1HILA

Structural evidence for induced fit as a mechanism for antigen-antibody recognition
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
molecule tags Immunoglobulin
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilA01
3WIFB 1IEAB 1G9MH 1U8PA 1D5IH 3O4OC 2VQ1A 1XGPA 2YEZA 3IRPX 4GG8A 3TO4C 1A3RL 3V6FA 3ARRA 4OF6A 4PIRF 3HE7D 1FL5B 1FFPA 3OAYK 3PP4L 4ZD3H 5I1KL 1KCRL 4U6TA 4QXUH 4OZGF 4NJAL 4IBLT 4PGCA 3MO1A 2YD9A 3KPSE 4LEOA 2HKHH 5FUOH 5MP6H 4JRYE 1MOEA 3C6SA 5EUOA 4WW2B 5DJDB 5HYSG 4P5TA 3GJFK 4J1UA 4N90D 1S9XB 1BGXL 3GSNL 4FQ2L 5C0ND 5E6YA 3LDBC 3HHRB 2H1PL 4LKCA 3ZSTA 2FATL 1ONQA 3GMLB 3WN5B 4Y5VA 1VERA 4K3DH 4RMQA 3WFDL 3TT3H 3QNZB 2WBJC 1A21A 1XCTA 2VL5A 3SKOA 3U7YL 4UT7L 1EFQA 4Z0XA 3ZKMC 1I1YB 2YN5A 4LVEA 4NN6B 1DQMH 1U8HB 3MGTB 5E8PB 4NP4L 5DR5H 1S3KH 2DYPD 1KTLA 2DQGL 4OLWL 4LDEB 3QPXH 2DQEH 2VXTL 4IHOA 4LBEB 3D18A 1MCPH 3UYOD 1FYHB 5I1GL 4OSUH 4G8EB 4Y19B 1OAQL 5L6YH 3LHPH 4PB9H 5GPRA 5I15H 1UWXK 3LEXA 1P7QD 4ONFH 5JOFA 1JNNH 2BDNL 3S4SB 4L29B 4KTDH 4XMPH 1HILB 1UYWH 3QDGE 2BVYA 2HT3C 3H3PH 4YXKH 4UNTA 2H32H 5JPNB 5EOCJ 4OZIB 5JXAH 3V0VB 5DJ0A 4NZTH 4QLRA 3DBXA 4DEPC 3CMOL 4C56A 2E9IA 1CFBA 2BNRA 4XBGB 4YEFA 2NX5A 3P0GB 2YZ1A 3PL6D 4JPWL 1B6UA 1MUJB 1WBZA 4PJ7B 4XAWH 3CFBB 1IILE 4F9LC 2Q8AH 5B38B 5D71H 5DHYA 1UB6A 3L3DB 2J4WL 4KHTL 2PCPB 2Z91B 5L7XH 3QNXA 3VE0A 4Y5YA 3GUTB 3NAAL 2ZG2A 3R1GH 3WFHB 5HHOE 3FB8B 2B1AL 2NY4B 3NCYS 2G60H 4ZS7L 5JMRA 4NHUB 4AMKH 5HPMB 5TE6L 1T2JA 5EOTB 2GJZA 4HJGB 5KZCD 2PN5A 4KDVA 3D2UD 5J6HA 1TJGH 2H45A 3MCKA 4ETQB 3F12B 4YHPA 1MQKL 1I4FB 2I60H 2BZDA 1JIBA 1YEIL 3SCMD 1ZGLP 2DRUA 3BUYA 4M7ZB 2VDPH 5ERWB 5FAAA 2BSSA 1IAOA 2K3TA 5T1KD 4G5ZH 3G5ZB 3JWOH 5D7IA 3KPNB 5I73B 4K8RH 3MROA 4IMLB 2E27H 2KQNA 3GMPB 3K8LA 5C3TA 1W0VB 4M48L 4WRLA 2QHLA 3CU7A 5CBEA 4YDKL 1PKQE 3QEUB 4BQ8A 2IMMA 4IRSB 2NY5H 1HHIA 4A6YL 1MCBA 1JWUA 1J5OL 2P8MA 2X4NA 1BLNA 4LIQH 1PKOA 5C70A 1F42A 2JJTC 2IG2L 1XCQA 4OBRA 4NZUH 2G2RB 5D8JH 3DX7B 4ERSL 1JUFA 3LMJL 4QRTA 2R1XA 4R4BB 3FFDA 2H6PA 2BNUB 3R8BB 4WU7B 3UBXA 3ULUF 3GO1L 4KMTH 4DQOL 2DQFA 1LO4H 1I7ZB 1U92B 3QJFB 1IAII 3TYFB 3NFNA 2X9YA 1WAAF 5J3HC 4PD4K 4PJ9C 2D0FA 2XQYK 3IFOB 4ZXBA 1X4XA 4O02H 5ETUA 2FJGA 1KPRB 1OTUD 3O3BA 1B4JL 1DUYA 4HWBL 3MSPA 4PS4L 4EN3D 3VWJB 1AP2B 2DQUL 2X09A 2D2OA 1C5DB 3W11D 4KRPB 2AJVL 5J1TC 4YXHL 4FQ1L 4JR9L 4GRWB 2NTFB 4OZHA 1F11B 1YMMD 3OZ9L 3WXVH 1SBBA 4PG9B 3CCHB 5SWSB 3I85A 1FYTE 2J8UF 4UIKL 3KDMA 4ZFFA 3RVXD 3M45A 2HTLD 4GSDL 1MFCH 4OJFH 5C0CE 2ZZUT 4G6KL 4QXGL 3TT1H 4DN3H 2W60A 4JRXE 1IGIL 2V7NA 4JFZL 1Q1JH 1MFDH 4PP1C 2V9RA 3WMSA 4TOYL 4G6AD 3ULUE 1A6UL 4LHJB 4LSVH 3BP6B 3RWEB 3W39A 5GSRB 4RQQB 3E3QE 5IM7B 5CSZB 1DUZB 1WAAE 5HY9A 2W59A 5EORH 3L1OL 1ZGLM 4B7IA 5LWYL 4PJBF 1PLGL 5DK0B 4LPXA 4YC2B 3O2VH 4MAYC 3QXWA 2ITDB 5KANI 4Z95L 5HHME 3GMNB 3EBAA 4NNYB 2Y1VA 1UVQB 3GIZL 3I75A 3KPRE 1E27B 4NUGL 4TVPL 1CIDA 1NGWB 4EUPH 1IC1A 1S7TB 4NQCE 3WIHA 2H26B 4I3SH 2VITA 4NHCL 4MCYA 3AY4A 4AIOA 2CDFA 5IVNA 3SDXB 5CJ5A 1KFAL 4ELMA 1CCZA 4UTBL 3C2SA 5TQ0H 3RNKA 4WUUB 4HIEA 2AEQH 1D5ZA 3LZFL 4LK4A 2VWEE 4WWKB 4JGJA 3ARGC 4XHJC 5I8CB 3SE4A 5IB4A 4U0RC 1QG3A 2HRPH 3VGBA 4IDJH 1WZ1L 4HJ0C 4LSTL 5DJCA 5IBUG 4IIQB 2FECI 3HZYB 1FO0H 2X42A 5JDSA 1F6FB 4X4YA 2P5WE 1CU4L 4Q7DA 4JFQA 3MV7E 5T1MB 2MJWA 1EVUA 2NZIA 2A77H 1WIOA 4ODWB 5TF0A 1ZOXA 3EYSL 3K8KA 2Z8SA 1HXMA 1L7TH 5A40E 3HRPA 4PJ8A 2CKBA 1T21A 1ITBB 4NQDD 4OZFA 4XC3L 4X9IA 3T3ME 5I1LA 5K59F 1LK3H 2VH5L 3BX7C 4PRHE 3IAGC 1YY9D 3RNQB 3KYAA 5E5MB 4YEEA 3A6CH 3ROOA 1WJ3A 5MERB 5JMOC 1JRHL 5E8NA 5J0BA 1BAFL 3TO4A 1MCLA 1HOCA 2AK1H 3QEQE 1FZKA 1YNLH 1J0JA 1EXUB 1MFEH 2RQ8A 3P9LA 1UJ3C 3QCVL 4KXZI 4FTVB 3MJ7A 5DTFB 1N8ZB 2R4SL 1DLFL 3NACL 1B0WA 3I84A 4XNQB 1P6FA 2CK2A 5GSVB 4FZ8H 5KSAC 3WL9B 3BP5B 1IC7H 4LNRA 3PWNB 2JIXB 2WZPD 3QH3A 3OB0K 3NA9H 3IAQA 5D7JA 4Y4KB 3RGVB 1X5XA 4DTGH 4XGZB 4R26L 2YD7A 4TULH 2J6EH 4XP4L 5IROA 1A1MB 3EYQC 4YHMH 4G8GE 5HI3C 5FCUH 1A6WL 3C5JB 1JHKH 4PRDB 2ADIA 4DN4H 2HVKB 2FBJH 4JFYA 1BEYH 2FH6A 2JCCA 2YKLH 4U6VH 3DVGB 3OGCA 3GKWH 2P8PB 3VXMA 3S35X 5DI8A 4N8VA 2MPAL 3VD7A 1ZMYA 5K59E 3RL1B 1XGTA 2P5EA 4RWYH 1JGEA 2ENSA 5DS8B 5JW4Q 1ZT4A 4HZAA 2BY3A 4QOKB 5E9DE 5EOQH 4JN1L 4L8DA 5LVEA 1DR9A 1RZJH 1I7RB 4YDVB 1T2XA 3TJEH 5I1JL 3PUCA 2DQJH 1D5BA 3L3OA 1MJ7L 1J05B 1CT8B 5DRWB 3SPVB 1FRGL 1WQVT 4RCAA 2NXZC 2NY1C 1IBGL 4XPTL 2CR3A 3GSRB 4P46B 3CFKB 1XF2A 4Z7WF 4AEHL 5C9JB 2EECA 1CL7I 3RJDA 3QUMB 3HN3A 5DLML 5C0AA 4YPJA 4OT1H 2HT2D 4WVRA 4EI5B 2UV3A 1U95B 5D1QC 2HJLB 5JHDE 3TBTA 3ESUF 4X80H 5F7MC 3UTTD 1HI6A 4LF3A 5D2LE 3DV4B 3EO9L 1VADB 1BZ9A 1HINL 5H94B 2YPLB 4XT1C 3S88H 2XT1B 1NCDH 1RUML 4ODUA 5KSVA 5E00A 2NY4D 3CX5K 1Q94B 2OYPA 2B7DT 3DUUA 3MOBH 1AH1A 5CLWA 3T8XB 4MNQB 2LTQC 3MRFB 5ITFB 3KHQA 1UA6H 3ARBB 2FSEB 3P4MA 4DZ8A 1ZLVH 5IFJA 4IRJC 5EDXA 2CDGB 4N1CA 3BKMH 3E6HB 2R29L 4H26A 1R5VA 2V9TA 4FQCL 4X7CC 1LGVA 3TN0B 4JKPL 5HYJA 2EE6A 3PWPA 4QRUB 4PJ5D 3QIWB 4QRRB 2YRZA 3FQNA 4K94L 3LKPA 2DQHH 3NCJH 3QQ4B 1NCWH 2OXHA 4Z7WE 4PB0L 4YWGL 1R3HA 3ULUC 3D85A 4IRSD 3S96B 1RULL 2VLJD 4NZRL 3RA7H 3RRQA 3ZHDA 3PQYB 3E3QC 3PP3K 5H37H 4MAUL 2VLKB 4JPIB 1OF2A 1HZHH 3SKMA 5FUZH 2CQVA 3RKDD 5T5NG 2FR4B 4LLUB 1JGUL 4DKEH 3UBXG 1T3FB 2MNUA 4Y4FD 3G04B 3A6BL 4NBXB 3MRPB 2Y5TB 1BQHG 4OUUB 2UYLA 3DMMD 3OG6B 4N0YL 4LRNH 1I85C 3AREB 4Y4HC 5CMAB 1BOGA 1O7VA 4O2EA 5GGSY 2V2XB 1ULVA 1FNLA 5ISZB 4OD3L 4E42A 1DVFB 4UQ3A 4R7DA 4C57C 2HTKD 1G0DA 2RR3A 2NY3B 3RAJL 5C0RL 4OLZL 5EZLA 5MEPA 1T66D 3QDME 1NCAH 3NMEA 3VWJD 3LKNA 1R3JA 1RUKL 3KJ6L 2VLRA 5E8DH 3ILPA 2IH3A 4N9OB 5GGSB 1KGCD 4HS3B 2CGRH 2QSQA 3KPOB 1YEFH 4I0PB 5HXMA 4JFHE 2PO6D 5IB1A 2R9HC 3G6JA 3VJ6B 1KTKE 2HFGL 5D9SB 3PWUA 3RIAK 4B53A 4ZUSA 3BQUC 5FA3B 1A3LH 2M2DA 4YK4C 4BUHA 2E3VA 4HF5H 4MD0A 3OAUH 5D5MF 3BEWA 1NGPH 1WC7A 4HAGA 3VFGL 4NKOB 2AI0L 1H3TA 2X4SB 1EEZA 1AO7A 3KLAA 3PWVA 5ACZA 5I17B 3WLWC 2IQ9L 3HG1E 4LEXH 1QPXA 4OAWA 5I74B 1D5IL 2QKIB 3BPCA 5INCA 1KB5A 4HH9A 1Q72H 1XR8A 1FZOA 3QUZB 3DO3A 3MYJB 4AYFA 1KYOJ 4ZD3L 4QRQB 3P4OB 1ZS8B 4QXUL 1OW0A 1NBVH 1FE8H 3IKKA 3KPSA 4JRYA 5CP7A 3SDDA 5MP6L 2HKHL 5FUOL 5I2IB 4JQIH 3GMMB 5DJ8A 4H25A 3LRGA 3D25A 2A9MH 3CVIL 4HCRA 5HDOA 4NIKB 2PKDA 1HNGA 2QHRH 5GRJH 1NUDA 2MQ3A 4F7MB 2A73B 4JFXA 5DK3A 3IXTA 4X6EB 5F1IB 3KAAA 4LLAA 2X70A 2NR6C 4OCWH 4P4RB 1K5NB 2NY2C 2P1YA 5IGXH 4G9FE 2FH8A 3DROB 4Z78B 3P30H 4K3DL 1GC1L 5D5ME 3TT3L 1PAMA 3PDDA 3IU4H 5L2KA 3RZWA 1JF1B 2BSTB 3HE6B 4Z9KB 4PJFB 3U1SH 4I0CC 1OSZA 4URTB 5DUBA 5DDHB 1DQML 4PREB 5F7DA 4PY8J 3MNVB 5EU6E 1KLFA 3O6LH 2BVQB 5FF6B 2C1OB 3L3IB 4MQXD 2EDEA 3JV6A 5BOPA 3C60C 5A16A 2D7QA 3QPXL 5HHVH 4D9RD 2DQEL 5FDWB 5A2KH 3IDMB 1OL0A 3HI1A 4NCC2 5FYKH 2BERA 4Y2DC 3LHPL 4HIHB 3Q3GB 4WI4A 3B9VA 5KSBB 3O11B 2Y72A 3BGMB 5CWSB 3GKZA 4ORZC 1JNNL 2GCYB 4F7EA 5DD5L 1URLA 5E2WH 4GS7B 3QDGA 2MMXA 3ALXA 4KTDL 5EU7E 3C9NA 4PTUB 4M3JA 3O81A 3IDYC 2PYEA 3QG7H 4LHUA 2XFXA 2ESVD 5JXAL 2P47B 5ESVA 3HNVH 1D5XB 1KTRL 2IF7A 1YEDB 3OF6D 4NZTL 3VWKC 1P7HL 3V5DB 5E4IA 1AQKH 3B9KB 3VFTA 5HI4C 2VLME 3NVQA 1JPGB 2HFFB 5JLZA 3TPUA 5KSAA 1AC6A 2Q8AL 5D71L 4X0KA 1R3IH 8FABA 3TJHD 1UH2A 1C16A 4BZ2H 4CL7A 2QV2A 3RGVD 2D7MA 3MBEC 1FL3A 1LO5A 2Z31A 4R97B 2F9BT 4F2MB 5HHOA 1VACB 1Q9WA 3R1GL 4HK0B 1HHJB 4NNXA 3GIVB 4GBXB 2G60L 3RY4A 3BO8A 4CDHA 1UXWA 1T1WA 3LKSB 3KXFB 4J4PD 2R2CA 2QEJA 2HT4D 1U3ZA 4B5EA 5AD0B 4HUWA 1H15B 1R6VA 4Q2ZA 2OQJA 2OR7A 3IU3A 4HUKB 3ARFD 4WFFE 1KT2B 1MI5D 2RIKA 4JZOA 1YNTB 4G6FB 4G5ZL 3SO5A 3OKLA 43CAA 3K4DA 2ID5A 5ICZB 5A1AA 4N0UE 3IDJB 1PKQA 4M1CC 5FYLD 4ODSH 2D0HA 2EKJA 4XXDB 5IVZA 1OP5H 3CLFL 4IOIB 5KN5A 3SBWC 1KG0B 2GSGB 3RDTA 1D6EA 2RGSA 1I3RB 3QDJB 4RBPH 1B0RA 5CS7A 1QLEH 4LIQL 4QNPF 4HLZH 2W0FA 3O4LE 3ZLQC 4WFGD 4J3WA 4QKXB 5K9KA 2IAND 4N90E 4YBQD 5TDOA 3BUTA 3QDHA 3D87B 2X5PA 1NBZB 5K9OB 3UZVB 4NQSA 5CIPA 1MCJA 4ETYA 2B4CC 3EO1B 3QA3A 3W82A 2CLVA 3HR5B 3VXUB 5IW1A 1KCKA 1LVEA 3PDOB 4YIQB 5FGCE 4MNHB 4E0RB 4E5XB 3OR7B 4LOUC 3FJTA 2VSDA 3WDHA 1PEWA 4WV1A 3BVNA 4O02L 3F6IA 2WSKA 4NKDA 4GAYA 1FO0B 2FWOA 1XIWD 3RWFB 1OHQA 1H3GA 1F6LL 2GY5A 2UVFA 1FC1A 1Z9MA 1KJ2H 1MWAA 3D0LB 1YDPA 4P2OA 4HGWB 1ES0A 1HH9A 1BIIB 1BZ7A 1C12B 2X1XR 3PWLB 4NQEB 5SWQB 5BQ7B 4L9LA 4RMWA 4WTZA 3X3FH 4WIQA 4IRJA 1XH3B 5DD1H 3HAEA 2FBOJ 2C4FT 3DGGB 4OFYD 1FYTA 1ZAGA 3C87A 3B2UD 2XN9D 5E99L 4PGJA 5C0CA 5HVWA 4L4TB 4KJPC 1MFCL 3EKCA 4JRXA 4OJFL 3RWDB 2APXA 4X5WA 5IMLB 4C83A 4DN3L 4QRRD 1JNHB 3BZFB 1I9RH 1KPUB 3ZDXF 4HIJB 3QWRA 2AQ1A 1MFDL 4FQXC 4ZTOH 3RUGA 2NW3A 3LQAL 4QHNA 3QXAA 1KIRA 3W0WB 3ZHKA 4FQIH 3OHXA 1WAAA 4OM1H 2VC2H 4R2GB 5GS3A 3FZUD 3O2DA 3WCYA 1GC1C 5EN2A 1A4KA 5BS0D 5C09B 5ALCH 2ZG1A 3O2VL 5I1DB 1VGEH 4OD1L 5DD3H 2YMXH 4G7VH 4JFFD 4LPUA 3KPRA 3WSQL 4YXLL 1G9NC 3BN3B 4BSWB 3L5HA 2UZXB 3C6LD 4NQCA 3SGEH 3B4NA 5HGDA 4PV8B 1SEQH 3ARED 1D9KC 1HQRB 1U3HB 4JZJA 2EIBA 2DMBA 2BHZA 5ISZD 2ICWI 5LGJB 2OI9B 4OLUL 1NDMB 2X44D 1J0HA 5ADPL 1LNUB 1G7PB 5I1CH 1QLRA 2IAMA 5TQ0L 5E08H 1YC7A 1JV5A 3LN4B 3VRJB 5EBWB 3RVUD 2DQDH 4XVJH 5HDLA 2F53D 3MJ8B 2E7LA 1MCWW 3T1FB 2VYRE 5F7EH 4JJ5B 1CVSC 4AIXA 5FB8B 4DK3A 1NGZA 2HRPL 1FZMA 4IDJL 3A67L 4LRIA 5GJTH 5JXED 3ZDXE 3OWEA 4J8RA 4KGLA 3REWA 2VKWA 1K8DA 4OTXL 3Q6GH 3FONA 4GFTB 4JFDB 3IVKA 3EFFA 3KYNA 1S7QA 3VXRD 4HWEH 3CDYA 4FQJH 1T0NB 1SEBB 4OFKA 3BKYL 5C07B 4BM7A 1UG9A 2PW1A 3B3IB 2A77L 2AXGB 1QFWL 1L7TL 4YAQB 5ACMA 1U8PB 1I7UA 1HHGB 3OJVC 4NBZB 2VQ1B 5IT2H 3HC0B 4KVNH 3ZE1E 4PJGF 1J1XL 4JAMA 5EC1B 4Z18A 1LK3L 3C5SB 4CADA 4QHKI 3T65A 1FH5L 1PYWA 1G7HA 4P3CL 3A6CL 2CDEB 4PLNC 3IXAB 1OAUH 1E6JH 1CFQA 5EUOB 1YNLL 5IWLC 1HQ4A 4KK9D 1MFEL 4NKMA 1NAKH 3UPAA 4D94A 1H5BC 3LIZH 4P2CG 1YECL 1KXVC 5DXWA 5E6IB 1PZUB 1YUHB 5DFWH 1U8OA 1IC7L 1TIUA 2EZ0D 1KYOK 5FOBA 3NA9L 3RI5K 5KVEH 2EDBA 5HHPA 2Y5EA 1JK8B 3D9AH 4XWOD 2VL5B 2J6EL 1CZ8L 2YD3A 3MLVL 4YHML 5FCUL 2OZ4H 2G75A 3B83A 3I3DA 3T04D 1YPZE 3FRPA 5HYIA 4HKXA 4U6VL 1CXKA 3GKWL 4TUKH 4IHOB 1LE5A 1FVDB 4GJTB 4PJGE 1NCUA 1AHWB 3WXWL 4G42A 1TQCC 4YHIB 1K8IB 1LE9A 1ORSB 1QHOA 4RWYL 2IPTH 5E9DA 4AIZA 1A8JH 1AFVH 3BYYA 1GPOH 1S8DB 3TIEA 1ZLUH 1E4KA 3CFDA 1GVIA 4NT6B 1RZ7L 3QIUD 4R9HA 3HE7C 5EOQL 4LHUG 2EDHA 3WIIL 3D39B 3SO3B 3TJEL 3G9AB 1UCTA 1JJUA 3U30C 3P40A 2RHEA 2AABL 2NX5B 4HQQL 1FAIL 3L3HB 3DWTA 3L3JB 5CSBA 5DMKA 4PRPD 1REIA 5DVKA 2I26N 2DLHA 4HKZA 1QA9B 5FYKU 2X4OB 5C0NC 2Z4QB 1UB6B 2LU4A 4ZOEA 1FSKB 3G5VA 4CGTA 3QNXB 1FORL 2VDMH 2GITB 3DTXB 1IAMA 2M1KA 4HH8A 4LVNC 4OT1L 3ULSB 5D7SH 4LMQI 3TF7C 3MV9D 1EDQA 3MRNB 4X80L 4KK5C 5D2LA 5KJRH 2BCKB 4I77H 4LLDB 4U1NA 2Q3ZA 4WW2F 5BVPH 3DX6A 3SJVD 5F8RC 3S88L 1W0WB 3O8XD 2Y23A 5DJ2A 1FAKT 4YHPB 1VFBA 2ARWA 3DHJA 2DICA 4UDTA 3K1KC 3MOBL 4PV9A 1MH5A 4X5XB 1NUFA 3KXFD 4XCEA 4OKVB 4HS6A 2BY0A 2ZSWA 4OI7A 1F3RB 3MROB 4Q9RH 5JNYA 2ADGA 3LV3A 4NQDE 1MHHB 5EU4B 4GRLD 1J0KA 2XWTB 2Q8BH 4Z76A 4G6FD 3LOWA 1I1AB 3C5ZD 1OB1B 1QQDA 4LPYA 4CN6A 5T3ZH 3BGAA 3RWJA 3S34H 3T4AA 5EPMA 4PRAB 1NCWL 3IF1A 5JORA 1BFTA 3PL6C 3WO4C 2ADJA 5IR1B 2VN7A 1XF5B 3W9EB 1G7MA 1A64A 1RURH 2IFFH 4D3CH 3DIFB 4MQ7A 4MA3A 4LMQE 2PTTA 1HZHL 2P24B 3FOLB 3OKYA 3GMQA 5FUZL 4OF3A 3ULVH 2W91A 2A9NL 1AGDA 1GYAA 4DKEL 4OZIF 4MJ4A 5IVXB 1UM5H 1T5WB 1VEPA 3EOAB 2HFEA 4ONHA 5BV7H 3MLZH 3B9EA 1SVZA 4GXUN 2XRAL 3BISA 4W4NA 3OSKA 3QXUA 3OPZH 1RZKH 1CQKA 1WFOA 2VE6A 4ZXBB 4M43H 4LRNL 3NGBC 4MXWH 1DEDA 3O3BB 4OFIA 4L9DA 3G6DL 3HFMH 1NGQH 3DUSB 3TESA 3CVHA 3SDAD 3CDGA 3F7VB 3SCMC 5ECJE 3QDMA 4LP5A 4OZHB 2Z35A 4WTZG 5JW5A 1NCAL 3HAEG 3MBXH 3CZFB 4P5MB 1WITA 3L95A 5J9PA 4DKDC 2P7TA 1A7NH 2OTPA 4WHTA 4AT6A 5DJ6B 3MLSL 4Y19E 3NN8B 4MDIA 1I7TA 2CGRL 4CMHC 1RIHL 5HVHC 1YEFL 4NDMB 2VXUH 3EDDA 4GH7B 1YEJH 2NY6D 1AGCB 3EYVA 1I1RA 3LPFA 2CIIB 4OZIE 3QI9B 4XNMB 5L2JB 2J8OA 2P8LB 4XPAH 3FCTB 2B5IB 4HF5L 3OAUL 5HY9B 3S36L 3DYMA 1DTUA 3MLTB 4XCNA 1G6RH 4PJ7E 3HCVA 5DVOA 1HKLH 2JLLA 1Z9OA 3M17A 3H9SD 3I75B 3BH9B 2OTUA 1YNKH 2GY7B 5T1LB 4FS0A 4JZNA 4KGJA 2NY0B 4MCYB 3P77B 3ZHLA 2J5LC 5F71A 2DM2A 5IB2B 1OTUC 2CDFB 4WHCA 1FPTH 4ODHH 1CDJA 4GW1B 4PJHA 4OM0H 4ZSOA 1FLTX 1WV7T 3P4NB 1D9KA 1FE8L 1NBVL 4R3SA 3TWCH 3W11C 2BOCA 1JPST 3BMVA 4JQIL 3VGGA 2A9ML 3IDNB 5IB4B 5J12B 1E4WH 3MRQB 4PJCF 1T89A 3TFKD 2R8SL 4RNRA 4H88L 5GRJL 2OTWB 1NC4A 1IM9A 3GRWA 3E1F1 1K2DB 4JFPB 4KROD 4BH7B 3I6LE 4YHNA 4ZAKD 3RVXC 4G9FA 1X5ZA 2HTLC 5IGXL 5D5MA 4J3VA 3ZTJG 4PLOB 3P30L 4PJ5E 3IU4L 3SDCA 2CLZA 2QSTA 1RZ8A 2EIDA 1T2QH 3LRSB 4ZO8A 3U1SL 1NJ9A 5FV2A 4G6AC 1PX3A 3VMPA 3S9DB 3QHZL 4MJ5A 5EU6A 3N85H 2DQCL 3HC4L 2Y36L 2CKBB 1T21B 3O6LL 3GSOA 4TVPE 4OZFB 1G0YR 5I76A 5C07D 1M7DA 1U36A 5KSUA 1N26A 4L8SB 5DSCB 5FYKL 1S9YA 3ARWA 4FMKA 4Y89A 1INDH 4L3EA 4EQ2A 1JRHI 1OGTA 3VU2A 4OF5A 3WEXA 2VXVL 2AKRB 4X6DF 5DFVD 4KAQH 3MX0A 1QRKA 5E2WL 1R24B 3TBSA 1BMGA 1S7UB 3MJ7B 2Y06H 4X4ME 5JHLH 2MCG1 1IQWH 3QG7L 1TENA 4PJCE 1IAKB 3P9MA 3HKFA 2VDKH 2DI9A 2R4RL 3H9HB 3HNVL 3NCMA 5IWLA 4WNQB 1NMBH 5IBTH 5TFSH 1EMTL 4L8BA 4P5TD 5D7JB 1X5GA 4Z77A 1CBVH 5T1DH 4JKKA 5DQ9A 1BQLH 3K0WA 4Q6IC 2D7TL 1R3IL 4GRWE 1KGCE 4ZFOA 1BVKB 4KWUA 1KJ2B 4BZ2L 3DURB 2I9TA 1BX2B 3TVMB 2OXGA 1G7IA 4G9DA 4RIRA 1GIGH 2FX8H 3G5YA 1JFQL 3FRPG 1ZHKA 4JY6B 1GZQA 4QHUA 4UQ2B 5SWSE 4MXQD 1ND0B 4N8VB 5DI8B 4EIZC 3T0XA 1D5MA 2E6PA 2O61A 3FRUA 2ZKHH 4I9WE 5DD0H 3T0DA 1KN4H 3MRGB 1CDUA 4LQFH 3H0TA 3ZT7A 5D1XA 1N0LA 3VFUB 1G7LA 1CGUA 4X6DE 1OARH 1EGJH 1OD9A 1YY9C 1P4IH 4YNYB 1A1OB 3FB6A 5CCKH 2ZUXA 4N0UA 2EDRA 1KJVA 1D5BB 3L3OB 5ICXA 4PR5B 3S7GA 1H3PH 4LCYA 3IT8D 3PV7A 4KDTA 4CW1A 4YFLI 1UEMA 3TZVB 3KYOA 3V2AR 3R0MA 4C56D 3BKJH 2BNRD 2NX5D 2EIZB 3O4LA 1QLEL 1ADQA 3PNWA 3RWIA 5J1SC 1IM3B 2LU7A 4NWUH 3MV8A 2G5RA 4WW1B 1M7IB 2HWZH 3BKCL 3D0VB 4W4OC 4NWTH 4WUUE 1ZLVK 4WJ5A 1I1FB 4JO4H 4O51A 3MJ9H 4APQA 3GBNL 4U1MB 4LHQB 3VXNB 6FABH 5BJTB 2J88H 3B6SA 4S1RH 2KL6A 5AEAA 5KSVB 4HX1B 4WEUD 3EOBB 4AJ0A 5SX4I 3O41A 2EC9T 2MQ0A 2EDLA 4K9EC 1DQQB 2FJHA 1BECA 4IM8A 1U8MB 1TPXC 5IEKB 5GHWH 1CI5A 1CG9A 1IQDA 1T83C 3X3GH 3I6GB 1CXFA 5DMIH 5FA4A 3T2NH 1QSEB 3L6FA 4JO3H 1A1NB 1R5VB 1C7TA 4B7LA 1A6AB 5HYJB 3X3FL 3WHXA 3JWDH 1P7QA 1MCRA 1T1XB 3D48R 1W72H 3VXPB 4LCCC 5D6CB 3ET9F 3MRMA 4KPHH 1NEUA 3TBWA 4HG4K 4YPGA 3D85B 1S7VA 1RVFH 4QT5B 4C59B 3TA3B 3ROLB 1NDGB 4KC3B 3O3EA 4J3OC 5DA0B 4JG1H 1BP3B 4X6CB 3BAEH 1CFSB 1AR2A 1ZA6A 3TP4A 2VAJA 4G80A 4ZTOL 4FTVE 3HUJB 2DDQH 1W2KT 4ZYKB 2HT2C 4XNZB 1RUAH 1FV1A 2VC2L 4FNLL 4X8XA 1UACH 4N0CD 3CK0H 5FKAB 2V2WA 4CVZA 4LAQH 4LCWB 5MEQA 3STZB 5ALCL 3BRGC 1LP9F 3L5JA 1VGEL 1TZHA 3ETBF 3IS0X 3DRQB 3T2QA 2GSIA 5DD3L 4G43B 4G7VL 2CMRL 2NY4C 2IPKB 5FO9A 3I02B 1CLZH 4ZXBD 1PD6A 3F7QA 5JDJA 5EZLB 5D7LB 4PGBA 5IOPA 3GI8H 5MEPB 1SEQL 3UZEA 5B8CC 2ATPA 3P9WB 2ZWLT 5BO1H 2W0KA 4AL8H 1MFBH 5DD6B 2RFXA 1ZSDA 4MA8H 2BHYA 1XF4B 4M7ZC 4QTIL 2IH3B 3PGCA 5I1CL 4R96A 4OI9A 5IHUL 3THMH 4UINL 3LN5A 3B2VH 5E2TL 5JIPA 1D6VH 4XVJL 3WFCH 1AGFB 5IB1B 1P4LA 4M1GL 4LKXA 5F7EL 4QOKE 4LFHG 2KPNA 3WJLC 3H7BA 3KLSA 5IIEA 4ZUSB 4FXGA 5FYLE 5EBLA 2DQIH 3Q6GL 5DZOA 3QEHA 3KPMA 4IRSC 1WC7B 4WFHD 3WE6B 2DTSA 3NFPA 4WHDA 1YMHA 4HWEL 2EDOA 4Z7UB 3VFPA 4FQJL 2CUHA 1EEYA 1EEZB 3RKDC 1FN4B 5ACZB 3KPLB 4WFGE 1PX4A 2ZUSA 4Y4FC 1R3KA 3BHBA 4GAFB 3L5IA 1AD9B 1WLHA 4C4KO 1CL7H 3BIKA 4MSWB 4Q97A 1JVKA 1T4KA 3NBNA 5INCB 5IKCA 3DMMC 2VAAA 4M6AA 1O0VA 3J7HA 5ELIA 1ZT1A 1A7OH 2HG5A 2R0WL 3G6AB 1W8OA 2HTKC 2NY0D 1E6JL 2YPLE 5DJ8B 4H25B 3EFDH 1PSKL 5JQ6H 1T66C 1DLHA 1FNSH 4TTGA 2YBRB 4R4FH 4MA1C 2O26U 1I9JL 4NZDA 3VWJC 4JFXB 5CJQH 4CN4A 1V7NL 3Q5OA 3FQTB 4KRPC 4FFWD 4UDUA 1PZ5B 4MNQE 1L4IA 5IJVA 4KUZH 5AG9A 1ZT7B 4JLRB 4RAUA 3QRGL 3D9AL 4S0TD 1HIMH 5DEZA 2BRQA 5FHAH 2B20A 1OSZB 3OGOE 4TNWF 3S5LA 5IB5A 4RGOH 2OZ4L 3KWWB 1YPZA 3GBMH 4WUKH 2OL3L 1IGYB 4QRRE 4X7FC 2OS7A 4F7CB 1MNUH 3CH1A 3CXHJ 1BJ8A 2VERN 4TUKL 3X12A 2NZ9D 3UYRH 4NM8H 1J8KA 1U8IB 1N0XH 5J56B 3WDIA 1PG7H 3HNTH 2R56L 12E8H 3PQYE 25C8L 3QIBA 4PJ8D 1FNGB 1R3LB 2V2TB 2VLKE 1JPTL 5DQDH 2PXYB 1YYMH 5EA0H 5DVMA 4QY8A 2CR6A 5F7YC 5DHVH 1AFVL 2DMKA 1TVBA 1JNLH 1GPOL 2PYEB 3MRCA 5T3XD 5HHNA 2B39A 4FABH 4RFNC 1N59B 2IPUG 5IJKA 3GSNA 1XGYL 3TO4D 2J8HA 1PJ9A 5C6TH 5FKPB 4AK1A 3EJZD 1FHGA 1KTDB 3MTRA 3S36X 5ISZE 1FBIL 2AJZA 2YSSB 2XOTA 1YC8A 1JGVH 1YN7A 5INDB 3T77B 3FOMA 4TRPH 1MHEA 3MRHB 4PY8I 3MMEA 1LEIA 5EIQA 5D7JD 4D0DA 1FL3B 2Z31B 5CBAB 4S1QH 4TN9A 4Q6IA 2DBLH 4V1DA 4OZ4B 2BVPB 4NNXB 5SX5H 1KEGH 2P44B 5D7SL 4ZUUB 3T0EA 4HWUA 3BO8B 1UWGH 1QTYT 3O9WB 4I77L 5HGHA 1UXWB 4HAFA 5C08B 4EXPX 1P2CB 4JRWA 3VA2C 5L9DH 5EZJA 4F7PB 3LN9A 1OP5K 4HUWB 3VXMD 5MENB 3IJYA 3ORJA 4MQXC 3IU3B 2VZVA 4MDJA 2QQQA 1JPSH 3MA7A 2F19H 2GK0B 2P5ED 1SJEB 2CPCA 3C09C 3I2CH 4H1LH 4U33A 1FQ9C 1FNHA 43CAB 1HEZB 5E03A 3WLBA 2EDNA 4PJFF 1DBJH 1CIUA 4LCUB 3BEVA 3LSOB 5I0DA 1X3DA 2FHFA 1AIFA 2O5XH 2Q8BL 4WY7L 5CEZD 3WIFA 1IEAA 3BDYL 2YN3A 2NXYB 1G6RB 5EC2B 4GUPB 4H0IA 5DJAB 5JOPD 5I9QB 5T3ZL 1D6EB 3CJJA 3MA9H 4PTTB 1J8HB 1FL5A 5DMGD 3U82B 5JTWA 5TDOB 2FEEL 2JB5H 2IFFL 3WJJC 4D3CL 3B5TA 3JZ7A 4NQSB 4JN2A 4WW2A 5DJDA 4K3GA 3QA3B 3TJHC 3BT2H 3ULVL 1S9XA 5C0AD 3RGVC 2OX5A 5F9WC 1BFSA 5DEGA 5IW1B 4J23A 1KN2H 5KW9L 4AEFA 5BV7L 4CNIA 3OAYH 2XY1A 1SYSB 3GMLA 3PXJA 3WN5A 1RZKL 1QFWM 4WV1B 3BVNB 4M43L 5KG9B 3QNZA 4HV8A 4MXWL 2FWOB 4J4PC 1NAMH 4PJFE 3GJFH 1I1YA 3SKNB 2VOTA 4R8WH 1LILA 1ES0B 1HH9B 3IETB 1AXTH 1U8HA 4F37K 3MGTA 3ARFC 4K7PH 3SEPA 3V9FA 4UB0H 1EO5A 3MOAH 3S3JA 1CLOH 2FYYB 4B50A 3ARUA 3BP4B 4LBEA 1XT5A 4A6YA 3P73B 1RV6X 3F58H 5IEHB 4JEGB 4G8EA 4Y19A 3KVQA 1X9QA 4GAJH 3QRFM 3ARDB 3EYFB 3IJSB 5HYJD 3PWPD 5KSBE 4U1SB 3U0WH 4C83B 5IHLB 3S4SA 4L29A 1HILA 3DOSA 4N0RA 4TPRL 1I8MB 5JPNA 2VXUL 3QXAB 3D85D 5ESQA 5EU5A 1F6AB 3V0VA 5IMMA 4EZMA 4PRIB 1SM3L 1J10A 4M5YL 2MKLC 4YBQC 5KS9B 2C3GA 1LEGB 4P59H 4P46C 1MUJA 1A4KB 3IB4A 4PJ7A 1AXSB 3KJ4B 1G6RL 2EIEA 3OKKA 3WS6A 5B38A 4ODVL 3L3DA 3L3KB 4M6OH 1MRDL 2PCPA 4EDXB 1NH6A 2Z91A 4JM2B 1DQTA 2ITCB 1YNKL 1TQBB 3T0BA 4WU5B 3GUTA 5A2FA 1RIUH 3SJVE 3IYLW 1ORQA 3FB8A 2I25N 4D2NA 2F5BL 2YC1B 1XIWC 5GS1B 4NHUA 1FPTL 2IJ0C 4ODHL 4HIIB 5HPMA 1ZVSA 5EOTA 5FIEA 4HJGA 4NN5B 3TWCL 4ETQA 3KXFE 1I4FA 3ARBC 2DQTH 3UROR 3BXNB 2VLRD 1A0QH 5ERWA 4P23B 4JVWA 2RCSH 4J8RB 3G5ZA 5J11C 1WIPA 3B2UC 4W6XB 3KPNA 5FYJH 1KIQB 3S3PA 1DCLA 3CC5B 2YA1A 4IMLA 3GMPA 2YUWA 3FONB 4LCIH 4K07A 1QYGH 1W0VA 1GOHA 2Y6SD 4P3WA 3F6LA 4NGHH 2AJXH 3QEUA 1G9MC 5FGRA 3FAWA 1XZ0B 1OM3H 3H3KA 1QFWI 1NGYB 1OWWA 3PHOB 3QDJE 1EFXB 3FZUC 5HYFA 1AO7D 5HTSA 4JAMB 3DX7A 1XGUB 1N4XH 2BSED 4R4BA 1PYWB 3U7AA 5CD3A 1INDL 2BNUA 2R0LH 4WU7A 5GISL 2YA0A 4HPYL 3C6LC 3GZKA 1ODAA 1I7ZA 1U92A 2PTVA 2X4UB 3AREC 1I8KB 4NKMB 4X4MA 3VXUE 4I18C 2JF1A 2FD6L 3CFIC 4MNGB 4OBSA 3C08L 1KJMB 5JHLL 3GSUB 3UP1A 3KPSD 3L7FB 5IFHL 1OQOA 4JRYD 2VDKL 3SDDD 1KPRA 3TC9A 3AXLB 5DC9B 4XTRD 2ZUWA 2H2PD 5LG1A 5TFSL 2CK0L 5FOBB 1QR1B 3QSKB 2I24N 5D6DC 1CBVL 3RVUC 1AP2A 2I9LB 4WI3A 1C5DA 1OQXA 1UGNA 2QL1A 2C9AA 1R0AH 1BQLL 1X5FA 1IC4H 4UU9A 3LD8C 4NQEE 5JXEC 2K9UA 2NTFA 3VGAB 1F11A 2FJFB 3FHAA 3S5LG 2WUCL 3TBVB 4HJ0D 4G6JL 2FX8L 4HKXB 5L2KD 3INUH 5SWSA 4DCQB 2VDOH 1Z3GH 3NFSL 1LE5B 3UJJL 3MUGB 5M95B 2QSCL 3FQXB 3CH8A 1W72B 3BZ4B 1G7JB 2LABA 1YEHH 3KGRA 4FFZH 3VXSB 2ZKHL 1A9BB 3GI9H 3HTLX 5DD0L 1OTSD 5IBUB 1KN4L 3MLUH 4GMTH 3OKMA 1MRFL 4QHMB 3BP6A 5H8DA 2V5MA 5GSRA 3I9GH 3TIEB 4HPOL 4RQQA 4Z7VF 5CSZA 1EGJL 1DUZA 4JB9H 3BPLB 4M6MH 5EUKA 2BXYA 1UZ6E 3QDGD 5DK0A 5CCKL 4WO4B 3OV6A 2ITDA 4OLYH 5C09E 4I48B 4NNYA 2PYED 1UVQA 1H3PL 4LHUD 4KK9C 1INQB 1CE1H 4OGAD 1E27A 3MLXH 1NGWA 1HSBB 4PRNB 1CXEA 1S7TA 3ZYIA 1YEKL 2H26A 2PW2A 4YBLC 4PJXB 4HUXB 4UT6H 1ZGLB 3SDXA 2EZ0C 2AV1B 5KSAD 2DIAA 1J0YA 2Z8RA 4WUUA 4XWOC 3ECBB 4WWKA 5EUOF 4NWTL 3RZCB 5I8CA 1EK3A 2Z31D 2CSPA 4P2RB 5HDQH 5HHOD 6FABL 2J88L 3LKRA 3MPCA 4JE4B 4S1RL 5HI3D 1YY8B 4DOHB 4QWWD 4X7SH 4IIQA 4D9LH 3HZYA 4XBPA 5F6IC 4TVSa 3F62A 4R0LB 4PV9B 5CJOH 1MH5B 5ESAB 4Z7VE 1CFTB 2UVEA 3EW3B 2ZSWB 4JFDE 5T1MA 1VSCA 3OXSA 5GHWL 3X3GL 4HUMB 2ADGB 5DMIL 3LV3B 3T2NL 4JO3L 4N9GA 2NY5C 4ODWA 5C07E 3X14B 5D93B 4KKCD 43C9B 1U8NB 3QIUC 3BIAX 1QQDB 3JWDL 4R4ND 4E41B 5GGTA 5EH1A 2L7UA 3PP4H 2W07A 3RNQA 4XMKL 4K71C 2HJKB 4R7NB 4NJAH 1RVFL 4ZPTB 3O3DB 5GGVY 1G7MB 1I8LC 1SY6A 4NPYB 3RDTD 3RU8H 4JG1L 1EXUA 4X7EC 5EUOE 1CGYA 3BDXA 4FTVA 2EE9A 5DTFA 1N8ZA 3MACH 2NY1D 1NMCC 1K85A 4ONHB 3U46A 2DKSA 4EXKA 4XNQA 5GSVA 3EDJA 3WL9A 4L4VB 4M03A 3PWNA 1KCLA 1RUAL 1MLCB 2JIXA 1UACL 2XZQH 4Y4KA 1S7RA 4LAQL 2HP4A 1QSFB 3QQ3B 4R97C 3O8XC 1QSVA 2B2XL 2VLLB 1A1MA 5IESL 3CVHB 4PRDA 2HVKA 5DUMH 4ZUVB 1CLZL 1HSAA 3KG5A 4G3YL 4OF8A 2Z35B 3DVGA 4OLWH 5JW5B 2P8PA 5F1KC 2QLVB 5BO1L 1I3VA 3L95B 3ZKQD 4P2OD 4AL8L 1Z6JT 3L5XH 2HRLA 2CJUH 4MA8L 3RL1A 4GRLC 1PW3A 3IFNH 3THML 5DS8A 3B2VL 1FFQA 4PG2A 3C5ZC 2UWEA 2D0GA 4QOKA 5GS2D 1CR9H 3WFCL 1FYTD 3S4SG 4XPGL 1PY9A 3HLAB 5BCAA 1ERNA 5C0CD 1CF8H 3EYVB 3UJIH 2ZOKB 3QYCA 4JRXD 1I7RA 3N1MC 5D2NB 2EC8A 5DHVB 3D39E 1X6NA 4HKBB 4WCYH 1J05A 5DRWA 1GZPB 3SPVA 3QWRD 2RB8A 2NX5E 3BW9B 4M7LT 4JDTH 2XY2A 3UO1H 1QBMH 3NCBB 5FFLA 1S7XA 2AK4A 1U41A 2XWBB 2HMIC 2K7PA 5B38G 1U58A 1ZHNB 3GSRA 4P46A 1DQJB 1HYSC 1ZTXH 3CFKA 2OTUB 5C9JA 1U91B 2BJML 4QTHB 3AM8A 3QUMA 4JZNB 1VKXB 3NAAH 5HHMD 1J86A 5IB3B 1N2RA 4EI5A 1CE6A 1U95A 2HJLA 2WQ8A 1FNEB 3T4YB 3DV4A 4NQCD 4PJHB 5T5NF 5FGBC 4L5FH 4HEME 4ZSOB 1VADA 1IKNC 3SDAC 3GHEH 1NL0L 2YPLA 1M71B 1F90L 4Y16A 3EFDL 3V8CA 5BRZB 1BQHB 1A6VH 4X9FA 1Q94A 4QXTB 4E9LA 3MUJA 4I1NB 2XG4A 2IAMD 5CJQL 3T8XA 4MNQA 3H2WA 4YHNB 3EZJB 4LVOC 5ITFA 2BSRB 3ARBA 4JCLA 4KRMB 4BJLA 4MHHG 4DKFH 5JW4R 4KUZL 3VDBA 1WVZA 3E6HA 4H1LB 1HIML 4OZHF 3TN0A 2NW2B 5J06A 2NY6C 1FL6A 1BHGA 3P0VL 1J5OH 3QIWA 4WUKL 3L5WB 3KYMA 1U0QA 1UM6H 3QQ4A 2UY6A 2A6DB 3JWNC 1MNUL 3IJHB 1TVHA 4NM8L 1N0XL 1S9YB 3PQYA 3QQNA 4HLJA 1PG7L 3HNTL 3LMJH 1L7IH 4JKLA 2VLKA 4JPIA 3ZYJA 5I30H 4L3EB 4R2GC 1RD6A 2FR4A 4LLUA 5DQDL 4XCFL 1T3FA 3G04A 1YYML 5IVXE 1FJ1B 4XP5H 1JNLL 3ZL4H 2XV6B 2NCMA 2EC9U 2Y5TA 3EJYD 4OUUA 4IDLA 2WIIB 4FXKB 2Q3AA 3AREA 5CMAA 4K7PY 4P4KB 3RBGA 2OMBA 4HWBH 3BI9X 2V2XA 5C6TL 3VW3L 5F7HA 5DQJB 1DVFA 2AJVH 2VXQL 3TFKC 1T5XB 1JGVL 3F7YB 1I8IB 1MCCA 4TRPL 2C3VB 1JHTB 3DETD 4ZFOB 3U36B 1NAMB 4OZHE 5FEBA 3GJFB 3IDIB 4ZAKC 3ARYA 4G9DB 4RIRB 2V6HA 3MCLH 2DBLL 1KNOB 5GGSA 1X5LA 4HS3A 4NRZB 5J7CC 3KPOA 4G6KH 1UWGL 3G08B 4I0PA 1IGIH 1D5MB 4I5BB 2AXHA 3VJ6A 4KQ3H 5D9SA 1A6UH 1H8OA 1RZJC 5FA3A 2LU3A 3P0YL 5J4MA 1T1ZB 1JPSL 5IUSA 2F19L 4OV6F 3GB7B 1NSNH 4CU6A 4Z7QF 2H32A 3JTSA 4LLQA 4UV4H 4NKOA 5E9DD 3QG6A 3QXDB 4M8QB 4UILL 2X4SA 1DBJL 5CD5D 2P45B 5CGYD 4Z95H 4IJ3B 5DFVC 5I17A 4HHAB 1KCSL 2XTJB 1RJLB 5K9QI 2DJSA 5I71B 5BW7A 2QKIA 1FZJB 4PJIB 5DRNA 1NC2B 4NHCH 5CKGA 3QUZA 3MYJA 4M4RA 4P5TC 1KFAH 2DL2A 3NPSC 3O4OB 4UTBH 4QRQA 3ULUH 3P4OA 1ZS8A 4TTDD 5MI0C 2BVTA 3LZFH 3UTQB 2YHGA 1UXSB 5I2IA 3GMMA 2X6MA 1UCBL 4XNUH 3BT2L 4Y5VC 1WZ1H 4ZTPH 4F7MA 2A73A 4AQ1B 2Q76B 4X9GA 4X6EA 5F1IA 1K5NA 1INEL 4MXQC 1DZBA 1JNJA 3RQ3A 1CD8A 4Z78A 2DLTA 3LDBB 3QCTH 4Z7QE 1RU9H 1JF1A 2BSTA 3HE6A 5E8OB 4PJFA 5LAXB 4EVNB 5E0QA 3MZGB 3L6FB 1NAML 3EYSH 1QVOB 3MRDB 4R8WL 5DDHA 4K23H 1AXTL 4HC1H 2WBJB 4PJAB 3FB5B 1DQDL 4UT9H 3MNVA 4K7PL 3O6MH 2BVQA 5FF6A 3L3IA 3MOAL 4XC3H 3RY5A 5FDWA 2IADB 2VH5H 3IDMA 1FG9C 4KZEH 5FCSH 3QWQB 3TBWB 1F4WH 3GSQB 3Q3GA 4GAJL 5KSBA 3O11A 3I6KB 5E8EB 3BGMA 5CWSA 3U0WL 2GCYA 1HCFX 3SO3C 5DK2B 3BWAA 3ZTJH 4RMUA 4PTUA 1ZA6B 1A6ZB 1NBYA 2R4SH 4AENB 3UTSB 4NJ9H 1D5XA 1YEDA 3LH2H 3V5DA 4B41A 1FV1B 2J2ZA 3B9KA 3ZKSD 2XWJA 4P59L 1AY1H 1BWMA 1JPGA 4Y5YC 3DVFA 2QQKH 4XP4H 1TZHB 2Y25A 3CGTA 4M6OL 2DTMH 2DLGA 4N1EA 5T3XL 1CDCA 1RY7B 3JV5A 4YQXH 4F2MA 4OIAA 1RIUL 1HHJA 2ATPB 3FFCB 1EH9A 4M7JH 3GIVA 1OT2A 4GBXA 3Q0HA 5GRVL 4JY5H 1T22B 4H20H 1ZANL 3QFJB 4NQUA 4I3GA 2EYSA 3QDMD 3LKSA 2YXMA 4X98A 3EYUH 3KXFA 5JA8B 1NFIB 2GJJA 5AD0A 4ELKB 2DQTL 5I6XC 2V5YA 1LDSA 2M26A 1KT2A 2AV7B 2IGFL 4JN1H 2RCSL 1YNTA 5CEZE 1I1AC 2JJVA 5ICZA 1NFDB 3B8YA 4YDJB 4LCIL 1MJ7H 5TDNA 3IDJA 2VDLH 3RPKA 2NNAB 5L8KB 3WNLA 4NGHL 4KJPD 3RGHA 4XXDA 1P7KB 1JGLH 3GGWB 3NABH 4IOIA 3MUY1 4BSJA 4WI6A 4FG6D 1RHHB 1BD2B 1KG0A 1OM3L 1EUUA 2GSGA 1I3RA 3QNYB 3QDJA 3H8NA 4PD4J 2DLFH 5C3LD 4QHLA 4N0CC 5DLMH 4EUPA 5CJXA 3EJJX 3MUZ1 4I8DA 1QLFB 1NBZA 5K9OA 1N4XL 2ICWB 3QUKA 5C0DB 4X6CF 1HINH 3EO1A 4NQVB 3IGAB 3HR5A 4ZXBC 2ZPKH 1E6OL 2AJYH 2H41A 3VXUA 2CRYA 1G0XA 1U8LB 1DLHB 3PDOA 1OD7A 4I2XB 3Q6FB 1OAXL 4MNHA 4E0RA 4E5XA 1D9KD 5F9OL 3WS3B 4BQBA 4UDUB 3HS0B 1DDHB 2Z0BA 1FO0A 1TZIA 1EPFA 1NC4D 1IM9D 4RAUB 3D0LA 4XPFL 1AGBB 1QSEE 4HGWA 1R0AL 3PWLA 1BIIA 1C12A 5SWQA 3HB3D 4NQEA 5HJ3A 5LBSH 2R1WB 2X2YA 5BQ7A 1IC4L 4G9FD 1XH3A 2DS4A 4LDLB 5HYJE 3DGGA 3MODL 3N1FC 1WF5A 2VISB 3SDCD 2ICWJ 1SJHB 4PB0H 3INUL 4L4JA 5HGAB 1J88A 2VDOL 1Z3GL 1GOFA 1UKTA 3QULB 1JI2A 3X12B 5ICYB 1RULH 2ZCKL 4NZRH 4L4TA 1RZIB 3RWDA 4MAUH 5HSFA 2A83A 1JNHA 1U93B 4LSPH 1X7QB 1YEHL 3QIBB 4LGSB 3BZFA 1KPUA 2B5IC 4FFZL 3GI9L 3V4VL 1JGUH 4JQXC 4X6CE 3MLUL 2LVCA 4GMTL 3W0WA 1X5JA 1ZV5A 3A6BH 5F96H 2R2EB 4DVBB 3HUJE 3Q5YA 3SGJA 2XZAH 5HHNB 4L3ED 3C8HA 4JB9L 4XNXL 1A5FH 3GSNB 4M6ML 4NO3B 4ZODA 5HBBA 3JSSA 5D7KD 5C09A 4N8PA 4LCWE 4M4PA 5SX5K 5I1DA 2NY0C 3AY4C 3WDJA 5DURD 1WZKA 4OD3H 4BSWA 1CE1L 2AJZB 3RAJH 1QFOA 1K4CB 5L0QB 3OJDB 2J6EA 2YPKA 4M7LH 1HQRA 1U3HA 5D7LE 5I66B 3BSZH 1LEIB 2VLMD 4FFVD 4FFWC 3FN0H 2JELH 4H8WC 3SE4C 4UT6L 5J12C 1RUKH 3KJ6H 5LGJA 2YA2A 1NDMA 1QRNB 1V3MA 1P53A 5J1AA 5C2UB 2GK2A 1G7PA 2VLRE 4V1DB 4QHKJ 1R5WB 3VRJA 3GJEA 3T3PE 4OCLC 2EKSA 4HKJB 3D3VB 3MJ8A 3T1FA 2B4CH 5EBMB 5HDQL 2LAGB 5FB8A 2QADD 3PGDB 1NEZB 4TNVF 2A74B 3ARGB 3VH8B 4X7SL 1VB9A 4D9LL 2AQ2A 3JXAA 3MA7B 2EO9A 2NZ9C 3MREB 5TH2B 1DQLH 2BVUA 4JFDA 3VFGH 2DKMA 2AI0H 4PJ8C 2X9WA 3ZTNH 1SMAA 3WLBB 5D1XD 4JKMA 3TV3H 5J13B 4JDVA 4Z7UE 4WFFD 3B3IA 3JVGA 4L1HA 1J0ZA 1AIFB 2AXGA 3X17A 4D8PB 4YAQA 2IQ9H 1U9KA 1QUNA 1HHGA 5JPMB 3WUWB 3HC0A 2N7BA 5IK3B 2EDTA 5EC1A 2HLAA 2PTUA 1FFRA 1U8KA 3C5SA 3HR6A 4P9HC 1JGDB 2N1KA 3EJZC 3EUUA 4OZGB 2CDEA 2FEEI 3IXAA 5GIRA 3Q1SH 1QFPA 3VFRB 5HI5D 1SVCP 3E6FA 3RU8L 3CVIH 1S5HA 4JN2B 1PG7X 1D3CA 2FB4H 3O4LD 2X4TB 3NOIA 1X44A 5D7JC 1A7QH 3MV8D 3MACL 4XVTL 5DEGB 4ZOAA 4U1IA 4TSAL 5E6IA 4CNIB 1OAKH 1UJ3B 5IROC 5JW3L 1YUHA 2L0DA 4APQD 1L9NA 4F8TA 1NKRA 3RHWK 2XZQL 4YH6A 1GC1H 4Q9CA 3OG4B 1UZ8A 1JK8A 2E8ZA 3C2AL 4HV8B 5GGRY 3VFSB 4KK5D 3QO1B 1I9IH 4RFEA 2JJSA 1KB5L 5L2KE 3AS1A 3DSFL 1DBKH 3TBYB 1G9NH 4F57H 2XTLA 1KXQE 4AEEA 5F44A 2C4XA 1DJSA 2R2BB 5DUML 3UDWA 3ZT5A 1CD1B 3ZDZF 2E7HA 2CLRA 2FEDD 1FVDA 4HCRL 4ZUWA 4A6YB 1EERB 5T3ZE 3FT4B 5EB9A 1AHWA 5GGRB 5F3BB 3L5XL 1CICA 1KXTB 2CJUL 4WWID 4YHIA 2EYRB 1K8IA 1F4XH 1ORSA 4JGUA 2VTFA 3IFNL 3U83A 5DD5H 3VD5A 3CU1A 2Q6WB 1CR9L 3ARZA 5D72L 1S8DA 3T2PA 4NT6A 2X9XA 5EIIB 5ESQB 2PYEE 1F58H 1MCEA 5EU5B 1CF8L 3UJIL 5IMMB 5DMGC 3ULVE 3D39A 1F97A 1FGNH 1JE6A 2KH2B 1LD9B 4WCYL 5GRVK 3L3HA 3L3JA 4JFEB 1AKJB 3QT2A 4JDTL 3UO1L 3IDGA 1QBML 4U6XB 3OKKB 3X13B 1QA9A 3CFJA 2X4OA 1FG2B 2Z4QA 2F5AL 3SY0B 1RUQL 2PETA 3E2HC 4ENED 5LGKA 5DZNA 1BVLB 1ZTXL 3CX5J 2X10A 2GITA 2NXZB 3DTXA 3O45B 1PDKA 1IGTB 3ULSA 1ORQB 3ZDZE 3MRNA 2YPVH 4KMLB 2BCKA 4LLDA 3C8KA 1ZVSB 3BJ91 4L5FL 1YN6B 3GHEL 1N7MH 5CJ8A 5C08E 1CTOA 1W0WA 1MCOH 3FFCD 2F58L 5MENE 1A6VL 3MV11 5DJZB 1IGJB 4X5XA 5F21B 4M5ZL 4OKVA 3VFWB 1TITA 4ODXB 3LS5H 4DKFL 3QHTC 2ZOLB 3D69B 4P5KA 4WTWA 2WW8A 2XZZA 3ZE2F 4MYWB 1MHHA 3ARVA 5EU4A 1F2XK 2XWTA 2LTQB 2BP3A 3CLFH 1I1AA 1OB1A 1HE7A 4N68A 1QBAA 3B43A 4PRAA 1UM6L 1CDBA 4K7PX 1UC6A 4DGIH 2JE8A 1Q0XL 5IR1A 1XF5A 3W9EA 1CGSL 3NZ8B 3QP3A 5TGBB 5C6WH 1H9VA 1JYWA 3DIFA 1GGIH 3DSNA 1L7IL 1N3NB 2X05A 5BVJB 5I30L 5CD3B 2P24A 3FOLA 4L8CB 5CLTA 2OMNA 3QFDA 3RUGF 1BIHA 3BZDA 4JY4B 1DANT 4JFOB 2ED8A 5IVXA 1T5WA 3EOAA 4U3CA 4XP5L 1AGEB 3ZL4L 1LWRA 4XB8A 2NY7L 4U31A 4NZJA 4UIMB 4M1DL 3RIFF 1JZ3A 1A02N 4FQLH 3DUSA 3KPQB 1M6OB 1MCIA 2XA3A 3F7VA 4CMMB 3ZE2E 3ZKXB 3T0AA 3VMNA 1IKFL 2DWDB 3QO0B 4Y4HB 4UU9B 1IC5H 5EG6C 4GKOA 1V5JA 1MJUL 3CZFA 2ZNWA 2ARJQ 4P5MA 3MCLL 4XC1L 5E99H 2J8UB 2Y6SC 5DJ6A 1JPFB 2HVJB 4X5LA 2WWKO 3NN8A 3JV4B 4MA7H 3AGVA 3UTOA 1F3JB 4U6YB 1EVTC 2C3XA 3CX2A 1KELH 4NDMA 4KQ3L 1S9WB 1RQ5A 3LQAH 3OKMB 3QXTA 4J3SA 3RUGE 1AGCA 2DB8A 1KV3A 2CIIA 3QI9A 4XNMA 5L2JA 2R23B 1MCSA 2P8LA 4PRIE 1MWAL 4O5LH 2MWCA 3FCTA 3QIBD 2VZ3A 3MV7B 5KS9E 1NSNL 4JQXA 5EUKB 4UV4L 3FAXA 3BQUB 3MLTA 4PJBB 2WIMA 4YK4B 3QUXA 3QDAA 4OD1H 5CAYB 1Z0NA 1AD0B 5H2BB 4YXLH 3WSQH 3IFPB 4D0CA 5B3NA 4YHOH 4JJHA 2CUIA 2KZ1B 1WUNT 3MLYH 3BH9A 2IEPA 1OP3K 4P2QA 1EJ6A 2P49B 3ARXA 1L9MA 1IT9L 1OW0C 5T1LA 3T3MF 2PW2B 4PRHB 3P77A 3SDDC 1EZVY 3IDXH 1IFHH 1GGBH 5IB2A 5C0EB 1N6QH 2OP4L 4XTRC 2H2PC 5CP3H 1S7SB 1KIPB 4OLUH 5L8JB 1ITCA 4GW1A 3ULUL 5ADPH 3WNNA 5ABDE 3P4NA 1FIEA 3UAJD 3IDNA 4LSQH 3VFOA 3MRQA 4XNUL 4NFDA 1XEDA 3A67H 4NRYB 2OTWA 4ZTPL 4V1DD 1HHKB 3LKRB 1K2DA 3T0ED 4JFPA 4BH7A 4QF1B 4OTXH 1EJOL 1FNFA 4XBPB 1BQSA 2P43B 5C9KA 5D1ZA 3D3VD 1Y6NR 4HUNB 3C8DA 2W65B 1FVCB 4PLJD 3QCTL 2BC4B 3OXSB 2IC2A 1RU9L 4G8GB 3BKYH 1OTSC 3LRSA 4N9GB 4MCZA 4U2YA 1QFWH 4Y8DC 2OSLB 4K23L 4HC1L 4UT9L 4X6FB 2NLJA 3O6ML 1NUGA 4OF0A 2A6JB 4HXBL 2F54A 1J1XH 4L8SA 5KVDH 5DSCA 5EZIH 1IGCH 3VG9B 4KZEL 4R6UA 1FH5H 1CDYA 1F4WL 1KJ3L 4P3CH 1HCVA 3C60B 2FHBA 4GQ9H 4OGAC 5B22A 3WNKA 4HFUL 2AKRA 2AQ3A 3U2SB 4Y2DB 1R24A 4XP9H 5F3HA 1A47A 4KJYA 4BQ6A 1S7UA 1WCQA 3SGDH 4MNGE 1A2YB 1IAKA 3U46B 1YECH 3H9HA 1JP5A 4NJ9L 5FO7B 5B3JF 3LH2L 4WNQA 5CHNA 3IDYB 3L3GB 3DARA 1S7RB 4OB5L 1AY1L 2Z31C 2FDBP 4L3CB 3VWKB 2QQKL 3IKCB 1H0DB 4J3UA 3MLVH 5I1AB 4F15B 3E8UH 3QAZB 2XKUA 4OQTH 4QWWC 2DTML 4KJWD 2VZ1A 5FO8A 4HULB 1BVKA 3DX8B 1KJ2A 3DURA 4DUVA 1BX2A 3HI6H 4DZBB 3TVMA 1FVEB 1HSAB 1H3XA 4YQXL 4XVUD 2LFGA 4Z7OF 4JY6A 4UQ2A 2CKNA 4M7JL 5D2LF 1ND0A 3MBEB 3WXWH 4JY5L 1Q8MA 4H20L 5C0GA 5E1AA 4BYHA 3VFVB 3EYUL 1T80A 4JQVA 3MRGA 4KKCC 1DBBH 1WFUA 2UWEB 1MCQA 4P0DA 1EIBA 3VFUA 4R4NC 1MVFA 4TUOB 4Y19D 1RZ7H 3I3EA 3UTPD 4NO0A 4YNYA 3WIIH 1A1OA 1NANH 4YO0B 2AABH 2D4FA 4HQQH 4PR5A 1FAIH 5B3JE 3RDTC 2VDLL 1CDGA 1S7XB 2AK4B 3V6OE 4HXAL 3FO1A 1JGLL 3NABL 3TZVA 3WHE1 1NFKA 1U58B 1GGCH 2EIZA 4Z7WB 1YQVH 4PJXE 1FORH 2DLFL 4HUVA 1IM3A 1VDGA 2FLBT 3K74B 1N2RB 4WW1A 4M93B 1CE6B 1M7IA 3RX5A 3D0VA 4Z7OE 1XGQB 1ZWIB 1I1FA 1VEMA 1SHMA 4TSBL 3WO3B 1AI1H 4U1MA 3VXNA 2R0ZH 2C1PB 4P2RE 5BJTA 2ZPKL 4WV1C 1A14L 2AJYL 2H8PA 4Y16B 3U48A 5J89A 4HX1A 3EOBA 4ALAL 3DPBA 2LQRA 4DOHE 3RTQA 5GRYA 1JWSB 1QFUH 3U0TB 3GBLA 1DQQA 4P2OC 2VDQH 1MRCH 1U8MA 1RMFH 4L9LC 5IP4A 4CU7A 5IEKA 1PVHA 2NYYD 3I6GA 1QSEA 2ORBL 1R5IB 3V5HB 3I6LD 1A1NA 1X6LA 5LBSL 1A6AA 2GFBB 3R4DA 1IJ9A 1FL6B 3GMOB 1T1XA 1B88A 3VXPA 3KYMB 4I0KA 5D6CA 3SKJL 2AP2A 1HWHB 4POZD 1TVHB 4QT5A 4WEBH 3TA3A 5TDPA 3ROLA 3VD9A 4AQOA 1NDGA 3GK8H 4LSPL 4TVPD 4GMSL 3MRRB 4X6CA 1CFSA 4M7KL 2A9NH 3WNOA 2VZTA 3HUJA 2HYMA 5F96L 4ZYKA 4HWZB 1NGXA 5GRWA 1B6DA 2XRAH 4WGWB 3RL2B 2XZAL 1WBYB 2P48B 5IG7A 4L4VE 5FKAA 5IQ7H 3O3AB 1A5FL 4LCWA 5DGRA 4LPVA 3STZA 4NYLB 1TQBC 1XF1A 1A7RH 1S9KC 1F4AA 1QSFE 3G6DH 4N8CH 3DRQA 4JZJC 2YWZA 2EEAA 4G43A 3HI5H 2IPKA 2JB6B 2H3NB 3I02A 3RKPA 5CEXA 5GS1C 4ORGB 1C08B 1GCFA 4KQ4H 4U7MA 5D7LA 5I1EL 3BESR 4M7LL 2IAMC 2VWEC 5CFHA 3BSZL 1CQYA 4K3JH 1CXLA 2OZ4A 3FN0L 2JELL 5FXCH 2E7LC 3SQOH 5DD6A 1OGAA 4PJHF 4KRPD 5F9DC 1XF4A 3MLSH 4LRIC 1E28B 1RIHH 3KR3H 1AGFA 2B4CL 3KPPB 5A3ID 3CIQA 5SWSD 3NCFB 1KCUH 2A1WH 2ATKB 3FT3A 1DEEA 2W9LA 3EHBD 4NKIH 3RWGB 2YS4A 4OLEA 4I9WD 5GGUB 1D7FA 4K9EH 5D96C 5D2NE 1DQLL 3WE6A 3S36H 2H32B 3JTSB 4LLQB 1K4DB 1ETZB 3QG6B 2L7JA 3K7UA 3ZTNL 4Z7UA 5GS0D 4HEPG 4M9OA 2WP3T 1FN4A 3TV3L 4LLYB 4XMLH 3KPLA 5CINL 4HS8H 1L0QA 5F6HJ 3HMXH 1AD9A 1YYLH 1RZFH 1WSST 4MSWA 3BZEB 3EJYC 4DFIA 5DRNB 3S8WA 2DAVA 4KK6D 2QR0B 2GTWB 2ENYA 5EO9B 2X7LB 2PYFA 4ACPA 2VL4A 4BSVB 4F7TA 4PJHE 3G6AA 2WNGA 3Q1SL 3DXAA 4NCDA 4PBXA 4ZSOE 5I8EB 1RUPL 3FTGB 5IHBA 2FB4L 4OGYH 3B8SA 2I07B 3DETC 2R8SH 3VFNB 1MJJB 1B0GB 4H88H 2YBRA 1A7QL 1F2QA 3SE3A 8CGTA 3HNSL 3JUYA 4TSCL 3SN6N 4WUUD 1IEBB 1B9ZA 3FQTA 3SHSA 4WWKD 1KACB 3DVNB 3QPQD 1ZHLB 1VFUA 1PZ5A 1OAKL 5AZ2L 4S2SA 3OAZK 3TCLA 4V2BA 1H5BB 3FQRB 1ZT7A 4JLRA 1FFNA 2XIDA 1V3JA 5FECA 5TF1L 4EBQH 3N1GC 1I9IL 1DBKL 1G9NL 1NLDH 4F57L 32C2B 3QHZH 3KWWA 1K6QL 2DQCH 3HC4H 4HJJL 2Y36H 3E0GA 1OWRM 3K46A 1IGYA 5KBNC 4BH8A 4F7CA 5K9QG 4YFDB 1WWAX 4XB7A 4OZFG 1U8IA 2EDYA 5CD5C 5CGYC 1BJMA 4ESKA 1E4KC 2Q7YB 1FNGA 1R3LA 1XFPA 2B8OT 2OJZH 5ILTL 4P2YA 2V2TA 1GXEA 1F4XL 4L3EE 2VXVH 4HLZG 4Q9QL 2PXYA 1E4XL 3BWAB 4UAOC 5J6GB 5D7KE 1TQCB 4WHYH 1CGWA 4NOFA 4NC1E 4OCXL 1JZ7A 5C6PB 1N59A 1NBYB 1F58L 2R4RH 4UOW1 5JUEH 1X4YA 2HN7A 4TTDC 1QEWB 1FGNL 4KY1L 4AH2B 4DGVH 1EMTH 2XWJB 2MTPA 4FTVD 5FKPA 3VMOA 2XZCH 4Y1AA 1KTDA 3PHQB 1SYVB 2CRMA 2YSSA 5CUSH 5IMKA 2D7TH 3QWOB 5I18H 5INDA 3T77A 4CVXA 3MRHA 3OTTA 1VFOA 2VABB 4U1GC 2JIXD 1GOGA 4Y4KD 2EDXA 4ZOCA 2R39A 2ADFH 5CBAA 2AS5M 3FMGL 3PV6B 4XNYH 1NQBA 1JFQH 2Q1EA 4OZ4A 2BVPA 4ZUUA 4GKNB 5HYSA 2YPVL 4DAGH 3O9WA 5HHXH 4N8VG 4AZ8A 1RPQA 2BNQA 3RPIA 2EYSB 5C08A 1P2CA 1MVUB 4LVNB 4KU1A 4X98B 1T6WA 4F7PA 1N7ML 5DEFB 5DRXA 2EE2A 3K2MC 2BVOB 1MCOL 5MENA 3BPNB 3BH8B 4D0BA 1DBAL 3W2DL 2G9HB 4Y2OA 2KQMA 3QQ9D 2FIKA 1IVLA 2GK0A 4YHYB 1SJEA 4XRCB 2DYPB 3UPRB 1HEZA 3LS5L 4QOKD 1ACZA 3RVVD 4LCUA 5JIIA 3B5GA 4XX1E 5CSGA 5TDNB 1EX0A 4RGNB 3LSOA 3EGSB 3CD4A 4JPKL 5F97E 1Q9OA 3ALPA 4DGYL 3LAFA 1Z0MA 2XTJE 2Y07H 1G6RA 5EC2A 4GUPA 5DC4B 5DJAA 1G84A 4PTTA 3UTZB 2X1PA 1J8HA 5C0IB 4NC2B 4QHLB 4Q0XL 1KUMA 2AK4D 4EUPB 2JTDA 4KUCF 4DGIL 2Y7QA 1MIML 5EZOH 3MV8E 3BKCH 1JN6B 2XXCB 4P46D 3L9RB 3QUKB 1GGIL 3RVTC 4NRXB 2XQBH 1NLBL 5TE7H 3GBNH 1ZEAH 4EKXA 3WO4B 3MR9B 2AXFB 3BMWA 4EI5D 1RIVH 2YWYA 4JPVH 1U42A 2PF6A 5JOEA 3WFEH 1SYSA 2Z92B 4YR6A 2YPLD 3TGXA 4XCCH 3U0PB 1LQSR 5KG9A 3CLEH 4Y16D 4MWFB 1WCBB 4FQLL 1TZIB 5EO1B 1PQZB 5FYJE 2HJFB 3SKNA 4X9HA 3IETA 4MNQD 5HJ3B 1LEKB 5K93A 3ARBD 4LLWB 4PJAE 3D2UB 1IC5L 2CXKA 3PJSB 2XXMB 2FYYA 4LLVA 5CGTA 3BP4A 4O2CA 3SCMB 1MLBB 1JYXA 3P73A 3BIBX 3R06B 5IEHA 7CGTA 1GAFL 4R90H 3HZVA 4N0FA 5T1KB 3TN0D 3ARDA 3EYFA 3IJSA 4CJ1A 4MA7L 4U1SA 3QIWD 4AG4H 2A83B 5JO5B 4FG6C 5D2NC 1YJDL 1KELL 1I8MA 2UY7A 4Z5RB 2ZUYA 1T04B 1EZVX 6CGTA 4CMHB 1F6AA 2O93L 4PRIA 3PQYD 4Y5XA 3ELAT 2XA8H 3UTSE 5KS9A 2VLKD 5EULV 3AROA 4FNLH 4O5LL 1LEGA 2W1NA 2WBKA 5DC0A 1AXSA 4FZEH 2LE9A 4OFPA 4AEIH 3L3KA 2CMRH 2ZNXA 4YHOL 3DX9B 3HRZB 4YX2H 1DSFH 4EDXA 3MLYL 4JM2A 2ITCA 3ZE1F 3EOTL 1ZA3A 2YPKB 4WU5A 2N56A 4G8FA 1LO3H 1BPVA 5J8OA 3GSVB 4KKBD 3IDXL 1IFHL 1GGBL 4LGPB 3UPCA 3FFCE 1DVFD 2YC1A 4XH2B 1N6QL 1T89C 5GS1A 4QTIH 2NY3D 4HIIA 3SGKA 5J1AB 3DECA 4Y0GA 5IHUH 5AAMA 3QFJE 4UINH 2APFA 2J5LB 3GJEB 3VRIA 3HB3C 5E2TH 3RBSA 2EKSB 2JKXA 4Y7MA 4LSQL 1NBQA 3BXNA 4EN3B 4M1GH 4C4KT 2A6KB 5J57B 4P23A 5DGQA 3VD4A 3SDCC 4I0PD 1KIQA 1YMMB 4XP6H 4U1HA 3CC5A 5E7BA 3Q5TA 3TIDB 2DLIA 1NFDE 1EGJA 3FN3A 1MCFA 4JDVB 4YHLH 1XZ0A 2APWA 2IBZX 1YPZF 4GKZB 5AUMB 5T5FL 1NGYA 2AEPH 1BD2E 3PHOA 4IS6B 4GLRI 2D4DA 4LASH 1EFXA 1RZGB 3AAZB 2ED7A 4O00A 4QCIB 1UB5A 5EU7C 4YDLC 2HLAB 5KVDL 3GFUA 5EZIL 4UTAL 1IGCL 1XGUA 1U8KB 4NC1C 4GKSB 3OJ2C 2CIKB 3OKEB 2R0WH 5FYLH 4GQ9L 5GIRB 3AB0C 3MRJB 2VNCA 1PSKH 3E6FB 4NUJB 1BFOB 1S5HB 3QUZD 5FHBH 3OKNB 4XP9L 2Q86B 2X4UA 3ZDYE 1I8KA 4K2UH 4MNGA 4PP2B 4PGDB 4FFVC 3MJ9A 1OSPH 5I75C 1I9JH 1KJMA 3GSUA 3U9UB 5C8JB 4AY0A 1V7NH 4MJIA 3L7FA 4I2XE 4U1IB 2VSCA 1MPAH 1QPPA 4Y8AA 3MUHL 3AXLA 2GUOB 1FNAA 4JHAL 1QR1A 2ERJC 2W92A 2I9LA 3BN9C 5GRUH 3QRGH 1UZ8B 4RFEB 3RP1A 2ZCHH 2QADC 1OY3B 3RVWD 3E8UL 4OQTL 2FJFA 5DJYB 1V7MH 4M62H 3TBVA 3V7MA 3HI6L 2OL3H 4W81A 3FO9B 1CFNB 4DCQA 3V79C 3RY6A 3HE6D 2FL5A 3WD5H 2CLRB 2V5SA 4K8RD 2AW2A 5K33A 1X5IA 4ZUWB 3MUGA 2W9EL 3FQXA 4MVBD 5D1XC 2J12B 1W72A 3BZ4A 4ZS6D 2R56H 3MRIA 1G7JA 5JIHA 1CICB 2JJWA 1CVRA 25C8H 2GTZA 5ENWB 5E2JA 3V6ZB 4BZ1H 3VXSA 1A9BA 1JPTH 1DANU 3WFBL 5KVGL 5AWNL 4OFDA 4HD9A 3ZT6A 1X5YA 2DIJA 3MRLB 1DBBL 1XF3A 4QHMA 1A9EB 4XXCC 4IJ3C 5C0FB 1WWBX 4KDTC 1XGYH 1EBPA 1I3GH 2XTJC 5I71C 2YD4A 1TMCB 2K7QA 4WO4A 2ILLA 4U1LB 2WINB 5HI5C 5IF0A 4I48A 3V6OA 3G5XA 1INQA 2IPUK 3IDGB 1FBIH 2EXYC 1U2CA 1FLRL 5GRXG 4NC0B 1HSBA 2UUDH 4PRNA 4OV5B 3CFJB 2VB5A 1PG7W 5B39B 2OR8A 1S9VB 4P49A 3B9KD 3MNZB 4XCYB 4PJXA 4KTEH 1M1SA 1GGCL 2W38A 1DP0A 1YQVL 4HUXA 4APQC 1ZGLA 5EFIB 4HT1L 4LARH 2AV1A 2EYTB 1P84J 4U6HA 1CXIA 1QRNE 1UKSA 1FCGA 3GM0A 4V1DE 1G1YA 2OJEB 4KVCL 4UBDD 3ECBA 4MD5B 1KB9K 1WICA 3T0EE 1RFDH 1TNMA 4RDQF 3RZCA 3C8KB 4FFYL 4P2RA 4PFEA 1YJDC 1AI1L 3D3VE 5DUPH 2R0ZL 4JANB 2EXWC 2X4RB 1YY8A 4GBXD 1KOAA 5C0JB 4ZNCD 2FEDC 1WK0A 3HPLB 1IGFL 4R0LA 1QFUL 4RMRA 3W9DB 1T03H 5ESAA 1CFTA 2VDQL 1MRCL 4HG4J 1RMFL 1A4JA 1YEEH 4P5KB 3V0AC 1Z5LA 5C2BL 1JZ5A 4WY7H 5DT1H 3CSGA 1TPXB 3X14A 3H6JA 3BDYH 43C9A 1U8NA 1KC5L 3KYKH 2V17H 2IH1B 4E41A 3O6FA 4KMQA 4RGND 2HAZA 1A6PA 1IAIM 1WBXB 1EAPB 5E56A 2C3WA 3ILQD 2HJKA 1L6ZA 4R7NA 4WEBL 4ZPTA 3O3DA 4OZGE 4LCCB 5DVNA 4NPYA 1TJHH 3QDJD 3GK8L 3DRTB 3QFDB 1JZ8A 4ENEC 1SJXA 4NO2A 3TH2T 1SBSH 1U6AH 1N6UA 2HMID 1QSZA 5KW9H 4P3DB 1HYSD 3MLWH 5F88A 4L4VA 4CRPA 3CFEB 1MLCA 2DI7A 5IQ7L 4HMDA 2MCPH 4KJQD 4PJ7F 4LPTA 1RJZA 3VXUD 1QSFA 4ZOBA 3QQ3A 1A7RL 1MAKA 4GT7A 4N8CL 4ZFZA 2VLLA 3HI5L 3UTTB 4RGMC 2IQAB 3CSPA 3H42H 4ZUVA 3F5WB 3K81A 3VXOB 4KQ4L 4K3JL 3V4UH 3LVEA 3QZWB 3SQOL 5E94B 3AMLA 4CBPA 4NQED 2IWGA 2CXGA 5I8OH 5B8CB 3UTPE 2AJ3A 3DVIA 5DJXB 5EOCL 3KR3L 4TPRH 5IMOB 5MEOB 4LVHC 3HLAA 1VA9A 1JHLH 1MEXH 1T6VN 4MD4B 1KCUL 2C7UB 5F9AC 2P42B 2A1WL 4QGTA 4WI5A 4L4TD 2ZOKA 5F1SA 4X8JB 4NKIL 1SM3H 4M5YH 5D2NA 5DHVA 4PJ5B 4HKBA 4K9EL 1GZPA 3HZMB 1LO2L 3BW9A 3EDEA 1K3IA 3W0WD 4JFEE 3QUXB 1ZVHA 1WT5A 4XZUB 4NO5A 2XWBA 2VLJB 4ODVH 2H2SD 4XMLL 4HS8L 4D0CB 3CFCH 3BGFB 4R2GD 1MRDH 1ZHNA 1DQJA 3MLPA 1MIEH 4FQHB 3HMXL 5D70H 4P2QB 3EO0A 3TEUA 3VGEA 1U91A 1YYLL 2DN7A 1RZFL 4PY7B 3RIAF 4QTHA 3H9ZA 5C09D 1VKXA 1UH3A 4Y4FB 5IB3A 1CD9B 1FNEA 2F5BH 2KBGA 5HVFB 1Q9LA 2B1HH 3T4YA 3MGOB 4KI1A 1BJ1H 5LQBL 3DMMB 5F9JB 4IMKA 5SV4A 1U3HD 1M71A 4QRPA 2WP3O 2ZUQC 3VDCA 4ODTH 1BQHA 4PJCB 4OGYL 1G7QB 5BRZA 3VFOB 3BRFA 4QXTA 1BVZA 4PJDA 1G6VK 2BSRA 5D1ZB 3PDGA 4MA1B 2DOCA 3OJMB 3T0VA 1QHPA 5FM4A 5HHQB 1JZ6A 4JHBA 3NTCL 5CILH 1KPVB 2DLEA 4HBQA 4H1LA 4EBQL 5C86A 4GRWF 5L88H 4ZDHA 1ED3B 2NW2A 1NLDL 4M00A 4MCZB 2B0SH 1DE4B 3MZTA 3VA6A 4JFDD 3L5WA 5KANG 2D7NA 2PO6B 3TO2B 2NLJB 3QIBC 2A6DA 3IJHA 2F54B 4DK6A 3OBAA 4X4ZA 4F3FB 4RISH 2MHAB 1VESA 5GISH 1MHCB 2OJZL 4RAVB 4RMVA 4HPYH 5IJKC 1HHHB 4M9PA 4X6DB 1MCWM 5DO2D 5F3HB 1T1YB 2EDJA 1FJ1A 4HDIB 4POYA 1IMHC 2FD6H 4KJYB 4CVWA 3C08H 1F4HA 2E9WA 5M7QA 2MSPA 4YGVB 3VI4F 2R2HB 5IFHH 5F7WC 1MELA 2WIIA 1KLUB 5JUEL 5I19L 5L0QC 3SE9H 1YEGH 4FXKA 5CHNB 2CK0H 2EDDA 4P4KA 4DGVL 3RJQB 3UAJC 1C1EL 4RFNB 5HGBB 2XZCL 5DQJA 3LB6D 2DI8A 2Y9RT 5CUSL 1T5XA 3F7YA 5E6ID 5I18L 4C58B 1I8IA 2C3VA 1CFVL 1JHTA 3T0EC 2GJ6A 5FO8B 3U36A 1NAMA 2WUCH 3GJFA 3IDIA 1JF6A 2ADFL 3SDXF 4G6JH 3AU1B 4MJ6B 3CDCA 4XNYL 4S1SH 2D31A 3NFSH 3QUYA 4PLJC 1KNOA 3UJJH 2J8UE 2QSCH 4NRZA 4DAGL 3G08A 5HHXL 5HVGB 4O2FB 4RWHA 4I5BA 5C0GB 3PABB 5E1AB 3BPOC 5DHXB 4BKLB 1X5KA 1MRFH 5ANMA 4U4BA 3SOBH 1T1ZA 4HPOH 5J13C 1DBMH 1CICD 5C1MB 1KIUA 3GB7A 4Q9BA 1IGML 3VI4E 4NO0B 1CK0H 2ZP0T 3QXDA 4M8QA 4XXCA 4F9PC 5T33H 5JW4M 1KLGB 5ALBH 4PJBE 5FDYA 4HHAA 3IRZA 3C09B 2OR9L 1RJLA 1RJCA 3FO1B 4H5SA 4N5ED 4YFLF 3D39D 3WUZA 2Y07L 5A43C 1YEKH 1FZJA 4PJIA 1NC2A 5I1HH 1JBJA 4RSVA 5M94B 4WW2C 4HUVB 2AJSL 2ESVB 4NKQB 3SDXE 4CAGA 4ISVB 4GAGL 5EZOL 5GS0L 3ABZA 3UTQA 1UXSA 2XQBL 4OFVA 5TE7L 1ZEAL 4KJWC 4MJ2A 2K1MA 2YXFA 3WN5C 1QFHA 4BFIB 2H8PB 2Q76A 4XAKD 1P1ZB 1RIVL 2VO5A 2CUMA 5GZOD 4XVUC 3RTQB 4JPVL 3B5HA 1FGVH 3MRKB 3UC0H 4NN6C 3WFEL 4DVRH 5F9WB 4XCCL 4Z0BH 1P84K 4BA8A 1V3KA 2MKWA 3CLEL 3NA4A 5E8OA 1T0MB 5LAXA 4JO2L 2BMKA 4GG6B 4EVNA 1DL7H 1QVOA 3MRDA 1C7SA 5F89B 4PJAA 2WBJA 3MOQA 3FB5A 1F13A 1MSPA 5A2LH 3BDBA 2IADA 1L0XA 3ARFB 4JREB 4XMKH 1PEZA 1MI5B 1I1AD 4R90L 3GSQA 4Q74A 4PGEB 4GQPH 3I6KA 5E8EA 5HYQB 2R1YA 5TDPB 5ID1B 2UWEF 4AG4L 5DK2A 4J3XA 4P48A 4OD2B 3NIDF 1TTGA 5ADOL 5MHSE 3VG0L 1A6ZA 3EAKA 4G7YL 4BFGA 2EDQA 1MAJA 2ZUVA 4AENA 1NGXB 3UTSA 3DHMA 3WS6C 2XA8L 3NCCB 5IG7B 1EV2E 4WFEE 5SWZA 1Q9KB 2IANB 4FZEL 4LU5H 1LP9B 2B2XH 5IESH 3U9PH 1ROWA 5GGTL 4AEIL 4YX2L 4RFOL 1DSFL 3MFFB 1AR1D 4RAHA 2YK1H 5CEXB 3FT2A 4G3YH 4F9LA 1N5AB 2DM7A 4LP4A 5FM5O 1LO3L 4P57B 1SY6L 1Z9LA 3FFCA 4UOJA 2NYYC 4I4WB 1OGAB 5IQ9B 2OL3B 1T22A 3QFJA 1UH4A 3OQ3B 4ZO9A 1RK1B 2EDWA 1NFIA 3CDFA 4ELKA 5I73C 1XIWB 1QACA 2UWEE 4XVSH 4XPGH 3F7RA 4OIIL 3NIDE 1MFAH 2AV7A 3FT3B 1DEEB 3RWCB 4POZC 3MCG1 4XP6L 5FYKD 1NFDA 4YDJA 2J3SA 1XR9B 2A2QT 2X40A 2NNAA 3N9GL 3NCYP 5J11B 2DD8L 3BD3A 3CNKA 2XN9B 5EIVA 1P7KA 5FOJA 1DFBH 3QI9D <