1Y8TA 1WQSA 4BXWA 1TA2A 1TE0A 3M36A 1BMFD 1CHGA 1DY8A 1VCPA 1MKXK 2AYWA 3LGTA 1YY3A 1ZHPA 1LPZB 1AY6H 4MDSA 1ZJKA 2V35A 1CQQA 2AERH 1X7AC 3MNBA 1MBMA 4LZ1H 2GGVB 3SGQE 3K2UA 5EU8A 1SLVB 1RGQA 1FX0B 4B74A 3DT0H 1BITA 1O2UA 1E79D 4XRNA 5LPEA 2PLXA 3MU5A 2WYJA 1B0FA 5EXLA 3SI3H 1C4V2 4ASHA 4ABAA 2J4IA 1ARBA 1Y3YA 3LKWA 2VWMA 4X6PA 1WOFA 5GWZA 2BY8X 2P8OB 1FY4A 4LXBH 4OS4A 1SGEE 4K1SA 5FHTA 2KZ4A 4I33A 3KQBA 2GP9B 1FY3A 3M7QA 1W0ZU 1D3QB 1O3JA 2HWLB 3M61U 1TNGA 1S5SA 1GBBA 2K0QA 1SFQB 2KCYA 2G52A 1V2UT 4RI0A 5C17A 2R2WU 5F8ZA 1E37B 3PWBA 2VIDA 5C3NA 4NSYA 4FU8A 3VB4A 1O3AA 2QY0B 4JZ1A 4Q7XA 2OBQA 3ZZ4A 1OP8A 4F48B 2VBCA 1E36B 5EXMA 4Z0KA 1FIZA 1V2NT 1C5TA 2ZTXA 2J38A 1BUIA 4MNXA 3RXEA 1C5SA 3O8CA 5LGOA 1AVWA 1HDTH 2YOLA 2ZPRA 3SHAH 3SORA 3ZVDA 3QTVH 1MBQA 1IQHA 5T6DA 2ZU5A 3STJA 3RUOA 4AGKA 1O5DH 2O8LA 1D3TB 3RXKA 1C5VA 1MTSA 1H9HE 1PQ5A 2G51A 4CR9A 4J2YB 3S69A 4ESTE 1SB1H 3MU1A 2CJIA 3IITA 2BD5A 4Q7YA 5FX6A 1V2KT 2AGIX 3KF2A 1BMAA 2Z9LA 1XMNB 1IQNA 1C9TA 1O2WA 4INLA 3FP8E 2BX3A 4CRFA 5B6LA 2D26C 3H5CB 3TU7H 1DM4B 2AIPA
chains in the Genus database with same CATH topology
2BZ6H 2B9LA 4JYVH 2PGBB 1TRYA 3RXAA 1ZMJA 4BANB 3SHCH 2NWNA 1NU7B 3QTOH 1LVYA 1BMNH 5IYTA 2BMGB 2FP7B 2GZ8A 1KXFA 1O5CB 3D23A 1O2TA 1SGTA 3A86A 3H7OA 1WBGB 3KN2A 5DP6A 1ZPBA 1GBIA 4BAQB 1FI8A 3MWIU 4XBDA 1DSTA 4K2YA 1TGCA 3GY3A 2A5AA 1GG6C 5FPSA 1QFKH 1GI8B 3NCLA 3T28A 4AORA 1D6RA 3MNXA 3BEUA 1AD8H 3OY6U 1Y5AT 2GZ9A 1OSSA 3A8AA 1A0LA 1ANCA 1V2QT 2CF9H 1TRNA 1UCYE 1C1VH 4K60A 1O30A 2EI8A 1FY1A 1WUNH 2TPIZ 1LCYA 1MKWK 2M5TA 1TQ7B 2FX4A 3V7TA 1JXPA 1YP9A 3U1JB 1F7ZA 4X8SH 1GVKB 3RU4E 1C5OH 4DURA 1P02A 3GDSA 4B75A 5A09A 3MH7A 2WINI 1C1WH 1XXFA 3RM2H 1F5LA 4MQAA 3M35A 1BCUH 1NRSH 2RA0A 3U8OH 1W10U 1BTZA 5JPMH 1ABIH 1O2YA 1XUIA 4JMYA 3OY5U 3DD2H 2GX4A 1NT1A 4MG3A 4X8UH 1OWKA 3MU4A 4KTUA 3TGKE 3SV9A 1BTUA 1IQGA 1FNIA 2Q6FA 5C1XA 4OS1A 1IQIA 1P2IA 1W2KH 2BQ6B 3K9XB 4OGYA 2B0FA 1O0DH 5PTPA 4X1QU 1EAIA 3BF6H 5E0JA 8GCHG 1L1NA 1SGFG 3C1KA 2A7JA 1HAPH 4X2WA 3ZVEA 1GWAA 2XBXA 1TOMH 3A83A 3SU0A 3LDXH 1K1MA 4WH8A 2LPRA 5ESBA 3N7OA 1EKBB 4TYDA 1DICA 1O39A 2ZU1A 2BYAX 3T5FH 1L4DA 4CRAA 1MTUA 4GSOA 1SPJA 1V2MT 1QJ6B 1MTNC 2F91A 1FONA 3RM0H 2HALA 1BRUP 2AMPA 3U8TH 3M7TA 4AOQA 2XW9A 1HV7A 1P57B 2O8WA 1BMLA 2KAIA 3GCOA 5L2ZH 3GCHB 4NZLA 1C1TA 1OPHB 1HJ9A 1YCPM 1ANDA 4A1VA 2ZTZA 1W12U 3GICB 5DKMA 3M5OA 4X8VH 1GG6B 3OSYA 1GGDB 3UQOA 1A3BH 2R9PA 2XXLA 3CP7A 1NY22 2P3UB 1ARCA 1SC8U 5HYOA 2KAIB 3BTKE 3BTFE 1LHFH 4NSVA 2BM2A 5JYIA 1F92A 1RIWB 3MH6A 4X1PU 1FAXA 1UTMA 3QDZB 1DITH 1C9PA 1SQTA 3V0XA 1ID5H 3RXFA 5F6MA 1CGJE 1THRH 1W7GH 5L30H 3DA9B 3IWMA 1GJ9B 5E0HA 3F9HA 2BDAA 5K0HA 1QJ7B 2A5IA 1C5RA 1OWEA 3ZVGA 2BVRH 1B7XB 1GCTB 1BTYA 1GI2A 4GPGA 1ZOMA 1V2PT 1T8NA 4MPXA 3BN9A 3TJUA 1A5GH 2P3FH 4K8BA 1O5FH 5L6NH 1O3IA 1O32A 2VGCC 3R3GB 4D8NA 1LQEA 1HAYB 1V2WT 4MTBA 4U2WA 4GUXA 2QXHA 1TGBA 1XUJA 2QIQA 4X6NA 1L4ZA 8GCHF 4MVNA 1KDQA 4NFEA 2ZGHA 3SNAA 3LGWA 3LT3A 1UTKA 1NRPH 2Y5GA 2FOHA 3SJ8A 3DHKH 2PHBA 5E8EH 2ZWLH 5EGMA 4ZROA 2A1DB 3S0NA 1L1GA 2ZG0H 1FV9A 3LIWA 3MU8A 3P70B 4ZUHA 2XCNA 1SGRE 1SHHB 1SGNE 2ZFTA 9ESTA 2QXGA 1ELFA 1SR5C 2ANWA 1ACBE 3DFLA 1GMDG 2VVUA 1DOJA 1LVOA 1GHYH 1S0RA 1HB0B 4HI3A 4BAHB 4JYUH 4B2AA 3L3TA 4FVDA 2XC5A 1T8MA 4ZHMU 3ZZ5A 5E2PA 3KQDA 1PQAA 1BOQA 1UTNA 3NK8A 5EQQA 1O3DA 4CREA 2V3OH 1ZTLA 3RMNH 1UK3A 1GJAB 3LGYA 1AWHB 1F0RA 2ZP0H 2ZFPH 4NCYA 3CS0A 4IC6A 5C67A 3L33A 3BTGE 4TWWA 1ZSKA 3HATH 1FDPA 1UMAH 5EW1H 1O3OA 1CO7E 1Y3WA 4FUIA 5DP8A 1LHEH 1L1JA 2BQ7B 4Y7BA 1ELDE 5EOKA 4OS6A 3L6PA 1QRZA 3LGUA 2BQWB 1TNJA 1ESAA 1QBNA 3UPEA 3NPSA 3SGAE 1O3HA 2H9EH 1CSOE 2CN0H 1EZXC 1QRWA 2NU1E 3A85A 3PM3A 4ZKRU 1EAWA 1HAVA 2ZZUH 1DS2E 5AVDA 3RU4T 2FTLE 4BAOB 2FM2A 3TH3H 5JBTA 1E0FD 3SJOA 4DG4A 5JB8S 2ZDKA 3S9AA 4Z6AH 2BLVA 3AASA 2ZGCA 1C5ZB 2RA3A 3VGCC 3D65E 1SMFE 1XUHA 1HLTH 2BTCE 4D9QA 1YCPH 2ZDAH 1GHAG 1U6QA 3P6ZB 2OC7A 2BDHA 2XYAA 2FPZA 4J1YA 1VITG 3VB6A 1O34A 6CHAB 1HAVB 1MZDA 1GJDB 3FZZA 2VU8E 3MYWA 1DWDH 1BBRK 1S6FA 1EB2A 2F9VA 2Z3CA 1UTJA 3ZZ7A 1ZLRA 2A2QH 1G37A 2JH5D 3RC5A 2F9NA 2FX6A 1IQMA 1BRBE 3B9FH 1EOLA 4Y71A 3BTHE 3T2NA 1GBEA 1OP2A 2SGAA 2ZECA 4UFGH 4CRDA 2GT8A 3U8RH 1OKXA 2D2DA 4XBBA 8LPRA 1N6XA 2AFQB 2WPJS 1O3CA 1GI5A 1P2MA 2OXSA 1O2XA 1HPGA 1GMDF 4WVPE 6LPRA 1MUEB 2QCYA 1SHYA 1O31A 3E91A 5C5NA 4WF8A 4O3TA 1UTLM 1VGCC 1DY9A 1RXPA 1Y3VA 2ANYA 1RTFB 2A4QA 3UWJH 2GDEH 4NIWA 4WY3A 3TNTA 3VXEH 2ZC9H 2VINA 2VNTA 2VIOA 1OYTH 3PLBA 1Y5UT 1QQ4A 1C1OA 1DWEH 2IPHA 2W7SA 3PLKA 2XCFA 2WUBA 4A1XA 1O2HA 1QL8A 4AG1A 1O2SA 1QL7A 4ZHLU 5CHAB 1J15A 1IQJA 1RS0A 4FUDA 2CXVA 1QNJA 1TMTH 2A7HA 1LKAA 5A8YA 2PKSB 3B8JA 1G3BA 4TY7A 3PO1C 2QYIA 3RMLH 1GL1A 2QA9E 1TPAE 3DFJA 5F8TA 1HAOH 1E34B 3RLWH 4IC5A 1WAYB 3QGNB 1EASA 2FODA 1CVWH 1SLWB 2SGDE 1G30B 2LNCA 1TRMA 3O8BA 1ZMLA 2FESH 3JZ1B 3UREA 2SNVA 1ZHRA 2ANKH 4UD9H 1NS3A 2GCHG 1AVXA 1K1LA 3UQVA 1GHAF 2FI4E 1BRCE 1VITF 1HAZB 5FPTA 1AMHA 1CBWC 1Z6EA 1NRNH 3S9CA 2Y7XA 2BLWA 2WV5A 4BAMB 1HJ8A 4THNH 2OTVA 2ZCKP 1F0TA 4CH8B 5FAHA 3A80A 3SBKA 1KXAA 4YESB 4ZKSU 1A4WH 4WWYA 1WQVH 4MPVA 4YT6H 4E7RG 1S6HA 2VIQA 4MNVA 3KNXA 2XBWA 2VWLA 1GI1A 1G2LA 1A0JA 1BTPA 5FXLA 1C2HA 1B5GH 3BG4C 3V13A 1QCPA 2PR3A 3VB5A 3TNSA 1TGNA 4ZAEA 1BT7A 1S81A 5C2ZA 1VJAU 1VCQA 3D62A 2W3KA 2OQUA 1UTPA 1THSH 3QO6A 4FUEA 5A2MH 1VGCB 1NROH 1A2CH 1MD8A 3ZZ8A 1SG8B 1G36A 2P95A 2ZHDA 1QB1A 3M5MA 4D9RA 1S0QA 1YPMH 2CV3A 8ESTE 4JZIA 1ANEA 1EJAA 1XUGA 1AZZA 1G3DA 1MTVA 5DGJA 5L2YH 4KTSA 3ELAH 1TPPA 3SOSA 2UUJB 2BD8A 5EG4A 2F9PA 4HTCH 2ZGJA 3W94A 4D7GA 3F9EA 1C5NH 1C1RA 4FUGA 4NA7A 5GPIB 3SNEA 1TGTA 3RXVA 2VIPA 1EJMA 1LMWB 4TPYA 1ANBA 1T4UH 1Z8JB 2GCTC 1AB9C 3UOUA 1QTFA 1Z6JH 2CMYA 2AIQA 3A87A 2D1JA 3KQEA 4Y7AA 4O3UA 1QR3E 1P04A 2IOTA 4Y0ZE 2VB0A 1QBVH 4IMQA 4YTAA 3RC6A 1D3DB 2ZQ1A 4I31A 1S85A 1GHBG 1DUEA 1BTXA 3RXHA 1TFXA 1MD7A 1P8VC 2FLBH 2OD3B 3SJ9A 1C5YB 1FPCH 2ZF0H 1K1JA 1GDUA 1SL3A 4XOJA 3VPKA 4YO9A 3TH4H 1KTTB 2UUKB 2G00A 2GCHF 1C1MA 1E38B 1YPGH 3UFAA 1BB0B 4NFFA 4NGAH 3E90B 1FY8E 3EYDA 3PMJA 1GI9B 1F0SA 2GV6A 3GCTF 2GMTC 3GY5A 3MHWU 2AMDA 1HAHH 1ELGA 1Q3XA 1HIAA 3UR6A 4X0WU 1WTGH 1V2VT 1BZXE 1IHTH 3HK3B 3OX7U 1ETTH 4XBCA 3SU4A 2ZNKH 3RXRA 1A46H 4UDWH 1O2LA 4K1EA 1UTOA 2W5EA 1QY6A 5GDSH 4K8YA 3SU2A 1G3EA 2I6QA 3CENA 4JCNA 6ESTA 2WPHS 2ZEBA 3ZVBA 3ATIA 1A5IA 2F3CE 1P3EA 1C2GA 1V2RT 2PTNA 1HIAB 2VJ1A 1O35A 1FPHH 4DGJA 1W14U 1PYTC 1TALA 1C2JA 2FOMB 1SLXB 2ZFQH 2FOEA 1C1PA 4XSKU 3A89A 2PFEA 3GYMA 1ZHMA 3ODFA 4YM9A 2TGAA 1O2JA 2PUQH 3SO3A 1FUJA 4NIVA 4I8KA 4E05H 1NZQH 2Y5HA 2HNTF 2RCEA 1Z1JA 2BOKA 1HAGE 2ODPA 2UUFB 4IMZA 2VH6A 2ZO3H 3ZZBA 4Y79A 1O33A 4JZFH 1C5UA 1GI6A 1O5EH 2PSYA 4FU7A 2FI5E 3ZYEA 3SV8A 3LC3A 1BJUA 5C5OA 3UR9A 2CGAA 4X1SU 1TOCB 2SGFE 2OINA 5HMAA 2UWOA 2VVVA 4HGCA 3ESTA 5A0BA 3BTEE 4HFPB 3F9GA 3F6UH 2GD4B 1Z8GA 3HGPA 2J94A 1GHBF 3K65B 2BY9X 5LPRA 1AO5A 5A8XA 4WXIA 1AFQC 4FVBA 4KELA 9LPRA 1SGDE 3QX5H 1K1IA 3T27A 4ZH8A 1O37A 2Q1JA 3MNCA 4KKDA 4A92A 2XWAA 3A7YA 3E0PB 1AE8H 1P10A 3A7XA 4H4FA 5FPYA 4I8LA 4I8HA 4U32A 1G2MA 3GY4A 4XFQA 2XWBI 1C5WB 1EAUA 1PPCE 2ALVA 3PTBA 2GMTB 1GHWH 2WPIS 1THPB 2ZCLP 3SU1A 3URCA 1S83A 1GBLA 3I78A 2I6SA 2OUAA 4WMEA 3T29A 4H6SB 4XDEA 3LU9B 1D6WA 1VR1H 2BY7X 5H4IB 4I32A 2ZDVH 1GI0A 1NN6A 1ZSJA 1ZGVA 1HGTH 2BDCA 3M3TA 1QJ1B 1NFUA 1OOKB 4CBOA 3QGJA 1KLJH 2YNBA 1LPGB 4YZUA 4ZKNU 2FOCA 4OS5A 1WCZA 3LC5A 2JKHA 3MU0A 5JBCS 3E8LA 1O2ZA 3FP7E 1ESTA 5DO4H 5EQSA 3B23B 3MFJA 2VVCA 1N8OC 3ENSB 2F9BH 3JZ2B 4ABIA 2Z9JA 3KCGH 3V12A 4AB9A 1IQKA 2GTBA 1ZRKA 2A4GA 3ATKA 5GCHG 1C1UH 1C1SA 1SGYE 3A88A 5B6OA 2STBE 5HXFA 1HBTH 5FCRA 3GYLB 4YLQH 2FDAA 7ESTE 2B7DH 1DXWA 3PWCA 3HKIB 1AQ7A 3MH5A 1QB6A 4INKA 3BTWE 3FANA 2H5DA 1F5KU 1BBRE 1YKTA 4DVAU 1CE5A 1DX5M 1YCPK 2HVXA 2ZIQH 2UWPA 5J4QA 2EEKA 1CGIE 2G5NA 4ABEA 4DOQA 2OLGA 1GVZA 3ZZAA 4AFSA 5AF9H 4H6TA 2XC4A 3ZZ9A 3E16B 3MTYA 3A8CA 1KSNA 1JOUB 2BD3A 4B73A 3EAJA 3OTJE 2H9HA 3Q00A 4ISOA 2ZFSA 8KME2 2QC2A 4INHA 1K1NA 1EPTC 4ABGA 3BEIB 4PROA 1HJAC 3RP2A 1HXEH 1Y5BT 1E35B 1Y59T 5LPFA 5BPEA 1GBHA 1EXFA 3ZV8A 1MKWH 2RG3A 2Z94A 1P06A 1JMOH 4MPUA 3SQHE 3A82A 1L0ZA 2PGQB 3AVZA 4Y8YA 1P11E 1ELVA 1TONA 4VGCC 1C5MD 4NZQA 1Y3XA 4DIIH 1C2EA 1TX8A 4Y10E 1YPLH 2ZPSA 1KXEA 1O36A 4AGJA 3OYPA 4I8GA 1MTNB 5HM9A 2C8ZB 1TX6A 4A5TS 5A8ZA 2A45B 4ABDA 1MU8B 1ZSLA 5DK1A 1YLCA 4B1TA 3SU5A 2CHAC 1H9IE 1UVPA 3W95A 3T62A 2Y81A 1KDQB 2C93B 3CS7A 4ISIH 1T8OA 3RU4D 3T25A 1NO9H 4AYYB 1DFPA 4X6OA 3UNRA 1VZQH 1HCGA 1YPJH 1M9UA 1O2VA 2HPQH 2C8WB 1C4Y2 1ESBA 1BQYA 2FIRH 2NU0E 2HLCA 3RXTA 2QF0A 1O5AB 3EE0B 4YOJA 1LKBA 1KXDA 3UNQA 1A61H 5FCKA 3TITA 1AZ8A 4UFDH 5GIBA 1O2NA 7LPRA 1TGSZ 5GCHF 1ZTJA 2ZU4A 1EOJA 1NFXA 3FFGA 1AGJA 1O3PB 4K69A 2Z7FE 3RXGA 3SUEA 3TK5A 4AYVB 1LPKB 1TQ0B 1AIXH 1ZPZA 2ODQA 3TGJE 1K2I1 1KLIH 4CH2B 1GI4A 1NM6A 1AE5A 1SI5H 1DLKB 2WUCA 4AN7A 3NUMA 1WU1A 5CE1A 2ZDMA 3TGIE 2BY6X 1NC6A 1GBCA 3SQEE 1MCTA 3ODDA 1SGIB 1NRRH 3A81A 1S82A 1TNKA 1JWTA 2TIOA 3RXLA 1EZSC 4IGDA 4TY6A 1RD3B 2P94A 2EC9H 1IQLA 4ABBA 1C1QA 1DPOA 2BLOA 4M7GA 3BIUH 1TAWA 1ZZZA 2BDBA 1XUFA 3BSQA 2Y82A