1HIAB

Kallikrein complexed with hirustasin
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
150
structure length
150
Chain Sequence
GKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A new structural class of serine protease inhibitors revealed by the structure of the hirustasin-kallikrein complex.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Complex (protease/inhibitor)
molecule keywords KALLIKREIN
total genus 29
structure length 150
sequence length 150
chains with identical sequence Y
ec nomenclature ec 3.4.21.35: Tissue kallikrein.
pdb deposition date 1996-12-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hiaB00
1C5MD 2ZHEH 1SLVB 3C1KA 1XUFA 1OPHB 1V2JT 1P3CA 1VCWA 2GCHG 1ANEA 1EAIA 3UNRA 3PMAB 1VJAU 2XTTB 3F9GA 2GDDA 2WUBA 5AHGH 3Q77A 8LPRA 4ZH8A 1TGCA 4GSOA 5E2PA 4NSVA 2Z9KA 2SNVA 3PLPA 1S85A 1GBJA 2VWLA 3FFGA 4ABHA 2WPKS 1DX5M 2HALA 4BXSA 1OSSA 1JRSA 1NU9A 2ZDVH 3OY5U 1BTUA 1QGFA 5A2MH 4B2AA 2BOKA 1IQJA 2BY7X 3U8RH 1UHBB 2THFB 1UK4A 3A84A 1FY5A 1IQLA 4JZ1A 3A82A 1ELTA 1H8IH 3P8OA 3E1XB 5AF9H 2HPQH 1RS0A 4FUEA 2I6QA 4GUXA 4Y0YE 1AE8H 4ABFA 1YPKH 3JZ2B 2Z9JA 1TQ0B 4MPXA 1WBGB 4AN7A 1BMNH 3RXCA 1YPEH 3RM0H 1C5QA 2Q1JA 4AOQA 1J8AA 2F83A 3RLWH 1NRRH 5AVDA 3F9HA 4O3UA 1ZJDA 1XKBC 1GHBF 2ZFSA 3SU1A 1ESBA 3W94A 3MNSA 1XXFA 4TYDA 2OBOA 4MPUA 5EG4A 1B0FA 4ZMAH 1EP6A 1TQ7B 4D7GA 1TMUH 3BSQA 2AH4X 1RJXB 2B9LA 3LKWA 1MKXK 1L4DA 1NN6A 2FOAA 2KAIB 1W0ZU 3SO3A 5B6OA 1KDQB 1UK3A 5E2OA 3VGCC 1SHYA 1HRTH 4JZFH 3URCA 1QBNA 4DG4A 3Q76A 3UTUH 3ZZ7A 3PLKA 3F68H 1NRPH 1HXEH 3T29A 1DY9A 2Z3CA 2VNTA 1H9HE 3GDVA 1B0EA 1LHFH 3VB5A 1HGTH 3DA9B 3U1JB 1O2KA 4I31A 1TYNA 2XCFA 1SGRE 1P2OA 2A0QB 3EQ0H 4A5TS 3FVFB 6GCHG 1FJSA 1NY22 1SHHB 5T6FA 2OCVB 3U9AH 2H1UA 3U98H 1TONA 3NXPA 4X2YA 2J95A 1C5OH 4ZKNU 1A4WH 2A5KA 3MOCA 3AASA 4KKDA 2GVFA 1WSSH 4WMEA 1P2JA 1FIZA 1SGCA 2JH5D 3TJUA 1V2RT 1SGNE 1YYY1 2BTCE 2QXHA 1Z8RA 3RC5A 2WPHS 1HAHH 3RXRA 2QXJA 5IYTA 1D3TB 2Q6GA 4B2CA 1PQ5A 1UO6A 1HCGA 3Q3YA 1UK2A 3KQCA 1G2LA 1ZSJA 3EE0B 3ZZ8A 1HAPH 1O3BA 1W7GH 2D1JA 2Y82A 1XUJA 5EPNA 1U6QA 1C1TA 2CGAA 2BXTH 2ZO3H 4Q2KA 3D62A 1TBQH 1GI4A 1T31A 2BLVA 1ZPBA 2SGDE 5C5NA 4NGAH 1O2JA 4KP0A 1TB6H 1TGBA 3A8DA 2SGAA 1A46H 3ITIA 1H9LB 3A83A 3MNXA 1KTTB 1V2ST 2V3OH 3FP6E 2C3SA 3A88A 3ZVDA 2HOBA 4NIXA 2FOHA 2QV1A 1AZ8A 3SU3A 2NU0E 2VVUA 1OP2A 1AKSB 1G36A 1NRSH 3CS7A 3IITA 1S5SA 3A7YA 2ZFFH 1C5TA 3RUOA 3TK9A 4WXVA 1CBWC 2P8OB 1ESTA 5JB9S 4FVDA 3UY9A 5GCHG 3TH2H 1THPB 1Z8IB 1XKAC 3SGQE 4MNXA 2ZPRA 1NFWA 1CVWH 5JBTA 3TGIE 3ZVGA 3TVJB 2FYQA 1CSOE 1MKWH 1Q31A 1ZRBA 3GYMA 4IMZA 4Q7XA 1OXGA 2PR3A 5EQQA 1G3BA 1GBEA 3TJVA 1HBTH 1GHWH 2ZPSA 5DKMA 3OY6U 5G4BA 1UTJA 2GT7A 1FONA 5GIBA 1FUJA 1C2JA 1QRXA 2F9OA 3SOSA 3BIVH 1S6HA 4ZKSU 2OTVA 4I8JA 2ZFRH 1P02A 2FLRH 4INHA 5BRRE 1C1WH 1HUTH 1JWTA 3RXOA 1KDQA 1YPHE 3EGKH 2ANMH 1O3OA 1GL0E 5CE1A 2UUFB 1ZJKA 1QIXB 4ISHH 1PPCE 3KHVA 1DICA 4WVPE 2ALPA 2Z3DA 1AMHA 1W12U 3TJNA 1O3MA 5LPRA 2FODA 1Y3WA 3BV9B 1C2EA 1T8NA 2VINA 1HJ8A 2ZDMA 1NC6A 2PGBB 1O2TA 1UTNA 1IQKA 2BY6X 2F9UA 5FAHA 3E90B 4BAMB 4AG2A 2HWLB 4Y7AA 4MVNA 3SZNA 1GMHG 5FCRA 3KEEA 3TH3H 1A0JA 2ODYB 8GCHG 1O3PB 3A7ZA 3SUDA 1D3DB 5LH8A 5I25A 1O33A 1K1OA 2ZHFH 4ABGA 1YM0A 3BTGE 5F8TA 1ZOMA 2QXGA 1NFYA 5CHAB 2WYGA 4NIVA 2VWOA 1DWCH 3T25A 4YM9A 1EP5A 1A2CH 1O36A 1VCQA 3SI3H 1LKBA 4X0WU 3KGPA 2P94A 3M7UA 4WMFA 3URDA 1P2QA 3K65B 4K1TA 4D9RA 1ZMJA 1T7CA 2ZHWH 2PSYA 1TX8A 4A1VA 1QQ4A 1UTOA 1YC0A 3S7HB 1V2NT 2YNBA 3EAJA 1TALA 5FXLA 3GY6A 4ABBA 3RC4A 2BX4A 1CE5A 3PLBA 3SUGA 1C5ZB 2VH0A 2ZGJA 4K8YA 3T5FH 2Y5FA 3F1SB 5C1UA 2G00A 4GCHF 5FX5A 1Y3VA 2EEKA 4Y79A 2BD2A 2FI5E 3ATIA 5EXNA 3S7KB 3V12A 1F0RA 1ELCA 4O97A 4MG3A 1LQDB 2EA3A 1FPHH 1YPHC 1DWDH 1NO9H 1C1SA 3ESTA 2A4GA 2G8TA 1MU6B 1SG8B 4X8SH 1Z6EA 1EUFA 1SSXA 2GD4B 4CBOA 3LH1A 1L4ZA 1G37A 2BD8A 4TPIZ 1P09A 1F92A 1V6DA 2FEQH 3UNSA 4ZHLU 4Y8ZA 3OU0A 2G52A 1ELEE 2RA3A 2SNWA 2XCNA 5A0AE 2ZKSA 3TJOA 1J17T 4DT7B 1C5SA 1ZTKA 5EW1H 5LPEA 1AVWA 2AFQB 4A7IB 4NIYA 3QO6A 3LONA 2VVVA 1TWXB 1AVGH 1RRKA 3RXHA 5FPYA 1SGYE 2XWBI 4MTBA 3SUFA 1WCZA 1O3IA 2FZZA 4X1QU 5JB8S 4A92A 2IPHA 1RTFB 1DUEA 4U30A 3ENSB 3NPSA 1RIWB 2PKSB 1C2FA 3TNTA 5GDSH 5DP5A 1T4UH 2F9VA 4AB8A 1SFIA 2A32A 2J4IA 4X1PU 1QCPA 3M5NA 5FX6A 1SLXB 4BTUB 4H6SB 3MHWU 1QA7A 2W3IA 2F9NA 1OWDA 2BDYA 3GCNA 3ZVCA 3PM3A 2R3UA 3S9BA 4CHAB 3H7OA 1UVUH 4FU9A 1XVMA 1DLKB 1SGPE 3HK6B 2QAAA 3UPEA 1ELDE 1LO6A 2G4TA 1KY9A 1GGDB 3O8DA 1PJPA 2CF8H 3M5MA 4FUIA 3M5LA 3M35A 3PYHA 5JDUB 2UWOA 2ZG0H 1AIXH 5EQRA 1HNEE 1EZQA 1FY4A 1Y5UT 3ZZCA 5L2ZH 4TWWA 1F7ZA 4OGYA 3ELAH 1UVOA 5GXPA 1SGFA 7GCHG 2BZ6H 1RFNA 4UEHH 1D6RA 1N8OB 1YF4A 4XSKU 1G3EA 3A8AA 1IQFA 1MQ5A 2ZQ1A 1PYTD 2EI6A 4CR9A 1W3CA 1O39A 2O8UA 3RU4D 2BY8X 4WWYA 1FNIA 2CJIA 1QB9A 2FOBA 1GPZA 3RMOH 3SV9A 2O9QA 4MQAA 2XC5A 5E0JA 1HAGE 1O2RA 3E8LA 2VU8E 1NFXA 5T3HA 5DJ7A 1DE7H 1EOLA 1SPJA 2QN5T 1BT7A 3BTWE 1KXAA 1A3BH 1GCDA 1W11U 3CS0A 1EZSC 3T27A 4NZLA 2ZGBH 2GKVE 1CT2E 5GCHF 4MDSA 1XUHA 1D3PB 2A5AA 3QLPH 3ZVBA 2ZP0H 2PKAA 3CENA 1PQ8A 3F9FA 5L30H 3LGUA 1JXPA 1G2MA 1N8OC 3KL6A 1TPAE 3KIDU 2BY5X 1O3JA 4INKA 4X6MA 1QL8A 3SNDA 1GI3A 3A8CA 3VXEH 4D9QA 3A80A 1CHOG 3I78A 4ESTE 2GCHF 3PMBB 3SU6A 2R9PA 2QF3A 5EGMA 2ESTE 2GMTB 2WYJA 1L1JA 1VITH 3UOPA 3HKJB 3RU4E 2PTCE 1P8VC 2HNTE 1GVLA 1DT2A 1N6XA 4BAHB 2PGQB 1BTXA 3A7TA 1KLJH 3H5CB 1IQHA 1KXCA 4ZAEA 4D8NA 3MH6A 2AGEX 1RXPA 2HGTH 2ZA5A 2V0BA 1DANH 3SBKA 3GDSA 2J2UA 3T62A 1GCTB 2VIVA 1UVTH 4DJZB 1GI0A 2BY9X 1FXYA 6LPRA 2TGTA 3LGTA 4JZEH 1UJ1A 3SJ9A 1GCTC 1S84A 1GJ4H 2BHGA 2EI8A 1QRWA 1AWFH 2FI4E 3QGNB 1SI5H 5C2ZA 1AWHB 5FBEA 4BNRA 2QY0B 2PHBA 1HJ9A 3E16B 1O2IA 2AGIX 1NT1A 3KNXA 1OWIA 5C1XA 1TRYA 1VCPA 1TNJA 1BB0B 2H9EH 3LH3A 3GDUA 1V2WT 1UVSH 3V7TA 5A0CA 3K2UA 4TY7A 3SN8A 2Z94A 5LPFA 1TBZH 3PMJA 4K1EA 2GT8A 2FX6A 4K8BA 4A6LA 1IAUA 1LVOA 3MU4A 4MLFB 2OC1A 4CRAA 2XW9A 1ZR0A 1AHTH 2STBE 1RTKA 1P0SH 2XBXA 2BOHB 2TRMA 3MI4A 4MNYA 2ZF0H 2WV5A 2C90B 4NWKA 1V2UT 3M3VA 4HI3A 1A0HB 1HAZB 1NROH 2SGEE 1GBIA 1AD8H 3SV6A 2ANYA 3RLYH 4ZXXH 2A4RA 3AAUA 2BLQA 1TPSA 4IMQA 5HMAA 1ZSKA 1FIWA 3AAVA 1GI8B 1ELGA 2O8WA 1BHXB 3GCTG 3GY3A 3TK5A 3A7VA 3LGIA 3GICB 1CA0B 2ZU1A 2H2ZA 1QFKH 1CGIE 2BD4A 3TGKE 1T8LA 5DP6A 3A87A 1DXPA 1EJNA 1MAXA 2A2XH 3BTME 2XRCA 5EXMA 3A89A 4JYTA 3STIA 1MH0A 4YZUA 3RXGA 3VGCB 1O30A 3W95A 1ETSH 2V35A 2Y6TA 5EQSA 5F8XA 1W2KH 1HJAB 3TPIZ 2BDHA 5I46H 3MTYA 4Y11E 2XC4A 2WV4A 1K1JA 2OINA 4HTCH 4GPGA 3UFAA 1WYKA 4Y8XA 3SV7A 1TGTA 2A7JA 2WINI 2VIDA 3IWMA 3M5OA 1KXEA 2ZU4A 4ZHMU 1AFQB 1DSUA 4KGAA 1TOCB 1LHCH 2GGVB 3NKKA 4JZDH 3BTQE 3ZV9A 1QR3E 1OX1A 1ABJH 3RXFA 2XYAA 2ULLA 1NRNH 1OS8A 1GG6C 3LU9B 2ZCHP 3VB6A 2OP9A 5L6NH 4DGJA 3CP7A 3MWIU 5HGGA 3PTBA 3E0PB 1EAXA 1GWAA 1GI6A 3BTFE 1IHSH 4MPVA 1O2OA 1TAWA 4B75A 3A81A 4I33A 3N7OA 4I32A 1ABIH 5EU8A 3QZRA 1YPGH 4DIHH 1GJ9B 3FZZA 2Y5HA 3ZYDA 1O5BB 3PB1E 1XM1A 1HIAB 1O31A 1OYTH 3LC3A 2BLOA 2C8ZB 3LDXH 2OLGA 3UIRA 2OUAA 5L2YH 1FAKH 3DHKH 4FUDA 4AFZA 1G30B 1INCA 3KF2A 3F6UH 1QURH 1C5PA 3U69H 1MKXH 4XE4A 3LC5A 2OD3B 1KXBA 4MPWA 5DK1A 4CH8B 1UTQA 3MO9A 4ABDA 1TNHA 1AN1E 1OP0A 2V3HH 1QJ7B 4UFDH 4E06H 2JH0D 1EPTC 1D9IA 3K9XB 1SC8U 2Y7ZA 1DS2E 4UFFH 1BRBE 5F8ZA 1F0UA 2BMGB 2JETB 3RMNH 3ZZ3A 2GZ7A 2Q6DA 4Q7ZA 1YPJH 2H9HA 1BIOA 1CBWB 2O8TA 1EPTA 2Z6BD 2HLCA 4H6TA 2BX3A 1S0RA 1C2KA 1SMFE 1Y59T 1QL7A 2R3YA 2QYIA 3KN2A 4LXBH 1O3AA 2ZU2A 2FWWA 3LGVA 1EB1H 4Y10E 6CHAC 2FX4A 2W26A 1GBCA 4X6NA 1SR5C 2ZTXA 1P11E 4ZKRU 4DY7B 1TBRH 5JBCS 3MU0A 3QUMP 4QT8C 5LGOA 1S0QA 1MD8A 1V2TT 3SJ8A 1LQEA 1JIRA 4E7RG 1V3XA 3VFEA 1BBRK 1SFQB 4O9VA 3RXQA 1IHTH 3BG4B 4THNH 1IOEA 1WOFA 1QQUA 1GBBA 1UCYH 4FVBA 1GVKB 1YPLH 1V2OT 1L2EA 2ZDLA 4ABEA 5A8ZA 1DSTA 2AS9A 4ZHAA 1EOJA 1O0DH 1UHBA 2QIQA 1BTPA 4UONA 2GV7A 2Z3EA 1ZGVA 3QWCH 5TCCA 2B0FA 1MTVA 4KTSA 2CMYA 1O2YA 2OQUA 1RIWC 2PKSC 1OOKB 2G55A 1GJCB 2Y81A 1P04A 2F9BH 1EAWA 1S6FA 3GY4A 3ZVFA 1GI9B 3S69A 1E34B 3O8RA 3UWJH 3MU5A 1J15A 2UUJB 4U01A 1V2KT 3MNBA 4Y0ZE 2GCTB 5JBBS 5DG6A 1SGEE 1C2IA 1C5WB 1BA8B 1PPGE 3MH5A 1PPFE 5GPIB 2EI7A 1C1NA 2VGCC 4D7FA 1TOMH 1S81A 1K1PA 2B7DH 1O5DH 4AFSA 2P59A 3RMMH 3RXLA 1ZMNA 1H1BA 2Y5GA 1FQ3A 4XDEA 1H4WA 1KLIH 1GHAF 4OS7A 1TMTH 1HXFH 2FIRH 2NU3E 4R0IA 2DUCA 2VIQA 2AIQA 3VB4A 3L6PA 1SLWB 2ZEBA 1JIMA 3A8BA 1GJ8B 4I8KA 3P95A 7KMEH 3P17H 3M36A 3GISB 4JK6A 1SQTA 2D26C 3NZIA 1A7SA 1Y5BT 4LZ1H 2F9PA 1NESE 3SNBA 4OS5A 1TRNA 1O5EH 5JBAS 5A8YA 5HYOA 1AFEH 4ZXYH 3M3SA 1SOZA 2ZCKP 4YESB 2ODQA 2NU2E 5GWZA 2KAIA 1EPTB 1G9IE 4KTCA 1VR1H 2QA9E 3SV8A 3SU4A 4Z6AH 1OP8A 1A1RA 2ASUB 2A7HA 2VIOA 3U8OH 1O3NA 2ANKH 2XC0A 1BZXE 1O3CA 3RXAA 1EZUC 2P8OC 2B5TB 1E0FD 1RD3B 3ZYEA 1GHYH 3TK6A 3EA9A 2PW8H 3KCGH 3PO1B 1DOJA 1GBMA 1YLCA 3SUEA 1C2MA 1AZZA 2NU1E 3V13A 1CT0E 5C3NA 2O8LA 2HNTF 1ESAA 2PFEA 2ZTYA 1GMCG 3HK3B 1XX9A 7LPRA 1OWHA 4AGJA 3SNCA 4X2VA 1C1UH 3F9EA 2BDAA 4BAKB 5HXFA 4FU8A 2BXUH 1RGQA 2G81E 3T2NA 2R2WU 3RXSA 3KQBA 3U1IB 1QL9A 2QCYA 1C5RA 3I77A 1TNLA 1HAYB 3E3TA 1C4V2 3ZZAA 1C1VH 2WPMS 1GG6B 2ZTZA 1QTFA 1UMAH 8GCHF 1CO7E 1C2HA 1ZRKA 1K21H 3PO1C 1HIAA 3SHAH 4UE7H 1O2PA 1CT4E 3HGPA 2VB0A 1ZLRA 4Y7BA 5FCKA 1C2DA 1M9UA 2FOFA 2HPPH 2W3KA 1P12E 1WAYB 4TY6A 2Z9IA 2J34A 4TPYA 5AFZH 2TIOA 6GCHF 2STAE 4D76A 5JYIA 1W10U 3A85A 2ZECA 1Y3YA 2ZFTA 4NZQA 1VGCC 1Z71A 4YT7H 1K1LA 4CRBA 3P6ZB 1OWKA 1S82A 1C5VA 4I8GA 3ATKA 3PROA 3M61U 5GJ4B 1P01A 4TWYA 4XBBA 4Z0KA 4NG9H 2W5EA 3EA7A 1BMAA 2BDIA 1MCTA 2LNCA 1ARCA 3O8CA 1W0YH 2CHAC 2C93B 1LVBA 3OYPA 3M7QA 2GZ8A 1ZHPA 3UNQA 4ISNA 2CHAB 5A8XA 5J4QA 4NFEA 6ESTA 1E36B 4E7NA 1BOQA 3TLOA 1GI2A 1QHRB 1O2NA 4AFQA 2PUQH 1Y5AT 3TH4H 3E6PH 4B76A 2R0LA 1VITG 1PQ7A 1O32A 1L1GA 1MTSA 4CBNA 1GJ7B 3DFJA 1ELBA 1VGCB 1O3HA 4ZUHA 3GY7A 1MZDA 2A5IA 1V2VT 1GBAA 1YLDA 3NCLA 5IDKA 1ETRH 3MMGA 2J92A 2GDEH 2YOLA 1CHGA 3RXKA 1DWEH 2FP7B 1Q3XA 3UUZA 1GHVH 2PLXA 1W8BH 1ORFA 1K1MA 1TPOA 1FI8A 1OWEA 1DXWA 3ZV8A 1GBLA 4HFPB 2FTMA 1ANDA 1PPZA 2DE9A 3ATWA 3GY5A 4I7YH 1F5KU 1SGFG 4E05H 1K28D 3HKIB 2J9NA 5FPTA 2ZCLP 7ESTE 3AW1A 4INLA 1TNGA 1B7XB 2CF9H 5BPEA 4Y6DA 1SGIB 2GTBA 1SGTA 4AYYB 4X2WA 5C67A 5DGJA 7GCHF 1HFDA 5ESTE 2RG3A 1QBVH 3BEFB 1IQEA 4FUHA 3FAOA 3WY8A 3FP7E 1MTNB 2P3UB 5E8EH 3ZVEA 1P2KA 5CHAC 1TFXA 3M37A 4VGCC 2J38A 1FY1A 4X2XA 1NPMA 4FUFA 1THSH 4GAWA 3HATH 2PWXA 1G3CA 4AGKA 4BAQB 1A0LA 1BDAA 1PPEE 4H42U 1WTGH 4VGCB 1DLEA 1S83A 2ZZUH 1O2XA 4JZIA 3UREA 1QY6A 1MU8B 1BCUH 4DOQA 4X1RU 1O2QA 6CHAB 1YCPM 1DITH 1GDUA 1KTSB 1UCYK 1W7XH 1HDTH 1Z1JA 4JYVH 1SOTA 2ILNA 2AMQA 2Y7XA 1QRZA 2BD7A 4CRDA 2EC9H 1J9CH 3RXMA 2ZDAH 1SVPA 2A2QH 1A61H 2ZHDA 4Q80A 3GCHB 1NM6A 2OC7A 1O3KA 2R0KA 5JPMH 1DVAH 4UFGH 4YLUA 3RXVA 4IBLH 2K1QA 2Z9GA 3D23A 1EJAA 3ZZDA 2ZGXH 4SGAE 1BRAA 2A45B 1TPPA 4WXIA 2C8XB 3ZVAA 3LPRA 1KXDA 1O3LA 4JMYA 5F03A 1WV7H 3A7WA 2BDCA 2VIPA 4NA9H 2ZDNA 4AORA 1C1QA 2PKAB 3FZDA 1FDPA 1D6WA 9ESTA 1C4Y2 1NRQH 1SQAA 3PWCA 5E0HA 1FN8A 3D49H 4CREA 4NWLA 1ZZZA 3DUXH 1ANCA 1P2NA 1P03A 1BBRE 1GJAB 2ZFQH 3ZZ6A 3LJJA 4NCYA 4YOGA 2GP9B 2FOGA 4WF8A 5TCAA 3KQEA 1FN6A 1LHGH 2XWAA 3SNAA 5K7RA 2F3CE 1P2MA 1O3DA 1VITF 4YOJA 3SW2B 2B8OH 3LIWA 1DUAA 2VJ1A 5EOKA 3SGBE 1ZYOA 2PTNA 4OGXA 1GBKA 4CRCA 2TGAA 5HM9A 1AE5A 3SNEA 4J2YB 1GJBB 1AB9B 3RP2A 1O3FA 1JBUH 4XOJA 4ABIA 1ID5H 3TU7H 5DPAA 2ZDKA 1O2ZA 3BG8A 5TJXA 2R2MB 3MO3A 3TITA 4MNWA 1LKAA 2BVRH 2WPJS 2GCTC 2VIWA 3BEUA 4FUGA 2PUXB 4YTAA 1TRMA 3UQOA 1WQVH 4GLYA 1C9PA 1O5FH 2ZWLH 4ZROA 1EJMA 1KLTA 4MNVA 2AERH 3E0NB 1GMCF 1LVMA 3MU1A 1MTNC 1NS3A 1TNIA 3SI4H 1O5GH 2BD5A 1L0ZA 3SGAE 3GY2A 2FOCA 1OWJA 2W7UA 1BRCE 1C5YB 1AI8H 1C1PA 2ZIQH 2XBYA 3P92A 4FUJA 4GHTA 3RXUA 1XMNB 1GHZA 4X6PA 1FMGA 4NIWA 2UWLA 2AMDA 1O2LA 2GMTC 3B9FH 1K1IA 1Z8JB 1FZZA 3BG4C 1O2HA 4Y71A 4AZ2B 1Z7KA 1EAUA 1EQ9A 3VB7A 2AIPA 1GBDA 2ZNKH 2P3FH 4IN2A 1AB9C 4X6OA 1AVXA 4CRFA 1TA6A 3Q3KA 4RKOB 3DD2H 2OBQA 1ETTH 1E37B 1ARBA 3RXPA 3RU4T 1MMJN 4I8LA 3VB3A 1O2MA 1J14A 5DP3A 3LGWA 1Y3XA 4IW4E 1FPCH 1SB1H 1VZQH 4B1TA 5DO4H 3U8TH 1KXFA 4X8VH 2XXLA 1C5NH 3MO6A 3BIUH 4K3JA 2FOEA 4O3TA 3ODFA 1W13U 2D2DA 2FM2A 1BMMH 2BD3A 3LJOA 4HZHA 3MH4A 4LOYH 3BTKE 2TPIZ 4BTIB 1IQIA 1HPGA 3RXDA 4Q7YA 1JRTA 3QK1A 5FPSA 4OS1A 3UWIA 1B5GH 1GDNA 5FBIA 1NTPA 2UUKB 2DE8A 1O3GA 1A5HA 4JYUH 1TABE 4YLQH 2FOMB 2AYWA 8ESTE 4CR5A 1P3EA 2ZGCA 3SU2A 1C4U2 1C2GA 3V3MA 1G3DA 1QNJA 2NU4E 3PV4A 2Q6FA 4XFQA 2G51A 1ELFA 3GCTF 1MCVA 4K5ZA 4ISOA 2H5CA 4U2WA 4SGBE 4U32A 4GCHG 4B2BA 1KSNA 3EDXB 1O35A 3STJA 1WQSA 1YCPH 1HB0B 1AUJA 1EX3A 1K1NA 1XVOA 3JZ1B 5EW2H 5E0GA 1K2I1 1HYLA 2BLWA 2UWPA 2FS8A 4IC6A 4CHAC 2RCEA 4CH2B 9LPRA 4X8TH 1EB2A 1P57B 2BVXH 1F5LA 1CA8B 4ASHA 5C5OA 1F0TA 4K2YA 2SGFE 2VVCA 2ZPQA 8KME2 2A4OA 1MKWK 2H9TH 1JOUB 1A5IA 1HAVB 1ZTJA 2Y80A 3V0XA 3SJKA 4LZ4B 4BTTB 2CV3A 1GMDG 1GHAG 3HGNA 1HV7A 3DT0H 1BBRH 4AX9H 3E91A 3DFLA 2C8WB 1YPMH 3RM2H 1TX6A 4NA7A 2RA0A 1CHOF 3AVZA 1O3EA 2D8WA 2FLBH 2ALVA 1TGSZ 1YBWA 1AFQC 1DPOA 1GJDB 4YO9A 1C9TA 2BD9A 3O8BA 4PROA 1T8MA 3P8NA 2BZAA 3SU0A 2YNAA 2SGPE 2A4QA 1XUIA 1TMBH 1P10A 4FUCA 4XBCA 4ABAA 3OX7U 4B71A 3B8JA 1N1LA 2Z9LA 1SQOA 2GZ9A 1GJ5H 1CA0C 4LK4A 1EATA 1HAIH 1C5LH 3P8FA 4UD9H 1KYNA 3BTTE 4OS2A 1BTYA 1TLDA 2FYRA 1HAVA 2C4FH 1N6YA 1BJVA 3M7TA 1DWBH 1BRUP 1IQGA 2G4UA 4IC5A 5CMXH 1K22H 1UTLM 3UR6A 2Z7FE 2A1DB 1UCYE 2VH6A 1FY3A 1ZHMA 1GHBG 5HM2A 1Z1IA 5H4IB 5PTPA 4BAOB 4F4OC 1BQYA 1IQMA 1BTHH 1GDQA 3S0NA 3ATMA 3GOVB 1TE0A 1SL3A 1THRH 4WMDA 3FP8E 1ZPCA 1EXFA 2FESH 1PQAA 2WPIS 2QXIA 3RXTA 1EZXC 3BTEE 1AO5A 3RDZA 1C1OA 1QJ6B 4RN6A 1QB6A 4XBDA 1TIOA 3VPKA 2F91A 1QBOA 3B23B 5AFYH 2H5DA 2GV6A 3FANA 4DVAU 2CXVA 1ZMLA 1G32B 3C27B 2BB4A 3S9CA 4CRGA 3UQVA 1DY8A 2FXRA 2FI3E 2SFAA 1AY6H 1DM4B 1GBHA 1RTLA 1KIGH 1ELVA 2FS9A 1E38B 1ZGIA 1Q2WA 2JKHA 1XUGA 2OC8A 5J4SA 2ZHQH 2RDLA 1EASA 3M3TA 1CGJE 1CU1A 1TGNA 2VWMA 2SGQE 1XXDA 4WY3A 3H7TA 5DP7A 1HAXB 2FDAA 3QTVH 1WTHD 3BF6H 3SJIA 5A0BA 3KQDA 1BUIA 1K9OE 1H9IE 3A7XA 4DURA 1LHEH 3L3TA 1ELAA 1LMWB 1P9SA 1P06A 1C1MA 1IQNA 1GVZA 2WPLS 2ZQ2A 3SORA 3PTNA 4A1XA 1D4PB 3G01A 1QB1A 2HRVA 3AW0A 3NWUA 4FXGH 2ZFPH 1P9UA 1MBMA 4O03A 3QX5H 1HAOH 3RC6A 1GBFA 4BXWA 2AMPA 3GYLB 3SHCH 1C2LA 1SBWA 5F6MA 5DP8A 1LPKB 2C8YB 2A31A 1C5UA 5ETXA 1VJ9U 2TGPZ 1MBQA 4IGDA 1O38A 1Z6JH 1YP9A 3PWBA 1V2PT 1O5AB 4ABJA 1V2LT 3EA8A 2ODPA 2PV9B 3VXFH 4R8TB 3R0FA 4KTUA 2ZU3A 1V2QT 1XUKA 1PFXC 3S9AA 1GJ6A 2PSXA 5DP4A 1T8OA 1A5GH 3LGYA 1HLTH 1W14U 1O2VA 2BDBA 1AUTC 1GI7B 2P93A 1LCYA 1GL1A 5ABWA 1P05A 2TGDA 1Y3UA 3EYDA 2XBWA 3HPTB 4B74A 1NZQH 2ANWA 3Q00A 5EODA 3QN7A 3LT3A 3ZZBA 1O2GH 3P8GA 1T4VH 4AB9A 2ZC9H 2BM2A 4NSYA 3P70B 1O5CB 2ZI2H 3NUMA 1HJAC 2BDGA 3TNSA 3MNCA 1E35B 1GI5A 1YCPK 3ZZ5A 1BJUA 3QTOH 1LDTT 2AGGX 4Y76A 2HNTC 3LOXA 2HVXA 3R3GB 5SGAE 1F5RA 1LHDH 1UTMA 1ZHRA 1EKBB 2IJOB 1ZTLA 3A86A 1GI1A 3GCHC 2W7SA 1H8DH 1F2SE 1MUEB 1OYQA 2BVSH 1ZPZA 1LPZB 3BN9A 3OTJE 1CQQA 4H4FA 1MZAA 2IOTA 1SGDE 4RSPA 5A09A 1DFPA 5FHTA 3UOUA 4GHQA 1FAXA 4JK5A 2BQWB 2FO9A 1P2IA 3T28A 1D3QB 2QC2A 3BEIB 1GBTA 1ZSLA 3RXJA 2LPRA 1BHXF 2QGRA 2FTLE 1AQ7A 3PMHB 2BQ6B 3MH7A 4YOIA 5T6GA 1BTWA 3SJOA 1GGDC 2P16A 1F0SA 4AFUA 3UR9A 3NK8A 1LVYA 1Z8GA 2ZGHA 4WH6A 4IN1A 5ESBA 3SQEE 1WUNH 1AGJA 1UTPA 4AG1A 1O2WA 2BQ7B 4HGCA 1ANBA 3OSYA 4FUBA 3ODDA 4BOHA 3GY8A 2CN0H 1QA0A 1DDJA 1SLUB 2VGCB 1YKTA 3ATLA 1C1RA 1NU7B 3QZQA 4AYVB 3MFJA 4BANB 4I8HA 1PYTC 4X1SU 5T6DA 3RMLH 3K6YA 1O2SA 1UVPA 4ZKOU 1FY8E 4Y8YA 4F49A 5EPYA 1GHXH 5K0HA 1A3EH 1PPBH 4RKJB 1T32A 1GMHF 3K6ZA 3VEQB 1LTOA 2XBVA 1LPGB 1JMOH 4WJG2 2G5NA 1BMLA 1MQ6A 2AEIH 4A1TA 3ZZ4A 1MTUA 3RXIA 2UUYA 2JH6D 2GX4A 1FLEE 1BTZA 4X1NU 3BTHE 4M7GA 1CGHA 3SQHE 2ZU5A 1L1NA 4B73A 3Q3XA 4NFFA 3RXEA 3QGJA 2A7CA 5C1YA 4OS4A 4FU7A 4IS5A 4GVUA 4KELA 3T26A 1C5XB 2V6NA 4JCNA 2I6SA 3RXBA 1NFUA 1TX7A 2XNIA 1SGQE 4UDWH 5EXLA 2FPZA 2QF0A 3TIUA 1J16A 1Y8TA 2OXSA 4DCDA 2NWNA 3I29A 1MTWA 1PPHE 1QJ1B 4DIIH 1O2UA 3TGJE 1UTKA 2VWNA 1TA2A 4J1YA 3MU8A 3BTDE 1MD7A 4X8UH 2J94A 1X7AC 1GMDF 2WUCA 2JETC 1FV9A 2IN2A 1MAYA 4OS6A 4NA8A 3IG6B 1ACBE 1YGCH 3MYWA 4DW2U 5C20A 2OC0A 3GCOA 4K60A 1OKXA 2BYAX 1BITA 3QDZB 4UFEH 2P3TB 4K1SA 2OQ5A 3SV2H 3D65E 4ISIH 1AU8A 2FMJA 3L33A 1WU1A 4WH8A 1O37A 1O34A 1V2MT 3SU5A 2G5VA 2P95A 4YT6H 2M5TA 2TBSA 5DP9A 1TNKA 3ZZ9A 4ISLA 1AKSA 4K69A 2H6MA 2O8MA
chains in the Genus database with same CATH superfamily
1C5MD 2ZHEH 1SLVB 3C1KA 1XUFA 1OPHB 1V2JT 1P3CA 1VCWA 2GCHG 1ANEA 1EAIA 3UNRA 3PMAB 1VJAU 2XTTB 3F9GA 2GDDA 2WUBA 5AHGH 3Q77A 8LPRA 4ZH8A 1TGCA 4GSOA 5E2PA 4NSVA 2Z9KA 2SNVA 3PLPA 1S85A 1GBJA 2VWLA 2KR7A 3FFGA 4ABHA 2WPKS 1DX5M 2HALA 4BXSA 2EQNA 1OSSA 1JRSA 1NU9A 2ZDVH 3OY5U 1BTUA 1QGFA 5A2MH 4B2AA 2BOKA 1IQJA 2BY7X 3U8RH 1UHBB 2THFB 1UK4A 3A84A 1FY5A 1IQLA 4JZ1A 3A82A 1ELTA 1H8IH 3P8OA 3E1XB 5AF9H 2HPQH 1RS0A 4FUEA 2I6QA 4GUXA 4Y0YE 1AE8H 4ABFA 1YPKH 3JZ2B 2Z9JA 1TQ0B 4MPXA 1WBGB 4AN7A 1BMNH 3RXCA 1YPEH 3RM0H 1C5QA 2Q1JA 4AOQA 1J8AA 2F83A 5C0UA 3RLWH 1NRRH 5AVDA 3F9HA 4O3UA 1ZJDA 1XKBC 1GHBF 2ZFSA 3SU1A 1ESBA 3W94A 3MNSA 1XXFA 4TYDA 2OBOA 4MPUA 5EG4A 3OFND 1B0FA 4ZMAH 1EP6A 1TQ7B 4D7GA 1TMUH 3BSQA 2AH4X 1RJXB 2B9LA 3LKWA 1MKXK 1L4DA 1NN6A 2FOAA 2KAIB 1W0ZU 3SO3A 5B6OA 1KDQB 1UK3A 5E2OA 3VGCC 1SHYA 1HRTH 4JZFH 3URCA 1QBNA 4DG4A 3Q76A 3UTUH 3ZZ7A 3PLKA 3F68H 1NRPH 1HXEH 3T29A 3KYFA 1DY9A 2Z3CA 2VNTA 1H9HE 3GDVA 1B0EA 1LHFH 3VB5A 1HGTH 3DA9B 3U1JB 1O2KA 4I31A 1TYNA 2XCFA 1SGRE 1P2OA 2A0QB 3EQ0H 4A5TS 3FVFB 6GCHG 1FJSA 1NY22 1SHHB 5T6FA 2OCVB 3U9AH 2H1UA 3U98H 1TONA 3NXPA 4X2YA 2J95A 1C5OH 4ZKNU 1A4WH 2A5KA 3MOCA 2JIZD 3AASA 4KKDA 2GVFA 1WSSH 4WMEA 1P2JA 1FIZA 1SGCA 5EIYA 2JH5D 3TJUA 1V2RT 1SGNE 1YYY1 2BTCE 2QXHA 1Z8RA 3RC5A 2WPHS 1HAHH 3RXRA 2QXJA 5IYTA 1D3TB 2Q6GA 4B2CA 1PQ5A 1UO6A 1SQRA 1HCGA 3Q3YA 1UK2A 3KQCA 1G2LA 1ZSJA 3EE0B 3ZZ8A 1HAPH 5C94A 4XD7D 1O3BA 1W7GH 2M2AA 3N7EA 2D1JA 2Y82A 1KMHB 4FETA 1XUJA 5EPNA 1U6QA 1C1TA 2CGAA 2BXTH 2ZO3H 4Q2KA 3D62A 1TBQH 1GI4A 1T31A 2BLVA 1ZPBA 2SGDE 5C5NA 4NGAH 1O2JA 4KP0A 1TB6H 1TGBA 3A8DA 2SGAA 2KZ4A 3FN8A 1A46H 5CDFE 3ITIA 1H9LB 3A83A 3MNXA 1KTTB 1V2ST 2V3OH 3FP6E 2C3SA 3A88A 4OM9A 3ZVDA 2HOBA 4NIXA 2FOHA 2QV1A 1AZ8A 3SU3A 2NU0E 2VVUA 1OP2A 3MQKC 1AKSB 1G36A 1NRSH 3CS7A 3IITA 1S5SA 3A7YA 2ZFFH 1C5TA 3RUOA 3TK9A 4WXVA 1CBWC 2P8OB 1ESTA 5JB9S 4FVDA 3UY9A 5GCHG 3TH2H 1THPB 2WZQA 1Z8IB 1XKAC 2L6OA 4MNXA 3SGQE 2ZPRA 1NFWA 2KM0A 1CVWH 2WV9A 5JBTA 3OE7D 3TGIE 3ZVGA 3TVJB 2FYQA 1CSOE 1MKWH 1Q31A 1ZRBA 3GYMA 4IMZA 4Q7XA 1OXGA 2PR3A 5EQQA 1G3BA 1GBEA 3TJVA 1HBTH 1GHWH 3PRDA 2ZPSA 5DKMA 3OY6U 5G4BA 1UTJA 2GT7A 1FONA 5GIBA 1FUJA 1C2JA 1QRXA 2F9OA 3SOSA 3BIVH 4Q4LA 1S6HA 4ZKSU 3PV5A 2OTVA 4I8JA 2ZFRH 1P02A 2FLRH 4INHA 5BRRE 1C1WH 1HUTH 1JWTA 3RXOA 1KDQA 1YPHE 3EGKH 2ANMH 1O3OA 1GL0E 5CE1A 2UUFB 1ZJKA 2RFKC 2W6ID 1QIXB 4ISHH 1PPCE 3KHVA 1DICA 4WVPE 2ALPA 2Z3DA 1AMHA 1W12U 3TJNA 1O3MA 5LPRA 2FODA 1Y3WA 3BV9B 1C2EA 1T8NA 2VINA 1HJ8A 2ZDMA 1NC6A 1MABB 2PGBB 1O2TA 1UTNA 1IQKA 2BY6X 4XRNA 2F9UA 5FAHA 3E90B 4BAMB 4AG2A 2HWLB 4Y7AA 4MVNA 3SZNA 1GMHG 5FCRA 3KEEA 3TH3H 1A0JA 2ODYB 8GCHG 1O3PB 4AC9A 3A7ZA 3SUDA 1D3DB 5LH8A 5I25A 1O33A 1K1OA 2ZHFH 2VBCA 1YM0A 3BTGE 4ABGA 5F8TA 1ZOMA 2QXGA 1NFYA 5CHAB 2WYGA 4NIVA 2VWOA 1DWCH 3T25A 4YM9A 1EP5A 1A2CH 1O36A 1VCQA 3SI3H 1LKBA 4X0WU 3KGPA 2P94A 3M7UA 4WMFA 3URDA 1P2QA 3K65B 4K1TA 4D9RA 1ZMJA 1T7CA 2ZHWH 2PSYA 1TX8A 4A1VA 1QQ4A 1UTOA 1YC0A 3S7HB 1V2NT 2YNBA 3EAJA 1TALA 5FXLA 3GY6A 5EJZA 4ABBA 3RC4A 2BX4A 1CE5A 3PLBA 3SUGA 1C5ZB 2VH0A 2ZGJA 4K8YA 3T5FH 2Y5FA 3F1SB 5C1UA 2G00A 4GCHF 1EFRD 5FX5A 1Y3VA 2EEKA 4Y79A 2BD2A 5F53A 2FI5E 3ATIA 2KX4A 2CK3D 4TT3D 5EXNA 3S7KB 3V12A 1F0RA 1ELCA 4O97A 4MG3A 1LQDB 3SZEA 2EA3A 1FPHH 1YPHC 1DWDH 1NO9H 1C1SA 3ESTA 2G8TA 2A4GA 1MU6B 1SG8B 4X8SH 1Z6EA 1EUFA 1SSXA 2GD4B 4CBOA 3LH1A 1BMFD 1G37A 1L4ZA 2BD8A 4TPIZ 1P09A 1F92A 1V6DA 2FEQH 3UNSA 4ZHLU 4Y8ZA 3OU0A 2G52A 1ELEE 2RA3A 2SNWA 2XCNA 5A0AE 2ZKSA 4RT1A 3TJOA 2F4LA 1J17T 4DT7B 1C5SA 1ZTKA 5EW1H 5LPEA 1AVWA 2AFQB 4A7IB 2KCYA 4NIYA 1YLNA 3QO6A 3LONA 2VVVA 1TWXB 1AVGH 4I86A 1RRKA 3RXHA 5FPYA 1SGYE 2XWBI 4MTBA 4ASUD 3SUFA 1WCZA 1NBMD 1O3IA 2IJD1 2FZZA 4X1QU 5JB8S 4A92A 2IPHA 1RTFB 1DUEA 4U30A 3ENSB 3NPSA 1RIWB 2PKSB 1C2FA 3TNTA 5GDSH 5DP5A 1T4UH 2F9VA 4AB8A 1SFIA 2A32A 2J4IA 4X1PU 1QCPA 3M5NA 5FX6A 1SLXB 4BTUB 4H6SB 3MHWU 1QA7A 2W3IA 2F9NA 1OWDA 2BDYA 3GCNA 3ZVCA 2V7QD 4FOUC 3PM3A 2R3UA 3S9BA 4CHAB 3H7OA 1UVUH 4FU9A 1XVMA 1DLKB 1SGPE 3HK6B 2QAAA 3UPEA 1ELDE 1LO6A 2G4TA 1KY9A 1GGDB 3O8DA 1PJPA 2CF8H 3M5MA 4FUIA 3M5LA 3M35A 3PYHA 5JDUB 2UWOA 2ZG0H 1AIXH 5EQRA 1HNEE 1EZQA 1FY4A 1Y5UT 3ZZCA 5L2ZH 4TWWA 1F7ZA 4OGYA 3ELAH 1UVOA 5GXPA 1SGFA 7GCHG 2BZ6H 1RFNA 4UEHH 1D6RA 1N8OB 1YF4A 4XSKU 1G3EA 3A8AA 1IQFA 1MQ5A 2ZQ1A 1PYTD 2HLDD 2EI6A 4CR9A 1W3CA 1O39A 2O8UA 3RU4D 2BY8X 4WWYA 1FNIA 2CJIA 1QB9A 3F2FA 2FOBA 1GPZA 3RMOH 3SV9A 3F2HA 2O9QA 4MQAA 2XC5A 5E0JA 1HAGE 1O2RA 3E8LA 2VU8E 1NFXA 5T3HA 5DJ7A 1DE7H 1EOLA 1SPJA 2QN5T 1BT7A 2YMSC 3BTWE 1KXAA 1A3BH 1GCDA 1W11U 3CS0A 1EZSC 3T27A 3FO8D 4NZLA 2ZGBH 2GKVE 1CT2E 5GCHF 4MDSA 1XUHA 1D3PB 2A5AA 3QLPH 3ZVBA 5DN6D 2ZP0H 2PKAA 3CENA 1PQ8A 3F9FA 5L30H 3LGUA 1JXPA 1G2MA 1N8OC 3KL6A 1TPAE 3KIDU 2BY5X 1O3JA 4INKA 3OTPA 4X6MA 1QL8A 3SNDA 1GI3A 3A8CA 3VXEH 3WWBA 3A80A 4D9QA 1CHOG 3I78A 4ESTE 2GCHF 3PMBB 3SU6A 3DSOA 2R9PA 2QF3A 5EGMA 2ESTE 2GMTB 2WYJA 1L1JA 1VITH 3UOPA 3HKJB 3RU4E 2PTCE 1P8VC 2HNTE 1GVLA 1DT2A 1N6XA 4BAHB 2PGQB 1BTXA 3A7TA 1KLJH 3H5CB 1IQHA 1KXCA 4ZAEA 4D8NA 3MH6A 2AGEX 1RXPA 2HGTH 2ZA5A 2V0BA 1DANH 3SBKA 3GDSA 2J2UA 3T62A 1GCTB 2VIVA 1UVTH 4DJZB 1GI0A 2BY9X 1FXYA 6LPRA 2TGTA 3LGTA 4JZEH 1UJ1A 3SJ9A 1GCTC 1S84A 1GJ4H 2BHGA 2EI8A 2PP6A 1QRWA 1AWFH 2FI4E 3QGNB 1SI5H 5C2ZA 1AWHB 5FBEA 4BNRA 2QY0B 2PHBA 1HJ9A 3E16B 1O2IA 2AGIX 1NT1A 3KNXA 1OWIA 5C1XA 1TRYA 1VCPA 3N99A 4DT4A 1TNJA 1BB0B 2H9EH 3LH3A 3GDUA 1V2WT 1UVSH 3V7TA 5A0CA 3K2UA 4TY7A 3SN8A 2Z94A 5LPFA 1TBZH 3PMJA 4K1EA 2GT8A 2FX6A 4K8BA 4A6LA 1IAUA 1LVOA 3FOAA 3MU4A 4MLFB 2OC1A 4CRAA 2XW9A 1ZR0A 1AHTH 2STBE 1RTKA 1P0SH 2XBXA 2BOHB 2TRMA 3MI4A 4MNYA 2ZF0H 2WV5A 2C90B 4NWKA 1V2UT 3M3VA 4HI3A 1A0HB 1HAZB 1NROH 2SGEE 1GBIA 1AD8H 3SV6A 2ANYA 3RLYH 4ZXXH 2A4RA 3AAUA 2BLQA 1TPSA 4IMQA 5HMAA 1ZSKA 1FIWA 3AAVA 1GI8B 1ELGA 2O8WA 1BHXB 3GCTG 3GY3A 3TK5A 3A7VA 3LGIA 3GICB 1CA0B 2ZU1A 4F55A 2H2ZA 1QFKH 1CGIE 2BD4A 3TGKE 1T8LA 5DP6A 3A87A 1DXPA 1EJNA 1MAXA 2A2XH 3BTME 2XRCA 2LELA 5EXMA 3A89A 4JYTA 3STIA 1MH0A 4YZUA 3RXGA 3VGCB 1O30A 3W95A 1ETSH 2V35A 2Y6TA 5EQSA 5F8XA 1W2KH 1HJAB 3TPIZ 2BDHA 5I46H 3MTYA 4Y11E 2XC4A 2WV4A 1K1JA 2OINA 4HTCH 4GPGA 3UFAA 1WYKA 4Y8XA 3SV7A 1TGTA 2A7JA 2WINI 2VIDA 3DSGA 3IWMA 3M5OA 1KXEA 2ZU4A 4ZHMU 1AFQB 1DSUA 4KGAA 1TOCB 1LHCH 2GGVB 3NKKA 4JZDH 3BTQE 3ZV9A 1QR3E 1OX1A 1ABJH 3RXFA 2XYAA 2ULLA 1COWD 1NRNH 1OS8A 1GG6C 3LU9B 2ZCHP 3VB6A 2OP9A 1VKYA 5L6NH 4DGJA 3CP7A 3MWIU 5HGGA 3PTBA 3E0PB 1EAXA 1GWAA 1GI6A 3BTFE 1IHSH 4MPVA 1O2OA 1TAWA 4B75A 3A81A 4I33A 3N7OA 4I32A 1ABIH 5EU8A 3QZRA 1YPGH 4DIHH 1GJ9B 3FZZA 2Y5HA 3ZYDA 1O5BB 3PB1E 1XM1A 1HIAB 1O31A 1OYTH 3LC3A 2BLOA 2C8ZB 3LDXH 2OLGA 3NRLA 3UIRA 2OUAA 5L2YH 1FAKH 3DHKH 4FUDA 4AFZA 1G30B 1INCA 3KF2A 3F6UH 1QURH 1C5PA 3U69H 5T1VA 1MKXH 4XE4A 3LC5A 2OD3B 1KXBA 4MPWA 5DK1A 4CH8B 1QZ8A 1UTQA 3MO9A 4ABDA 1OHHD 4RI0A 1TNHA 1WDIA 1AN1E 1OP0A 2V3HH 1QJ7B 4UFDH 4E06H 2JH0D 1EPTC 1D9IA 3K9XB 1SC8U 2Y7ZA 1DS2E 4UFFH 2LP6A 1BRBE 5F8ZA 1F0UA 2BMGB 2JETB 3RMNH 3ZZ3A 2GZ7A 2Q6DA 4Q7ZA 1YPJH 3KQ5A 2H9HA 1BIOA 1CBWB 2O8TA 1EPTA 2Z6BD 2HLCA 4H6TA 2BX3A 1S0RA 1C2KA 1SMFE 1Y59T 1QL7A 2R3YA 2QYIA 3KN2A 4LXBH 1O3AA 2ZU2A 2FWWA 3LGVA 1EB1H 4Y10E 6CHAC 2FX4A 2W26A 5GNDA 1GBCA 4X6NA 1SR5C 2ZTXA 1P11E 4ZKRU 3U28C 4DY7B 1TBRH 5JBCS 2QE7D 3MU0A 3QUMP 4QT8C 5LGOA 1S0QA 1MD8A 1V2TT 3SJ8A 1LQEA 1JIRA 4E7RG 1V3XA 3VFEA 1BBRK 1SFQB 4O9VA 3RXQA 1IHTH 3BG4B 4THNH 1IOEA 1W0KD 1WOFA 1QQUA 1GBBA 1UCYH 4FVBA 1GVKB 1YPLH 1V2OT 1L2EA 2ZDLA 4ABEA 5A8ZA 1DSTA 2AS9A 4ZHAA 1EOJA 1O0DH 1UHBA 2QIQA 1BTPA 4UONA 2GV7A 2Z3EA 1ZGVA 3QWCH 5TCCA 2B0FA 1MTVA 4KTSA 2CMYA 1O2YA 2OQUA 4YXWD 1RIWC 2PKSC 1OOKB 2G55A 1GJCB 1H8ED 2Y81A 1P04A 2W6JD 2F9BH 1EAWA 1S6FA 3GY4A 3ZVFA 1GI9B 3S69A 1E34B 3O8RA 3UWJH 3MU5A 1J15A 2UUJB 4U01A 1V2KT 3MNBA 4Y0ZE 1S6LA 2GCTB 5JBBS 5DG6A 1SGEE 1C2IA 1C5WB 1BA8B 1PPGE 3MH5A 1NBME 1PPFE 5GPIB 3AK5A 2EI7A 2IPQX 1C1NA 2VGCC 2WPDD 3PRBA 4D7FA 1TOMH 1S81A 1K1PA 2B7DH 1O5DH 4AFSA 2P59A 3RMMH 3N7DA 3RXLA 1ZMNA 1H1BA 5HKKD 2Y5GA 1FQ3A 4XDEA 1H4WA 1KLIH 1GHAF 4OS7A 1TMTH 1HXFH 2FIRH 2V3MA 2NU3E 4R0IA 2DUCA 2VIQA 2AIQA 3VB4A 3L6PA 1SLWB 2ZEBA 1JIMA 3A8BA 1GJ8B 4I8KA 5HIYA 3P95A 7KMEH 3P17H 1WXRA 3M36A 3GISB 4JK6A 1SQTA 2D26C 3NZIA 2QF5A 1A7SA 1Y5BT 4LZ1H 2F9PA 1NESE 3SNBA 4OS5A 1TRNA 1O5EH 5JBAS 5A8YA 5HYOA 1AFEH 4ZXYH 3M3SA 1SOZA 2ZCKP 4YESB 2ODQA 2NU2E 5GWZA 2KAIA 1EPTB 1G9IE 4KTCA 1VR1H 2QA9E 3SV8A 3SU4A 4Z6AH 1OP8A 1A1RA 2ASUB 2A7HA 2VIOA 3U8OH 1O3NA 2ANKH 2XC0A 1BZXE 1O3CA 3RXAA 1EZUC 5B6LA 2P8OC 2B5TB 1E0FD 1RD3B 3ZYEA 1GHYH 3TK6A 3EA9A 1W0JD 2PW8H 3KCGH 3PO1B 1DOJA 1GBMA 1YLCA 3SUEA 1C2MA 1AZZA 2NU1E 3V13A 1CT0E 5C3NA 2O8LA 2KCAA 2HNTF 1ESAA 2PFEA 3DCLA 2ZTYA 1GMCG 3HK3B 3UB0A 1XX9A 7LPRA 2J5UA 1OWHA 4AGJA 3SNCA 4X2VA 1C1UH 3F9EA 2BDAA 4BAKB 5HXFA 4FU8A 3W1EA 2BXUH 1RGQA 2G81E 3T2NA 2R2WU 3RXSA 3F3BA 3KQBA 3U1IB 1QL9A 2QCYA 1C5RA 3I77A 1TNLA 1HAYB 3E3TA 1C4V2 3ZZAA 1C1VH 2WPMS 1GG6B 2ZTZA 1QTFA 1UMAH 8GCHF 1CO7E 1C2HA 1ZRKA 4Z1MD 1K21H 3PO1C 1HIAA 3SHAH 4UE7H 1O2PA 1CT4E 3HGPA 2VB0A 1ZLRA 4Y7BA 5FCKA 1C2DA 1M9UA 2FOFA 2HPPH 2W3KA 1P12E 1WAYB 4TY6A 2Z9IA 2J34A 4TPYA 5AFZH 2TIOA 6GCHF 2STAE 4D76A 5JYIA 1W10U 3A85A 2ZECA 1Y3YA 2ZFTA 4NZQA 1VGCC 1Z71A 4YT7H 1K1LA 4CRBA 3P6ZB 1OWKA 1S82A 1C5VA 4I8GA 3ATKA 3PROA 3M61U 5GJ4B 1P01A 4TWYA 4XBBA 4Z0KA 4NG9H 2W5EA 3EA7A 1BMAA 2BDIA 1MCTA 2LNCA 1ARCA 3O8CA 1W0YH 2CHAC 2C93B 1LVBA 3OYPA 3M7QA 2GZ8A 1ZHPA 3UNQA 4ISNA 2CHAB 5A8XA 5J4QA 4NFEA 6ESTA 1E36B 4E7NA 1BOQA 3TLOA 1GI2A 1QHRB 1O2NA 4AFQA 2PUQH 1Y5AT 3TH4H 3E6PH 4B76A 2R0LA 1VITG 1H8HD 1PQ7A 1O32A 1L1GA 1MTSA 4CBNA 5KECA 1GJ7B 3DFJA 1ELBA 1VGCB 1O3HA 4ZUHA 3GY7A 1MZDA 2A5IA 1V2VT 1GBAA 1YLDA 3NCLA 5IDKA 1ETRH 4F48B 3MMGA 2J92A 2GDEH 2YOLA 1CHGA 3RXKA 1DWEH 2FP7B 1Q3XA 3UUZA 1GHVH 2PLXA 1W8BH 1ORFA 1K1MA 1TPOA 1FI8A 1OWEA 1DXWA 3ZV8A 1GBLA 4HFPB 3GS9A 2FTMA 1ANDA 1PPZA 2DE9A 3ATWA 3GY5A 4I7YH 1F5KU 1SGFG 4E05H 1K28D 3HKIB 2J9NA 5FPTA 3UAIC 2ZCLP 5KEDA 7ESTE 3AW1A 4INLA 3CNRA 1TNGA 1B7XB 2CF9H 5BPEA 4Y6DA 1SGIB 2GTBA 1SGTA 4ACBA 4AYYB 4X2WA 5C67A 5DGJA 7GCHF 1HFDA 5ESTE 2RG3A 1QBVH 3BEFB 1IQEA 4FUHA 3FAOA 3WY8A 3FP7E 1MTNB 2P3UB 5E8EH 3OAAD 3ZVEA 1P2KA 5CHAC 1TFXA 3M37A 2JJ1D 3OEHD 4VGCC 2J38A 1FY1A 4X2XA 1NPMA 4FUFA 1THSH 4GAWA 3HATH 2PWXA 1G3CA 4AGKA 4BAQB 1A0LA 1BDAA 1PPEE 4H42U 1WTGH 4VGCB 1DLEA 1S83A 2ZZUH 1O2XA 4JZIA 3UREA 1QY6A 1MU8B 1BCUH 4DOQA 4X1RU 1O2QA 6CHAB 1YCPM 1DITH 1GDUA 1KTSB 1UCYK 1W7XH 1HDTH 1Z1JA 4JYVH 1SOTA 2ILNA 2AMQA 2Y7XA 1QRZA 2BD7A 4CRDA 2EC9H 1J9CH 3RXMA 2ZDAH 1SVPA 2A2QH 1A61H 2ZHDA 4Q80A 3GCHB 1NM6A 2OC7A 1O3KA 2R0KA 5JPMH 1DVAH 4UFGH 4YLUA 3RXVA 4IBLH 2K1QA 2Z9GA 3D23A 1EJAA 3ZZDA 2ZGXH 3FKSD 4SGAE 1BRAA 2A45B 1TPPA 4WXIA 2C8XB 3ZVAA 3LPRA 1KXDA 1O3LA 2OK5A 4JMYA 5F03A 1WV7H 3A7WA 2BDCA 2VIPA 4NA9H 2ZDNA 4AORA 1C1QA 2JJ2D 2PKAB 3FZDA 1FDPA 1D6WA 9ESTA 4ZCNA 1C4Y2 1NRQH 1SQAA 2J98B 3PWCA 5E0HA 1FN8A 3D49H 5HIZA 4CREA 4NWLA 1ZZZA 2J98A 3DUXH 1ANCA 1P2NA 1E79D 1P03A 1BBRE 1GJAB 2ZFQH 3ZZ6A 3LJJA 4NCYA 4YOGA 2GP9B 2FOGA 4WF8A 5TCAA 3KQEA 1FN6A 1LHGH 2XWAA 3SNAA 5K7RA 2F3CE 1P2MA 1O3DA 1VITF 4YOJA 3SW2B 2B8OH 3LIWA 1DUAA 2VJ1A 2KFWA 5EOKA 3SGBE 1ZYOA 2PTNA 4OGXA 1GBKA 4CRCA 2TGAA 5HM9A 1AE5A 3SNEA 4J2YB 1GJBB 1AB9B 3RP2A 2J97A 1O3FA 1JBUH 4XOJA 4ABIA 1ID5H 3TU7H 5DPAA 1E1RD 2ZDKA 1O2ZA 3BG8A 5TJXA 2R2MB 3MO3A 3TITA 4MNWA 1LKAA 2BVRH 2AHME 2WPJS 2GCTC 2VIWA 3BEUA 4FUGA 2PUXB 4YTAA 1TRMA 3UQOA 1WQVH 4GLYA 1C9PA 1O5FH 2ZWLH 4Q63A 1EJMA 1KLTA 4MNVA 4ZROA 2AERH 3E0NB 1GMCF 1LVMA 3MU1A 1MTNC 1NS3A 1TNIA 3SI4H 1O5GH 2BD5A 1L0ZA 2KCOA 3SGAE 3GY2A 2FOCA 1OWJA 2W7UA 1BRCE 1C5YB 3F0PA 1AI8H 1C1PA 2ZIQH 2XBYA 3P92A 4FUJA 4GHTA 3RXUA 1XMNB 1GHZA 4X6PA 1FMGA 4NIWA 2UWLA 2AMDA 1O2LA 2GMTC 3B9FH 3F0OA 1K1IA 1Z8JB 1FZZA 3BG4C 1O2HA 4Y71A 4AZ2B 5C17A 1Z7KA 1EAUA 1EQ9A 3VB7A 2AIPA 1GBDA 2ZNKH 2P3FH 4IN2A 1AB9C 4X6OA 1AVXA 4CRFA 1TA6A 2EY4C 3Q3KA 4RKOB 3DD2H 2OBQA 4HG6A 1ETTH 1E37B 1ARBA 3RXPA 3RU4T 5EJLA 1MMJN 4I8LA 3VB3A 1O2MA 1J14A 5DP3A 3LGWA 1Y3XA 4IW4E 1FPCH 1SB1H 1VZQH 4B1TA 5DO4H 3U8TH 3KYGA 1KXFA 4X8VH 2XXLA 1C5NH 3MO6A 3BIUH 4K3JA 2FOEA 4O3TA 3ODFA 1W13U 2D2DA 2FM2A 1BMMH 2BD3A 3LJOA 4HZHA 3MH4A 4LOYH 3BTKE 2TPIZ 4BTIB 1IQIA 1HPGA 3RXDA 4Q7YA 1JRTA 1UW7A 3QK1A 5FPSA 4OS1A 3UWIA 1B5GH 1GDNA 5FBIA 1NTPA 2UUKB 2DE8A 1O3GA 1A5HA 4JYUH 1TABE 4YLQH 2FOMB 2AYWA 8ESTE 4CR5A 1P3EA 2ZGCA 3SU2A 1C4U2 1C2GA 3V3MA 1G3DA 1QNJA 2NU4E 3PV4A 2Q6FA 4XFQA 2G51A 1ELFA 3GCTF 1MCVA 4K5ZA 4ISOA 2H5CA 1SKYE 4U2WA 4SGBE 4U32A 4GCHG 4B2BA 1KSNA 3EDXB 1O35A 3STJA 1WQSA 1YCPH 1HB0B 1AUJA 1EX3A 1K1NA 1XVOA 3JZ1B 5EW2H 5E0GA 1K2I1 1HYLA 2BLWA 1YWUA 2UWPA 2FS8A 2GJGA 4IC6A 4CHAC 2RCEA 4CH2B 9LPRA 4X8TH 1EB2A 1P57B 2BVXH 1F5LA 1CA8B 4ASHA 5C5OA 1F0TA 4K2YA 2SGFE 2VVCA 2ZPQA 5CHBA 8KME2 2A4OA 1MKWK 2H9TH 1JOUB 1A5IA 1HAVB 1ZTJA 2Y80A 3V0XA 3SJKA 4LZ4B 4BTTB 2CV3A 1GMDG 1GHAG 3HGNA 1HV7A 3DT0H 1BBRH 4AX9H 3E91A 3DFLA 2C8WB 1YPMH 3RM2H 1TX6A 4NA7A 2RA0A 1CHOF 3H09A 3AVZA 1O3EA 2D8WA 2FLBH 2ALVA 1TGSZ 1YBWA 1AFQC 1DPOA 1GJDB 4YO9A 1C9TA 2BD9A 3O8BA 4PROA 1T8MA 3P8NA 2BZAA 3SU0A 2YNAA 2SGPE 4P02A 2A4QA 1XUIA 1TMBH 1P10A 4FUCA 4XBCA 4ABAA 3OX7U 4B71A 3B8JA 1N1LA 2Z9LA 1SQOA 5EJ1A 2GZ9A 1GJ5H 1CA0C 4LK4A 4RT0A 1EATA 1HAIH 1C5LH 3P8FA 4UD9H 1KYNA 3BTTE 4OS2A 1BTYA 1TLDA 2FYRA 1HAVA 2C4FH 1N6YA 1BJVA 4B6EA 3M7TA 3DSPA 1DWBH 1BRUP 1IQGA 2G4UA 4IC5A 5CMXH 1K22H 1UTLM 3VG8A 3UR6A 2Z7FE 2A1DB 1UCYE 2VH6A 1FY3A 1ZHMA 1GHBG 5HM2A 1Z1IA 5H4IB 5PTPA 4BAOB 4F4OC 1BQYA 1IQMA 1BTHH 1GDQA 3S0NA 3ATMA 3GOVB 1TE0A 1SL3A 2WSSD 1THRH 4WMDA 3FP8E 1ZPCA 2F43B 1EXFA 2FESH 1PQAA 2KCPA 3ZIAD 2WPIS 2XNDD 2QXIA 3RXTA 1EZXC 3BTEE 1AO5A 2HVYB 3RDZA 1C1OA 1QJ6B 4RN6A 1QB6A 4XBDA 1TIOA 3VPKA 2F91A 1QBOA 3B23B 5AFYH 5KGOA 2H5DA 2GV6A 3FANA 4DVAU 2CXVA 1ZMLA 1G32B 3C27B 3PV2A 2BB4A 3S9CA 4CRGA 3UQVA 1DY8A 2FXRA 2FI3E 2SFAA 1AY6H 1DM4B 1GBHA 1RTLA 1KIGH 1ELVA 2FS9A 1E38B 1ZGIA 1Q2WA 2JKHA 1XUGA 2OC8A 5J4SA 2ZHQH 2RDLA 1EASA 3M3TA 5FL7D 1CGJE 1CU1A 1TGNA 2VWMA 2SGQE 1XXDA 4WY3A 3H7TA 5DP7A 1HAXB 2FDAA 3QTVH 1WTHD 3BF6H 3SJIA 5A0BA 3KQDA 1BUIA 1K9OE 1H9IE 3A7XA 4DURA 1LHEH 3L3TA 4B6FA 1ELAA 1LMWB 1P9SA 1P06A 1C1MA 1IQNA 1GVZA 2WPLS 2ZQ2A 3SORA 3PTNA 4A1XA 1D4PB 3G01A 1QB1A 2HRVA 3AW0A 3NWUA 4FXGH 2ZFPH 1P9UA 1MBMA 4O03A 3QX5H 1HAOH 3RC6A 1GBFA 4BXWA 2AMPA 3GYLB 3SHCH 1C2LA 1SBWA 5F6MA 5DP8A 1LPKB 2C8YB 2A31A 2RDEA 1C5UA 5ETXA 1VJ9U 2TGPZ 1MBQA 4IGDA 1O38A 1Z6JH 1YP9A 3PWBA 1V2PT 1O5AB 4ABJA 1V2LT 3EA8A 2ODPA 2PV9B 3VXFH 4R8TB 3R0FA 4KTUA 2ZU3A 1V2QT 1XUKA 1PFXC 3S9AA 1GJ6A 2PSXA 5DP4A 1T8OA 4M9FA 3EE7A 1A5GH 3LGYA 1HLTH 1W14U 1O2VA 2BDBA 1AUTC 1GI7B 2P93A 1LCYA 1GL1A 5ABWA 1P05A 2TGDA 1Y3UA 3EYDA 2XBWA 3HPTB 4B74A 1NZQH 4P00A 2ANWA 3Q00A 3WWFA 5EODA 2K8IA 3QN7A 3LT3A 3ZZBA 1O2GH 3P8GA 1T4VH 4AB9A 2ZC9H 2BM2A 4NSYA 3P70B 1O5CB 2ZI2H 3NUMA 1HJAC 2BDGA 3TNSA 3MNCA 1E35B 1GI5A 1YCPK 3ZZ5A 1BJUA 3QTOH 5IK2D 1LDTT 2AGGX 4Y76A 2HNTC 3LOXA 2HVXA 3R3GB 5SGAE 1F5RA 1LHDH 1UTMA 1ZHRA 1EKBB 1FX0B 2IJOB 1ZTLA 3A86A 2QF4A 1GI1A 3GCHC 2W7SA 1H8DH 1F2SE 1MUEB 1OYQA 2BVSH 1ZPZA 1LPZB 3BN9A 3OTJE 1CQQA 4H4FA 1MZAA 2IOTA 1SGDE 4RSPA 5A09A 1DFPA 5FHTA 3UOUA 4GHQA 1FAXA 4JK5A 5C0TA 2BQWB 2FO9A 1P2IA 3T28A 2K0QA 1D3QB 2QC2A 3BEIB 1GBTA 1ZSLA 5DSFA 3RXJA 2LPRA 1BHXF 2QGRA 2FTLE 1AQ7A 3PMHB 2BQ6B 3MH7A 4YOIA 5T6GA 1BTWA 3F2GA 3SJOA 1GGDC 2P16A 1F0SA 4AFUA 3UR9A 3NK8A 1LVYA 1Z8GA 2ZGHA 4WH6A 4IN1A 5ESBA 3SQEE 1WUNH 1AGJA 1UTPA 4AG1A 1O2WA 2BQ7B 4HGCA 1ANBA 3OSYA 4FUBA 4TSFD 3ODDA 4BOHA 3GY8A 1K0HA 2CN0H 1QA0A 1DDJA 1SLUB 2VGCB 1YKTA 3ATLA 1C1RA 1NU7B 3QZQA 4AYVB 3MFJA 4BANB 2L74A 4I8HA 1PYTC 2XOKD 4X1SU 5T6DA 3K6YA 1O2SA 1UVPA 3RMLH 4ZKOU 1FY8E 4Y8YA 4F49A 5EPYA 1GHXH 5K0HA 1A3EH 1PPBH 4RKJB 1T32A 1GMHF 2WHXA 3K6ZA 1LTOA 2XBVA 1LPGB 1JMOH 4WJG2 3VEQB 4ACAA 2G5NA 1BMLA 1MQ6A 2AEIH 4A1TA 3ZZ4A 1MTUA 3RXIA 2UUYA 2JH6D 2GX4A 1FLEE 1BTZA 4X1NU 3BTHE 4M7GA 1CGHA 3SQHE 2ZU5A 1L1NA 4B73A 3Q3XA 4NFFA 3RXEA 3QGJA 1E1QD 2A7CA 5C1YA 4OS4A 4FU7A 4IS5A 4GVUA 4KELA 3T26A 1C5XB 2V6NA 4JCNA 2I6SA 3RXBA 3WW7A 1NFUA 1TX7A 2XNIA 1SGQE 4UDWH 5EXLA 2FPZA 2QF0A 3TIUA 1J16A 1Y8TA 3OEED 2OXSA 4DCDA 2NWNA 3I29A 1MTWA 1PPHE 1QJ1B 4DIIH 1O2UA 3TGJE 1UTKA 2VWNA 1TA2A 4J1YA 3MU8A 2JDID 1MD7A 3BTDE 4X8UH 2J94A 1X7AC 1GMDF 2WUCA 2JETC 1FV9A 2IN2A 1MAYA 4OS6A 4NA8A 3IG6B 1ACBE 1YGCH 3MYWA 4DW2U 2YMSB 5C20A 2OC0A 3GCOA 4K60A 1OKXA 2BYAX 1BITA 3QDZB 4UFEH 2P3TB 4K1SA 2OQ5A 2YMSD 3SV2H 3D65E 4ISIH 1AU8A 2FMJA 3L33A 1WU1A 4WH8A 1O37A 1O34A 1V2MT 3SU5A 2G5VA 1YY3A 2P95A 4YT6H 3SYJA 2M5TA 2TBSA 5DP9A 1TNKA 3ZZ9A 4ISLA 1AKSA 4K69A 2H6MA 2O8MA
chains in the Genus database with same CATH topology
1C5MD 2ZHEH 1SLVB 3C1KA 1XUFA 1OPHB 1V2JT 1P3CA 1VCWA 2GCHG 1ANEA 1EAIA 3UNRA 3PMAB 1VJAU 2XTTB 3F9GA 2GDDA 2WUBA 5AHGH 3Q77A 8LPRA 4ZH8A 1TGCA 4GSOA 5E2PA 4NSVA 2Z9KA 2SNVA 3PLPA 1S85A 1GBJA 2VWLA 3FFGA 4ABHA 2WPKS 1DX5M 2HALA 4BXSA 1OSSA 1JRSA 1NU9A 2ZDVH 3OY5U 1BTUA 1QGFA 5A2MH 4B2AA 2BOKA 1IQJA 2BY7X 3U8RH 1UHBB 2THFB 1UK4A 3A84A 1FY5A 1IQLA 4JZ1A 3A82A 1ELTA 1H8IH 3P8OA 3E1XB 5AF9H 2HPQH 1RS0A 4FUEA 2I6QA 4GUXA 4Y0YE 1AE8H 4ABFA 1YPKH 3JZ2B 2Z9JA 1TQ0B 4MPXA 1WBGB 4AN7A 1BMNH 3RXCA 1YPEH 3RM0H 1C5QA 2Q1JA 4AOQA 1J8AA 2F83A 3RLWH 1NRRH 5AVDA 3F9HA 4O3UA 1ZJDA 1XKBC 1GHBF 2ZFSA 3SU1A 1ESBA 3W94A 3MNSA 1XXFA 4TYDA 2OBOA 4MPUA 5EG4A 1B0FA 4ZMAH 1EP6A 1TQ7B 4D7GA 1TMUH 3BSQA 2AH4X 1RJXB 2B9LA 3LKWA 1MKXK 1L4DA 1NN6A 2FOAA 2KAIB 1W0ZU 3SO3A 5B6OA 1KDQB 1UK3A 5E2OA 3VGCC 1SHYA 1HRTH 4JZFH 3URCA 1QBNA 4DG4A 3Q76A 3UTUH 3ZZ7A 3PLKA 3F68H 1NRPH 1HXEH 3T29A 1DY9A 2Z3CA 2VNTA 1H9HE 3GDVA 1B0EA 1LHFH 3VB5A 1HGTH 3DA9B 3U1JB 1O2KA 4I31A 1TYNA 2XCFA 1SGRE 1P2OA 2A0QB 3EQ0H 4A5TS 3FVFB 6GCHG 1FJSA 1NY22 1SHHB 5T6FA 2OCVB 3U9AH 2H1UA 3U98H 1TONA 3NXPA 4X2YA 2J95A 1C5OH 4ZKNU 1A4WH 2A5KA 3MOCA 3AASA 4KKDA 2GVFA 1WSSH 4WMEA 1P2JA 1FIZA 1SGCA 2JH5D 3TJUA 1V2RT 1SGNE 1YYY1 2BTCE 2QXHA 1Z8RA 3RC5A 2WPHS 1HAHH 3RXRA 2QXJA 5IYTA 1D3TB 2Q6GA 4B2CA 1PQ5A 1UO6A 1HCGA 3Q3YA 1UK2A 3KQCA 1G2LA 1ZSJA 3EE0B 3ZZ8A 1HAPH 1O3BA 1W7GH 2D1JA 2Y82A 1XUJA 5EPNA 1U6QA 1C1TA 2CGAA 2BXTH 2ZO3H 4Q2KA 3D62A 1TBQH 1GI4A 1T31A 2BLVA 1ZPBA 2SGDE 5C5NA 4NGAH 1O2JA 4KP0A 1TB6H 1TGBA 3A8DA 2SGAA 1A46H 3ITIA 1H9LB 3A83A 3MNXA 1KTTB 1V2ST 2V3OH 3FP6E 2C3SA 3A88A 3ZVDA 2HOBA 4NIXA 2FOHA 2QV1A 1AZ8A 3SU3A 2NU0E 2VVUA 1OP2A 1AKSB 1G36A 1NRSH 3CS7A 3IITA 1S5SA 3A7YA 2ZFFH 1C5TA 3RUOA 3TK9A 4WXVA 1CBWC 2P8OB 1ESTA 5JB9S 4FVDA 3UY9A 5GCHG 3TH2H 1THPB 1Z8IB 1XKAC 3SGQE 4MNXA 2ZPRA 1NFWA 1CVWH 5JBTA 3TGIE 3ZVGA 3TVJB 2FYQA 1CSOE 1MKWH 1Q31A 1ZRBA 3GYMA 4IMZA 4Q7XA 1OXGA 2PR3A 5EQQA 1G3BA 1GBEA 3TJVA 1HBTH 1GHWH 2ZPSA 5DKMA 3OY6U 5G4BA 1UTJA 2GT7A 1FONA 5GIBA 1FUJA 1C2JA 1QRXA 2F9OA 3SOSA 3BIVH 1S6HA 4ZKSU 2OTVA 4I8JA 2ZFRH 1P02A 2FLRH 4INHA 5BRRE 1C1WH 1HUTH 1JWTA 3RXOA 1KDQA 1YPHE 3EGKH 2ANMH 1O3OA 1GL0E 5CE1A 2UUFB 1ZJKA 1QIXB 4ISHH 1PPCE 3KHVA 1DICA 4WVPE 2ALPA 2Z3DA 1AMHA 1W12U 3TJNA 1O3MA 5LPRA 2FODA 1Y3WA 3BV9B 1C2EA 1T8NA 2VINA 1HJ8A 2ZDMA 1NC6A 2PGBB 1O2TA 1UTNA 1IQKA 2BY6X 2F9UA 5FAHA 3E90B 4BAMB 4AG2A 2HWLB 4Y7AA 4MVNA 3SZNA 1GMHG 5FCRA 3KEEA 3TH3H 1A0JA 2ODYB 8GCHG 1O3PB 3A7ZA 3SUDA 1D3DB 5LH8A 5I25A 1O33A 1K1OA 2ZHFH 4ABGA 1YM0A 3BTGE 5F8TA 1ZOMA 2QXGA 1NFYA 5CHAB 2WYGA 4NIVA 2VWOA 1DWCH 3T25A 4YM9A 1EP5A 1A2CH 1O36A 1VCQA 3SI3H 1LKBA 4X0WU 3KGPA 2P94A 3M7UA 4WMFA 3URDA 1P2QA 3K65B 4K1TA 4D9RA 1ZMJA 1T7CA 2ZHWH 2PSYA 1TX8A 4A1VA 1QQ4A 1UTOA 1YC0A 3S7HB 1V2NT 2YNBA 3EAJA 1TALA 5FXLA 3GY6A 4ABBA 3RC4A 2BX4A 1CE5A 3PLBA 3SUGA 1C5ZB 2VH0A 2ZGJA 4K8YA 3T5FH 2Y5FA 3F1SB 5C1UA 2G00A 4GCHF 5FX5A 1Y3VA 2EEKA 4Y79A 2BD2A 2FI5E 3ATIA 5EXNA 3S7KB 3V12A 1F0RA 1ELCA 4O97A 4MG3A 1LQDB 2EA3A 1FPHH 1YPHC 1DWDH 1NO9H 1C1SA 3ESTA 2A4GA 2G8TA 1MU6B 1SG8B 4X8SH 1Z6EA 1EUFA 1SSXA 2GD4B 4CBOA 3LH1A 1L4ZA 1G37A 2BD8A 4TPIZ 1P09A 1F92A 1V6DA 2FEQH 3UNSA 4ZHLU 4Y8ZA 3OU0A 2G52A 1ELEE 2RA3A 2SNWA 2XCNA 5A0AE 2ZKSA 3TJOA 1J17T 4DT7B 1C5SA 1ZTKA 5EW1H 5LPEA 1AVWA 2AFQB 4A7IB 4NIYA 3QO6A 3LONA 2VVVA 1TWXB 1AVGH 1RRKA 3RXHA 5FPYA 1SGYE 2XWBI 4MTBA 3SUFA 1WCZA 1O3IA 2FZZA 4X1QU 5JB8S 4A92A 2IPHA 1RTFB 1DUEA 4U30A 3ENSB 3NPSA 1RIWB 2PKSB 1C2FA 3TNTA 5GDSH 5DP5A 1T4UH 2F9VA 4AB8A 1SFIA 2A32A 2J4IA 4X1PU 1QCPA 3M5NA 5FX6A 1SLXB 4BTUB 4H6SB 3MHWU 1QA7A 2W3IA 2F9NA 1OWDA 2BDYA 3GCNA 3ZVCA 3PM3A 2R3UA 3S9BA 4CHAB 3H7OA 1UVUH 4FU9A 1XVMA 1DLKB 1SGPE 3HK6B 2QAAA 3UPEA 1ELDE 1LO6A 2G4TA 1KY9A 1GGDB 3O8DA 1PJPA 2CF8H 3M5MA 4FUIA 3M5LA 3M35A 3PYHA 5JDUB 2UWOA 2ZG0H 1AIXH 5EQRA 1HNEE 1EZQA 1FY4A 1Y5UT 3ZZCA 5L2ZH 4TWWA 1F7ZA 4OGYA 3ELAH 1UVOA 5GXPA 1SGFA 7GCHG 2BZ6H 1RFNA 4UEHH 1D6RA 1N8OB 1YF4A 4XSKU 1G3EA 3A8AA 1IQFA 1MQ5A 2ZQ1A 1PYTD 2EI6A 4CR9A 1W3CA 1O39A 2O8UA 3RU4D 2BY8X 4WWYA 1FNIA 2CJIA 1QB9A 2FOBA 1GPZA 3RMOH 3SV9A 2O9QA 4MQAA 2XC5A 5E0JA 1HAGE 1O2RA 3E8LA 2VU8E 1NFXA 5T3HA 5DJ7A 1DE7H 1EOLA 1SPJA 2QN5T 1BT7A 3BTWE 1KXAA 1A3BH 1GCDA 1W11U 3CS0A 1EZSC 3T27A 4NZLA 2ZGBH 2GKVE 1CT2E 5GCHF 4MDSA 1XUHA 1D3PB 2A5AA 3QLPH 3ZVBA 2ZP0H 2PKAA 3CENA 1PQ8A 3F9FA 5L30H 3LGUA 1JXPA 1G2MA 1N8OC 3KL6A 1TPAE 3KIDU 2BY5X 1O3JA 4INKA 4X6MA 1QL8A 3SNDA 1GI3A 3A8CA 3VXEH 4D9QA 3A80A 1CHOG 3I78A 4ESTE 2GCHF 3PMBB 3SU6A 2R9PA 2QF3A 5EGMA 2ESTE 2GMTB 2WYJA 1L1JA 1VITH 3UOPA 3HKJB 3RU4E 2PTCE 1P8VC 2HNTE 1GVLA 1DT2A 1N6XA 4BAHB 2PGQB 1BTXA 3A7TA 1KLJH 3H5CB 1IQHA 1KXCA 4ZAEA 4D8NA 3MH6A 2AGEX 1RXPA 2HGTH 2ZA5A 2V0BA 1DANH 3SBKA 3GDSA 2J2UA 3T62A 1GCTB 2VIVA 1UVTH 4DJZB 1GI0A 2BY9X 1FXYA 6LPRA 2TGTA 3LGTA 4JZEH 1UJ1A 3SJ9A 1GCTC 1S84A 1GJ4H 2BHGA 2EI8A 1QRWA 1AWFH 2FI4E 3QGNB 1SI5H 5C2ZA 1AWHB 5FBEA 4BNRA 2QY0B 2PHBA 1HJ9A 3E16B 1O2IA 2AGIX 1NT1A 3KNXA 1OWIA 5C1XA 1TRYA 1VCPA 1TNJA 1BB0B 2H9EH 3LH3A 3GDUA 1V2WT 1UVSH 3V7TA 5A0CA 3K2UA 4TY7A 3SN8A 2Z94A 5LPFA 1TBZH 3PMJA 4K1EA 2GT8A 2FX6A 4K8BA 4A6LA 1IAUA 1LVOA 3MU4A 4MLFB 2OC1A 4CRAA 2XW9A 1ZR0A 1AHTH 2STBE 1RTKA 1P0SH 2XBXA 2BOHB 2TRMA 3MI4A 4MNYA 2ZF0H 2WV5A 2C90B 4NWKA 1V2UT 3M3VA 4HI3A 1A0HB 1HAZB 1NROH 2SGEE 1GBIA 1AD8H 3SV6A 2ANYA 3RLYH 4ZXXH 2A4RA 3AAUA 2BLQA 1TPSA 4IMQA 5HMAA 1ZSKA 1FIWA 3AAVA 1GI8B 1ELGA 2O8WA 1BHXB 3GCTG 3GY3A 3TK5A 3A7VA 3LGIA 3GICB 1CA0B 2ZU1A 2H2ZA 1QFKH 1CGIE 2BD4A 3TGKE 1T8LA 5DP6A 3A87A 1DXPA 1EJNA 1MAXA 2A2XH 3BTME 2XRCA 5EXMA 3A89A 4JYTA 3STIA 1MH0A 4YZUA 3RXGA 3VGCB 1O30A 3W95A 1ETSH 2V35A 2Y6TA 5EQSA 5F8XA 1W2KH 1HJAB 3TPIZ 2BDHA 5I46H 3MTYA 4Y11E 2XC4A 2WV4A 1K1JA 2OINA 4HTCH 4GPGA 3UFAA 1WYKA 4Y8XA 3SV7A 1TGTA 2A7JA 2WINI 2VIDA 3IWMA 3M5OA 1KXEA 2ZU4A 4ZHMU 1AFQB 1DSUA 4KGAA 1TOCB 1LHCH 2GGVB 3NKKA 4JZDH 3BTQE 3ZV9A 1QR3E 1OX1A 1ABJH 3RXFA 2XYAA 2ULLA 1NRNH 1OS8A 1GG6C 3LU9B 2ZCHP 3VB6A 2OP9A 5L6NH 4DGJA 3CP7A 3MWIU 5HGGA 3PTBA 3E0PB 1EAXA 1GWAA 1GI6A 3BTFE 1IHSH 4MPVA 1O2OA 1TAWA 4B75A 3A81A 4I33A 3N7OA 4I32A 1ABIH 5EU8A 3QZRA 1YPGH 4DIHH 1GJ9B 3FZZA 2Y5HA 3ZYDA 1O5BB 3PB1E 1XM1A 1HIAB 1O31A 1OYTH 3LC3A 2BLOA 2C8ZB 3LDXH 2OLGA 3UIRA 2OUAA 5L2YH 1FAKH 3DHKH 4FUDA 4AFZA 1G30B 1INCA 3KF2A 3F6UH 1QURH 1C5PA 3U69H 1MKXH 4XE4A 3LC5A 2OD3B 1KXBA 4MPWA 5DK1A 4CH8B 1UTQA 3MO9A 4ABDA 1TNHA 1AN1E 1OP0A 2V3HH 1QJ7B 4UFDH 4E06H 2JH0D 1EPTC 1D9IA 3K9XB 1SC8U 2Y7ZA 1DS2E 4UFFH 1BRBE 5F8ZA 1F0UA 2BMGB 2JETB 3RMNH 3ZZ3A 2GZ7A 2Q6DA 4Q7ZA 1YPJH 2H9HA 1BIOA 1CBWB 2O8TA 1EPTA 2Z6BD 2HLCA 4H6TA 2BX3A 1S0RA 1C2KA 1SMFE 1Y59T 1QL7A 2R3YA 2QYIA 3KN2A 4LXBH 1O3AA 2ZU2A 2FWWA 3LGVA 1EB1H 4Y10E 6CHAC 2FX4A 2W26A 1GBCA 4X6NA 1SR5C 2ZTXA 1P11E 4ZKRU 4DY7B 1TBRH 5JBCS 3MU0A 3QUMP 4QT8C 5LGOA 1S0QA 1MD8A 1V2TT 3SJ8A 1LQEA 1JIRA 4E7RG 1V3XA 3VFEA 1BBRK 1SFQB 4O9VA 3RXQA 1IHTH 3BG4B 4THNH 1IOEA 1WOFA 1QQUA 1GBBA 1UCYH 4FVBA 1GVKB 1YPLH 1V2OT 1L2EA 2ZDLA 4ABEA 5A8ZA 1DSTA 2AS9A 4ZHAA 1EOJA 1O0DH 1UHBA 2QIQA 1BTPA 4UONA 2GV7A 2Z3EA 1ZGVA 3QWCH 5TCCA 2B0FA 1MTVA 4KTSA 2CMYA 1O2YA 2OQUA 1RIWC 2PKSC 1OOKB 2G55A 1GJCB 2Y81A 1P04A 2F9BH 1EAWA 1S6FA 3GY4A 3ZVFA 1GI9B 3S69A 1E34B 3O8RA 3UWJH 3MU5A 1J15A 2UUJB 4U01A 1V2KT 3MNBA 4Y0ZE 2GCTB 5JBBS 5DG6A 1SGEE 1C2IA 1C5WB 1BA8B 1PPGE 3MH5A 1PPFE 5GPIB 2EI7A 1C1NA 2VGCC 4D7FA 1TOMH 1S81A 1K1PA 2B7DH 1O5DH 4AFSA 2P59A 3RMMH 3RXLA 1ZMNA 1H1BA 2Y5GA 1FQ3A 4XDEA 1H4WA 1KLIH 1GHAF 4OS7A 1TMTH 1HXFH 2FIRH 2NU3E 4R0IA 2DUCA 2VIQA 2AIQA 3VB4A 3L6PA 1SLWB 2ZEBA 1JIMA 3A8BA 1GJ8B 4I8KA 3P95A 7KMEH 3P17H 3M36A 3GISB 4JK6A 1SQTA 2D26C 3NZIA 1A7SA 1Y5BT 4LZ1H 2F9PA 1NESE 3SNBA 4OS5A 1TRNA 1O5EH 5JBAS 5A8YA 5HYOA 1AFEH 4ZXYH 3M3SA 1SOZA 2ZCKP 4YESB 2ODQA 2NU2E 5GWZA 2KAIA 1EPTB 1G9IE 4KTCA 1VR1H 2QA9E 3SV8A 3SU4A 4Z6AH 1OP8A 1A1RA 2ASUB 2A7HA 2VIOA 3U8OH 1O3NA 2ANKH 2XC0A 1BZXE 1O3CA 3RXAA 1EZUC 2P8OC