1HILA

Structural evidence for induced fit as a mechanism for antigen-antibody recognition
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
b'DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
molecule tags Immunoglobulin
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilA01
1I7TA 3LKSA 3DGGA 4LLUB 4FFZL 3TEUA 4G8GE 3PWLA 2CMRH 5IFAL 1FVDB 2HJFB 5C9JA 1HSBA 1DBKL 4A6YH 1MCLA 2CUIA 4GRWH 1HILB 4NKDB 3CDFA 5J1TC 4G3YL 5BZDA 3K74B 2C4FT 4NO0A 4GUPB 3RVTC 1LE9B 1ZHBA 5ERWA 1A4JB 1CICB 4OBRA 1A5FL 2VXUL 3V5KA 5T5FH 2EC9T 4MNQE 3KR3H 1ITCA 4MXVE 2VDOH 5D7LE 5HXMA 1KG0A 4MCYB 2A9NL 5L6YH 5DMKB 4NZRL 4LSDA 2Z92B 2JIXD 4HIJA 2HVKB 3K3QA 4XBGA 5JHDD 3LEYH 1NGYB 3KPSB 3B83A 4GXVH 4ETQA 3NIFE 4KUZL 5FM8A 2VL5B 3F65A 2AERT 4YWGH 5E1AA 1NBVH 2HJKB 3A67L 4F7CB 4Q0XH 3IU3A 4I9WD 2ZOKB 2ILLA 4XMPH 3MV01 3QUXA 3REVA 3PWPE 2J3SA 5IVZA 5T5FL 5KZCB 4XGZB 4LSVL 1J8HB 4GRWF 1WQVT 3QXVA 1NUNB 1IAII 1AHWC 2DMCA 4D3CL 1ZA3A 4JFQA 5ESVB 3B2VH 4Z18A 3WNLA 1ZLSL 2VDNH 1OAQL 3UTOA 4J23A 4L4VA 3WUWB 3LS5H 2EIEA 2HMIC 1J05B 4NWUL 4QEGA 3MSPA 5LAXB 1FJ1A 4I3RH 4YR6A 3EYVB 4ZODA 1ERNA 3QULA 4LL9A 4F57L 5HVHB 3QIBA 3BD4A 3NIDF 1HXMA 3OXSB 2ARJQ 1UM5L 1ULVA 3X12B 2PTUA 3E6HB 4K8RD 4LDEB 5E8OB 2ZZUT 1MHCB 4PJXB 4LVHC 4BFIA 4QLRA 1MFBH 2WBKA 2EDJA 2AJVH 1ZKAA 3MYJA 1XH3A 2KDGA 4MSWA 4N0UE 3TCLB 3VGBA 3HN3A 3WN5B 3KPMA 4PPTA 2Q3ZA 2YKLH 3ZTNL 1ORSA 4Y5YC 4ENED 4MNQB 5MENE 1GGBL 4JQIL 1D9KA 1K8IA 4O2CB 5I15H 2B0SH 2WIIB 3BWUC 1LWRA 4XCYA 4LNVA 1D5BB 4KMQA 1T3FA 4P3WA 3S35L 3MRBB 2OI9C 2ZJSL 4OCNC 4TULL 4WO4B 5AAWA 5JNYB 3DTXB 5HHOE 1AFVH 2ZUQC 1FVDA 4UBDD 4UV7H 4WV1C 4HXAH 2GITA 1DDHB 2X1XR 5ACZA 3WEXA 4CGTA 1IM3B 4X8XA 4UIKH 1FNEB 4WTZG 5F9OL 5AD0A 4H1LG 5GISH 1U8OA 1ODAA 5ANMB 1CD0A 1IEAB 1T4KA 4XP1H 1L7IH 3IDNB 1J8HA 5BZWA 3INUH 4H1LB 3I50H 2VXQL 5JR1L 4LIQE 1G7HB 4F2MA 4I18B 2XWJB 2F5AH 3BVNB 1WFOA 4OI9A 3TNNB 2E27H 1IC1A 4BH8A 3OHXA 2Q76A 3PQYD 1B4JL 4PJBE 3MLVH 4WCYH 3TBVA 1XIWB 4ZAKA 3U9PL 1JZ4A 3S5LA 3SDCB 1MHCA 2PYEE 4KQ4L 2YPVL 3DRQA 4XVJL 4GW5A 1RSFA 3E6HA 5CZVL 1OF2B 1JI2A 1I3RB 4A2LA 5CBAB 4UIKL 1QPXA 4FG6D 1PSKH 5F7DB 1MQKL 2AS5M 5DT1H 3V6BR 3EYQC 3U48A 1F4YH 3WHXA 2GJ6A 3IETB 3HPJA 1CU4L 2HYMA 2V5MA 2CGRH 1PG7H 1JGLH 4O2CA 4X5WB 1JHTA 2FWOB 3OKDB 4MNQA 3O9WC 5HHXL 1AXTL 3O2VL 3BP6B 4K3DL 1CFSA 4NQTA 1FIGH 3V6FA 2ERJB 1MAML 1NAMB 4ISVA 4DKFH 3F8UB 1NH6A 4UBDC 4P48A 1B88A 1MFAL 3SDYL 4J4PC 3SE4A 2NTSP 3MMEA 1EHNA 2DLFH 3ZKND 4ERSL 5CGTA 4P5TD 1MH5A 3UTSE 2YZ8A 2PXYB 4OQ1A 3SGEI 1GC1H 4LCYA 2DQCH 2HTKC 3FCTA 3M45A 1UA6H 3DX9B 3KYNB 1I4FB 3ARUA 4Q58C 4WTXA 3V7AE 5FA4B 4JKMA 5C7XH 3H8NA 5FYKL 2ADJB 5GHWH 5SWZE 1V05A 3HB3D 1XF2A 4XPTH 1K4CA 4KHXL 2AK4A 1U8NB 4L8BB 5CJQH 4ZPVB 4FFYH 1MLCA 3KXFD 3FQXB 1T5WA 2XQYK 1JPSL 4MNGB 3UZQA 3GSVB 2WLZA 5IESL 2YRPA 3MXWH 1YEFL 3C2SA 3VWKC 2VDKH 1LEIA 5IB5B 1ZSDB 4E41B 4ZFOL 3RVXC 1RVFL 4Q6IB 1DQLL 2XTJE 5BRZE 1J7VR 3UPRA 5KSBB 3MRBA 5EB9A 1S7UA 1HCVA 3A6BH 5E1AB 1DVFD 4F9PA 5E2TH 3WIIL 3SKMA 4LQ1A 4UT7L 5F3HB 3SDXE 1MQKH 4F58H 1RK1B 4KQ3H 5K9KB 2R1WA 3BZ4B 3LIZH 4C56B 2XQBH 2HH0H 5HGBA 1FN4A 4FRWA 4R4FH 4MD4B 2NMSA 4JFZH 4KKBD 1MLBB 4RIRA 5CZVH 1MCNA 4PB9H 3REWA 2FD6H 3QAZB 1HHGB 4MA1C 4LU5H 2EKSA 1RUQL 3ULUL 1BM3L 4OF3A 4BSJA 3QEHB 4NT6A 3D25B 1GL4B 3MLRH 1A7BA 4RAUA 4QRRE 3TT3H 3GMOB 4KUCD 4HULB 1X5GA 3QCUH 2DICA 4I48B 2AEQL 2MOVA 4GT7A 4OFKA 4HW6A 1MCKA 3V9FA 3MQIA 5C0BE 4JFFA 1AP2B 4NO2A 4XWGH 3MLUH 4JCLA 3ARQA 5FYKU 4CU7A 4NUGH 1NFIA 1TJGL 5JOPD 3H3KA 4FXKB 4Z76B 4EBQH 4M61A 3MA7A 5DRWB 4PP2A 4JDZA 3WXWH 2MSPA 5KSAC 1NUGA 4WW2A 1Q72L 1A0QL 5ENWA 1EJ6A 1YEJH 3KPQA 3GK8L 1MLCB 3P9LB 3CSBA 3EYFB 2AK4B 4WFHE 4GKSB 3GSRB 1NGQL 4Y7MA 3C5JB 3CIQA 1W0WB 3T0VA 3HC4L 1G7IB 5D5MA 3V5HB 2BNRB 5GS1B 3C87A 3IFLH 4PGEB 4I2XB 1MH5B 5CGMA 3T0BA 5AD0B 2AEPL 4D9QD 3S88H 3DMMC 3VA2C 2FJHA 3RI5K 5L7XL 4LU5L 4JFED 3OJVC 2BFVH 1R3LA 2OSLA 4D94A 1IAOA 1LGVA 5I1LB 4X9GA 4MDJA 7CGTA 1IC7L 2ATKA 2FWOA 3VCLB 3LEYL 4AENB 2OJEB 5C0IA 1ZHNA 2XI9A 5BXFA 4MDJB 1F5WA 1PQZA 3BT2H 3BYYA 5IMLB 1IZKA 1VADB 1O7SA 4Y16B 1QLFB 2HJLA 3HZYB 1PZ5B 4KRMB 3C8DA 4DK6A 2G2RB 4WUUA 5JA8B 3T4AA 3RAJL 3BFOA 1XGYL 5ALCH 3MODL 4HUXB 3SDAC 3VG0L 3NCMA 3HS0B 5TDPB 1Y6NR 4FXGB 5C0RL 2W38A 3BH9A 5JXAL 4XI5D 1NANH 1RUAL 3NA9H 2WZPD 3KXFA 1ZLSH 3QDGD 1M4KA 3BQUA 3FB8A 3BW9A 4EI5A 3NIFF 3QIWD 4PTTB 2DWEA 3JVGA 4LLMB 3KXFB 2NQCA 2YRLA 4HH9B 1CN4A 2PXYC 2Q7NA 2VDOL 4F57H 1NAKH 3PHSA 3GK8H 4DKEL 3QNZA 4Z7OE 1PBYA 4I4WA 2HFFB 2NW3B 4MB3A 2V2TB 4PBVC 1L9NA 1B90A 2D7OA 2ERJC 3VFMA 3HI1B 3KJ4C 1I3UA 3VFWB 1TVDA 3MCG1 2X1WL 3O6LL 3U9UB 1MWAL 5DEFA 5HHNA 4WENB 1KPVA 5TE6L 1MUJA 1CFVL 4GRWB 1FNAA 1BEYL 2D2OA 2R4SH 3QCTL 5DRXB 3O3BB 4DTGL 1FORH 1FZOB 2JJUA 5ALBL 1J0ZA 4MA8H 5HD8C 1JYNA 1ZT1A 2VMFA 1QFWI 5CWSA 5DURD 3IFPB 3LMJH 3BZFA 3QWRA 1J11A 4DEPB 2AV1B 5BW7C 5B39B 1TVHA 4AIXA 5LQBH 4LSUH 4NHCL 3B9KD 2GTWA 3JXAA 1NSNL 5K9QI 3STLB 2YS4A 1ZLVK 5E8PB 1YQ2A 4KMLB 1SY6L 3IJSA 4PG2C 5E8OA 5GRUH 3CDGB 4CNIA 3X11B 1KPUA 3OGCA 2QADD 4P5TB 5FYKD 5ABDE 5CSBA 1SY6A 5JPNB 1R3HA 5IV2A 1AY1L 2NY4D 3BKJH 5DJYA 1AKJA 5I17A 1LEIB 3ARDC 3UX9B 5BJTB 4N0FB 5H2BB 4W6WB 1F4WH 1PLGL 3QDAA 2EDHA 4F7PB 3MRDA 4XMKH 3F7QA 3VFGH 1G6RL 4PP1C 1KIQB 2AXGB 1CD8A 1NPUA 4HC1H 1N7MH 5JHLH 3GKWH 1S9WB 4M8QA 3RKDD 3GBML 2F58L 2VLLA 4PJCE 5C0BA 1AQDA 1T21A 1CGXA 5IB3B 4HPOH 3H42L 1BQUA 3HMXL 1UH3A 4PJDF 5F9WB 5J3HC 1UXSB 1OY3B 5ESQA 1OD9A 3C09C 3NFPA 3P4NA 4MQXC 1WBYB 4KI1A 4OT1H 3IFOA 1RHHB 1B0WA 3MLTA 1Q9LB 1CFQA 4NT6B 3NABL 1EFXA 3E2HB 3J8F7 4G6AD 4DTGH 4LCCA 4UTAH 3L5WA 3KWWA 5IBTH 3TA3B 4NQDA 1BQLL 5A1AA 5D7JA 3AB0B 3JZ7A 4LP5A 4P59L 1FH5L 4PJ8A 3MZTA 3L7EB 5K93A 2VJXA 3QQ3B 1AHWA 4TQEH 3KPLA 2J12B 4PRAB 2ZUXA 3P4MB 4WJ5A 1OGAE 5FCSH 4B0MM 4F15B 1J1XL 3OBAA 1MFEL 3PWVA 2GQHA 2MPAL 2EH8H 3FOMB 3DUHA 2EO9A 4OSUH 1QSVA 4NO5A 4X5XA 5FUCE 5CP7A 3G9AB 3EJZC 1RHFA 1CXKA 1TZIB 1RFDH 4OCXH 2ZPKL 4L8SC 2H32H 3V0VA 4WFED 2IQAB 1S7RB 3QDMD 1IVLA 2MJWA 1KFAL 3D85D 1Y0LA 4Y89A 4CMMA 5DZNA 1EEYA 4HC1A 1FVEA 3O9WB 3QDMB 2F19L 3VFTB 1MEXL 1HKLH 3MBEB 4MGXA 3WDHA 3ULVH 1EO7A 1VA9A 1AGEA 1H0DB 2DJ4A 4OM1H 1ACYH 5C0GB 1T83C 4LSQL 4TUKH 4WW2F 3L3DA 4Y5VC 5IFJB 3ARGA 4LLQB 5GGQL 4PJCA 3H42H 1ORQB 4FZEH 2NZ9C 1IM3A 5E8EA 5D93B 4G7YL 4Y88A 1GOGA 4XNXL 5GXBB 3FMGH 2JCCE 4HF5L 1CF8H 2NXZD 5D6CB 5HYQB 1OSPL 5JHDA 2W65A 4NQXB 3O6KL 4JR9L 1GC1L 4YHYC 1VFMA 1DSFL 4MAYD 4ZS7L 3S36L 4JG0L 4NRXA 4YWGL 2BSSB 4CVWA 2WK2A 3KPLB 3MTRA 2W9DH 1OAZL 5I1JH 4NSKA 5LGHL 1BFVH 5HVWA 5GGTL 4L4TD 3TGXA 2F8OA 4AEFA 1R3JB 1S3KH 3DGCR 3GI9L 3C9NB 2Z93B 1XH3B 1NLBL 1BD2A 3AY4A 1EHLH 5C0AA 3U1SH 4NGHL 4FG6C 4YAQB 1DVFA 1AGFA 1OSPH 4ODWB 2R23B 1A8JH 4Y8AA 5I75C 1BVLA 3NCYP 1YEJL 1OSZB 3QG6B 2A6DA 2X1QA 4PJXE 2NX5B 3WXVL 1IKNA 3U36B 4L4VD 1FJ1B 2DYPD 2Z4QA 5J11C 4YIQB 1UWXH 5D9SA 3VD4A 2OZ4L 1MCSA 1CFTA 1FYTB 4BH7A 4BUGA 3WJJC 1R5VB 4PGBB 3L3GA 4OFYA 4B41A 5TQ2L 4LLAA 4RFNB 5F6HJ 4QY8B 25C8H 1KPVB 4FQJH 5EBLB 1EJOH 5I2IB 2YA2A 3VFNB 35C8L 3E3QE 3V6ZB 4HF5H 3UTTE 4EOWH 4OLVH 4Y1AB 5INDB 3DYMA 4OD1H 2PO6D 1JN6B 1CTOA 5EO1A 3FN9A 3QBTB 4HKJA 4XNXH 1I8MA 2IGFH 3HC3L 4XBGB 3CAFA 4ODHH 2H2PC 2DQHH 4MAYC 4PRDB 1KNOB 1JCKA 4ONHA 3LDBC 4AEIL 4OLUH 4FABL 2VWEE 4LSSH 2QV2A 1HEZB 1NAMH 2HT2D 3VD9A 1S9XA 4RISL 1KXVC 3VMOA 5KSAA 1TVBA 1JVKA 4PRHA 5EZLA 2JB6B 3MNZA 5DQ9B 5E95B 2BMKB 5HYSA 1BFVL 4YDVA 5IB4A 4U6XB 2A9MH 4K8RL 2F74B 3FJTA 3NBNA 4C56A 1RIUH 3DVIA 1Y18B 3NAAH 4QF1A 3IFLL 4YIQA 3ARDB 2A73B 4I13B 3TN0C 1IARB 4N68A 5HGHA 5ICYA 5GGSA 3VXMB 4BQCA 3BH8A 2NPLX 1HHIB 1XR8A 3GBNL 5CKAA 1A6UL 1IAMA 1LK2B 3ZKMD 5C0IB 1AE6L 4MCZA 3ROOA 3PQYA 4AENA 4NZTL 1P7KB 3P30L 5IHUL 3EOBB 3HE6C 3AS0A 2W1NA 3DRTA 3OKNB 1UZ8A 3TYGH 5KG9A 4JPIA 2NY7L 1K4CB 1ND0A 3H3PH 5FO7A 1A9BA 3MRHB 3K8MA 4TTDC 1T22A 2FECI 3FAXA 2ATPB 5D2LE 5F9WC 2W91A 1EO8H 3MC0A 3ZDYF 2AI0L 3PL6B 3BDYH 3DVNB 5J89A 1S7QB 1X4XA 5HHXH 1I8MB 4BQ9A 4L3ED 4OD1L 3UTZA 1E27B 2IALB 3HNVH 3HAEB 5EO1B 5C08E 5CBEA 5H35A 4DUVA 1I9JH 1FGVH 4X8JB 1QSZA 4QHLB 3BP5A 4P2OD 2V7NA 4L9LC 5CEZL 3O8XA 3MLXL 2ZP0T 4OUOA 1HINL 1QRKA 5IMMB 1UB5B 5C09E 4KZEL 5FHBH 3IKCB 5JW5A 2R2EA 4NO3A 4FQXB 3N85L 2KUTA 4LSSL 3CH1B 4CDGC 5IBUB 4JO2L 4JY5L 1K3IA 3QEQA 3L3GB 3C08L 4Y4KB 1JGEA 3I2CL 1ORQA 4P99A 5DUBA 4MLIA 5HJ3B 1CXEA 1WAAA 1BOYA 1JGVH 4JFXB 3J7HA 2XZCH 1IM9D 2BXZA 1NAML 1PD6A 3WIHL 3N1FC 3FO0H 2GUOA 1AR1D 1TQCC 5DMIL 1D9KC 5K33A 2SEBB 1Q0YH 1FG2B 5IW6B 4QOKA 1V3KA 3CFBA 3SCMD 3NIGE 3FQNB 3VGEA 1MRFH 4M7KH 3OXRB 4HC1L 1YNLH 3FRPG 3KS0J 4IRZH 2D7NA 5ETUA 3GGWA 4R4FL 1F3JB 3QA3A 4DQOL 3W0WA 4G42A 4EDXA 2W9DL 5HDOA 1F4HA 3ARBA 4X7SL 2QHLA 5CP7B 3S36X 1S8DA 4YH6A 5EU3A 2BVUA 4KVNH 5TDOA 4MD4A 4Y4KC 1ZV5A 2CUMA 5C0BD 4DAGL 5C0ND 3QIBC 5AWNH 3VFOA 1EHLL 5CSGA 2A6JB 5I1EL 2VDRL 1VEPA 5HHOA 4KTYA 2VLRD 4OLWL 5CFHA 4LEXH 4U1SA 1UQSB 2B4CC 5IIEB 1K5NA 3MROB 4WEMB 4LP4A 5FO8A 4E0RA 1YMHA 4WGVB 2Q3AA 4JLRA 3DMMB 4Y5XC 1MVUB 1OGTB 4IRZL 3DBXB 3HNSH 2R29L 1KCSL 2DQIH 4XNQB 4X0KB 3ARFD 1EV2E 1KENL 3QIUC 1BECA 3DBXA 4KRNA 4UV4L 4OLEA 5DK2B 3OSKA 5C8JA 4U6HA 5JW4Q 4N9OB 5SWSE 5HI5C 4TRPL 1I4FA 4YHLL 2BHZA 4GAYB 3IT8D 3RHWF 3BEWA 4XPHL 5L8LB 3MLZH 2FIKB 4FQLL 4LCYB 4UINL 4F80A 1EHXA 1X44A 2VZTA 5HYJD 4WTZA 3WIHH 4XNMB 2XZQH 3G6DH 4U1HA 3JV6A 5GS2D 4TOYL 4HQQL 1NGWA 3UBXI 2CLZA 1FRGH 1KTLA 2Y6SD 3SO5A 4IRJC 4JFDA 1QBMH 3U4BH 2GW5A 4HGKC 3CMGA 4U1IB 3QUYB 4HIEA 1ETZA 4K3HA 1FSKB 4NYLA 4DOHE 1DE4A 3A67H 4UTAL 3QRFM 4UQ3A 4PJDB 1EMTL 4U49A 3LN9A 1T04B 2EDNA 4FMKA 2VXTL 1RV6X 4TUOA 5D7IA 5EO9B 3RKDC 5J9PA 1QUNA 1H9VA 1LHZA 4M3JA 3FQWB 3STLA 3FOLB 3WFDL 1Z3GH 2HT3C 4M5YH 4MXWH 1I7RA 1P4IH 1T1ZA 2NY6C 1RMFL 4NNPH 4XI5C 2B0SL 1ZVSA 4LRNH 2EH8L 3T4YA 5CLWA 4XCCH 1SJHB 2VISB 3WSQH 1IL1B 1XGRA 4U1LB 1SVZA 2YUWA 1C1EH 1M6OB 5GGVY 3AM8A 2DM3A 5E5MB 4PGZA 3UTSD 2DM7A 3VDBA 3OAZK 3S34H 4OZHB 5EO0B 5BMFL 3O3AA 3CH1A 4BUHA 5F9OH 1H3VA 1FBIH 5EORL 3BAEL 3P2TA 4WI3A 1AO7A 3QIUD 4ODXB 3N1MC 2BVPB 4HGWB 4Z7NF 2N4IA 3EFDL 5EU4B 3MFFB 3RY6C 3TNMB 2NY1D 1CVRA 3H6JA 2OMBA 5D70L 3V8OA 2AQ2A 3EGSB 3FZUD 1YPZB 4HK3J 1MHPL 4M48H 4GUPA 2VXSH 4OV5B 3HAEA 3RWDA 1ETZB 4HJGB 2LU7A 3VH8B 1F97A 4JFDD 1ZOXA 5BCAA 2P45B 3ET9F 2APTA 3RA7H 5E00B 3F6LA 4GW5B 4X7FC 1R5WA 5F1KC 1AC0A 1MY7A 3WS6C 4PJ7A 5T3ZD 5GRWA 4PLJC 2WP3T 3CVIL 3DI2B 4JPKH 1J12A 3WIFB 4HG4J 4LQFL 1ZEAH 4MX7B 4WO4D 4Y4HD 5EDXA 35C8H 3VXOB 4M6NH 4Q9CA 2OTPA 1U8IB 1P7QB 2W60B 3U0TA 1IKFL 5EFIA 3I84A 2VXTH 4OLVL 5F7MC 4GW4A 4LCUA 4OGXL 3V52H 2MHAA 3RL2B 1U8JB 4I5BA 2Z31D 3IXAB 2R2CA 4YDVB 2OJEA 5FCUH 5FM5M 1I3GL 5LQBL 4PV8A 1UQSA 5ITBH 1SJXA 3JTTA 3BQUC 3DGGB 1UJ3B 3L3KB 4YNYB 5ID0B 4S10A 3VFVB 5DHVH 3CPLA 1H5BB 5EBMB 4EJ1C 3BGFB 4ODBD 2XPGA 3GSOA 2H6PA 3RNKB 2BNQA 2XWTB 5DF0A 3HLAB 3P11L 3FT2A 3TVMA 1PSKL 5DJ6A 1F3JA 3V52L 4LSVH 1MCHA 3A6OA 1YQVH 2IBZX 2X7LA 2YPLE 3RGVC 2YRZA 4K3DH 2WBJC 2PETA 2IEPA 4L8DB 4X6EA 2PR4L 3K4ZA 3GKWL 5SX5H 2APXA 3V4UH 2V2XB 1RVFH 4LPWA 5DRNA 3NIGF 3SDYH 1S7VA 5ENWB 1R5IB 2I07B 3F7RA 1YZZA 1S5IL 4HIJB 1XGQB 5JPMB 1P7QD 1R24A 2NY7H 2X4PA 4NZRH 5IMOA 2GSGB 4LCIH 4Y4HB 2FR4A 4QXGH 4D9RE 3G5YB 1CDCA 1PVHA 2CR6A 1MRDH 1ACZA 4ZXBD 5FYKH 3N06B 3B3IA 1LO3L 4PD4K 4PRBB 5C6PB 3MV7D 1BJ1H 4K94H 2BMKA 2CIKB 3L95B 3NACL 1UA6L 1SM3L 4XZUB 1JYVA 5CAYB 4P23D 1W0VB 2RCSH 4O9HL 1UZ6F 3WS6A 1N6VA 1G9NH 2YUVA 2I5YL 2X10A 5KVDL 2AJSL 1IGYB 5DD1H 4NOFA 5DUPH 4ZUUB 4KROC 3O8XD 5EPMB 4HFWA 2ITDA 1ZTXL 2CKBB 3NAAL 4TNWF 3ILPA 1MVFA 1S9KC 4YUEH 4R7NB 3AS3A 3S35H 1DQML 2H3NB 3ES6A 3KPSA 4DCQB 2P8LA 4FTVB 1LEKB 3V5HA 3GSQB 3WNMA 3QQ4B 3MNWA 4PRIB 2VQ1A 3G9VA 4DEPC 4DGVL 2ATPA 1G6RB 2EO1A 4QRUA 2MCPL 4G6KL 1WIUA 2BCKA 3RZCA 3UPRB 1MI5E 1QSFB 4NKMA 4XP4L 5AUMA 5I1DA 5I1IH 3INUL 1CICA 1FYTE 4Z5RB 5T3ZH 3O9WD 4YBLB 3VRLE 2XN9D 4C83B 5I1DB 2BX5A 4IM8A 2QEJA 3LQZA 3TV3L 5C0JA 2DLTA 2D7MA 1U8NA 4L8BA 2DLHA 4AEEA 1EIBA 1CCZA 2EDOA 4KI5E 3FHQA 3OB8A 5IR1B 1DQMH 5LVEA 4NQDE 4XWGL 4YK4C 3TVMC 2GSGA 2NY4B 1LILA 1R24B 4RX4D 3OMZA 2V5TA 4B7LA 5D2NC 3T08A 1AGEB 5GRVK 4LASH 1I9IH 1FL3B 2OTUB 3BI9X 4MJID 5KOMC 5JXEC 4PJFB 2BXYA 1KPRA 2Z0BA 5C0CD 2VISA 3QUYC 2UWEB 4L1HA 3EFFA 1Q0XL 4J8RA 4P4KD 1UKSA 3QYCA 5IIEA 1W0VA 4S0TD 1MCQA 4P2RA 1DBBH 3OJDA 5E5UB 3NACH 3LN5A 1CFBA 1NFDB 3F7VB 1JNHB 3QHTC 1YA5A 2VOTA 3PHOB 5IEHA 3O4LB 1NBYA 5F21B 1A1MB 1YEHL 4IRJA 3CZFB 4CU6A 3JWOC 4X4YA 3P4MA 3U1SL 3QQ3A 2NY6B 1DE4B 1K3ZA 1JZ8A 3CVHB 1I3RA 2YKLL 4ZNEE 3PDGA 1WC7B 2XACC 2DTMH 4KAQL 3ZTNH 3GI8L 3KPRD 3MV8A 1TIUA 5B38B 1BWMA 4XRCA 2CLZB 4ACPA 5C6TL 3THML 4KH2A 4U1LA 1G6VK 3CX5K 4C57C 4WFFD 3SPVA 3U4BL 4YO0B 3U0TB 3G5VB 4HH8A 2J8UA 3AAZA 3QPQC 4O2EB 4XCFH 1NC2D 3NFSL 2FHCA 4HWZA 4FHBD 1XR9A 1OD7A 1EX0A 1UXWA 3ARRA 4H8WL 4RGOH 5EOCH 1IEBA 4I1NB 1EAJA 4QHKI 2RIKA 3CVHL 3ZDZF 3U4EB 3RWCB 4W6YB 2XQBL 1Q9WB 4HK0B 2IPUK 2ZCLL 1CG9B 2FEEI 2BY2A 1O5DT 3MRIB 3TJEH 3UMTA 5SWQB 1OTSC 1A6ZA 5L8KB 5DEGA 4AEHL 2W9EH 4V1DE 4XVTH 5KSVA 4GH7B 4NNXA 5EU6D 2YUXA 1VEMA 2G60H 1AGBA 3MV9B 4IRJB 4PLOB 3F7PC 3RVXD 5EC1B 4I0CC 3NFSH 1NC2B 1WWWX 3WMSA 1A6VL 3CXHK 4Q2ZB 3TBTA 4JRXE 2GTWB 1O7VA 1M71B 2F8XC 2O5YH 3TCXA 3KJ4B 3ARZA 2BERA 1PYWB 1KEGH 2XQYG 3FFCE 4QRRB 4OTXL 2YZ1A 4QHMA 2XKSA 1ES0B 5DVOA 2YMXL 1JF1B 5FECA 2PYED 4XXDB 2P5WE 3KPRB 2Q7YB 3MRKA 4CN4A 1MCCA 2RFXA 3DJ9A 4YHIA 1EEZA 5GRJL 3S98A 3HRZA 1MHPH 3D39A 4M48L 4JHWH 1A6UH 3QEUB 3VWJB 4PY8I 3VH8A 1AXSB 3UTQB 5C0FA 1L7IL 4ALAH 3VFTA 4DVBA 3GJEA 5HDQL 2V2WB 4RAVA 3IDIB 1KELL 2FATH 1Y0LB 3AS2A 5HI3C 3MO1A 1G7JA 3NZHH 4L8CB 1B4JH 1G9ML 2DJSA 4F7PA 1U91A 2EEDA 1EBPA 2QL1A 2HTLD 3VG9B 4CJ0A 1V7MH 5F72S 1LDSA 4JDVB 3BKCL 1IM9A 5A2JH 4JPKL 2HJKA 1RQ5A 4Y5VA 1FFPA 3CJJA 4W70A 4PJIA 5LXGL 4OD2B 5HI4C 9CGTA 3N9GH 4PJAF 5CIPA 2VQ1B 4MNGE 2XTJC 4M7LH 3S88L 1BJ1J 4JANB 1ZANL 1BD2E 1A6AB 2VAAB 4G9DA 2OTWA 4IRSB 4NZDA 5CZKA 4IJ3C 4FQXC 1KELH 4P57B 2NY5C 4HKZB 4F9LA 4RMWA 3MRJA 4IDLA 4KTDL 4JFEB 3GO1L 3ARED 5IP4A 4NM8H 5CEZE 2MFNA 4HCRH 3BUYB 4HPOL 5HI4D 3VFPA 1XGPB 4ZUWA 3KGRA 2P8PB 4KK6C 3ZHKA 1HXMB 1X5IA 3OXSA 5FEBA 2ESVB 1FO0B 4KJQC 4G7VL 3MV9E 3G6AA 3BP7A 3OR7A 2ZG3A 2Q86A 4AMKL 2B4CL 4LLVB 5H37H 5B3NA 1ZANH 1E4XH 2Y25A 3DURB 4NCC1 4NM4H 5B8CC 1EUTA 1Y18A 5ESVA 4PLNC 5DGRA 2F74A 1BBDL 4JJHA 4R2GC 4M7LT 4N0FA 3G6JE 3W39A 1JGDB 4IRJD 2CRIA 1WZ1L 1FV1B 3BIKA 1J1XH 2OQJB 5IG7A 1KLUA 5HI5D 4HUNB 4P9MH 1TITA 2R1YB 4XAWL 3HUJF 2B39A 3EOAA 3MRMB 1XGTA 4QO1A 4C56D 2XV6B 1M05B 3MPCA 2EXYD 4WHTA 2I9TB 1JYXA 3QAZC 4R0LC 1GZQA 2F53D 3S4SA 3MOAL 5DVMA 3ZT6A 3NCCB 1A22B 1D6EB 2YD8A 1FYTD 4NQCA 4LKCB 1KLFA 4JG0H 5FIEA 4KDTA 2ORBH 1CLYH 3PV6A 1HWHB 5E7FA 1OWRM 5FXCH 2X42A 1OB1B 1XGUA 1IGCL 2NX5D 3TWCH 4U0RC 3EYSL 3PV7A 3OR6A 4JM2C 5E94B 5F44A 3FFCA 1A3QA 5I8KH 5D2LB 1QFOA 5DJAA 2P44B 4QHUA 5IB1A 2EDXA 5JLZA 3T2OA 3C5ZA 4ZTOH 4JHAL 1QYGL 4HG4K 5LWYH 1NBQA 3JSSA 4NC1E 1T89C 1I3VA 1KN2H 4EDXB 3BSZL 3OX8A 4NO3B 2XA8L 5IFHH 4GG8A 3EHBD 2E6JA 2APWA 1N2RB 5GRUL 3TH2T 3FO1B 5I1AA 4OJFL 3FB5A 4CRPA 2A6DB 3RX8A 5DSCB 3ULSA 1A7PH 3GSNL 1X4YA 3BKML 2L0DA 3ARGC 3GMPA 1G84A 5F7EL 4PRNA 3E0GA 2R15A 3L6FA 3QPXH 3VGFA 1YN6A 3WLWD 1EEYB 3K7UA 1QR1B 1QHPA 2WLYA 3DUUB 3FB8B 1T89A 1M05A 2R0WL 4P2QB 3PDOA 4YHKH 4P9ML 2ZWLT 2DOCA 1U8MA 5HHPB 1JZ2A 4HJGA 3FN0H 4WU7A 1H3WM 4XB7A 4XB8A 1ZSDA 1UZ8B 4Y4FA 3DSFL 1WC7A 3GSOB 4QGTA 2HLFD 5JOFA 1S3KL 3RBSA 4HV8B 1KN4H 1R3IL 4GAJL 1RUAH 3NA9L 4ODUA 4JDZB 2JJSC 5KAQG 3P0VH 4L4TA 2DQEH 4IOIA 1INEL 1NUFA 4DN3H 1IQDB 4LKCA 5LJYH 3MBED 2F53E 4U05A 4XPFL 1DCLA 4KRPD 5H35B 4C4KT 5D7IE 3SCMA 4G6KH 3FT4B 1MFDL 3OJDB 2B2XL 1G7MB 4L29B 4M6ML 4Z7WE 3G6JB 1ED3A 4PGDB 3T65A 3UJJL 4N90E 5DK0B 3QFJE 2MQ3A 2Y5TB 2YC1B 1MCFA 1GAFH 3EDEA 4BFGA 1X5YA 3FB6A 1ADQA 4BFBD 4Y2DA 4EXKA 4JRYE 2YD7A 4ISVB 3MRGB 4U6VH 5IB3A 1B2WH 1FFQA 4GLRI 2VXSL 2P42B 3L3HB 1QNZH 1FC1A 4XPBL 2EE2A 4UI2A 5FKPB 4RFNC 1RFDL 2ZSWA 1A3RL 4M1GH 3HUJA 5IFHL 3SDXB 3KPPA 4R97B 2XG4A 5CIPB 1N6UA 4C54A 4PJIB 3KPTA 4O5LL 3LKOA 1ITBB 1BM3H 3E6FA 2HFGL 4U1IA 4HK3N 2IPTH 4X6DF 5CJ8A 3TPUB 4CVZA 3HB3C 1QA9B 1IC4L 3HG1B 1VDGA 4MNGA 3FQUB 4A2MA 4NCDA 3KPOA 5FUOH 3RQ3A 3FRPA 1U8LB 1DJSA 5F9AC 3RGVA 1ZT7A 4ZXBB 3U0PB 4OZGF 3L7EA 4FXLA 4NCC2 4M43H 4JO4L 1TVHB 4HIIA 4JZJC 3RIFF 2R8SL 1IZJA 4F37K 5CEXB 1A3RH 3AVEA 4G8EA 2BNRE 4OB5H 4PJFE 1XF5B 1ZT4A 4QRSA 1IQWL 1VB9A 3MJ7A 4XPFH 3ULSB 5HDBF 4KDVA 4NZTH 4HS8H 5TE7L 4YPGB 2CKBL 1FNEA 3W0WE 4B50A 4BZ2L 3DMMA 1INEH 2NY3B 2YC1A 1KLUB 5MHSE 4P2QD 3FHAA 3C6SA 5FV2A 3WFEH 1QHOA 2OXHA 2IPUG 2EEAA 3ZSTA 2VZOA 2D9QB 1R5VA 1S78C 3QH3A 5ACLA 2HVJA 2P5EA 1QKZH 4M6OL 1PKQA 1QFUL 4ZO7A 4L4TB 5KVEH 2PR4H 3PJSB 3QDJA 4MD5B 5I66B 4BA8A 3P4OB 2VLME 2YD2A 4OZGE 5CD3A 2FHFA 4MJ5B 1UM4H 4MA3B 3O11A 3L1OH 3RX7A 3CVHH 5EUKB 2MTPA 3HG1E 4HMDA 4S1RH 1IEHA 1CLYL 4KZEH 1CZ8L 2X9XA 3ROLA 2R0KH 3BUYA 4IHOA 1KJMA 3RIFK 1AKJD 2QBWA 3ROLB 3RU8H 1JWUA 3GMNB 2C3VB 2DQJL 4JR9H 4KMTL 3WHE1 3K0WA 2HT2C 1CL7L 2JCCB 5C0GA 3EZJB 4LNRA 3SGDI 1OQOA 1KJVB 1EJOL 5KOVC 4NP4L 3DV6B 5FM5O 1F3DJ 4CBPA 5B38A 3FO1A 2E7BA 4CMMB 5C0RH 3TBYA 1P7HL 3DX7A 3HE7B 3DXAE 4IBLT 1CFSB 4KZDH 4KKCD 2BSED 3CXHJ 3ZT5A 1TNMA 4WNQB 4WHYH 3MO1B 1MPAL 1OM3L 4DZ8A 3H7BA 3VW3L 2NXYC 5HYJA 4YEEA 4H8WC 3I02B 4HWZB 5DD5L 3S8WA 4X6CF 5JO5B 3W9DB 5HY9A 4E5XA 2ZUUA 5F96H 4PJ8B 3DVNA 5J6GB 4JPVH 5LBSH 3WHE0 1GGIH 4MJIE 1CXHA 5BRZB 1CE6B 2EDYA 4BFIB 5C0CE 1U8QB 5A43C 3EYFA 1BBDH 4P2RE 5EUKA 3ZE2E 1ZK9A 4X9IA 4K7FA 2AKRA 4XXCA 1FZJB 4UDUB 4XVUC 1I9EA 1HKLL 1A1OB 2BDNH 3JWDH 2VLLB 3TBSA 1JNNL 1WEJH 5ADPL 5CP3H 2OLDA 3PIQB 4YHOH 2OX5A 1ZGLP 5TJWK 3MUZ1 4IRSD 5HVGB 2ITCB 4NM8L 4BQ8A 1KGCD 5E6IC 2J88L 4D9LH 1OHQA 1HSAB 4OCWH 3BGMB 4OGYL 2D03H 2V9TA 4J8RB 3HE7A 4OGAD 5EBWA 3TO4C 3ARBD 5EZIH 3Q6GL 4MQ7A 4BSWB 2WIIA 5F7HA 3ZYZA 5E5MA 5M7QA 4PLKC 2AJ3A 4JPWL 1UB6B 4PRPE 2QQKL 1J87A 1UXWB 5F9JA 1VKXB 3ULUC 2VAJA 4NUJB 3LQMA 2GIYA 5DD3L 2NY5L 4K9EH 1ZHLB 1MHEB 4GRMB 2E7MA 3MJ9H 4YC2C 2D3VA 4D8PB 4DN4L 1S7SB 3SDDA 4PJXA 4QRQB 3P30H 5IHUH 3W2DL 1RUPL 3IFPA 3ZT7A 1RZGA 4CMHB 2B5IC 2R2HB 1IC5L 3HG1A 1AXIB 1A6PA 3VG9C 2FZ3A 2A9NH 3KPQB 1H3TA 5TDOB 1AGCA 4LSUL 4M6AA 1OP3H 5FO9B 5C07D 4NJAL 2FL5A 1CDIA 4LHUG 5LBSL 4JDTH 4APQB 1G9MC 1RJLB 5DMIH 4UT6L 1R3HB 4Y5XB 1IAIL 5GSVB 2DM4A 2A73A 3TO2B 5T1LB 4D9RD 3QZWB 4LAQL 5SX4I 2VITB 4L3AA 4JKPL 5T5NF 2E6PA 5EH1A 3QP3A 1TTFA 2FBJL 3DOSA 3GMQA 5FF6A 3MLPA 4Z0BL 1RUMH 1KCVH 4CN1A 1IGML 5KSAB 1JHLH 3HI6L 2CR3A 4ZUVB 4HUWA 5TQ0L 3R1GH 3RUGB 2UVEA 1MCEA 4YDIH 1WBZB 3KLDA 3GBMH 4HLZG 2DTSA 2VDRH 2X4OA 1DLHB 2CIKA 4GXUM 3BIBX 5E6IB 2AJUH 1MI5B 4MHHG 2QQKH 1ADQL 5HD8D 3NH7H 3UBXG 1KEGL 4QXUH 3MJ9A 1MJ7H 2GHWB 4K9EL 3RA7L 1NDMA 4JFYB 3W82A 3CVIH 3RL1B 1U8LA 4M5ZL 2AJZB 4ZG1A 2BOBB 1QLFA 1RZKH 1A1MA 2FJGB 4RBPK 5DFTA 3T0EC 1WZLA 4QRTB 1N59A 4HS3B 1HILA 3WFCL 1C08A 2X1PA 3DRQB 5TDNA 2BRQA 1CBVH 5C86A 4PY7A 1YNTA 4L8DA 4X6EB 3QRGL 1OT1A 5GJSL 3PL6C 4TUJB 5D1XC 4Y0GA 5DMYA 5D1ZD 4JDTL 2UV3A 2O5ZH 1NC4B 4LEOA 1LDPH 3P0GB 3ABZA 3VFSA 5IROC 2X9YA 3GHEL 3QR2A 2K7PA 3B2UD 4YXKL 3O9WA 4BZ1H 5D1QD 5DRZB 2GK0A 4HFWB 1IC4H 4Z0BH 3BWAB 1R5WB 3QDGE 4ZSOE 2Q1EA 5HGHB 4CW1A 3MCLL 4MAUL 3X13A 4LAQH 4RCAA 5C09D 1FNFA 3SOBH 4JKPH 4K94L 4JM4H 1BX2A 4P3DB 4UOJA 5TQ0H 2GFBA 2Z35B 3DTXA 3L95A 3RNQA 2ZUTA 3HNSL 1TQBC 2AAVA 4HX1A 4PJ7E 4EQ2A 1LNUB 4QTHB 2R9HD 2J5LC 2C1PA 4Q9RH 5BOPA 3C5ZC 5GGQH 4XPBH 4LPTA 4PP2B 1MRFL 3WSQL 2KKQA 1CIDA 4NZJA 5DJ2A 3MBEC 4NDMA 1KTKE 5D1QC 5D71L 2NY3C 3TP4A 4QT5B 3BQUD 3AREA 3FTGA 5IT2L 5F1OB 2F15A 1JK8A 1H3XA 4O5LH 4F33A 3MLXH 3H7LA 4WU7B 4FQ2L 3PP3H 4OFIA 5DDHA 1DZBA 3GUTB 4ZFGH 4X6BA 1YY9D 2IPTL 2ZJSH 4TULH 2P8MA 5JDSA 1YDPA 1EAPB 4LBEB 5IHZA 1QSFD 2GJ6E 3LAFA 3EOYG 4JO1H 4CADA 1QFPA 1BQHA 2WWMC 3TVMB 4QWWD 1J18A 1KPRB 1NCCH 3I6LE 2WWMD 3SKNB 3CDCA 3QNXA 4EN3B 2MWCA 3GDBA 4DUXA 1EHAA 2AXGA 3FO0L 1LK2A 4POZC 4ZUTA 1G7JB 4XNUH 5GJSH 1CFNA 4S11A 1Z3GL 5JW4R 5MP6L 4C59B 5D1QB 4Z9KB 2V5RA 2BVQA 4ZFZB 2MNUA 3TO2A 2FSEB 3WIHA 4XCCL 1FE8H 4FA8A 4PJBA 3O45A 3MV8E 2FEEL 3IU3B 1L0XA 1PKQE 1RULH 5EU5A 3VRJB 4HZLA 3SE9H 4YDKL 2PYEA 1U58B 1OAUH 3NVQA 3ARGD 3ALWA 5J13C 1W8OA 4RGNE 1AD9A 3CDGA 2COQA 3SDXF 4HKXA 3Q1SL 1BZ7A 3JV6B 5L9DH 1I8LA 3MREA 1F58H 4NNYA 1FP5A 4K07A 2R0LL 5SWSD 5EG6C 4Q9RL 3DVFA 1X4ZA 4HKZA 4LOUD 3Q5YA 3PNWA 3KPMB 4X7TA 1ZHLA 2CLRA 3BN9C 5DMKA 4NQCB 2QQLH 5HHMB 3D6GA 3G04B 3GBNH 4IMLB 5T1MA 3HC0B 3CK0L 1B0RA 4LPYA 4OZ4A 4LVNB 2V5SA 2EE6A 3L1OL 4J2XA 1IRAY 5E00A 3FT3A 3IS0X 3IB4A 4KQ3L 1UH2A 3IXTB 5CGYD 1N8ZA 5LCVH 1G7LA 2NR6D 4LLYA 2EIBA 1NCTA 3NPSC 1I8LC 2DWDA 5T1KD 3ARWA 4WO4A 2DDQH 4LLYB 3BZEA 4K9EC 3QPXL 4WI9A 2IG2L 3KLSA 4Z0XB 1T3FB 3EYUH 4MMXC 5CINH 3BO8A 4PJAA 2ITCA 1YYML 2HFFA 5ITFA 5I71C 4XCEB 3U7YH 1XEDA 2C4FU 4OGZA 5IFJA 5BOZG 4JM2F 2EIZB 3ZTJG 2Z4QB 4NQSA 3D5OF 3QXWA 1JTOA 3PHQA 1NGXB 3CK0H 2HP4A 4S1SH 1EFXD 4FFZH 5CEZH 1RURL 1I1YA 3RVUD 1UWGL 4X0KA 4YHML 1G7PB 1BGXH 2E7LA 4PJDE 4G5ZH 5IESH 4QCIA 1KBGL 3NGBB 5F6HI 4LPVA 2AK1L 3BGAA 5GGUB 3MMEB 5TF0A 4Z7WB 4X6CB 3B8SA 2WIMA 1D5ZB 2HKHH 5BRZA 4JRYD 2VXVL 3MV8D 3RDTD 3DO7B 4NPYB 4NO5B 3FT2B 1CBVL 4IRSA 2F53B 5I18L 5EC1A 3QHZL 3ZKSD 4HT1H 3O6FD 3T04D 3FQRB 3VXNA 4K23H 5FUZH 1DUYA 3RTQB 4NHUB 4GS7B 4FQIL 3WCYA 4MQTB 1K6QH 1NFDA 3LRSB 2DQFA 3O3EB 5BS0B 2X2YA 3C6SB 2ZCKH 3PQYE 1ZEAL 4KK8C 5CBAA 5IMMA 4AY0A 1OW0C 3MRQA 3DNKA 5D8JH 5EOQH 4M8VA 1N8ZB 3MNVB 2OR8A 5D7LA 1YDPB 3RWEA 3QUZD 5JTWA 4PRHD 2KZ1B 3ARGB 3PDDA 3K1DA 4PGEA 5ISZD 2ADGA 5C71A 1C5CL 5C0EB 4LCWE 4LKXA 1CGTA 2FCBA 4E42B 5DHVA 4NJAH 2UZIL 3D39B 1F4AA 1JPGB 2UWEF 4AZ8A 2MKWA 5IVXB 4Z7UF 1CDJA 3IDXL 4YXHL 5FUCC 3HPLB 3D9AL 1F45A 2WINB 1HXYA 2OM5A 5TH2A 1NCAL 1S9WA 4M8QB 1K6QL 1OPGL 5IJVA 1U8OB 2D0FA 1KJMB 1MVUA 3P9LA 3FQUA 2EDFA 1WTLA 2DJUA 3IGAB 5I0DA 2P46B 4L9LA 2QKIA 4S1SL 3LSOA 1OAKH 5D1XB 2DBLH 5DD3H 4OV5A 2VXVH 5E2JA 5TGBA 3RZCB 1WFTA 1I1CA 3K1KC 2ZUVA 5FB8A 4YHZL 1GH7A 3MFFA 3HAEG 2GSIB 3HUJB 1S5HB 4MB4A 2K3TA 4OFYD 4ZQKB 3WJJA 4N0YL 2XXCB 3MA9H 1S8DB 4L5FL 4U7SA 5GS0D 5I15L 2LU3A 3GJFB 4FQCL 2P4AB 3CUPB 3PXHA 1R0AH 1FNHA 3QIWA 3K4AA 3CFEB 1A64A 2H32B 3IDMA 3PNWB 1S7TB 5BQ7B 3KNBB 4ZYKA 5CJQL 1MJ8L 1YEGL 3D1MC 1J10A 3NOIA 2JELL 2AEIT 3FB6B 2VZ3A 1II4E 3UJIH 3KNBA 4ZYKB 5IBUG 1J8HD 4PRDA 3AREC 1EMTH 3VXUE 4IRSC 1DFBL 1FL5B 5MEND 2HRPH 4JLRB 4HS3A 3LEVH 4Z7QF 5HHVH 3MV7A 4Y19A 4JG1H 2QHRL 5JA9A 2RCSL 1BD2D 5T1DL 1FORL 2E5EA 3WFDH 3DX8A 4P5KB 4N0RA 5IWLC 2R0ZL 1U8KB 2J6EA 2J8OA 1KB5B 4YHLH 5DJZB 2Y23A 1ZA3B 1NMCB 3TFKD 1T03L 3L3IA 4K2UL 4QOKD 4ZUSB 1FVCA 4CVZB 2WMPA 5DMGD 1AJ7L 3EW3B 5D1ZB 12E8L 4WU5A 1Q38A 2WW8A 4PRIA 2IWGA 2P8MB 5EIVA 5JDSB 7FABL 1LEGB 4APQD 1T6WA 1IT9H 2UY7A 2VLJD 2VLRB 3RWHB 2PW1A 4DCQA 2ZSVA 4N5UA 4WHDA 3TZVA 4M5ZH 2PF6A 4I3SH 2Y07H 3I9GH 4ZOCA 1CQYA 4WDIB 1FQ9C 5JOPE 4KKCC 4WUKH 4ZDHA 3QZWG 5FHAL 5GS0C 4EVNA 4PGDA 3V6FB 4APQC 5DK0A 4QRPB 3SN6N 3BSZH 4ONGH 3REWB 3BRGC 2IPKB 3LD8C 3THMH 1E4KC 3ROOB 3DETC 2LVEA 4H1LH 4WFHD 4IOSD 5C0AE 4L4JA 2BNUB 1R3LB 2OSLB 3O2DA 4JVPA 4FFWD 2XWBA 4Z7VA 4Y4HA 1KYOK 3D3VD 2XTJB 1X5HA 2IANA 4IS6B 4GKOA 2FJHB 2XWBB 2PXYD 1MCJA 4PIRF 5D6CA 3L5JA 4KUZH 3HKFA 2VDPL 4AQOA 2NY2D 3O41A 2UYLA 2IAMA 3E1F1 1H8SA 1E27A 2IALA 4OGXH 5I9QB 3SGJA 1DBBL 2ZOLA 2CXGA 2ZUWA 4XNYL 1D3CA 4NUJA 2Z9TA 1CD9B 3UTTB 1BJ8A 1CE6A 5HHPA 3LY6A 2DIBA 4ONGL 1UM6H 4X5LA 5D7JC 2IBZY 2VDKL 5JHDE 2VLMD 1NCUA 3RWJB 2IQ9L 4OLXL 3VD5A 2GAZB 1OARH 4NKIL 3ESUF 4Q97A 2JK5B 4EDWL 1MCWM 3LVEA 5INDA 3DIFB 4GMSH 3U79A 4OAWA 4RRPG 5C0CB 3M1BA 3MRQB 5J6HB 3HC4H 3OX8B 2DWDB 2NYYD 2K7QA 1EPFA 2OL3L 4R4BB 4GG8B 3ZDXE 2FX9L 1VACA 3UTSA 1GJIA 3LKPA 3VXRE 1FAKT 1VGEH 3DX7B 4JO1L 1UM6L 5DQ9A 4EUPB 4QTIH 3LKPB 3BN9D 3OR6B 2HN7B 4KRPC 1HEZA 4YHYB 2DS4A 2XRAH 5C2BL 3H9SE 4CU8A 4OF6A 1BHGA 5DR5L 1NLDH 4OCYH 1CWVA 2A74A 3P9WB 2NNAB 1H0DA 4XNUL 5EOTA 4G8FA 4AIOA 5E2VL 1MHEA 1NMAL 4GRMA 5C2UB 1JGUL 3S4SB 2FYYB 1MHHA 1FCGA 3SDCC 2IG2H 2IH3B 3UYPA 3VXQB 4PB0L 2R1XB 1QBAA 3KPSE 2DQTH 1VPOH 2D7QA 2E9BA 5I73B 1TZHA 3SKUD 1A6VH 3KYAA 4WO4C 5CD3B 1S7TA 5BQ7A 5FUOL 2D4DA 1L6ZA 1IGMH 4GG6F 2NY0D 4JKKA 3CLFL 1LVEA 4PFEA 4BFEA 5FGBA 1ZE3C 4HHAA 4LPXA 4G5ZL 1MCOL 3BP4B 4PTUB 2LQRA 3HFMH 3Q5OA 1ZLUK 3RDTB 4WY7H 1CXIA 1Z9OA 4IS6A 1S7SA 5FDWB 1SQ2N 5MEQA 1WWCA 2KQMA 1IAKA 5LGJA 3I6GA 1KJVA 3REVB 1YY9C 1S5IH 4Y19B 5ISZA 5J56B 3MZGB 4RWYL 5GRVL 4CADB 3SE3C 4FZEL 5GS0L 2HA1A 3BN3B 4LCIL 1FZKA 1TJGH 2RFXB 3TJEL 2NY1C 1A6TB 2XY1A 4UV7L 1UADC 4N8VB 1FLRL 4OZIF 3NFNA 4NRZB 1GGYA 4QRSB 4QTIL 1MCPH 1YEEL 4PREB 4N8VG 1NAMA 1NDGB 4W4NA 5DUML 1VESA 4G8FB 2L7JA 5C08A 1MAKA 3DECA 1KIRB 4HUUA 5E56A 3VXRD 2YR3A 1NLDL 5LWYL 3I6KB 4POUB 1KOAA 4WWKA 1QFUH 2ARJA 3O8XC 5KW9L 2O5YL 2Z31B 4MA8L 1PKQB 5EUOB 3KLHC 1I7UB 3F7YA 4X6DA 15C8L 3T0AA 4JANA 2A6IA 3LMJL 5I19H 1KV3A 1Q1JH 4HZLB 1BZ9B 5EU3B 1MNUH 1KBGH 2Y07L 5E2VH 5SWQA 1Q9OA 1RPQA 1QR4A 1MELA 2H8PB 4X98A 5DMJB 5IQ7H 3FAWA 3W0WD 3MLYH 4NBXB 2YXFA 3CLEH 4HWBH 4DOHB 1JBJA 1WAAF 4HWUA 5CMAB 4D0CA 3WFEL 2AQ1A 4HHAB 4M4RA 1BVKA 4NFBA 1AHWB 3U2SB 2EEBA 4J6RL 4CDHA 4IDJH 2QSCL 3O2DL 2N56A 4Z7WF 3CNKA 3M8OH 2DAVA 3PWPB 5I1IL 2EYSA 3OKEB 1EEQA 4IIQC 2B4CH 2JTDA 1LO0L 5HTSA 5HHQA 3MLWH 4KHXH 4RQQA 3KYOB 4PJEE 2HKFH 3MBEA 5EWIL 4K7PX 4P9HC 4V1DB 2VL5A 3DSNA 2EC8A 3NFPB 3P4NB 4HPYH 3EYQD 5C0AB 4Z77A 4LSTL 4EZMA 4WV1A 4KVCH 3VMPA 1BQSA 4OD3L 1FLRH 4XC3H 1JYWA 5CEYA 5FGCE 4I18C 2BY3A 2D7PA 2NY3D 4PJHA 3U82B 4FQ2H 1NC2A 4NQSB 3KXFE 3RL1A 3ULUF 2OI9B 4NBYB 3TBTB 3TA3C 1LD9A 4OT1L 3HE6A 4KK5C 5IMLA 4KK8D 2HN7A 3FRUB 5FFLA 4V2BA 1ZHNB 2GYSA 5AZ2H 1NBYB 3D9AH 4Y4FB 1NJ9B 1NKOA 3QHFL 3KPRE 3LN5B 1TTUA 3PGFL 2CJUL 4AK1A 2JJSA 1CL7H 1WLHA 3OAUH 3WN5C 3ME0A 4N0UB 4B7IA 2VSCA 4LSTH 3IXTA 3DIFA 3DVGA 2JK5A 1RU9H 3LS4L 3TT1H 32C2A 1RUKH 4WEBH 5T3XL 2CQVA 1DBKH 4A6YL 5DEZA 1OM3H 2IBGA 4PJHF 1JZ5A 1T03H 1IGFH 4RFEB 3T0XA 3V0WH 3VE0B 4U6YA 1RK0A 5FOBA 5MEPB 4U1GB 4YO0A 2X05A 4TVSa 4YHOL 5ELIA 2BVOB 2NX5E 5F7KC 1OAXH 3PWPA 5GSVA 3D3VE 5ECJE 5GZND 3SPVB 2NY1B 1KIQA 2CJUH 2AGJH 4OGYH 1F58L 3BO8B 5SWZB 3MNVA 1AD9B 1IKNC 5EWIH 3TJHC 3HRPA 3BE1L 4V1DD 5E2UH 4OF0A 2JJWA 4S1QL 5D5ME 1HK6A 4GAGH 1HE7A 5SX4H 4JPWH 3ZTJH 5JNYA 4HGMA 3MA7B 1RU9L 3TT1L 2P47B 5IBTL 3IF1B 3OZ9H 1CLZL 1P4BL 1A14L 1TZHB 3C5SA 3DX8B 1UWEL 3OL2A 5MEOA 2AXJA 2CLVB 3AY4C 4WRLA 1UJ3C 3MR9B 3JBG7 3WS3A 1B6UA 1I9JL 5T1MB 4NUGL 4NKQB 4KVCL 3L6FB 1OGAA 2EE9A 1OTUD 4Q9QH 5DFVD 5ICZA 1UKTA 3W0WB 4HKJB 4LAJH 1IGTB 4P2RB 5C08B 2CKBA 3KAAA 3LB6C 4JVWA 3EYUL 4MCYA 5K9QG 3T1FA 5JHLL 3WNNA 2F58H 4NWTL 4O51A 1EAPA 1QKZL 4G43A 4FXGA 5DQDH 3UTPE 1P5UA 5AEAA 1PEZA 2J5LB 1T1YB 1PKOA 1U93A 1OAZH 3B6SB 5EZJA 2E8ZA 4RMRA 3ULVF 2BSRB 5I8OH 5DJAB 2DQUL 1HH9B 3LPFA 4JZNA 2W0PA 1T0MA 4UIMA 3ARDA 2R2BB 4ZFZA 1HHJB 3S6CA 5F7EH 3CU7A 1HH9A 1RI8A 5D1QA 4UU9B 5ICXA 3RZWA 5IB4B 4ZUTB 5FYLE 4U1MA 1XT5A 4KPHH 5JPMA 4BYHA 4G9FB 2VR9A 3GMOA 4GJTB 1CR9L 1E6OH 4MA7L 4G7YH 3WO4B 1MCBA 4FQQA 4MZ2A 1KJ2A 1JPGA 4U6TA 3BT2L 2EDEA 2NXZC 4QXTA 1YEKH 2WQ8A 1A2YB 1MHHB 1OGAB 5I76A 3QCTH 1BEYH 3P9MB 4WI6A 5DGQA 1S7QA 3O2WL 4MAYA 2ZPKH 4RGND 5KVEL 3B9AA 1SEQH 3MRCA 2CDGA 2WQRA 4NDMB 5I1KH 1MCRA 3IAQA 4EOWL 1QSFE 3VWKA 3G08B 4ZFOA 4OF8A 2F5BH 1NEUA 1Y6MR 4WI7A 4JJ5B 4HV8A 4H0IA 3QIWB 3S3JA 5JR1H 2H2PD 1F13A 4YDIL 4P4KB 1JRHI 2B7DT 1IAIM 1NMAH 1QD0A 3X3GH 3U7AA 1CT8B 1RMFH 1N26A 3MLVL 4NNPL 4WCYL 1GGUA 4QRTA 2FX7H 3C2AL 5J1SC 3IDJB 3G5YA 3UZVB 2FB4H 2GJ6B 3IETA 4TSBL 4JRXB 1BQHG 4RDQF 4YBQC 4JZNB 2QR0A 1JZ3A 1U8IA 4PJGE 5H8DA 2GK0B 4LGRB 4PRNB 3IDGB 1WGOA 1NBZB 4HS6B 4J4PA 3SE4C 3TFKC 2BSTA 4LEOB 1Z9LA 3QDMA 3D25A 1NEZG 5IK3A 4PV9A 5EULV 4KUCF 1W2KT 2EYRA 4OI7A 1NMBH 2E3VA 3T1FB 2WUBL 4DFIA 3A6CH 1Z9SA 4HMEA 4XCNA 1GOHA 1F8TL 1A7QH 2XWJA 3EOAB 3MRMA 4YQXH 4X6BB 1NUDA 5IOPA 1NL0L 4E5XB 3SY0B 4Q2ZA 5DJ6B 5JW4M 4FQCH 3UYOD 4JDVA 5BZWB 1SYVB 3QJFB 3WKML 4U1KA 1A7RH 5JUEH 1YPZA 4PRID 2R1WB 3BZ4A 3HNTL 3W81A 1E4KA 3D0LA 1FYHB 3QISA 5KSVB 1OB1A 3G5XA 3FQTA 3RWFB 2DQJH 5HYQA 4M00A 3QSKB 4H88L 4O58H 3UTTD 4X4MA 3VWJA 5J12B 2IPKA 3F12B 2Z8RA 2RB8A 1NANI 1JFQL 5GHWL 1B0RB 4F8QA 3TBWB 4M1DL 4GRLD 3CC5A 4R4ND 1JWMA 2W0KA 5EFIB 3SOBL 4QHMB 2DRUA 4LNRB 4YBQD 3LCYA 1JMXA 1HZHL 4NQEE 5AWNL 4FP8H 3VXOA 5ADPH 3MRPA 1MFCH 2VDNL 1FHGA 3IDNA 5AG8A 3T2PA 1EEUA 3VXSE 1YMME 2K9UA 5ESAA 4UILL 2GCYA 4ONFH 2C1OA 3AM8C 4PUBL 2Z91B 1DN0B 4OBSA 4S1RL 4RGMB 4J3VA 5E6YA 1I1YB 3DXAD 4P2YA 4YK4B 3H3BC 4MQ7B 4OCXL 4BSWA 4G80B 1J9CT 1U3HC 3CSYB 4GKSA 3PHQB 5D7KE 4X99B 3BPNC 3MRLA 4NJ9H 4L9LB 2NY0C 4JFOB 1FVCB 4I3SL 3WLBA 4G80A 3HE7C 2NY2B 3NN8B 4I0KA 3BEVA 5GGRY 1P9MA 1A7NL 5AZEL 1QVOB 3FONB 3SQOH 3X11A 3B9KA 3VDCA 2I60H 2VR5A 1RZGB 4UOW0 1A6WH 3T1WA 4D8PA 4G6JL 4R0LA 3V4UL 1QRNA 4MSWB 3TCLA 1BBJA 5KANI 3MRJB 2H1PL 5LGKA 1ROWA 5HDBE 1F3RB 1JWSA 1K2DB 3NH7L 2OCFD 3AU1B 5I1GH 2WSKA 3TBWA 1ZGLM 4OZFH 4D2NA 3T09A 4U2YA 5L0QB 4HJ0D 3T4YB 3TIEB 3MLYL 4F33B 5DLMH 4R90L 4KPHL 4XC1L 3R8QA 3O4OC 3RWIA 4OLYL 1DQQB 3EYVA 3CFIC 4LPCA 1RJYA 5BS0A 3QEGL 1E6OL 3ARYA 3TH3T 5MEQB 4TSAH 2YSSB 4JE4B 3TIDB 4XCEA 3HI1A 3MRFB 3ZL4L 2FEDD 5F96L 1S7WB 1KCVL 1LO0H 2IMMA 3CX2A 5I1JL 3ZDXF 5LGHH 3DHJA 4JZOA 4JREB 1DEEA 1H5BC 1IQWH 2E27L 2GITB 1VFBB 3QIWC 4PJ5A 5H94B 2BVTA 3E6FB 3WNKA 1DBAH 5BV7H 3CZJA 3FB7A 3QDGA 1TLKA 4ZSOA 4KK6D 1QQDA 4QNPE 4HIEB 3ARFC 1G9EA 2NY4C 4K7PY 2BVQB 3VXSD 2DWEB 2GEEA 4X6CA 2AJUL 3FQXA 3W2DH 3OG6B 3NCJH 2P1YA 3QQ4A 4YBLC 6CGTA 2MQCA 2FYYA 4R26H 1DR9A 3A0OA 2XN9B 5IFAH 4PJGB 4DAGH 5ID1A 5EN2B 3S36H 2P5WA 3C60B 4JGMA 3GSXA 3O6FA 3HS0A 4JO2H 4M02A 5TDPA 3VRIA 4DK3A 4FOMA 1QZ1A 4PR5B 5J6GA 1DQDH 2FIKA 5GSRA 4G6JH 2X09A 4I3GA 2ADGB 1NFKA 3Q6FA 3OZ9L 4LOUC 4TSBH 2IMNA 2R4RH 4JRXA 2XRAL 4R96A 4OZGB 4XZUA 4XP1L 3LQZB 1EO5A 3BYTA 4N0CC 3VXUD 4WNQA 4F7EA 3GMLB 1OGTA 5D96C 2X4RB 1VACB 3UTSB 2H41A 4YE4H 5I6XC 4Y5YB 2EDQA 5CSZB 2FH6A 4FQXA 4R7DA 2Q20A 1AH1A 3LRSA 1CLOH 2DQGL 2NLJA 4KROB 2CK2A 1IEBB 3TF7C 2CXKA 1QVOA 4XCYB 4WUUE 3OWEA 3PIQA 1A7QL 3QB7C 1XAUA 3C09B 3CFCH 3BEVB 3LKQA 4MJIB 3QNZB 5T1KA 3WBDA 4HT1L 1OAXL 3S34L 1R3KA 2YD6A 3BDXA 3QJFA 4I2XA 5TE4L 1CE1L 5IOPB 5E08H 4DGVH 4TPRL 5D1XD 5F89B 4EI6B 1HQ4A 2ZOKA 4UZGA 4X7TB 4Y4FD 1P6AB 5L2KB 3BE1H 5E2UL 3CLFH 4E41E 4HIHB 3PDOB 3QHZH 4NNYB 4WV1B 3EFFB 5FYJD 4JY6B 4KHTL 3S37L 4Z7VE 5K9JH 3C5JA 3FQNA 2FRGP 4JPIB 1JK8B 1GRWA 1LP9F 3W39B 3BDBA 4HAFA 4O58L 3ECBB 2Q6WA 3TNNA 1UFUA 4X80L 2NNAA 3L7FA 4QWWC 1SJVA 3BZFB 1KCSH 1ZWIB 2DQIL 1VFAB 1AE6H 4NC0B 4TNVK 1P4IL 1DQDL 2E7LC 1TTGA 2FL5B 4LCWD 2EZ0C 1I9RL 3RGVB 2HT3D 3C8HA 5HJ3A 1A4JA 3TYGL 2Q86B 1MFBL 2BSRA 3W9EA 1CT8A 2ED9A 1I8KA 2R4RL 4KKAC 1C5CH 3T8XB 4JQVC 5KSBE 1NCDL 3L5XH 4KKAD 2VYRE 3LRGA 4ZO6A 4R4BA 3VXTA 1FG9C 3O8XB 3QI9D 4TOYH 4WWKC 5KW9H 5TF1H 1L9MA 2ZG2A 3D0VB 3GMRA 4KJYB 1ZVYA 1T1WA 5EU6A 2DQUH 5DVNA 2EKSB 5I19L 1AY1H 4PJBF 5EN2A 3BJLA 1CGSH 2P8LB 4J3XA 2YUZA 4U3CA 2XICA 4WI8A 1DBMH 2H6PB 4R7NA 1GZQB 1GSMA 4YHNB 4N90D 3RJDA 1U92B 2YEZA 4HWBL 4FQQB 3GSWB 1PG7X 2F8VA 4G3YH 1YMMA 5FO7B 2VC2H 4Y5VB 4KJPC 3QEQD 3QT2A 1HN1A 4IDJL 4JO3L 4PJIE 4JFZL 2OQJA 4YGAB 3RWDB 4UTBH 2L7UA 3ARSA 5DJXA 4NO0B 3I3BA 3T3PE 4FMFA 3KJ6L 3VXMA 3KLAB 1NDMB 1BGXL 8CGTA 5IF0B 1NBVL 5CILH 4JKLA 1ZWIA 4XVJH 3KLAA 4MJ6B 5F70A 3MYZA 3NZ8A 3IVKA 5MEPA 4P5TC 2KQNA 1WWAX 5FKPA 1N4XL 3TIEA 3LQAH 1HINH 1PX4A 1MCDA 1OLZA 2FGZA 4JFEE 5EZLB 2VC2L 4O51B 3QUXB 4TQEL 5HYSG 5KVFL 4Y4KD 1XF4B 1I3GH 2H2SD 2VQUA 5DJDA 1MFEH 2H45A 4YPGA 2W07A 3HZVB 1UEMA 2PO6C 2VLKA 2A77L 1CDGA 3MCKA 5KS9F 3L5XL 3TESA 3OPZL 3GMQB 5I1EH 2RQ8A 4MVBD 1JFQH 2PTTA 4OCRH 5I1CL 3N50A 5GRYA 1Y6KR 5I1AB 5DJ2B 5DUPL 1B0GA 1AO7B 4YNYA 4X6DE 4DGYL 4LASL 1EDQA 2ICCA 4PS4H 2QKIB 2NY5H 4I8DA 2M2DA 2Y7QB 1NGZA 1ACYL 1JF5A 4P46D 1J1OH 2WUCH 4WW2B 3OB0H 1TMCB 5E6IA 3HA0A 4KROD 4XMLH 2DQDH 1FO0H 4R96B 2ADIB 3DWTA 3IU4L 4GKZB 2R2BA 5JIPA 3WKMH 4HXBH 4XP5H 4J3UA 2AV7B 2EDLA 2DN7A 2CK0L 3OHXB 4Y1AE 5GPRA 4I18A 1C5DB 1U3HB 4XBEH 1JUFB 4KV5E 2X4QA 4IJ3B 4PLKD 1I1FA 4BQBA 3RWEB 3KS0H 4PS4L 1FPTL 2OL3H 1C16B 4F3FA 1P4BH 1ES0A 3V6OE 3EAKA 5EBWB 1OVZA 1R3JA 1DANU 1F6FB 4HKBA 5D8JL 3QRGH 4HUVB 4YGVA 1TJHL 4GXUN 3TC9A 4HEME 3D3VA 5E08L 5EUOF 3G6JA 2A83B 3W9DA 5H94A 5I8CB 1HQ4B 4GAFB 4RIRB 1I9IL 1Z0MA 3Q48A 2VE6B 5GGSY 1YY8A 2AJVL 1EVTC 1WT5A 5DTFA 4A6YB 3HE6B 3FQRA 3VXNB 3ULUH 3UYRH 1LD9B 3PHOA 5IEHB 3S37H 4XVUD 3HR6A 1D5MA 4XBEL 4Z7UA 4MXVF 5EIIB 3WYRA 4J7RA 2AQ3A 2IQ9H 4GMSL 5GZOD 1EXUB 1UWXK 2JF1A 1KIRA 4NBZB 4MA1B 1OARL 3S37X 3OPZH 3NTCH 2B1AH 1OT2A 4GKNA 5DK2A 3MRNB 2ZCHL 1ZLVH 1FO0A 3BKYL 4POYA 3S5LB 4PJFA 2NY2C 3BMWA 2WUCL 5CIPH 5IHBA 5C09B 4YPJA 1RZKL 3ILQD 3WXWL 1E4JA 1TETL 3AU1A 4HDIB 3SDAB 1GGTA 3L3JA 1H8OA 5I74B 5DA4A 3TN0D 5A2LH 1W0YT 2XKUA 3MROA 2DI8A 5GGVH 1QYGH 1AR1C 1BIIB 4HJJH 4WY7L 3VH8G 5ALBH 1FVEB 4EUPH 3DETD 3H7BB 3CCHA 4H0GA 3G5ZB 2VB5A 5T33H 4DUWA 1BVKB 3U2SA 3S96B 3BZEB 4XH2A 1IT9L 4JHZA 1J5OL 4O4YL 4EIGB 1I8IB 4P4RA 2DL9A 2YK1L 1AO7E 5DYOA 5E9DA 5FGRA 4GG6A 1IM9B 2A6IB 2PKDA 5DLML 2VLJB 4XC1H 3V95A 3U0WL 5E4IA 3QDHA 2P5WD 1YECH 2EDWA 1X7QA 2DQCL 3HZMB 5TFSH 5J3HD 2C7UA 3RVTD 2OK0H 3UO1L 4LMQI 2C4XA 3QQ9C 4MHHI 3DO7A 5FCUL 3PV6B 3H9SB 3LH2H 4IIQA 5DWUH 4G9FD 1PG7L 2HVKA 1U8HB 3LS5L 2PUQT 1Q9KA 4QKXB 4XPTL 3BXNA 2AV1A 1MRCH 1EFXB 1T22B 5E6ID 3N1QC 4XHJC 5IJKA 3OAYH 1YN7A 4GS7C 2R39A 4NO0D 1DBJH 4AG4L 5CILL 5KJRL 3EHBC 1I1FB 2NXZB 3KYOA 5CP3A 3GM8A 5BS0E 3MA9L 3O11B 4R4NC 12E8H 3B5GA 2F54E 5TE4H 5I16A 4JZJB 4P2CG 5BZDB 3OKLA 4TN9A 4DJMA 5FDWA 3NTCL 4UAOB 1JPFA 3EDJA 4RMUA 3EJZD 1S5HA 5C0JB 4AT6A 1X6NA 2Y72A 2FO1A 3W11C 1K8DB 3MBXL 2W92A 4L1DA 1CGVA 3AC0A 2JE8A 2VDQL 1INQA 5DFWH 5BJTA 1LQSR 5HHMD 5C07B 4YFDB 3BPOB 1GHFH 2JJVA 1FGVL 2DKUA 4KKNA 4ONOA 5HI3D 2RAMA 5F7WC 1C5BH 1OAYL 1Q9WA 4HK0A 1H8NA 3VGHA 2YEZB 3BPCA 5FK9B 3RZCD 1W8NA 2R0ZH 4HXAL 3GHBL 4I0PD 2GCYB 1IFHH 3DX6B 5TPWH 5LKNA 5D7LD 3S4SG 2XPGB 3O41B 1NCWL 3H9ZA 4H88H 3WS3B 1N64L 4MCZB 3OJMB 4R2GD 5CWSB 2C26A 3X17A 4XPGH 1QSEE 1EZVX 2AV7A 2UUDK 5E4EC 3WLWC 5TFSL 5KSBF 4JY4A 1MJJB 5E99L 4AM0A 3TA3D 3RWGB 2AJSH 3VCLA 3VXUB 1MJJA 4PP1D 3MACL 4P4KA 5FKAA 2JKXA 2HAZA 4G9FE 5DYOB 4EN3D 3CVHA 1CI5A 5IF0A 5ETUB 5C0CA 3RDTA 3QUZB 5D7SH 1SY6H 5F97E 4XAKE 1B9ZA 5IMOB 4WWID 3FFDA 1P9MC 5D93C 4ALAL 3S9DB 4DVRH 3VE0A 1FAIH 1K4DA 3LQAC 3WDJA 5FV1L 4OM0H 2BP3A 1CD1A 4RAVB 4OD3H 4X7DC 4OZFG 2KBGA 5IVZB 1C5DA 1U3HA 2R23A 2EZ0D 4YFLI 4NN5C 4TNWK 4O2EA 5HVHC 4YAQA 1I7ZB 1Q72H 3OGOE 1RZJH 2BOCA 5JIKA 1WVZA 2G60L 2PCPA 4OZFB 5JDJA 3L3OB 1Z0NA 1PG7W 1NFDF 4NM4L 3BQUB 4P2QA 4PTTA 1M7IA 1JZ7A 4XBPA 1ED3B 4LVHB 4QCIB 5AZ2L 2VZ1A 1G7PA 1WZ1H 3RNKA 4K3GA 3QFDA 2Y9RT 2KL6A 1OL0A 4QT5A 5E2TL 2IAMB 1N5AA 2BNQD 3SGDH 1I1AB 4FTVD 3GB7A 3DURA 3PJSA 3LPWA 4I9WE 3QDME 4Y4FC 3B2UC 4KTDH 1WZKA 4ZXBC 3GHBH 3O4LA 4HUMB 5DHXB 1SEBA 5E8NB 1OSZA 5IB1B 2EXYC 4PRIE 4JM2B 4POZD 4TSAL 1FH5H 5C7XL 4ZDHB 5B22A 5B4MC 4U1JB 4XNZB 4KJWD 4NQEB 2Q8AL 3G08A 5F6IC 2X40A 2X6MA 3F62A 4HUWB 2A0LC 3T65B 1KNOA 3BKCH 5FGSA 1CD1B 4WDIA 4MD0B 2GJZA 3DX6A 1WV7T 2QQNH 3MXWL 1KC5H 5GS1A 1HI6B 1I1AD 4M03A 2DMBA 1MLBA 3BRFA 3PWUA 4Y2OA 3MJGX 2VXUH 5EC2B 1MOEA 3QZWA 1FN4B 4ZNEA 2BHUA 2J8UB 3AAZB 5IB2A 2VLJA 4RWYH 4UT7H 5E24E 4GBXD 4Y1AA 3VW3H 5J0BA 1LO5B 3LIZL 4QF1B 3GI8H 4LSPH 3KLHD 4ZUSA 2ZOLB 5KVGH 3BIKB 3RWGA 2YN3A 1NEZA 1U58A 1JGDA 4YFLF 4CL7A 1MCPL 3Q2CA 1FL6A 4OLZL 1KTRL 1URLA 2BVPA 4HGWA 3P0YH 4PJCB 3QG7H 4Z7VB 4DKEH 4FABH 4HUKB 4CUCA 4NHCH 4G7VH 4X4YB 4ESKA 4L8SB 4OCRL 5I1CH 3BRDA 3UP1A 3EO0A 3FCTB 1D6EA 3PWNB 4EN3A 3ZLQC 1HDMA 4RFEA 3PXJA 5IQ9A 4Y16D 2WM0A 1KB5L 1JNLH 3O6LH 3ARTA 43C9B 4MZ3A 4JM2D 3UYRL 2VH5L 1U6AH 4UMGA 4Q74A 4RGNC 4OUUB 2I24N 4AH2A 2D4FA 4AEHH 3E3QC 4U3XA 1INQB 3UAJD 3VXSA 2ENSA 3IDMB 3OG4B 5FYJU 3WFZA 4KY1L 5DDHB 3WO3B 4HXBL 3BP6A 4XP5L 2B2XH 2FGWH 5ID1B 3C5ZB 4XAWH 2PYFB 4JFPB 4RRPA 1GIGH 1H15A 4TUOB 5D7IB 1FFOA 2J8HA 3HPJB 3O2WH 4OKVA 5D9SB 5K9KA 1GAFL 3GRWA 5F6IB 1JGUH 4OD2A 1WISA 2FR4B 3SKOB 4LVOC 4NQCE 1U95A 1RUKL 1BQLH 3LEVL 4MYWB 2BNRD 1YC8A 3AS1A 4PV8B 5L7XH 1ZAGA 5DJXB 1KB5A 3RUGE 4YQXL 1RHHA 4MQSB 4N1HB 4JY6A 1XF2B 3L9RB 1HYSD 3FFCD 4MVBC 1U0QA 3JWDL 3EO1B 5DMGC 2EKJA 5BV7C 4X9FA 3AMLA 3P0YL 3VWJC 5EOTB 3RVWD 2KH2B 4P2OC 3DX9A 3VRIB 5J7CC 4S1QH 1JWMB 3NZHL 2LTQB 1M7DB 2DI9A 4G9DB 4N5EC 2VABA 3A6BL 1FNLA 1J0KA 3F5WB 4LDLB 2VIRA 1BFSA 1JNLL 3QUZA 4FQ1L 4GLRH 5B38G 3VRLF 1K5NB 3M07A 1WCQA 5FKAB 5GRJH 4NHUA 5I6XB 4R6UA 3GMLA 1F42A 4L8CA 4UV4H 4X8JA 3UPAA 4X5WA 2E7CA 4AEIH 5GGVL 4GQPH 4OLUL 3IDIA 3GMMA 2O5XH 3GZKA 3QJHA 2BHYA 4XP6L 3QO1B 5DS8B 1MSPA 5IBLC 1DVFC 4ODSH 2AVGA 5BRZD 4XC3L 4G42B 5BVJB 1JTTA 4N8CH 3WIFA 3P77B 5F7DA 2WV3A 3SQBA 3VJ6B 1EEZB 3K2UL 3ZDYE 4AIZA 4Z7VF 4QXUL 3SGEH 1GIGL 5DK3A 4WUUD 4LCCB 2HFGH 1IBGH 4NKOB 4Z77B 1Q8MA 1QO3B 3RJQB 4N8VA 5TH2B 4HKXB 5IW6A 4FFVC 2VLKE 3WV0A 3ZKXB 4OLWH 2BK8A 1XIWA 4ZAKB 3O3BA 3HCVB 2Q76B 1XR8B 4M6MH 1N4XH 3QUMA 3UDWC 1U2CA 3M8OL 1FSKC 3CFJB 5C70A 3ULVL 3SJVE 2D7TL 5JW4N 4WIQA 3MGTA 2RHEA 5FA3A 2V2TA 3MGOB 3CXDL 1TCMA 3BDYL 4OFDA 3ZHLA 4PJDA 4YUEL 3R1GL 1T66C 5I9QC 1VPOL 4HUVA 1DBJL 5E1HB 5C0FB 4ELMB 1KC5L 4PJGF 2VDML 4HBQA 1CYGA 1WITA 3TPKA 1OTSD 5DI8A 2RR3A 2VKXA 2DD8L 3RPIA 3O0RL 4IMKC 2Y36H 2CIIB 4JY4B 1OQXA 4P2OA 5DJCB 1QBML 2R56L 2CMRL 3LB6D 4PGCA 5IW1B 5T5NG 3LD8B 1TZGH 4G8GD 3SCMC 4GAGL 1WZMA 2C3XA 5C0BB 1VEOA 2KZWA 1I85A 4XCNB 1LK3L 4K3JH 4UQ2A 2VDLL 1F02I 4D0DB 3F58H 5I30H 3UZEA 4OCWL 1KXQE 3JV4A 3PL6D 5I1HL 2OTUA 3V5KB 3VJ6A 1HDMB 2FEDC 2XA8H 3O6ML 4BSVB 3CSGA 4D9QE 5MENB 4G6ML 3U9UA 1S9YB 5ICYB 1INDH 3FL7A 4PG9A 3FO9B 1U3ZA 1A7PL 1E6JL 1G1CA 5T3ZE 2OR9L 3D2UB 1UACH 2YN5A 4RSVA 3L7FB 1AD0B 4OIIH 3VXPA 4V2CB 3ECBA 1WF5A 2CDEB 4LSQH 4ODTH 2X5PA 2P48B 2A38A 1N0LA 4JCMA 1PX3A 4N9GB 4QHKJ 1JPTH 4CJ1A 4M62H 4YEFA 4HWNA 4F7CA 3CFDB 5GGRB 4JM4L 3LHPH 4XWOD 5I16B 3T2QA 1XF4A 1BQHB 1A7RL 4LBEA 5IHZB 1YJDC 1WK0A 1G6RA 3TH4T 3C9NA 3EFDH 1TCRB 3UTPD 3MOBH 1QO3A 1NFDE 4EUPG 1XF5A 1YNTB 3WO4C 1IL1A 1XGRB 2A9ML 4K8RH 4GQ9L 1Q94A 2E7HA 2BJMH 1F3DH 4HS6A 4R26L 4O2FB 3RX5A 5J12C 1WCBB 5HDLA 3VFWA 3FZUC 5EIIA 4ZUUA 4KJYA 4CAGA 1OP5H 1T7XA 1MWAA 5JO5A 4U1JA 4ODTL 4C4KO 2X4SA 4S0SD 3JTTB 4RMSA 1JNHA 3OKYA 1JGEB 3LEXB 5EU5B 3VRJA 4GRLC 5I30L 4NKDA 1HZHH 2GJJA 3RNQB 5DEGB 1T0PB 3TT3L 5C9JB 1BX2B 4P3DA 4QRRD 2Y06H 1VGKA 2BCKB 5IJVB 3QXAA 4LFHG 4H25B 1GGBH 15C8H 3CMOL 3GB7B 4P5MA 1QP1A 1F90L 1YN6B 5FOBB 4OFPA 4X4XA 4GAJH 5KANG 3KYNA 1WT5C 1T7YA 2GT9A 2Q6WB 1XZ0B 1FG2A 3D18B 1UENA 3X3GL 2DYPB 3UJTL 5C0DB 2ZUYA 3QDJE 2H9GB 1OOAA 1G6RH 5D5MB 3UC0H 5CINL 5A3IC 1RZ7L 1W0WA 3MV7E 2JB5L 3O2DH 1UACL 3K8LA 3V7AG 2C3HA 3H0TA 3OKKB 2Z8WC 4Q6IA 1LP9A 4PRBA 3VI4E 3TO4D 5HYFA 1JHLL 1D5IL 4M62L 5A40E 4MJIA 4GW1A 5FYJE 1RJZA 2NW2A 5JQ6L 4KKLC 5EA0H 4MA3A 2J8UF 1IBGL 2XTLA 1UWGH 4YHMH 3BH8B 1MWAB 4RX4A 1WJ3A 1YJDH 5D2NB 3G5XB 2ED7A 2LE9A 5FGCB 1YEIL 1Z2KA 1MREH 2QQLL 1FL6B 2MQ0A 1TNNA 3IJHB 4OZHA 4NQDB 5EO0A 4TSCH 4BZYA 4MAYB 1D5ZA 4K94C 5JIIA 2X89D 4JFHE 4Z7WA 5SWZA 5CKGA 4QXTB 5CUSL 1TXKA 3T2NH 3PL6A 3U46A 3Q6FB 1BLNB 3IJYB 1KJ2B 3L3DB 4WFEE 1E28B 1G9MH 3ALXA 2DDQL 3DPBA 3MRHA 1LE5B 2R9HC 5JZ7C 4H20H 5EA0L 4LCWB 3RGVD 2BNQB 2XWTA 1PW3A 2YD1A 5KS9A 1YYMH 4NN6C 3QWOA 2I60L 3B4NA 4XTRC 4PD4J 4YDLC 1CZ8H 1JHTB 1NKRA 3OKDA 1PGRB 1AGDA 3JVGC 3RBGA 4UU9A 5ICXB 3CMOH 2NLJB 3SBWC 3D2UA 4PG9B 2P24B 3HI6H 5IR1A 4P23A 3V0VB 3MUY1 5T1LA 4R7DB 5FYLH 2V5YA 1S7UB 5DJYB 4Y5YA 3CSYA 4YDLB 4JFDE 4OM1L 3D85B 3K46A 4JN2B 3MJ9L 1ZXQA 2D9CA 3MUGB 5K9OB 3T0WA 5EBGA 3IJSB 4CNIB 3BISA 4UQ2B 5ESAB 2NY6D 5JW3H 2FGWL 5KN5A 4IEFB 2EH7L 1P7QA 2W60A 4ORGB 2YPLD 3O6FC 3HG1D 4UUJA 3B9EA 3HNVL 3NCFB 5IVXA 4P49A 1N5AB 3MRCB 4FQPA 4XP4H 2ZSWB 3K2MC 2Y5EA 2FJFA 2YWYA 2AW2A 1BVLB 1J86A 4LARL 4PLJD 2AJ3B 4NOBA 3KYKH 4LLDA 5JMRA 5L2JB 5DZLA 2EDKA 3JWDC 4U0RB 1MREL 1P1ZB 4Y19E 5DD5H 4FZ8L 5D71H 1ZS8A 1U42A 4O00A 5ISZB 4Z7QE 2NR6C 3ESVF 3QO0A 3LKRB 1IAKB 4X83A 4JPVL 4C56E 2CDEA 3T8XA 3D69A 3GI9H 3IKKA 4Z8FL 3TVMD 2A6JA 4UNVA 2EC9U 1UYWL 1YNKH 1YEKL 3TBYB 2GY7B 4FP8L 4GG6E 2GSIA 3GJEB 1IILE 4JHBA 3SEPA 1HHJA 2ADJA 1UC6A 3SKNA 4YXHH 4RAHA 5FO9A 5A2IH 4F7TB 3OAZH 4WWKD 5B8CA 1E4WH 4U1GC 2LABA 3QG6A 5F1NB 1R5IA 2I07A 3BW9B 4EI5B 1QBLL 1FDLH 3IFNL 4LHQB 2A0LD 2G9HB 5BMFH 1S78D 2Z31A 1M7IB 3C08H 5IEKB 4JFFD 3WL9A 5TQ2H 1FO0L 1FNGA 2QADB 1U92A 2UWEE 4KV5F 5KZCD 1UYWH 1YNKL 4KJPD 2HRLA 2QR0B 4EI6A 2XZCL 5JMOC 3Q6GH 1QRNE 1B6DA 4H1LA 5I66A 1A6AA 3B9KB 3STZB 2P7TA 1AGBB 2CIIA 3MV9A 3SO3C 3C60D 3FRUA 2X70B 1JN6A 4I3RL 4KGJA 5JW3L 4NNXB 4NRXB 4LIQH 3F12A 5EUOE 3MRLB 5EZIL 3KYKL 4NQDD 5AYUL 1RZIA 4XCFL 3VI3E 3ZO0A 2R2EB 1TZGL 5IVOA 5CSZA 4YHPA 3KYMA 4XH2B 3AB0C 1QSED 4LLUA 1NC4D 2HKHL 3QFJB 2HG5B 4QHUB 3PWVB 1CICC 2F5BL