1HIAB

Kallikrein complexed with hirustasin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural class of serine protease inhibitors revealed by the structure of the hirustasin-kallikrein complex.
pubmed doi rcsb
molecule keywords KALLIKREIN
molecule tags Complex (protease/inhibitor)
source organism Sus scrofa
total genus 29
structure length 150
sequence length 150
chains with identical sequence Y
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hiaB00
3SUGA 5A8XA 6GCHF 3NCLA 1C2JA 2P3FH 1MTVA 1BJVA 1ZTKA 3BTEE 1P02A 1TNKA 2O8WA 2WPJS 3BEFB 1PQ7A 1FN8A 2C93B 1MU6B 1C5ZB 1P57B 1ZMLA 1B0FA 1Y3VA 4I8KA 2BQWB 1HAVA 2BTCE 4AX9H 5IYTA 1QBNA 1ETTH 4CREA 1SB1H 1CBWC 1ZPZA 3HK6B 1GG6B 3MNXA 3SHCH 3SV7A 1IHTH 1P2MA 2BDCA 5C2ZA 5JBCS 8GCHF 1MZDA 1GHVH 1MZAA 3M3VA 2O8UA 1D3TB 2FXRA 2ZHEH 4NIWA 1XUJA 4CR9A 1AUTC 1E35B 1ESAA 1V2PT 4MDSA 4DIIH 3P95A 1W7GH 1SQTA 1GBBA 4B76A 1C2HA 1L4ZA 1C1NA 3E0NB 2BDAA 2QXGA 3SV9A 2GMTC 2ZU2A 1OKXA 1MD7A 4ZXYH 1DX5M 2SNWA 4FVBA 4YLQH 1GDNA 2F83A 2J92A 4D76A 4YZUA 2A7CA 2P59A 3QGJA 2WYJA 2BX3A 4WJG2 1LPZB 3LC5A 1IQGA 1QL8A 4JCNA 4GVUA 4XSKU 1CA0B 2XBXA 3OTJE 2A5IA 5HMAA 1UCYK 3TVJB 3SU2A 3U8OH 2PSYA 2ZHDA 3PB1E 1D3QB 4FUDA 2GGVB 2PTCE 1JRSA 1BRBE 3LJOA 1EUFA 5JBBS 1AVGH 2GZ7A 3F6UH 1SR5C 2WV5A 1O3GA 4VGCC 1ZSJA 1GCDA 3ZV8A 4UFEH 2QY0B 4CRGA 1MAXA 1C5LH 4WVPE 3BTME 1L0ZA 1NFYA 1F92A 2HALA 1NO9H 1EZQA 1J9CH 5T6FA 2QAAA 3NXPA 3RXBA 5LH8A 1GHBG 3KQBA 4XFQA 1OOKB 1OX1A 2ODQA 4A6LA 4X2YA 3RXEA 2WYGA 4DCDA 5JB8S 4AYVB 1OWHA 3RXAA 3ZZ5A 1HAHH 4IW4E 4GHQA 1MTWA 1QIXB 2VWNA 1O3EA 4AGJA 3UWJH 3A7XA 1RTKA 3P8GA 3A7TA 5JDUB 2UWLA 1TNIA 1ANCA 3T26A 4D8NA 3SUEA 1IQJA 3OY6U 3M37A 3TPIZ 4Y7AA 3JZ2B 3F9HA 1GJCB 2PUQH 2HLCA 2VIVA 2BOKA 4XBBA 1W11U 2ZP0H 5F8TA 1QRZA 1DWEH 3KHVA 3U1IB 1CE5A 1SVPA 3LGVA 3CENA 1ZHMA 2B5TB 2ZFTA 2QN5T 1GJAB 3RU4D 4CRFA 3T5FH 1CU1A 2PWXA 1EP5A 8LPRA 1ELFA 1YYY1 1HIAB 1FIWA 1ZSLA 1V2TT 5FBEA 4ISHH 1LVOA 3ZZBA 4K69A 2NU4E 1C5OH 1NROH 3LH1A 5LGOA 4B1TA 3PLKA 1RIWC 4J2YB 1P03A 1P9SA 2PR3A 1KYNA 4ZH8A 1XXDA 4BXWA 3SV2H 1T8NA 1P9UA 2C3SA 1EJNA 2CF8H 1O3NA 1FPHH 3IG6B 1Z71A 4NWKA 1SSXA 5E2PA 2JH6D 4B75A 4AG1A 1NPMA 4FUEA 2Y7XA 3AAUA 1IQLA 5E0HA 1O2QA 2AIPA 1TX8A 2PFEA 4B2CA 1VZQH 3DUXH 4WWYA 1ZPBA 5A8YA 3BTHE 1GJ7B 1BTZA 4INLA 5EQRA 2VVVA 3QZQA 3UQVA 1K1IA 5LPFA 1DE7H 2V35A 2ALPA 4XOJA 7LPRA 2B9LA 3KEEA 2Z9LA 1YKTA 1C5MD 2ZEBA 2A32A 2ZFRH 2HPQH 2F9VA 3PWCA 3U9AH 3UNSA 2PKAA 3RM0H 4FUFA 2FTMA 4BAKB 2F9OA 1O36A 4GHTA 1SI5H 4MNXA 1UK4A 1NT1A 1L4DA 3VFEA 1LTOA 3D62A 3RXPA 1AN1E 2Q1JA 3KCGH 5C3NA 1H8IH 3UQOA 3ZVBA 2W7SA 2G51A 3BTDE 1FI8A 1ARBA 3EDXB 4BANB 3VXEH 3KN2A 4MPVA 2BM2A 4U32A 3SNDA 1V2UT 2Y5FA 4X6NA 2ZDLA 1GBDA 1BRCE 2BD3A 4IN2A 2WINI 1QQUA 1NZQH 5FCRA 4GLYA 1FPCH 2G5VA 1JWTA 1HAYB 1OWIA 2CN0H 2J38A 3PV4A 4MLFB 4ZHLU 1HNEE 1DY9A 2GCHG 3L6PA 1A61H 1IHSH 3MU4A 1GG6C 1AY6H 1T4UH 3U69H 3DD2H 1XX9A 1TE0A 1V6DA 2C4FH 1P04A 1SGRE 4I33A 2W7UA 1O2UA 1K21H 4ZUHA 4BTIB 1ZGIA 2GV7A 1QQ4A 2OQUA 3MU0A 1UJ1A 2BDHA 4OS7A 4CRCA 1O3LA 4CRBA 4E06H 4D7GA 3PO1B 3T28A 2ZPRA 2CGAA 4I31A 3UPEA 4AYYB 3TK6A 3T27A 1FAXA 3UUZA 5C67A 3PMAB 1Y3YA 3QLPH 5A2MH 1HDTH 2F9NA 1N1LA 4F4OC 1BMLA 4NA8A 4X8VH 5L30H 1DUEA 1CHOG 3NWUA 1ZLRA 3MFJA 3O8CA 4K2YA 1CA0C 4AFZA 2DUCA 4FUJA 3MO3A 1GBFA 1GI2A 1Z1IA 2GCHF 1E37B 1Y8TA 1F0UA 2WPHS 4WH8A 1QHRB 1VGCB 1P3CA 2J34A 3LDXH 3UR9A 3M3TA 1EPTB 1DT2A 2O8TA 1G3CA 1ANEA 1WYKA 4LZ4B 3MOCA 2EC9H 2H9EH 1E36B 1T4VH 2XW9A 4X2XA 3OSYA 3ZZ6A 3BTWE 2RA3A 1P01A 2ZDMA 1GBMA 3GY4A 4NIYA 3ZVDA 2GVFA 1UTOA 3Q3YA 3V3MA 1ZYOA 2OLGA 1K1PA 3LOXA 1CA8B 5EGMA 3RU4T 3DFJA 2H5CA 4ISLA 2R3UA 3SU0A 3GOVB 4I7YH 4JZ1A 4ZROA 1B0EA 1QB1A 3IITA 3ZZ9A 2GD4B 1XKBC 1FY4A 3P6ZB 1IAUA 2XTTB 8KME2 5AHGH 4K3JA 8ESTE 1ZRKA 2BD8A 2ZG0H 3EA7A 2AH4X 3G01A 4AORA 3TK9A 5FX6A 2CF9H 2R0LA 1HJAB 4YM9A 2GP9B 1CQQA 1GJBB 1V3XA 3U98H 4CBOA 4JYUH 3H7TA 2PV9B 4FUHA 1XUFA 2SGPE 1DS2E 2UUKB 4WMFA 1FLEE 1HIAA 1ID5H 2K1QA 2W3KA 3VB4A 1EOJA 1GPZA 3LPRA 5EPYA 3MU8A 2ZTZA 2FLBH 5GIBA 3RUOA 3TH3H 5GWZA 4X1NU 1HRTH 1AB9B 1CGJE 1SGNE 2G81E 2RCEA 1GI5A 2FX4A 2FS8A 3K6ZA 2Y5HA 2BHGA 2FS9A 3SJ9A 1O3PB 1IQEA 5FX5A 2HOBA 3AAVA 4H4FA 1Y59T 2FOHA 3TU7H 1ACBE 4OS4A 2BB4A 3SN8A 1H8DH 1AIXH 1E34B 1A5IA 2Y80A 1BTYA 4IC6A 3E16B 4B71A 2ZFFH 4DT7B 3SBKA 1H1BA 4TY6A 3RXTA 1EB2A 3SUFA 4GUXA 5GXPA 2XC5A 5AFYH 3TK5A 2C8ZB 1GMHF 3S7HB 1BBRE 3P8OA 1OPHB 1HV7A 5EOKA 1GL1A 1AQ7A 3NK8A 5BPEA 2FOBA 5DO4H 5F8ZA 4K1EA 3GISB 3ZVGA 2TGPZ 3AW0A 3KF2A 1NY22 2NU0E 1PPZA 4NGAH 1ZSKA 3SU4A 1OP8A 4Q80A 1S6FA 2FDAA 1BT7A 4YT6H 3MO9A 1BMAA 3TGJE 4OS6A 4AGKA 3FVFB 3UREA 1UTLM 3EE0B 1H9IE 2FYRA 6ESTA 1C5SA 3H5CB 2OCVB 1HLTH 3TITA 2NWNA 5I46H 1GI3A 2ZC9H 2QA9E 2GKVE 2HPPH 1VCQA 4I32A 3ODDA 3M36A 3C1KA 3RLWH 1TA2A 1BBRH 1C1RA 1ELAA 2VIDA 1GHXH 1UMAH 2GDDA 1ELBA 2ZU1A 2IPHA 4J1YA 4JK6A 4Q7YA 1FDPA 2RDLA 1O2IA 3F9FA 1ELVA 1NRQH 5C1UA 1QURH 3LGUA 2BDIA 1LO6A 1C2DA 2ZWLH 1C1UH 1P8VC 4FU7A 2OC0A 1RXPA 1A5GH 1O2OA 2AYWA 3A7ZA 3ATMA 3AASA 1TGSZ 2SGAA 1FMGA 1O2YA 3RC6A 1ELCA 3SORA 1GJ9B 1W0YH 1O2ZA 1SGTA 1F7ZA 2SNVA 3BIVH 3ZVCA 1HYLA 2QYIA 4O03A 1BTWA 1QA0A 1YPKH 1NS3A 1KXAA 5C1YA 2QC2A 4DY7B 1MKWH 3R0FA 4Y10E 5DJ7A 1DSUA 1JRTA 2Z94A 1IQFA 1QY6A 1GVZA 1UVSH 2QCYA 2IN2A 3SGQE 4NZQA 3URDA 1SHYA 3TJUA 3A81A 1MBQA 1QB9A 1RGQA 1TPAE 3M5MA 3BEUA 1SGYE 3PO1C 3CP7A 3LKWA 3BIUH 1XM1A 2GV6A 4O3UA 4DJZB 4Q7ZA 5FBIA 4O97A 1D3DB 1LVYA 4Y76A 2FM2A 3GICB 4R0IA 1TIOA 1G37A 1Y3WA 1PPGE 3MNCA 2ZU4A 4IN1A 1CT4E 1EPTA 1DDJA 1XUIA 2TPIZ 2P8OB 4A1VA 3QTVH 3FP6E 1W8BH 2D1JA 1O34A 4X1SU 4UONA 1LHCH 1SGEE 4NSVA 3GY2A 3RMMH 4U01A 2AGIX 2QXHA 2XNIA 5C1XA 4YLUA 1O3MA 1TFXA 3PYHA 4E05H 1VGCC 3ZZCA 1O2JA 3RXRA 1QJ7B 2JH5D 4X6OA 3FFGA 1EJMA 1EPTC 2G00A 1QJ6B 3EYDA 2G55A 1EQ9A 5A8ZA 1FN6A 3ZVEA 4AN7A 4X6PA 1JMOH 2HNTC 2ZHQH 1A3BH 1RFNA 3RMNH 1TRYA 4H42U 1S84A 2Z9JA 6LPRA 1C5NH 1DWDH 1C4U2 4Q2KA 9LPRA 1PPCE 1UTKA 3HGPA 2BXUH 2A0QB 1BJUA 3QGNB 3S9BA 2R0KA 1GBCA 1NC6A 2ILNA 4FUGA 1F0TA 2AMQA 2ZDKA 2FIRH 2Q6GA 1YPHC 3F68H 2HWLB 2OINA 3A7WA 2D8WA 2ASUB 1SLVB 1GI0A 3HK3B 4YOGA 1ELEE 1TAWA 4FU8A 1HAGE 1IQHA 5H4IB 1QBOA 1QA7A 2BLWA 5FAHA 5A0CA 4A5TS 4DIHH 1HJAC 1TGNA 2SGFE 1QL9A 1XUHA 1WV7H 3SUDA 1TNJA 1TA6A 3E90B 3PMHB 4X2VA 1HAPH 1FUJA 4X1QU 1MCVA 4MVNA 1THRH 2A4OA 3Q3KA 2EI8A 3OX7U 4KP0A 1TOMH 4R8TB 3CS7A 5TCCA 2OBOA 5DP7A 1DXPA 4MNVA 3ZZ4A 1JXPA 2ZNKH 1O39A 5EODA 1AB9C 2ZZUH 9ESTA 1GI8B 4MG3A 3QN7A 1C1WH 1W2KH 3A84A 1O2HA 1P12E 2VU8E 3SU5A 1WSSH 1GHZA 2CJIA 5EW2H 1SHHB 1BCUH 1DOJA 3K9XB 3ATKA 1NESE 1TQ7B 3QX5H 3W95A 2HNTE 2QF3A 1NRRH 4JK5A 2BY8X 1P3EA 4DW2U 2AIQA 1BIOA 3ZYDA 3ATWA 2JETB 3PLBA 1H9HE 1W0ZU 1C5RA 1PPFE 5JB9S 3A80A 1AMHA 5HM9A 4MQAA 4TY7A 3UNRA 1QB6A 1TX6A 1AU8A 3BSQA 3F1SB 1JIMA 1OP0A 1T31A 5FXLA 2P94A 1YPHE 2ZO3H 2ULLA 4WXVA 1MTSA 3M3SA 2GZ9A 1O0DH 3S9AA 3Q00A 1KLJH 1ZR0A 1K1MA 2W26A 2FPZA 5GJ4B 1Z6EA 2AGEX 1DWBH 1EP6A 4ZXXH 3C27B 3LT3A 3UIRA 1AO5A 5TJXA 1PJPA 2YOLA 4IC5A 1CT0E 5EQSA 1O5FH 3S69A 2GZ8A 1IOEA 5DK1A 2FX6A 2GT7A 4HGCA 1GHBF 4UE7H 2ZA5A 3E3TA 2PLXA 3GCTG 2A4QA 3RXJA 4GSOA 1GI9B 3MH6A 2AFQB 1S5SA 4ABHA 3RM2H 1J14A 1C9PA 1TABE 3KGPA 4AFQA 1AVXA 2A45B 1KXDA 2GT8A 4B73A 4IBLH 1G3BA 1O2VA 4LK4A 1O3OA 1XMNB 4Y71A 1GMCG 4Y8YA 1BBRK 1HBTH 1OYQA 2BY5X 3GYLB 5EXNA 2BD9A 2ZGJA 1DANH 3QTOH 3RXKA 1HPGA 1YPLH 1PQAA 2VWMA 1CVWH 1P10A 3ESTA 1N6XA 3F9EA 3BN9A 3PWBA 4A1TA 3SW2B 4BAHB 1DLEA 2FMJA 1TRMA 3E8LA 1EASA 3GCOA 1YLDA 2H9TH 3ODFA 4NZLA 5PTPA 1PPEE 1KTTB 1FJSA 3OU0A 3GCTF 1EAXA 4ZKOU 2B7DH 2ZHWH 1KDQB 1KLIH 5LPRA 2F9UA 3VEQB 1J16A 1YBWA 3RC5A 1UO6A 1S82A 1RJXB 1AE5A 5J4QA 1QBVH 4I8HA 1SFIA 3E1XB 1DVAH 2UUYA 4GPGA 1MKWK 3SNBA 2PGQB 1B5GH 4B2BA 3RDZA 1MQ5A 1YP9A 4CH8B 1G3DA 1ZMNA 1GMCF 1C2EA 3SU3A 2R9PA 3STIA 5DP6A 1SBWA 1ZPCA 5BRRE 4WMDA 1BTPA 1ZZZA 2PKSB 1ANBA 1HCGA 2PGBB 2GDEH 3M7QA 2O8MA 3SGAE 1EX3A 2Y81A 2JKHA 2RG3A 3ZVFA 1ETRH 1ZJKA 2P8OC 2TGTA 4ABDA 2ZDVH 3RXCA 1KXBA 2VH6A 1C5PA 2OQ5A 1MQ6A 3DFLA 1IQKA 2KAIB 3A8DA 3M5OA 1LKAA 2QV1A 2WUBA 1KXCA 1EZUC 2V3OH 1W13U 1PYTD 1Y5AT 5F8XA 2J95A 2AEIH 3HPTB 4IMZA 3LJJA 1PQ5A 4ASHA 5DG6A 4WH6A 4MPWA 1HAZB 4AFUA 1LKBA 1FY3A 1F5KU 2F9PA 2UUJB 1A1RA 2ZQ1A 3KQEA 3H7OA 3O8BA 1GBTA 3ENSB 2ZFSA 5T6DA 1MH0A 1FZZA 1Z8RA 4E7RG 4BTTB 2FESH 1TWXB 4Y0YE 4ZKRU 4Y6DA 3M5NA 2BQ6B 1S81A 2AGGX 2BXTH 4D9QA 5GDSH 4AB9A 3LGWA 2VWOA 1A5HA 1QRXA 1Z8IB 2ODPA 3V13A 1WCZA 1BMMH 1TMUH 1ZHRA 1YPJH 1O2SA 1LPGB 1PQ8A 2HVXA 1AE8H 4DOQA 1OXGA 1NFWA 2UUFB 4X8TH 2FOCA 2OXSA 4BAOB 5AFZH 1Z8GA 2FTLE 2NU3E 1GBIA 1GHAG 2C8YB 3M61U 2ZDAH 5CHAB 3DA9B 4TPYA 2P3UB 2V0BA 4X8SH 2J2UA 3KL6A 5EPNA 5A0BA 2AMDA 3K2UA 5ETXA 3BV9B 1ABIH 4K1TA 5FPTA 1Z7KA 4RKJB 5CMXH 3NKKA 3P92A 1DFPA 2FOGA 3B23B 2FOFA 3MHWU 5HGGA 3BTQE 1FNIA 2Y5GA 4ZKSU 2WPKS 3O8RA 1QFKH 2BD2A 4IMQA 2GTBA 3NPSA 2GCTB 2IJOB 1H4WA 2J9NA 5GCHG 4K60A 1O5AB 4IGDA 2XBVA 3LU9B 4U30A 1K28D 4ISOA 3SV6A 4YT7H 1EXFA 2BLQA 3BG4B 3BTTE 2RA0A 1LVBA 1S85A 2BDGA 2OC7A 1GBJA 1O3AA 1KIGH 3ZZ3A 4MTBA 2YNBA 1SFQB 1P09A 2JETC 3JZ1B 1G2MA 1QR3E 3TNSA 4NA7A 1UVTH 1UTQA 3PROA 5A09A 1GCTB 4ZHAA 1TGTA 4BOHA 1CHOF 1UTPA 1LMWB 1UVPA 3RXVA 1GGDB 1GVLA 3A89A 1WOFA 2ZTYA 3RXLA 3A83A 1O2LA 2C8XB 4NWLA 1FAKH 3CS0A 2SFAA 2BDBA 2GMTB 3MH4A 1A3EH 4KTSA 3Q77A 1O3DA 1MTNB 1N8OB 1SG8B 1ESTA 5GPIB 1SGIB 1GBLA 1LDTT 2FZZA 2BY7X 2CMYA 1SOTA 2BQ7B 4X8UH 1AWHB 2ZU5A 1Y3UA 3URCA 5ABWA 3V0XA 4BTUB 2B8OH 4I8LA 4DVAU 5GCHF 2Q6FA 5ESBA 1CO7E 5EG4A 1C2MA 1GL0E 4AB8A 1LHEH 2J94A 1O5BB 2QGRA 1LHDH 2J4IA 2BZAA 3L33A 4XDEA 7KMEH 1XXFA 1KLTA 4BXSA 2EI6A 3GY6A 1O3KA 1V2VT 1FXYA 1OS8A 4YOJA 2H9HA 2NU1E 1O2TA 3AVZA 5DP3A 1C9TA 5EQQA 4KKDA 1NTPA 1ZHPA 3R3GB 1EAIA 2ESTE 1SC8U 1GJ4H 7ESTE 1VITH 1YPMH 1LQDB 2ZFQH 1DSTA 3MNSA 4WMEA 1MCTA 4ISIH 1A0HB 1O3IA 4NIVA 1A2CH 2FI5E 3ZVAA 1HJ9A 1L1NA 1TX7A 1XVMA 3BTGE 1ETSH 7GCHG 1WAYB 2QF0A 1KDQA 2P93A 4X6MA 1V2QT 3RP2A 2FLRH 1GHYH 2QIQA 3RXOA 3MU1A 1LHFH 2BDYA 2B0FA 2H2ZA 1K22H 2G5NA 1V2KT 2FOAA 1EJAA 1ZTLA 2TGDA 4K8YA 4AZ2B 4DG4A 1QCPA 2ZFPH 4M7GA 3WY8A 2EA3A 1NU9A 5T3HA 3O8DA 5HXFA 3MO6A 2VNTA 1J17T 3A8CA 3TIUA 4FUIA 3ZZ7A 4TYDA 1AHTH 1TNLA 1RS0A 2TGAA 1DITH 1O30A 1E0FD 2G4UA 1D3PB 1TB6H 2KAIA 2PKSC 3TGIE 3QUMP 3T29A 1F2SE 4RN6A 1OWKA 4ZKNU 2ANKH 4OS5A 2G52A 7GCHF 1A46H 1TBRH 3SQHE 3TLOA 1MU8B 3HKJB 3GCHB 4OGYA 1K1LA 3ATLA 3I77A 2AMPA 1HAXB 1P05A 1O2PA 2ANMH 1GMDG 1S0RA 1QJ1B 1TNGA 3MNBA 5FHTA 1LHGH 4YOIA 4K8BA 2SGEE 2XCNA 3GDSA 1MTUA 1C2KA 1O2KA 4MNYA 1KTSB 1C4Y2 2FODA 2ZIQH 3SNAA 1BTXA 1BTHH 3GY8A 2VIQA 1GBKA 1S83A 5C5OA 1GWAA 1T8OA 2F91A 3KQCA 2CHAB 2G4TA 1BTUA 1MKXH 1ARCA 1UVOA 1O2WA 3PTBA 3TJVA 2ZTXA 4Z0KA 1T32A 2HRVA 4O9VA 1EATA 1SGDE 3GCNA 1JIRA 1SGFA 2Y6TA 1RTLA 1G36A 4WF8A 2R3YA 2Z7FE 1C2FA 8GCHG 2DE9A 2VINA 2VJ1A 1FY1A 1NRSH 2Z3CA 2ZGBH 1WU1A 1P06A 1O5CB 1ELDE 1N6YA 5CHAC 1P2OA 4D9RA 1GMDF 1CGIE 3I29A 1QRWA 3HGNA 4ABFA 3VB6A 1O2NA 5JYIA 4MPUA 2D26C 1GI7B 3HATH 3GDVA 1C1VH 5IDKA 1AUJA 3EGKH 4GCHG 1AFQB 3LGIA 1C1QA 1AZ8A 2Z9IA 3D49H 5FCKA 1SGQE 1AGJA 1TRNA 5TCAA 1W10U 1A7SA 2VGCB 2GCTC 4AG2A 2F9BH 3SU6A 5DGJA 3BTFE 5CE1A 3EA9A 4IS5A 1DICA 1D9IA 3T2NA 3BG4C 2ZCKP 2VIOA 3EQ0H 1G32B 5E2OA 1EB1H 2STAE 1SLXB 1C2IA 1O3FA 2PUXB 2Z9KA 2Y7ZA 1BHXF 4OGXA 3BTKE 1YPEH 2BMGB 1BDAA 1GCTC 2TBSA 4JMYA 3ITIA 1EOLA 1G30B 1ZTJA 1P2QA 1WQVH 1SOZA 1GGDC 1ZRBA 3NZIA 2XYAA 4QT8C 5F6MA 1Z1JA 4A7IB 1O5EH 1NRNH 3B8JA 1HUTH 2FO9A 1SPJA 1TMBH 2A7HA 1GBHA 1V2OT 3RXGA 4PROA 4MNWA 1DUAA 4KELA 4GCHF 2O8LA 1QL7A 2FOMB 4HFPB 1MTNC 3ZZDA 1N8OC 3VGCB 3M7TA 1BITA 1Z6JH 3L3TA 1NN6A 2XRCA 1O2GH 1V2WT 4X1RU 4CHAB 5E0JA 3BF6H 1PPBH 3Q76A 2AERH 4LZ1H 1A4WH 1OP2A 2BVRH 1TOCB 4ZMAH 1XUKA 2V3HH 2XWAA 2A1DB 3PLPA 3A87A 3KIDU 1ANDA 3V12A 3F9GA 3SU1A 1ABJH 3P8FA 3MWIU 1O2XA 1J8AA 4NSYA 2THFB 1MUEB 4ABAA 3FANA 4Q7XA 2BZ6H 4GAWA 5FPYA 1P11E 5C5NA 5F03A 4K1SA 3I78A 5C20A 3A88A 2BLOA 4UFDH 2BYAX 1THSH 1BRUP 4XE4A 2A4GA 5E8EH 6CHAB 1D4PB 3SO3A 1ESBA 3LGYA 2Z3EA 5L2ZH 1A0LA 4H6SB 4D7FA 2VVUA 5E0GA 4X1PU 1BB0B 4JYVH 2FEQH 5EU8A 1GJDB 1EZSC 1F0RA 1TPPA 1C2LA 3LC3A 4FUBA 3A86A 1C1PA 1OWDA 1HXFH 1ELGA 1ZGVA 2WUCA 3IWMA 2ZPSA 1O3JA 5I25A 2G8TA 2W3IA 2FI3E 1C5YB 5SGAE 4Y7BA 1EAUA 3QK1A 1Q3XA 3FZDA 1C5TA 3RC4A 2A5KA 1TPOA 4ABJA 3ZYEA 4ESTE 1HXEH 3VPKA 4JZEH 2BY6X 1ZOMA 3LGTA 2ZGXH 1S6HA 5AF9H 1W3CA 1VJAU 4Y8XA 2NU2E 2R2MB 3LIWA 1BRAA 2HGTH 1BZXE 1UK2A 5B6OA 1O35A 2CXVA 2OC8A 3QO6A 3RXFA 1JOUB 2Z3DA 1QGFA 2M5TA 2A2XH 1C5XB 2PTNA 2P3TB 4NFEA 3A8BA 1SLWB 2F3CE 1O32A 4X0WU 1Q2WA 1CHGA 3P8NA 2Y82A 1QNJA 3GY7A 1C1TA 1IQIA 3T62A 4YO9A 5FPSA 3RXMA 1UHBA 3TJNA 1MBMA 3D23A 4E7NA 1RTFB 1TALA 2ODYB 1Y3XA 3GCHC 5HM2A 2ZI2H 4DURA 4BNRA 1OWJA 1XKAC 2WPIS 3ZV9A 3MH5A 4RSPA 4OS2A 5DP9A 4ABGA 1XUGA 1HAOH 3S0NA 3TGKE 1NM6A 5DP5A 4SGBE 1F5RA 4LOYH 1Y5UT 5L2YH 3T25A 1RRKA 2BVXH 1AKSB 2C8WB 1L1GA 2CHAC 4ABEA 1AVWA 3QWCH 2BLVA 2H6MA 1BUIA 1O3BA 1M9UA 3DHKH 1HGTH 5DP4A 2EI7A 2ZQ2A 3EA8A 1V2JT 1AFEH 1FY5A 2ZHFH 1MKXK 1TGBA 3VXFH 1UTJA 1IQNA 1NFXA 3N7OA 2V6NA 4CR5A 3BEIB 2AS9A 1BMNH 2PHBA 1VITG 2Z6BD 4CH2B 1OYTH 3PTNA 3UWIA 1JBUH 1AI8H 2BD4A 4Y79A 1TQ0B 3GYMA 1WBGB 3B9FH 1CGHA 2OBQA 2PSXA 5EW1H 1MAYA 3MTYA 1C5UA 4AFSA 4AOQA 3ZZAA 2VH0A 3KQDA 4INHA 3SNEA 3RMLH 2ANYA 1HB0B 4K5ZA 1AFQC 1K1OA 4SGAE 1V2ST 2Q6DA 1O5DH 1WTHD 4A92A 5HYOA 3ZZ8A 3KNXA 1LQEA 1K2I1 2P16A 5G4BA 1SLUB 3FAOA 3DT0H 2BY9X 1PPHE 2VGCC 1P2JA 1BOQA 1K9OE 4I8GA 4UDWH 1VJ9U 1T7CA 1KXFA 2QXIA 1W12U 5ESTE 3GDUA 1GJ8B 1VITF 3M7UA 3S9CA 2VVCA 4ABIA 1O37A 2UWPA 4HI3A 1Q31A 5JPMH 3P17H 2ZCHP 4MPXA 1FV9A 2OP9A 3S7KB 1WQSA 1YCPH 3VB3A 1O5GH 1SQOA 3UR6A 3K65B 1GJ5H 1GI4A 3MU5A 3A7VA 1OSSA 5DP8A 2A2QH 1Z8JB 1GVKB 2CV3A 1D6WA 2FWWA 5T6GA 4Y0ZE 5EXLA 1BA8B 2WV4A 5L6NH 3U8TH 3RXHA 1LVMA 1CT2E 3PMBB 4THNH 3VGCC 4H6TA 1P0SH 4CHAC 5EXMA 2OTVA 4A1XA 3ELAH 1EKBB 1GDQA 2OD3B 3QDZB 3RXQA 1HJ8A 1V2MT 2JH0D 4FXGH 2H1UA 1O31A 1V2RT 1O33A 2A7JA 4ISNA 2H5DA 1YLCA 2QXJA 3PM3A 3UNQA 4NCYA 1UCYE 4ZAEA 1DPOA 3A82A 3RXIA 1FIZA 3VB7A 1CBWB 1TYNA 2EEKA 2ZGCA 3SOSA 1NFUA 4JYTA 4X2WA 1KSNA 1H9LB 3SI4H 4NG9H 1DY8A 4HTCH 1GI6A 1S0QA 3EAJA 1FQ3A 1XVOA 4JZDH 4BAMB 1CSOE 3FP7E 4XBDA 1HAVB 3V7TA 1GHAF 1MD8A 1QTFA 2O9QA 2STBE 2XBWA 1FONA 1C1OA 1BQYA 1UVUH 3MMGA 1UK3A 4WXIA 1G2LA 3LH3A 3U1JB 1AD8H 6CHAC 2OUAA 1W7XH 1J15A 3UOUA 2SGQE 2XC4A 4NFFA 4UFFH 5JBTA 2I6QA 1UCYH 2ZGHA 1O3HA 3SJOA 1A0JA 3E6PH 1O2MA 1BHXB 1SMFE 2XWBI 2ZECA 3LONA 3M35A 1W14U 1GBAA 3SJKA 1P2KA 1GBEA 3E91A 3ATIA 3SJIA 2TRMA 5DPAA 2UWOA 1GMHG 2WPLS 3OYPA 2WPMS 3MH7A 2TIOA 4B2AA 1G9IE 1THPB 1AWFH 4VGCB 4JZFH 4YESB 4ZHMU 4B74A 3M5LA 3P70B 4WY3A 1YM0A 4FVDA 2IOTA 1C4V2 1EAWA 2A4RA 2VIWA 2BOHB 3SI3H 4CRDA 1KXEA 1T8LA 1NU7B 2GX4A 2A31A 1L1JA 4OS1A 1SGCA 1WTGH 3VB5A 1E38B 5A0AE 2BX4A 5K0HA 3U8RH 4FU9A 4TPIZ 1IQMA 3SV8A 4INKA 2SGDE 1V2NT 1YGCH 1GHWH 2Z9GA 3A7YA 4U2WA 3NUMA 1TLDA 1DM4B 4UEHH 4CBNA 1LCYA 2PW8H 3RXDA 2XCFA 1AKSA 1VCPA 4KTCA 3SNCA 3GY3A 1TMTH 1DLKB 4O3TA 4LXBH 1TONA 1GI1A 2VWLA 1PFXC 1TPSA 4Y11E 1YCPM 1O2RA 4XBCA 5K7RA 1UTNA 4UFGH 4TWWA 1C1SA 3BG8A 2FI4E 3UY9A 1WUNH 1DXWA 1P2NA 1MMJN 1UTMA 1G3EA 2D2DA 2FYQA 4BAQB 1GJ6A 1C5QA 1L2EA 2DE8A 4RKOB 1INCA 1KY9A 2ZU3A 3AW1A 5JBAS 1K1NA 1C2GA 1EZXC 4JZIA 3SHAH 5LPEA 1FY8E 1O38A 1YPGH 2R2WU 1U6QA 4KTUA 1C5WB 3Q3XA 2LPRA 2VB0A 1AZZA 1RIWB 2YNAA 1SGFG 3MI4A 2BVSH 2ANWA 1C5VA 2FOEA 1ZJDA 1YF4A 3RMOH 2LNCA 1T8MA 2I6SA 2XXLA 4TWYA 5AVDA 1VCWA 4YTAA 3UFAA 3TJOA 1V2LT 3GY5A 1HFDA 1C1MA 1K1JA 1O3CA 4FUCA 1VR1H 1ZMJA 1RD3B 1UHBB 1OWEA 3STJA 3UTUH 3D65E 1B7XB 3RU4E 3FZZA 3E0PB 1GDUA 3RXSA 2ZCLP 2VIPA 6GCHG 3RXUA 3SQEE 1TGCA 2XC0A 3HKIB 1TNHA 3RLYH 4CRAA 3UOPA 4NA9H 1SGPE 2ZPQA 3MYWA 3FP8E 3SZNA 4Y8ZA 2A5AA 2W5EA 1LPKB 3W94A 4Z6AH 4UD9H 2ZF0H 1ORFA 3QZRA 3K6YA 1F5LA 2ALVA 2P95A 3SJ8A 3OY5U 1Y5BT 2ZKSA 4ABBA 1D6RA 2ZDNA 1HAIH 3A85A 4DGJA 1F0SA 4NIXA 2BD5A 2FP7B 5J4SA 2C90B 1PYTC 3TH2H 2BD7A 4HZHA 1DWCH 4F49A 1X7AC 4I8JA 1ELTA 1P2IA 2OC1A 1YCPK 2PKAB 5DKMA 1YC0A 3PMJA 2XBYA 3SGBE 2HNTF 3TNTA 1TBZH 1TBQH 4KGAA 1NRPH 3TH4H 1SL3A 3A8AA 1SQAA
chains in the Genus database with same CATH superfamily
3SUGA 5A8XA 6GCHF 3NCLA 1C2JA 2P3FH 1MTVA 1BJVA 1ZTKA 3BTEE 1P02A 1TNKA 2O8WA 2WPJS 3BEFB 1PQ7A 1FN8A 2C93B 1MU6B 1C5ZB 1P57B 1ZMLA 1B0FA 1Y3VA 4I8KA 2BQWB 1HAVA 2BTCE 4AX9H 5IYTA 1QBNA 1ETTH 4CREA 1SB1H 1CBWC 1ZPZA 3DSGA 1GG6B 3HK6B 3MNXA 3SHCH 3SV7A 1IHTH 1P2MA 2BDCA 5C2ZA 5JBCS 8GCHF 1MZDA 1GHVH 1MZAA 3M3VA 2O8UA 1D3TB 2FXRA 2ZHEH 4NIWA 1XUJA 4CR9A 1AUTC 1E35B 1ESAA 1V2PT 4MDSA 2M2AA 4DIIH 3P95A 1W7GH 1SQTA 1GBBA 1H8ED 4B76A 4ASUD 1C2HA 1L4ZA 2V7QD 1C1NA 3KYFA 3E0NB 2BDAA 2QXGA 3SV9A 2GMTC 2ZU2A 1OKXA 1MD7A 4ZXYH 1DX5M 2SNWA 4FVBA 4YLQH 1GDNA 5HIZA 2F83A 2J92A 2J98A 4D76A 4YZUA 2A7CA 2P59A 3QGJA 2WYJA 2BX3A 4WJG2 1LPZB 3LC5A 1IQGA 1QL8A 3NRLA 4JCNA 4GVUA 4XSKU 2JJ1D 1CA0B 2XBXA 3OTJE 2A5IA 5HMAA 1UCYK 3TVJB 3SU2A 3U8OH 1YLNA 2PSYA 2ZHDA 3PB1E 1D3QB 4FUDA 2GGVB 2PTCE 1JRSA 4YXWD 5C94A 1BRBE 3LJOA 1EUFA 2XOKD 5JBBS 1AVGH 2GZ7A 3F6UH 1UW7A 1SR5C 2WV5A 1O3GA 4VGCC 1ZSJA 3CNRA 1GCDA 3KYGA 3ZV8A 4UFEH 2QY0B 4CRGA 1MAXA 1C5LH 4WVPE 3BTME 1L0ZA 1NFYA 1F92A 5DN6D 2HALA 1NO9H 1EZQA 1J9CH 3DSPA 5T6FA 2QAAA 3NXPA 3RXBA 5LH8A 1GHBG 3KQBA 4XFQA 1OOKB 1OX1A 2ODQA 4A6LA 4X2YA 3RXEA 2WYGA 4DCDA 5JB8S 4AYVB 1OWHA 4XRNA 3RXAA 3ZZ5A 1HAHH 4IW4E 4GHQA 1MTWA 1QIXB 2VWNA 1O3EA 4AGJA 4AC9A 3UWJH 3A7XA 1RTKA 3P8GA 3A7TA 5JDUB 2UWLA 1TNIA 1ANCA 3T26A 4D8NA 3SUEA 1IQJA 3OY6U 3M37A 3TPIZ 4Y7AA 3WWBA 3JZ2B 3F9HA 1GJCB 2PUQH 2HLCA 2VIVA 2BOKA 4XBBA 1W11U 2ZP0H 5F8TA 1QRZA 1DWEH 3KHVA 3U1IB 1CE5A 1SVPA 3LGVA 3CENA 1ZHMA 2B5TB 2ZFTA 2QN5T 1GJAB 3RU4D 4CRFA 2IJD1 3T5FH 1CU1A 2PWXA 1EP5A 8LPRA 1ELFA 1YYY1 1HIAB 1FIWA 1ZSLA 1V2TT 5FBEA 4ISHH 1LVOA 3ZZBA 4K69A 2NU4E 3OEHD 1C5OH 1NROH 3LH1A 5LGOA 4B1TA 3PLKA 1RIWC 4J2YB 1P03A 1P9SA 2PR3A 1KYNA 4ZH8A 1XXDA 4BXWA 3SV2H 1T8NA 1P9UA 2C3SA 1EJNA 2CF8H 1O3NA 1FPHH 3IG6B 1Z71A 4NWKA 1SSXA 5E2PA 2JH6D 4B75A 4AG1A 1NPMA 4FUEA 2Y7XA 3AAUA 1IQLA 5E0HA 1O2QA 2AIPA 1TX8A 2PFEA 4B2CA 1VZQH 3DUXH 4WWYA 1ZPBA 5A8YA 3BTHE 1GJ7B 1YY3A 1BTZA 4INLA 5EQRA 2VVVA 3QZQA 3UQVA 1K1IA 5LPFA 1DE7H 2V35A 2ALPA 4XOJA 7LPRA 2B9LA 3KEEA 2Z9LA 1YKTA 1C5MD 2ZEBA 2A32A 2ZFRH 2HPQH 2F9VA 3PWCA 2KFWA 3U9AH 3UNSA 5CDFE 2PKAA 3RM0H 4FUFA 2FTMA 4BAKB 2F9OA 1O36A 4GHTA 1SI5H 4MNXA 5KGOA 1UK4A 1NT1A 1L4DA 3VFEA 2KCPA 1LTOA 3D62A 3RXPA 1AN1E 2Q1JA 3KCGH 5C3NA 1H8IH 3UQOA 3ZVBA 2W7SA 2G51A 3BTDE 1FI8A 1ARBA 3EDXB 4BANB 3VXEH 3KN2A 4MPVA 2BM2A 4U32A 3SNDA 1V2UT 2Y5FA 4X6NA 2ZDLA 1GBDA 1BRCE 3OFND 2BD3A 4IN2A 2WINI 1QQUA 1NZQH 5FCRA 4GLYA 1FPCH 2G5VA 1JWTA 1HAYB 1OWIA 1YWUA 2CN0H 2J38A 3PV4A 4MLFB 4ZHLU 1HNEE 1DY9A 2GCHG 3L6PA 4TSFD 1A61H 1IHSH 3MU4A 1GG6C 1AY6H 1T4UH 3U69H 3DD2H 1XX9A 1TE0A 1V6DA 2C4FH 1P04A 1SGRE 4I33A 2W7UA 1O2UA 1K21H 4ZUHA 2YMSB 2KM0A 4BTIB 1ZGIA 2GV7A 1QQ4A 2OQUA 3MU0A 1UJ1A 2BDHA 4OS7A 4CRCA 1O3LA 4CRBA 4E06H 4D7GA 2CK3D 3PO1B 3T28A 2ZPRA 2RFKC 2CGAA 4I31A 3UPEA 4AYYB 5F53A 3TK6A 3T27A 1FAXA 3UUZA 5C67A 3PMAB 1Y3YA 3QLPH 5A2MH 1HDTH 2F9NA 1N1LA 4F4OC 1BMLA 4NA8A 4X8VH 5L30H 1DUEA 1CHOG 3NWUA 1ZLRA 3MFJA 3O8CA 4K2YA 1CA0C 4AFZA 2DUCA 4FUJA 3MO3A 1GBFA 1GI2A 1Z1IA 2GCHF 1E37B 1Y8TA 1F0UA 2WPHS 4WH8A 1QHRB 1VGCB 1P3CA 2J34A 3LDXH 3UR9A 3M3TA 1EPTB 1DT2A 2O8TA 1G3CA 1ANEA 1WYKA 2EQNA 3MOCA 4LZ4B 2EC9H 2H9EH 1E36B 1T4VH 2XW9A 4X2XA 3OSYA 3ZZ6A 3BTWE 2RA3A 1P01A 2ZDMA 1GBMA 3GY4A 4NIYA 3ZVDA 1E79D 2GVFA 1UTOA 3Q3YA 3V3MA 1ZYOA 2OLGA 1K1PA 3LOXA 1CA8B 5EGMA 3RU4T 4ZCNA 3DFJA 2H5CA 4ISLA 2R3UA 3SU0A 3GOVB 4I7YH 4JZ1A 4ZROA 1B0EA 1QB1A 3IITA 3ZZ9A 1NBMD 2GD4B 1XKBC 1FY4A 3P6ZB 1IAUA 2XTTB 8KME2 5AHGH 4K3JA 8ESTE 1ZRKA 2BD8A 2ZG0H 3EA7A 2AH4X 3G01A 4AORA 3FO8D 3TK9A 5FX6A 2CF9H 2R0LA 1HJAB 4YM9A 2GP9B 1CQQA 1GJBB 1V3XA 3U98H 4CBOA 4JYUH 3H7TA 2PV9B 4FUHA 1XUFA 2SGPE 3F2HA 1DS2E 2UUKB 1COWD 4WMFA 1FLEE 2JIZD 4I86A 1HIAA 1ID5H 2K1QA 2W3KA 3FOAA 3VB4A 1EOJA 1GPZA 3LPRA 5EPYA 3MU8A 2ZTZA 2FLBH 5GIBA 3RUOA 3TH3H 5GWZA 4X1NU 1HRTH 3DCLA 1AB9B 1CGJE 1SGNE 2G81E 2RCEA 1GI5A 2FX4A 2FS8A 3KQ5A 3K6ZA 2Y5HA 2BHGA 2FS9A 3SJ9A 1O3PB 1IQEA 5FX5A 2HOBA 3PV5A 3AAVA 4H4FA 1Y59T 2FOHA 3TU7H 1ACBE 4OS4A 2BB4A 3SN8A 1H8DH 1AIXH 1E34B 1A5IA 2Y80A 1BTYA 4IC6A 3E16B 4B71A 2ZFFH 4DT7B 3SBKA 1H1BA 4FOUC 4TY6A 3RXTA 1EB2A 3SUFA 4GUXA 5GXPA 2XC5A 5AFYH 3TK5A 2C8ZB 1GMHF 3S7HB 1BBRE 3P8OA 1OPHB 1HV7A 5EOKA 1GL1A 1AQ7A 4RT1A 3NK8A 5BPEA 2FOBA 5DO4H 5F8ZA 4K1EA 3GISB 3ZVGA 2TGPZ 3AW0A 5C17A 3KF2A 1NY22 2NU0E 1PPZA 4NGAH 3N7DA 1ZSKA 3SU4A 1OP8A 4Q80A 1S6FA 2FDAA 1BT7A 4YT6H 3MO9A 1BMAA 3TGJE 4OS6A 4AGKA 3FVFB 3UREA 1UTLM 3EE0B 1H9IE 2FYRA 6ESTA 1C5SA 3H5CB 2OCVB 1HLTH 3TITA 2NWNA 5I46H 1GI3A 2ZC9H 2QA9E 2GKVE 2HPPH 1VCQA 4I32A 3ODDA 3M36A 3C1KA 3RLWH 1TA2A 1BBRH 1C1RA 1ELAA 2VIDA 1GHXH 1UMAH 2GDDA 1ELBA 2ZU1A 2IPHA 4J1YA 4JK6A 4Q7YA 1FDPA 2RDLA 1O2IA 3F9FA 1ELVA 1NRQH 5C1UA 1QURH 3LGUA 2BDIA 1LO6A 3PRDA 1C2DA 2ZWLH 1C1UH 1P8VC 4FU7A 2OC0A 1RXPA 2KCOA 1A5GH 1O2OA 2AYWA 3A7ZA 3ATMA 3AASA 4B6EA 1TGSZ 2SGAA 1FMGA 1O2YA 3RC6A 1ELCA 3SORA 1GJ9B 1W0YH 1O2ZA 1SGTA 1F7ZA 2SNVA 3BIVH 2J97A 3ZVCA 1WXRA 1HYLA 2QYIA 4O03A 3WW7A 1BTWA 1QA0A 1YPKH 2JDID 1NS3A 1KXAA 5C1YA 2QC2A 4DY7B 1MKWH 3R0FA 4Y10E 5DJ7A 1DSUA 1JRTA 2Z94A 2YMSC 1IQFA 1QY6A 1GVZA 1UVSH 2QCYA 5IK2D 2IN2A 3SGQE 4NZQA 3URDA 1SHYA 3TJUA 3A81A 1MBQA 1QB9A 1RGQA 1TPAE 3M5MA 3BEUA 1SGYE 3PO1C 3CP7A 3LKWA 3BIUH 5GNDA 1XM1A 2GV6A 4O3UA 4DJZB 4Q7ZA 5FBIA 4O97A 1D3DB 1LVYA 4Y76A 2FM2A 3VG8A 3GICB 4R0IA 1TIOA 1G37A 1Y3WA 1PPGE 3MNCA 2ZU4A 4IN1A 1CT4E 1EPTA 1DDJA 1XUIA 2TPIZ 2P8OB 4A1VA 3QTVH 3FP6E 1W8BH 2D1JA 1O34A 4X1SU 4UONA 1LHCH 1SGEE 4NSVA 3GY2A 3RMMH 4U01A 2AGIX 2KCYA 2QXHA 1SQRA 2XNIA 5C1XA 4YLUA 1O3MA 1TFXA 3PYHA 4E05H 1VGCC 3ZZCA 1O2JA 3RXRA 1QJ7B 2JH5D 4X6OA 3FFGA 1EJMA 1EPTC 2G00A 1QJ6B 3EYDA 3FN8A 2G55A 1EQ9A 5A8ZA 1FN6A 3ZVEA 4AN7A 4X6PA 1JMOH 2HNTC 2ZHQH 1A3BH 1RFNA 3DSOA 3RMNH 5DSFA 1TRYA 4H42U 1S84A 2Z9JA 6LPRA 1C5NH 1DWDH 1C4U2 4Q2KA 9LPRA 1PPCE 1UTKA 3HGPA 2BXUH 2A0QB 1BJUA 3QGNB 3S9BA 2R0KA 1GBCA 3W1EA 1NC6A 2ILNA 4FUGA 1F0TA 2AMQA 2ZDKA 2FIRH 2Q6GA 1YPHC 3F68H 2QE7D 2HWLB 3N7EA 3EE7A 2OINA 3A7WA 2D8WA 2ASUB 1SLVB 1GI0A 3HK3B 4YOGA 1ELEE 1TAWA 4FU8A 1HAGE 1IQHA 5H4IB 1QBOA 1QA7A 2BLWA 5FAHA 5A0CA 4A5TS 4DIHH 1HJAC 1TGNA 2SGFE 4P02A 1QL9A 1XUHA 1WV7H 3SUDA 1TNJA 1TA6A 3E90B 3PMHB 4X2VA 1HAPH 1FUJA 4X1QU 1MCVA 4MVNA 2WHXA 1THRH 2A4OA 3Q3KA 2EI8A 3OX7U 4KP0A 1TOMH 4R8TB 3UB0A 3CS7A 5TCCA 2OBOA 5DP7A 1DXPA 4MNVA 3ZZ4A 1JXPA 2ZNKH 1O39A 5EODA 1AB9C 2ZZUH 9ESTA 1GI8B 4MG3A 3QN7A 1C1WH 1W2KH 3A84A 1O2HA 1P12E 2VU8E 3SU5A 1WSSH 1GHZA 2CJIA 5EW2H 1SHHB 1BCUH 1DOJA 3K9XB 3ATKA 1NESE 1TQ7B 3QX5H 3W95A 2HNTE 2QF3A 1NRRH 4JK5A 2BY8X 1P3EA 3MQKC 4DW2U 2AIQA 1BIOA 3ZYDA 3ATWA 2JETB 3PLBA 1H9HE 1W0ZU 1C5RA 1PPFE 4Z1MD 5JB9S 3A80A 1AMHA 5HM9A 4MQAA 4TY7A 3UNRA 1QB6A 1TX6A 1AU8A 3BSQA 3F1SB 1JIMA 1OP0A 1T31A 5FXLA 2P94A 1YPHE 2ZO3H 2ULLA 4WXVA 5EJZA 1MTSA 3M3SA 2GZ9A 1O0DH 3S9AA 3Q00A 1KLJH 1ZR0A 1K1MA 2W26A 2FPZA 5GJ4B 1Z6EA 2AGEX 1DWBH 1EP6A 4ZXXH 3C27B 3LT3A 3UIRA 1AO5A 5TJXA 1PJPA 2YOLA 4IC5A 1CT0E 4M9FA 5EQSA 1O5FH 3S69A 2GZ8A 1IOEA 5DK1A 3SZEA 2FX6A 2GT7A 4HGCA 1GHBF 4UE7H 2ZA5A 3E3TA 2PLXA 3GCTG 2A4QA 3RXJA 4GSOA 1GI9B 3MH6A 2AFQB 1S5SA 5EJ1A 4ABHA 3RM2H 1J14A 1C9PA 1TABE 3KGPA 4AFQA 1AVXA 2A45B 1KXDA 2GT8A 4B73A 4IBLH 1G3BA 1O2VA 4LK4A 1O3OA 1XMNB 4Y71A 1GMCG 4RI0A 4Y8YA 1BBRK 5KEDA 1HBTH 1OYQA 2BY5X 3GYLB 5EXNA 2BD9A 2ZGJA 1DANH 3QTOH 3RXKA 1HPGA 2AHME 1YPLH 1PQAA 2VWMA 3OEED 1CVWH 1P10A 3ESTA 1N6XA 3F9EA 3BN9A 2PP6A 3PWBA 4A1TA 3SW2B 4BAHB 1DLEA 2FMJA 1TRMA 3E8LA 1EASA 3GCOA 1YLDA 2H9TH 3ODFA 2W6ID 3F2GA 3SYJA 4NZLA 5PTPA 1PPEE 3PV2A 1KTTB 1FX0B 1FJSA 3OU0A 1KMHB 3GCTF 1EAXA 4ZKOU 2B7DH 2ZHWH 1KDQB 1KLIH 5LPRA 2F9UA 3VEQB 1J16A 1YBWA 3RC5A 1UO6A 1S82A 1RJXB 1AE5A 5J4QA 1QBVH 4I8HA 1SFIA 3E1XB 1DVAH 2UUYA 4GPGA 1MKWK 3SNBA 2PGQB 1B5GH 4B2BA 3RDZA 1MQ5A 1YP9A 4CH8B 1G3DA 1ZMNA 1GMCF 1C2EA 3SU3A 2R9PA 3STIA 5DP6A 1SBWA 1ZPCA 5BRRE 4WMDA 1BTPA 1ZZZA 2PKSB 1ANBA 1HCGA 2PGBB 2QF4A 2GDEH 3M7QA 2O8MA 2VBCA 3SGAE 1EX3A 2Y81A 2JKHA 4DT4A 2RG3A 3ZVFA 1ETRH 1ZJKA 2P8OC 2TGTA 4ABDA 2ZDVH 5KECA 3RXCA 1KXBA 2VH6A 1C5PA 2OQ5A 1MQ6A 3DFLA 1IQKA 2KAIB 3A8DA 3M5OA 1LKAA 2QV1A 2WUBA 1KXCA 1EZUC 2V3OH 1W13U 1PYTD 1Y5AT 5F8XA 2J95A 2AEIH 3HPTB 4IMZA 3LJJA 1PQ5A 4ASHA 5DG6A 4WH6A 4MPWA 3FKSD 1HAZB 4AFUA 1LKBA 4OM9A 1FY3A 1F5KU 2F9PA 2UUJB 1A1RA 2ZQ1A 3KQEA 4XD7D 3H7OA 3O8BA 1GBTA 3ENSB 2ZFSA 5T6DA 1MH0A 1FZZA 1Z8RA 4E7RG 4BTTB 2FESH 1TWXB 4Y0YE 4ZKRU 4Y6DA 3M5NA 2BQ6B 1S81A 2LP6A 2WZQA 2AGGX 2BXTH 4D9QA 5GDSH 4AB9A 3LGWA 2VWOA 1A5HA 2IPQX 1QRXA 1Z8IB 2ODPA 3V13A 1WCZA 1BMMH 1TMUH 1ZHRA 1YPJH 1O2SA 1LPGB 1PQ8A 2HVXA 1AE8H 4DOQA 1OXGA 1NFWA 2UUFB 4X8TH 3F0PA 2FOCA 2OXSA 4BAOB 5AFZH 1Z8GA 2FTLE 2NU3E 1GBIA 1GHAG 2C8YB 3M61U 1BMFD 2ZDAH 5CHAB 3DA9B 4TPYA 2P3UB 2V0BA 4X8SH 2J2UA 3KL6A 5EPNA 5A0BA 4FETA 2AMDA 3K2UA 5ETXA 3BV9B 1ABIH 4K1TA 5FPTA 1Z7KA 4RKJB 5CMXH 3NKKA 3P92A 1DFPA 2FOGA 3B23B 2FOFA 3MHWU 5HGGA 3BTQE 1FNIA 2Y5GA 4ZKSU 2WPKS 3O8RA 1QFKH 2BD2A 4IMQA 2GTBA 3NPSA 2GCTB 2IJOB 1H4WA 2J9NA 5GCHG 4K60A 1O5AB 4IGDA 2XBVA 3LU9B 4U30A 1K28D 4ISOA 3SV6A 4YT7H 1EXFA 2BLQA 3BG4B 3BTTE 2RA0A 1LVBA 1S85A 2BDGA 2OC7A 1GBJA 1O3AA 1KIGH 3ZZ3A 4MTBA 2YNBA 1SFQB 1P09A 2JETC 3JZ1B 1G2MA 1QR3E 3TNSA 4NA7A 1UVTH 1UTQA 3PROA 5A09A 1GCTB 4ZHAA 1TGTA 4BOHA 1CHOF 1UTPA 1LMWB 1UVPA 3RXVA 1GGDB 1GVLA 3A89A 1WOFA 2ZTYA 3RXLA 3A83A 1O2LA 2C8XB 4HG6A 4NWLA 1FAKH 2K0QA 3CS0A 2SFAA 2BDBA 2GMTB 3MH4A 1A3EH 4KTSA 3Q77A 1O3DA 1MTNB 1N8OB 1SG8B 1ESTA 5GPIB 1SGIB 1GBLA 1LDTT 2FZZA 2BY7X 2CMYA 1SOTA 2BQ7B 4X8UH 1AWHB 2ZU5A 1Y3UA 3URCA 5ABWA 3V0XA 2WPDD 4BTUB 2B8OH 4I8LA 4DVAU 5GCHF 2Q6FA 5ESBA 1CO7E 5EG4A 1C2MA 1GL0E 4AB8A 1LHEH 2J94A 1O5BB 2QGRA 1LHDH 2J4IA 2BZAA 3L33A 2RDEA 4XDEA 7KMEH 1XXFA 4Q4LA 1KLTA 5EJLA 4BXSA 2EI6A 3GY6A 1O3KA 1V2VT 1FXYA 1OS8A 4YOJA 2H9HA 2NU1E 1O2TA 3AVZA 5DP3A 1C9TA 5EQQA 4KKDA 1NTPA 1ZHPA 3R3GB 1EAIA 2ESTE 1SC8U 1GJ4H 7ESTE 1VITH 1YPMH 1LQDB 2ZFQH 1DSTA 3MNSA 2J5UA 4WMEA 1MCTA 4ISIH 1A0HB 1O3IA 4NIVA 1A2CH 2FI5E 3ZVAA 1HJ9A 1L1NA 1TX7A 1XVMA 3BTGE 1ETSH 7GCHG 1WAYB 2QF0A 2KZ4A 1KDQA 2KR7A 2P93A 4X6MA 1V2QT 3RP2A 2FLRH 1GHYH 2QIQA 1E1RD 3MU1A 1LHFH 2BDYA 2B0FA 3RXOA 2H2ZA 3F3BA 1K22H 2G5NA 1V2KT 2FOAA 1EJAA 1ZTLA 2TGDA 4K8YA 4AZ2B 4P00A 4DG4A 1QCPA 2ZFPH 2OK5A 4M7GA 3WY8A 2EA3A 1NU9A 5T3HA 3O8DA 5HXFA 3MO6A 2VNTA 1J17T 3A8CA 3TIUA 4FUIA 3ZZ7A 4TYDA 1AHTH 2K8IA 5C0UA 1TNLA 1RS0A 2TGAA 1DITH 1O30A 1E0FD 2G4UA 1D3PB 1TB6H 2KAIA 2PKSC 3TGIE 3QUMP 3T29A 1F2SE 4RN6A 1OWKA 4ZKNU 5B6LA 2ANKH 4OS5A 2G52A 7GCHF 1A46H 1TBRH 3SQHE 3TLOA 1MU8B 3OAAD 3HKJB 3GCHB 4OGYA 1K1LA 3ATLA 3I77A 2AMPA 1HAXB 1P05A 1O2PA 2ANMH 1GMDG 1S0RA 1QJ1B 1TNGA 3MNBA 5FHTA 1LHGH 4YOIA 4K8BA 2SGEE 2XCNA 3GDSA 2GJGA 1MTUA 1C2KA 1O2KA 4MNYA 1KTSB 1C4Y2 2FODA 2ZIQH 3SNAA 1BTXA 1BTHH 3GY8A 2VIQA 1GBKA 1S83A 5C5OA 1GWAA 1T8OA 2F91A 3KQCA 2CHAB 2G4TA 1BTUA 1MKXH 1ARCA 1UVOA 1O2WA 3PTBA 3TJVA 2ZTXA 4Z0KA 1T32A 2HRVA 4O9VA 1EATA 1SGDE 3GCNA 1JIRA 1SGFA 2Y6TA 1RTLA 1G36A 4WF8A 2R3YA 2F43B 1QZ8A 2Z7FE 1C2FA 8GCHG 2DE9A 2VINA 2VJ1A 1FY1A 1NRSH 2Z3CA 2ZGBH 1WU1A 1P06A 1O5CB 1ELDE 3OTPA 1N6YA 5CHAC 1P2OA 4D9RA 1GMDF 1CGIE 3I29A 1QRWA 3HGNA 4ABFA 3VB6A 1O2NA 5JYIA 1H8HD 4MPUA 2D26C 1GI7B 3HATH 3GDVA 1C1VH 5IDKA 2JJ2D 1AUJA 3EGKH 4GCHG 1AFQB 3LGIA 1C1QA 1AZ8A 2Z9IA 3D49H 5FCKA 1SGQE 1AGJA 1TRNA 5TCAA 3OE7D 1W10U 1A7SA 2VGCB 2GCTC 4AG2A 2F9BH 3SU6A 1E1QD 5DGJA 3BTFE 5CE1A 3EA9A 4IS5A 1DICA 1D9IA 3T2NA 3BG4C 2ZCKP 2VIOA 5CHBA 3EQ0H 1G32B 5E2OA 1EB1H 2STAE 1SLXB 1C2IA 1O3FA 2PUXB 2QF5A 2Z9KA 2Y7ZA 1BHXF 4OGXA 3BTKE 1YPEH 2BMGB 1BDAA 1GCTC 2TBSA 4JMYA 3ITIA 4B6FA 1EOLA 1G30B 1S6LA 1ZTJA 1P2QA 1WQVH 1SOZA 1GGDC 1ZRBA 5HIYA 3NZIA 2XYAA 4QT8C 5F6MA 1Z1JA 4A7IB 1O5EH 1NRNH 3B8JA 1HUTH 2FO9A 1SPJA 1TMBH 2A7HA 2V3MA 1GBHA 1V2OT 3RXGA 4PROA 4MNWA 1DUAA 4KELA 4GCHF 2O8LA 1QL7A 2FOMB 4HFPB 1MTNC 3ZZDA 1N8OC 3VGCB 3M7TA 1BITA 1Z6JH 3L3TA 1NN6A 2XRCA 1O2GH 1V2WT 4X1RU 4CHAB 5E0JA 3BF6H 1PPBH 3Q76A 2AERH 4LZ1H 1A4WH 1OP2A 2BVRH 1TOCB 4ZMAH 1XUKA 2V3HH 2XWAA 2A1DB 3PLPA 3A87A 3KIDU 1ANDA 3V12A 3F9GA 3SU1A 1ABJH 3P8FA 3MWIU 1O2XA 1J8AA 4NSYA 2THFB 1MUEB 3WWFA 4ABAA 3FANA 4Q7XA 2BZ6H 4GAWA 4RT0A 5FPYA 1P11E 5C5NA 5F03A 4K1SA 3I78A 5C20A 3A88A 2BLOA 4UFDH 2BYAX 1THSH 1BRUP 4XE4A 2A4GA 5E8EH 6CHAB 1D4PB 3SO3A 1ESBA 1WDIA 3LGYA 2Z3EA 5L2ZH 1A0LA 4H6SB 4D7FA 2VVUA 5E0GA 4X1PU 1BB0B 4JYVH 2FEQH 5EU8A 1GJDB 1EZSC 1F0RA 1TPPA 1C2LA 3LC3A 4FUBA 3A86A 1C1PA 1OWDA 1HXFH 1ELGA 1ZGVA 2WUCA 3IWMA 2ZPSA 1O3JA 5I25A 2G8TA 2W3IA 2EY4C 2FI3E 1C5YB 5SGAE 4Y7BA 1EAUA 3QK1A 1Q3XA 3FZDA 1C5TA 3RC4A 2A5KA 1TPOA 4ABJA 3ZYEA 4ESTE 1HXEH 3VPKA 4JZEH 2BY6X 1ZOMA 3LGTA 2ZGXH 1S6HA 4F55A 5AF9H 1W3CA 1VJAU 4Y8XA 2NU2E 2R2MB 3LIWA 1BRAA 2HGTH 1BZXE 1UK2A 5B6OA 1O35A 2CXVA 2OC8A 3QO6A 3RXFA 1JOUB 2Z3DA 1NBME 1QGFA 2M5TA 2A2XH 1C5XB 2PTNA 2P3TB 4NFEA 3A8BA 1SLWB 2F3CE 1O32A 4X0WU 1Q2WA 1CHGA 3P8NA 2Y82A 1QNJA 3GY7A 1C1TA 1IQIA 2LELA 3T62A 4YO9A 5FPSA 3RXMA 1UHBA 3TJNA 1MBMA 3D23A 4E7NA 1RTFB 1TALA 2ODYB 1Y3XA 3GCHC 5HM2A 2ZI2H 4DURA 4BNRA 5T1VA 3U28C 1OWJA 1XKAC 2WPIS 3ZV9A 3MH5A 4RSPA 4OS2A 5DP9A 4ABGA 1XUGA 1HAOH 3S0NA 3TGKE 1NM6A 5DP5A 4SGBE 1F5RA 4LOYH 1Y5UT 2W6JD 5L2YH 3T25A 1RRKA 3F2FA 2BVXH 4ACBA 1AKSB 2C8WB 1L1GA 2CHAC 4ABEA 1AVWA 3QWCH 2BLVA 2H6MA 1BUIA 1O3BA 1M9UA 3DHKH 1HGTH 5DP4A 2EI7A 2ZQ2A 3EA8A 1V2JT 1AFEH 1FY5A 2ZHFH 1MKXK 1TGBA 3VXFH 1UTJA 1IQNA 1NFXA 3N7OA 2V6NA 4CR5A 3BEIB 3H09A 2AS9A 1BMNH 3ZIAD 3GS9A 2PHBA 1VITG 2Z6BD 4CH2B 1OYTH 1W0KD 3PTNA 3UWIA 1JBUH 1AI8H 2XNDD 2BD4A 4Y79A 1K0HA 1TQ0B 3GYMA 1WBGB 3B9FH 1CGHA 2OBQA 2PSXA 5EW1H 1MAYA 2YMSD 3MTYA 1C5UA 2L74A 4AFSA 4AOQA 3ZZAA 2VH0A 3KQDA 4INHA 3SNEA 3RMLH 2ANYA 1HB0B 4K5ZA 1AFQC 1K1OA 4SGAE 1V2ST 2Q6DA 1O5DH 1WTHD 2KCAA 4A92A 5HYOA 3ZZ8A 3KNXA 1LQEA 1K2I1 2P16A 5G4BA 1SLUB 3FAOA 3DT0H 2BY9X 1PPHE 2VGCC 1P2JA 4Q63A 1BOQA 1K9OE 4I8GA 4UDWH 1VJ9U 1T7CA 1KXFA 2QXIA 1W12U 2F4LA 5ESTE 3GDUA 1GJ8B 1VITF 3M7UA 3S9CA 2VVCA 4ABIA 1O37A 2UWPA 4HI3A 1Q31A 2WV9A 5JPMH 3P17H 2ZCHP 4MPXA 1FV9A 2OP9A 3S7KB 1WQSA 1YCPH 3VB3A 1O5GH 1SQOA 3UR6A 3K65B 1GJ5H 1GI4A 3MU5A 3A7VA 1OSSA 5DP8A 2A2QH 1Z8JB 1GVKB 2CV3A 1D6WA 2FWWA 5T6GA 4Y0ZE 5EXLA 1BA8B 2WV4A 5L6NH 3U8TH 3RXHA 1LVMA 1CT2E 3PMBB 4THNH 3VGCC 4H6TA 1P0SH 4CHAC 5EXMA 2OTVA 4A1XA 3ELAH 1EKBB 1GDQA 2OD3B 3QDZB 3RXQA 1HJ8A 1V2MT 2JH0D 4FXGH 2H1UA 1O31A 1V2RT 1O33A 2A7JA 4ISNA 2H5DA 1YLCA 2QXJA 3PM3A 3UNQA 4NCYA 1UCYE 4ZAEA 1DPOA 3A82A 3RXIA 1FIZA 3VB7A 1CBWB 1TYNA 2EEKA 2ZGCA 3SOSA 1NFUA 4JYTA 4X2WA 1KSNA 1H9LB 3SI4H 4NG9H 1DY8A 4HTCH 1GI6A 1S0QA 3EAJA 1FQ3A 1XVOA 4JZDH 4BAMB 1CSOE 3FP7E 4XBDA 1HAVB 3V7TA 1GHAF 1MD8A 1QTFA 2O9QA 2STBE 2XBWA 1FONA 1C1OA 1OHHD 1BQYA 1UVUH 3MMGA 1UK3A 4WXIA 1G2LA 3LH3A 3U1JB 1AD8H 6CHAC 2OUAA 1W7XH 1J15A 3UOUA 2SGQE 1W0JD 2XC4A 4NFFA 4ACAA 4UFFH 5JBTA 4F48B 2I6QA 1UCYH 2ZGHA 1O3HA 3SJOA 1A0JA 3E6PH 1O2MA 1VKYA 1BHXB 1SMFE 2XWBI 2ZECA 3LONA 3M35A 1W14U 1GBAA 3SJKA 1P2KA 1GBEA 3E91A 3ATIA 3SJIA 2TRMA 5DPAA 2UWOA 2J98B 1GMHG 2HLDD 2WPLS 3OYPA 2WPMS 3MH7A 2TIOA 4B2AA 1G9IE 1THPB 3PRBA 3AK5A 1AWFH 4VGCB 4JZFH 4YESB 4ZHMU 4B74A 3M5LA 3P70B 4WY3A 1YM0A 2L6OA 4FVDA 2IOTA 1C4V2 1EAWA 2A4RA 2VIWA 2BOHB 3SI3H 4CRDA 2WSSD 1KXEA 1T8LA 1NU7B 2GX4A 2A31A 1L1JA 4OS1A 1SGCA 1WTGH 3VB5A 1E38B 5A0AE 2BX4A 5K0HA 3U8RH 3N99A 4FU9A 4TPIZ 1IQMA 3SV8A 4INKA 2SGDE 1V2NT 1YGCH 1GHWH 2Z9GA 3A7YA 4U2WA 3NUMA 1TLDA 1DM4B 4UEHH 4CBNA 1LCYA 2PW8H 3RXDA 2XCFA 1AKSA 1VCPA 4KTCA 3SNCA 3GY3A 1TMTH 1DLKB 4O3TA 4LXBH 1TONA 1GI1A 2VWLA 1PFXC 1TPSA 5C0TA 4Y11E 1YCPM 1O2RA 4XBCA 5K7RA 1UTNA 4UFGH 4TWWA 1C1SA 3BG8A 2FI4E 3UY9A 1WUNH 1DXWA 1P2NA 1MMJN 1UTMA 1G3EA 2D2DA 2FYQA 4BAQB 1GJ6A 1C5QA 1L2EA 2DE8A 4RKOB 1INCA 1KY9A 2ZU3A 3AW1A 5JBAS 1K1NA 1C2GA 1EZXC 4JZIA 3SHAH 5LPEA 1FY8E 1O38A 1YPGH 2R2WU 1U6QA 4KTUA 1C5WB 3Q3XA 5EIYA 2LPRA 2KX4A 2VB0A 1AZZA 1RIWB 2YNAA 1SGFG 3MI4A 2BVSH 1SKYE 2ANWA 1C5VA 2FOEA 1ZJDA 1YF4A 3RMOH 2LNCA 1T8MA 2I6SA 2XXLA 4TWYA 5AVDA 1VCWA 4YTAA 3UFAA 5HKKD 3TJOA 1V2LT 3GY5A 1HFDA 1C1MA 1K1JA 1O3CA 4FUCA 1VR1H 1ZMJA 1RD3B 1UHBB 1OWEA 3STJA 3UTUH 2HVYB 3D65E 1B7XB 3RU4E 3FZZA 3E0PB 1GDUA 3RXSA 2ZCLP 2VIPA 6GCHG 4TT3D 3RXUA 3SQEE 1TGCA 2XC0A 3HKIB 1TNHA 5FL7D 3RLYH 4CRAA 3UOPA 4NA9H 1SGPE 2ZPQA 3MYWA 3FP8E 3SZNA 4Y8ZA 2A5AA 2W5EA 1LPKB 3W94A 4Z6AH 4UD9H 2ZF0H 1ORFA 3QZRA 3K6YA 1F5LA 2ALVA 2P95A 3SJ8A 1MABB 3OY5U 1Y5BT 2ZKSA 3UAIC 4ABBA 1D6RA 2ZDNA 1HAIH 3A85A 4DGJA 1F0SA 4NIXA 2BD5A 2FP7B 5J4SA 2C90B 1EFRD 1PYTC 3TH2H 2BD7A 4HZHA 1DWCH 3F0OA 4F49A 1X7AC 4I8JA 1ELTA 1P2IA 2OC1A 1YCPK 2PKAB 5DKMA 1YC0A 3PMJA 2XBYA 3SGBE 2HNTF 3TNTA 1TBZH 1TBQH 4KGAA 1NRPH 3TH4H 1SL3A 3A8AA 1SQAA
chains in the Genus database with same CATH topology
3SUGA 5A8XA 6GCHF 3NCLA 1C2JA 2P3FH 1MTVA 1BJVA 1ZTKA 3BTEE 1P02A 1TNKA 2O8WA 2WPJS 3BEFB 1PQ7A 1FN8A 2C93B 1MU6B 1C5ZB 1P57B 1ZMLA 1B0FA 1Y3VA 4I8KA 2BQWB 1HAVA 2BTCE 4AX9H 5IYTA 1QBNA 1ETTH 4CREA 1SB1H 1CBWC 1ZPZA 3HK6B 1GG6B 3MNXA 3SHCH 3SV7A 1IHTH 1P2MA 2BDCA 5C2ZA 5JBCS 8GCHF 1MZDA 1GHVH 1MZAA 3M3VA 2O8UA 1D3TB 2FXRA 2ZHEH 4NIWA 1XUJA 4CR9A 1AUTC 1E35B 1ESAA 1V2PT 4MDSA 4DIIH 3P95A 1W7GH 1SQTA 1GBBA 4B76A 1C2HA 1L4ZA 1C1NA 3E0NB 2BDAA 2QXGA 3SV9A 2GMTC 2ZU2A 1OKXA 1MD7A 4ZXYH 1DX5M 2SNWA 4FVBA 4YLQH 1GDNA 2F83A 2J92A 4D76A 4YZUA 2A7CA 2P59A 3QGJA 2WYJA 2BX3A 4WJG2 1LPZB 3LC5A 1IQGA 1QL8A 4JCNA 4GVUA 4XSKU 1CA0B 2XBXA 3OTJE 2A5IA 5HMAA 1UCYK 3TVJB 3SU2A 3U8OH 2PSYA 2ZHDA 3PB1E 1D3QB 4FUDA 2GGVB 2PTCE 1JRSA 1BRBE 3LJOA 1EUFA 5JBBS 1AVGH 2GZ7A 3F6UH 1SR5C 2WV5A 1O3GA 4VGCC 1ZSJA 1GCDA 3ZV8A 4UFEH 2QY0B 4CRGA 1MAXA 1C5LH 4WVPE 3BTME 1L0ZA 1NFYA 1F92A 2HALA 1NO9H 1EZQA 1J9CH 5T6FA 2QAAA 3NXPA 3RXBA 5LH8A 1GHBG 3KQBA 4XFQA 1OOKB 1OX1A 2ODQA 4A6LA 4X2YA 3RXEA 2WYGA 4DCDA 5JB8S 4AYVB 1OWHA 3RXAA 3ZZ5A 1HAHH 4IW4E 4GHQA 1MTWA 1QIXB 2VWNA 1O3EA 4AGJA 3UWJH 3A7XA 1RTKA 3P8GA 3A7TA 5JDUB 2UWLA 1TNIA 1ANCA 3T26A 4D8NA 3SUEA 1IQJA 3OY6U 3M37A 3TPIZ 4Y7AA 3JZ2B 3F9HA 1GJCB 2PUQH 2HLCA 2VIVA 2BOKA 4XBBA 1W11U 2ZP0H 5F8TA 1QRZA 1DWEH 3KHVA 3U1IB 1CE5A 1SVPA 3LGVA 3CENA 1ZHMA 2B5TB 2ZFTA 2QN5T 1GJAB 3RU4D 4CRFA 3T5FH 1CU1A 2PWXA 1EP5A 8LPRA 1ELFA 1YYY1 1HIAB 1FIWA 1ZSLA 1V2TT 5FBEA 4ISHH 1LVOA 3ZZBA 4K69A 2NU4E 1C5OH 1NROH 3LH1A 5LGOA 4B1TA 3PLKA 1RIWC 4J2YB 1P03A 1P9SA 2PR3A 1KYNA 4ZH8A 1XXDA 4BXWA 3SV2H 1T8NA 1P9UA 2C3SA 1EJNA 2CF8H 1O3NA 1FPHH 3IG6B 1Z71A 4NWKA 1SSXA 5E2PA 2JH6D 4B75A 4AG1A 1NPMA 4FUEA 2Y7XA 3AAUA 1IQLA 5E0HA 1O2QA 2AIPA 1TX8A 2PFEA 4B2CA 1VZQH 3DUXH 4WWYA 1ZPBA 5A8YA 3BTHE 1GJ7B 1BTZA 4INLA 5EQRA 2VVVA 3QZQA 3UQVA 1K1IA 5LPFA 1DE7H 2V35A 2ALPA 4XOJA 7LPRA 2B9LA 3KEEA 2Z9LA 1YKTA 1C5MD 2ZEBA 2A32A 2ZFRH 2HPQH 2F9VA 3PWCA 3U9AH 3UNSA 2PKAA 3RM0H 4FUFA 2FTMA 4BAKB 2F9OA 1O36A 4GHTA 1SI5H 4MNXA 1UK4A 1NT1A 1L4DA 3VFEA 1LTOA 3D62A 3RXPA 1AN1E 2Q1JA 3KCGH 5C3NA 1H8IH 3UQOA 3ZVBA 2W7SA 2G51A 3BTDE 1FI8A 1ARBA 3EDXB 4BANB 3VXEH 3KN2A 4MPVA 2BM2A 4U32A 3SNDA 1V2UT 2Y5FA 4X6NA 2ZDLA 1GBDA 1BRCE 2BD3A 4IN2A 2WINI 1QQUA 1NZQH 5FCRA 4GLYA 1FPCH 2G5VA 1JWTA 1HAYB 1OWIA 2CN0H 2J38A 3PV4A 4MLFB 4ZHLU 1HNEE 1DY9A 2GCHG 3L6PA 1A61H 1IHSH 3MU4A 1GG6C 1AY6H 1T4UH 3U69H 3DD2H 1XX9A 1TE0A 1V6DA 2C4FH 1P04A 1SGRE 4I33A 2W7UA 1O2UA 1K21H 4ZUHA 4BTIB 1ZGIA 2GV7A 1QQ4A 2OQUA 3MU0A 1UJ1A 2BDHA 4OS7A 4CRCA 1O3LA 4CRBA 4E06H 4D7GA 3PO1B 3T28A 2ZPRA 2CGAA 4I31A 3UPEA 4AYYB 3TK6A 3T27A 1FAXA 3UUZA 5C67A 3PMAB 1Y3YA 3QLPH 5A2MH 1HDTH 2F9NA 1N1LA 4F4OC 1BMLA 4NA8A 4X8VH 5L30H 1DUEA 1CHOG 3NWUA 1ZLRA 3MFJA 3O8CA 4K2YA 1CA0C 4AFZA 2DUCA 4FUJA 3MO3A 1GBFA 1GI2A 1Z1IA 2GCHF 1E37B 1Y8TA 1F0UA 2WPHS 4WH8A 1QHRB 1VGCB 1P3CA 2J34A 3LDXH 3UR9A 3M3TA 1EPTB 1DT2A 2O8TA 1G3CA 1ANEA 1WYKA 4LZ4B 3MOCA 2EC9H 2H9EH 1E36B 1T4VH 2XW9A 4X2XA 3OSYA 3ZZ6A 3BTWE 2RA3A 1P01A 2ZDMA 1GBMA 3GY4A 4NIYA 3ZVDA 2GVFA 1UTOA 3Q3YA 3V3MA 1ZYOA 2OLGA 1K1PA 3LOXA 1CA8B 5EGMA 3RU4T 3DFJA 2H5CA 4ISLA 2R3UA 3SU0A 3GOVB 4I7YH 4JZ1A 4ZROA 1B0EA 1QB1A 3IITA 3ZZ9A 2GD4B 1XKBC 1FY4A 3P6ZB 1IAUA 2XTTB 8KME2 5AHGH 4K3JA 8ESTE 1ZRKA 2BD8A 2ZG0H 3EA7A 2AH4X 3G01A 4AORA 3TK9A 5FX6A 2CF9H 2R0LA 1HJAB 4YM9A 2GP9B 1CQQA 1GJBB 1V3XA 3U98H 4CBOA 4JYUH 3H7TA 2PV9B 4FUHA 1XUFA 2SGPE 1DS2E 2UUKB 4WMFA 1FLEE 1HIAA 1ID5H 2K1QA 2W3KA 3VB4A 1EOJA 1GPZA 3LPRA 5EPYA 3MU8A 2ZTZA 2FLBH 5GIBA 3RUOA 3TH3H 5GWZA 4X1NU 1HRTH 1AB9B 1CGJE 1SGNE 2G81E 2RCEA 1GI5A 2FX4A 2FS8A 3K6ZA 2Y5HA 2BHGA 2FS9A 3SJ9A 1O3PB 1IQEA 5FX5A 2HOBA 3AAVA 4H4FA 1Y59T 2FOHA 3TU7H 1ACBE 4OS4A 2BB4A 3SN8A 1H8DH 1AIXH 1E34B 1A5IA 2Y80A 1BTYA 4IC6A 3E16B 4B71A 2ZFFH 4DT7B 3SBKA 1H1BA 4TY6A 3RXTA 1EB2A 3SUFA 4GUXA 5GXPA 2XC5A 5AFYH 3TK5A 2C8ZB 1GMHF 3S7HB 1BBRE 3P8OA 1OPHB 1HV7A 5EOKA 1GL1A 1AQ7A 3NK8A 5BPEA 2FOBA 5DO4H 5F8ZA 4K1EA 3GISB 3ZVGA 2TGPZ 3AW0A 3KF2A 1NY22 2NU0E 1PPZA 4NGAH 1ZSKA 3SU4A 1OP8A 4Q80A 1S6FA 2FDAA 1BT7A 4YT6H 3MO9A 1BMAA 3TGJE 4OS6A 4AGKA 3FVFB 3UREA 1UTLM 3EE0B 1H9IE 2FYRA 6ESTA 1C5SA 3H5CB 2OCVB 1HLTH 3TITA 2NWNA 5I46H 1GI3A 2ZC9H 2QA9E 2GKVE 2HPPH 1VCQA 4I32A 3ODDA 3M36A 3C1KA 3RLWH 1TA2A 1BBRH 1C1RA 1ELAA 2VIDA 1GHXH 1UMAH 2GDDA 1ELBA 2ZU1A 2IPHA 4J1YA 4JK6A 4Q7YA 1FDPA 2RDLA 1O2IA 3F9FA 1ELVA 1NRQH 5C1UA 1QURH 3LGUA 2BDIA 1LO6A 1C2DA 2ZWLH 1C1UH 1P8VC 4FU7A 2OC0A 1RXPA 1A5GH 1O2OA 2AYWA 3A7ZA 3ATMA 3AASA 1TGSZ 2SGAA 1FMGA 1O2YA 3RC6A 1ELCA 3SORA 1GJ9B 1W0YH 1O2ZA 1SGTA 1F7ZA 2SNVA 3BIVH 3ZVCA 1HYLA 2QYIA 4O03A 1BTWA 1QA0A 1YPKH 1NS3A 1KXAA 5C1YA 2QC2A 4DY7B 1MKWH 3R0FA 4Y10E 5DJ7A 1DSUA 1JRTA 2Z94A 1IQFA 1QY6A 1GVZA 1UVSH 2QCYA 2IN2A 3SGQE 4NZQA 3URDA 1SHYA 3TJUA 3A81A 1MBQA 1QB9A 1RGQA 1TPAE 3M5MA 3BEUA 1SGYE 3PO1C 3CP7A 3LKWA 3BIUH 1XM1A 2GV6A 4O3UA 4DJZB 4Q7ZA 5FBIA 4O97A 1D3DB 1LVYA 4Y76A 2FM2A 3GICB 4R0IA 1TIOA 1G37A 1Y3WA 1PPGE 3MNCA 2ZU4A 4IN1A 1CT4E 1EPTA 1DDJA 1XUIA 2TPIZ 2P8OB 4A1VA 3QTVH 3FP6E 1W8BH 2D1JA 1O34A 4X1SU 4UONA 1LHCH 1SGEE 4NSVA 3GY2A 3RMMH 4U01A 2AGIX 2QXHA 2XNIA 5C1XA 4YLUA 1O3MA 1TFXA 3PYHA 4E05H 1VGCC 3ZZCA 1O2JA 3RXRA 1QJ7B 2JH5D 4X6OA 3FFGA 1EJMA 1EPTC 2G00A 1QJ6B 3EYDA 2G55A 1EQ9A 5A8ZA 1FN6A 3ZVEA 4AN7A 4X6PA 1JMOH 2HNTC 2ZHQH 1A3BH 1RFNA 3RMNH 1TRYA 4H42U 1S84A 2Z9JA 6LPRA 1C5NH 1DWDH 1C4U2 4Q2KA 9LPRA 1PPCE 1UTKA 3HGPA 2BXUH 2A0QB 1BJUA 3QGNB 3S9BA 2R0KA 1GBCA 1NC6A 2ILNA 4FUGA 1F0TA 2AMQA 2ZDKA 2FIRH 2Q6GA 1YPHC 3F68H 2HWLB 2OINA 3A7WA 2D8WA 2ASUB 1SLVB 1GI0A 3HK3B 4YOGA 1ELEE 1TAWA 4FU8A 1HAGE 1IQHA 5H4IB 1QBOA 1QA7A 2BLWA 5FAHA 5A0CA 4A5TS 4DIHH 1HJAC 1TGNA 2SGFE 1QL9A 1XUHA 1WV7H 3SUDA 1TNJA 1TA6A 3E90B 3PMHB 4X2VA 1HAPH 1FUJA 4X1QU 1MCVA 4MVNA 1THRH 2A4OA 3Q3KA 2EI8A 3OX7U 4KP0A 1TOMH 4R8TB 3CS7A 5TCCA 2OBOA 5DP7A 1DXPA 4MNVA 3ZZ4A 1JXPA 2ZNKH 1O39A 5EODA 1AB9C 2ZZUH 9ESTA 1GI8B 4MG3A 3QN7A 1C1WH 1W2KH 3A84A 1O2HA 1P12E 2VU8E 3SU5A 1WSSH 1GHZA 2CJIA 5EW2H 1SHHB 1BCUH 1DOJA 3K9XB 3ATKA 1NESE 1TQ7B 3QX5H 3W95A 2HNTE 2QF3A 1NRRH 4JK5A 2BY8X 1P3EA 4DW2U 2AIQA 1BIOA 3ZYDA 3ATWA 2JETB 3PLBA 1H9HE 1W0ZU 1C5RA 1PPFE 5JB9S 3A80A 1AMHA 5HM9A 4MQAA 4TY7A 3UNRA 1QB6A 1TX6A 1AU8A 3BSQA 3F1SB 1JIMA 1OP0A 1T31A 5FXLA 2P94A 1YPHE 2ZO3H 2ULLA 4WXVA 1MTSA 3M3SA 2GZ9A 1O0DH 3S9AA 3Q00A 1KLJH 1ZR0A 1K1MA 2W26A 2FPZA 5GJ4B 1Z6EA 2AGEX 1DWBH 1EP6A 4ZXXH 3C27B 3LT3A 3UIRA 1AO5A 5TJXA 1PJPA 2YOLA 4IC5A 1CT0E 5EQSA 1O5FH 3S69A 2GZ8A 1IOEA 5DK1A 2FX6A 2GT7A 4HGCA 1GHBF 4UE7H 2ZA5A 3E3TA 2PLXA 3GCTG 2A4QA 3RXJA 4GSOA 1GI9B 3MH6A 2AFQB 1S5SA 4ABHA 3RM2H 1J14A 1C9PA 1TABE 3KGPA 4AFQA 1AVXA 2A45B 1KXDA 2GT8A 4B73A 4IBLH 1G3BA 1O2VA 4LK4A 1O3OA 1XMNB 4Y71A 1GMCG 4Y8YA 1BBRK 1HBTH 1OYQA 2BY5X 3GYLB 5EXNA 2BD9A 2ZGJA 1DANH 3QTOH 3RXKA 1HPGA 1YPLH 1PQAA 2VWMA 1CVWH 1P10A 3ESTA 1N6XA 3F9EA 3BN9A 3PWBA 4A1TA 3SW2B 4BAHB 1DLEA 2FMJA 1TRMA 3E8LA 1EASA 3GCOA 1YLDA 2H9TH 3ODFA 4NZLA 5PTPA 1PPEE 1KTTB 1FJSA 3OU0A 3GCTF 1EAXA 4ZKOU 2B7DH 2ZHWH 1KDQB 1KLIH 5LPRA 2F9UA 3VEQB 1J16A 1YBWA 3RC5A 1UO6A 1S82A 1RJXB 1AE5A 5J4QA 1QBVH 4I8HA 1SFIA 3E1XB 1DVAH 2UUYA 4GPGA 1MKWK 3SNBA 2PGQB 1B5GH 4B2BA 3RDZA 1MQ5A 1YP9A 4CH8B 1G3DA 1ZMNA 1GMCF 1C2EA 3SU3A 2R9PA 3STIA 5DP6A 1SBWA 1ZPCA 5BRRE 4WMDA 1BTPA 1ZZZA 2PKSB 1ANBA 1HCGA 2PGBB 2GDEH 3M7QA 2O8MA 3SGAE 1EX3A 2Y81A 2JKHA 2RG3A 3ZVFA 1ETRH 1ZJKA 2P8OC 2TGTA 4ABDA 2ZDVH 3RXCA 1KXBA 2VH6A 1C5PA 2OQ5A 1MQ6A 3DFLA 1IQKA 2KAIB 3A8DA 3M5OA 1LKAA 2QV1A 2WUBA 1KXCA 1EZUC 2V3OH 1W13U 1PYTD 1Y5AT 5F8XA 2J95A 2AEIH 3HPTB 4IMZA 3LJJA 1PQ5A 4ASHA 5DG6A 4WH6A 4MPWA 1HAZB 4AFUA 1LKBA 1FY3A 1F5KU 2F9PA 2UUJB 1A1RA 2ZQ1A 3KQEA 3H7OA 3O8BA 1GBTA 3ENSB 2ZFSA 5T6DA 1MH0A 1FZZA 1Z8RA 4E7RG 4BTTB 2FESH 1TWXB 4Y0YE 4ZKRU 4Y6DA 3M5NA 2BQ6B 1S81A 2AGGX 2BXTH 4D9QA 5GDSH 4AB9A 3LGWA 2VWOA 1A5HA 1QRXA 1Z8IB 2ODPA 3V13A 1WCZA 1BMMH 1TMUH 1ZHRA 1YPJH 1O2SA 1LPGB 1PQ8A