1HILB

Structural evidence for induced fit as a mechanism for antigen-antibody recognition
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
total genus 40
structure length 214
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilB01
3FTGA 5C0CE 5FUOL 4KU1A 4I48B 5F96L 1IAOB 1P2CB 2P46B 3ECBA 4JRXD 5AUMA 3QUZA 3UTTB 5JOPD 4G8EA 4P49A 4HZLA 5CWSB 1Z0MA 4HIXH 2JJSA 1E4WH 1IC7H 1UB6A 3S37X 3ALWA 4L9LB 5EO9B 5E99L 3FQUA 3PE9A 1NSNH 1AGBA 2VZVA 2ZP0T 3VRLE 1UWXK 1KCRH 2FHBA 3MV9D 1T83A 3LS5L 3U4EB 4P59H 2ICWB 3MRJA 2ICWI 4FABL 2AI0H 3A6CH 4QEGA 4OZ4A 1UYWL 4RWHA 2KKQA 2X1PA 3CU1A 1NGXB 3O2DH 1FFOA 4H20H 4PS4H 4R26L 2YBRB 4XCEB 4RQQB 3B43A 4XXDA 4YXKL 1WFNA 5DRNA 1KUMA 4Z7VF 2DAVA 5E03A 3V5KA 2ATKB 1INEL 3QIBC 4D8PB 4F2MB 2ADIB 4UIMB 4EKXA 3DO7B 4NKIH 1WWAX 3QCVL 1KB9J 3DARA 4NO0D 1HE7A 1FYTB 1MRDH 1KNOB 2XWTB 4MSWB 5JMOC 1EO5A 3UBXI 5FF6A 1N59B 2YD2A 1Z9OA 4TTGA 4BSWA 1AD0B 1DTUA 5ITFA 3LVEA 2YA2A 3I6LE 3T0EA 4O51B 1N6VA 3IB4A 4TN9A 3P0VL 4OLVL 3PWJA 5ESAB 1CD0A 3ROLA 5IBLD 1VKXB 4IRJB 1GGCH 4HJ0C 1S9XB 2Y7QA 4BFEA 2GAZA 3NCFB 3VFMA 4Z7NE 1RZKL 15C8L 1FCCA 3QIUB 4YDIL 1HDMA 1J87A 2F53D 2W38A 4DGYL 3L5WA 3RIFF 2FNBA 3O4LB 5TQ0H 1DANU 3O3EB 3MRRA 4S1DD 1TVDA 5LCVH 1R6VA 5DHVB 3QUKB 3PWPB 1X6NA 2ED8A 5JOFB 4Y19D 4TVPL 3P11H 2HKFH 1FZOB 4Q2ZA 3Q0HA 3L1OL 3S34L 5K9KB 2RB8A 3DRTA 3BUYB 4DTGL 4L5FH 1IEAB 2NY5L 1JK8B 4ODHL 4GQPH 3MGTA 5IK3B 3QRFM 3OL2A 3BGMB 3VI4F 2BNRD 1T0PB 3QEQD 3B2UD 5ITBL 2GJ6E 4OI7A 1HILB 3HNVL 2UV3A 4NQSA 4H1LG 5ALBH 5T3ZH 4PPTA 2E3VA 2F54E 1QR1B 1DL7L 1WVZA 1JGUH 1MIML 1VADB 4N68A 2J7LA 3VXSE 1NCTA 2IPUK 1S5HA 2LVEA 3FN0H 4DKFH 1JGEA 4XVJH 5E2UL 5DMYA 3KPOB 5EUOE 3BWAB 1VKXA 3PGDA 2C5DC 5TF1L 5KTEH 3QG6B 1QSVA 4YK4B 1OSZB 4M7JL 1FP5A 3KPTA 4KKNA 5FHBL 1X4ZA 4LSVH 4MNGA 4U3HA 3QXWA 4G5ZH 4ODUA 4XBGA 5FF6B 1DL7H 5D4QA 3QUML 4K3EH 4Z7QF 4HWZA 4XP4H 2ITCB 4ZG1A 2MQ3A 3O41A 3BEWA 3KXFE 4JR9L 3MRHA 3UXFA 5C9KA 2Y06H 3IS1X 3QDGB 1NMCB 3V6ZB 1PSKL 3NCJH 1CGYA 2DMBA 5I1DB 4Y2DA 5IHZB 5KTEL 5EO1B 2EDEA 4K7PY 5D1QA 1JPFB 5GISH 4RGOL 1NDGA 1WEJL 3LN5B 5FDWB 1HXMA 5D7IA 5DF0A 2NY5H 3D3VD 3U46B 4NFCA 1N59A 1QPXA 4O2FB 4XPBL 4OI9A 2FHFA 2WLYA 3MLTA 4RQQA 1EMTL 4PRIB 4KC3B 4UIMA 1NEZG 1KOAA 3C9NA 2NR6C 2ZCKL 2Y36H 4OZ4B 5DMKB 1C08A 3V5KB 4I0PD 4PJXB 1U3ZA 1FZMA 1BAFH 4ZTOH 2IF7A 1KPVA 1JF5A 4IMKC 5DRNB 1PY4A 4YHML 3SJVA 1RZIA 5ENWA 4D0DA 3T4YA 1RU9H 1F90H 1RUAL 2E7LC 5DT1L 1NGXA 2H41A 1VEOA 3HPLB 4KTDH 2WBJD 5D1QD 1A6VL 4KTEH 2YPKB 2IEPA 5TH2B 3QFJE 3ZMRA 5SWZA 4CMHC 3T4AA 2WWMD 1WAAF 4FQIL 3HC4L 1CGWA 3BD4A 5HPOA 1ZXQA 3RNQA 2UVFA 4GO6B 2G9HB 1AGBB 1DSFL 4YO0B 1IGTA 4J3TA 1MHPH 1QR4A 3STLA 4X9FA 5HY9A 3V6BR 3SGDH 1FV1A 3DI3B 3WO4B 1AO7A 3ARFA 4IMKA 3KLSA 3MO1A 5HBBA 3D0VB 4OLWL 4HZAA 1ZSDA 1E6OL 1QBAA 1EJOL 1G0YR 3K8LA 5DD6A 3HR5B 3WUWA 2VXTL 4X7TA 4KMLB 5C0AE 3VFTA 1IL1A 1NFDB 3RDTC 1BVKB 1EFQA 2P8LB 3CSPA 3FQNB 4PLOB 3T2OA 3BYTA 1IM9B 5D93C 2DQEL 4HWBL 5J57B 4A6YL 4HPOH 1A6UH 4QOKB 1MAJA 3W9DA 4G9FE 4WU5A 4MHHI 4O2CA 3WDIA 4DFHA 1SJHA 3IU3A 1F3DH 3PWLA 5D7JB 2X4RB 2MNUA 5EZJB 1NGQH 1NC4B 3QCUH 1QEWB 4EN3A 2Q6WB 1D6VH 2DTMH 4Y5XB 1VA9A 4FQXA 4GBXA 4HC1A 5LQBH 4NWUH 3B2VH 2EDLA 4HXAL 4I3RL 4PRBB 2ARJA 1NL0H 3CNKA 1MFBL 3D3VB 3JWDH 4X4ME 5CBAB 4OB5L 3BH9A 2BCKB 3MV9B 1KLUA 3DX6A 3NZ8B 5KS9F 3E0GA 1QUNA 5T1KA 1DBBH 1QBLL 1C7SA 1CG9B 1BBJB 4JO1H 3G9AB 4OI8A 5D7IF 1XCQA 3QI9B 3QCTL 4RGNB 3QWRA 4OCYH 2A6IB 3L3HA 4XPHH 4HIXL 3NCCB 4ELKA 5D71L 3V6OE 5FHAL 1S7WB 2EEAA 5D7SL 3C08L 4YDIH 2DQJH 4YXLL 5FUOH 1PZ5A 4LLMA 1EO8H 4KZDL 3EJYD 5IMOA 3L3IB 4OB5H 3V52H 1NDMA 4YO0A 3O3AB 5C6TH 1YMMD 2F53E 1QSEA 1X3DA 4QXGL 4G80A 3U79A 1S7RB 4XMLH 4AL8H 2YXFA 4UNTA 1CI5A 4OIIL 2FJFA 3QH3B 1W0VA 1NGYB 4HS8L 3MOAL 4HIJB 1JMXA 4N1EA 1OAZL 2YUVA 5SX4I 4MYWB 5F93C 4FS0A 2A0LD 1RK0B 4WEUD 3D6GA 3QWRD 4G43A 2J3SA 4KGJA 5ENWB 2ATPB 2KQMA 1XF2A 1HNFA 4K23H 3DO3A 5E9DA 3JBG7 4XGZA 4X0KA 2WIIB 3LKQB 5JOPE 3MRMB 3ARYA 2R0ZH 3F7YB 4U6VL 1OF2B 1OGTA 2XY2A 3LY6A 1I7UB 4JFYB 3BKJL 1GHFH 1R5WB 4X7DC 5FYJE 3U0TA 4EN3B 3MV11 3LRHA 4JQIH 2XI9A 2X4RA 1CFSA 3ZLQC 4OZHE 1DN2A 5IMKA 1KT2B 3KPQB 3W9DB 3HZYA 1FNEB 1SEQH 5TDOB 3O81A 4LPUA 2EE9A 1GYAA 2CKBB 5DI8B 5HPMB 1IM9A 4ZSOB 3KVQA 1BFOA 1HCVA 4EDWL 1WZKA 4C58B 4HBCL 5F71A 3TJHC 4PJ9D 4PJ8D 2BNQD 3HR5A 4WUKH 3FONB 4OCMC 4YHKH 4GLRH 3P3YA 5I1GH 3RWJA 4RAVB 4KKCD 1VHPA 2DLFL 4KTEL 3QXAA 5B8CB 1IAMA 5DHXB 5BS0E 3C09B 1QRNA 1M1SA 2OR8A 4U1KB 4TRPL 1PAMA 4ODXA 4O02L 4HIIA 1P6AB 3PXHA 4G3YL 1UM4H 1GOGA 2NNAB 3OKMA 4KK6D 2DQDL 2OQJA 4X4XB 3JTTA 4MJID 4M62H 5T3ZD 2D7TH 5CGYD 5CHNB 1CFQA 3O6FB 1HILA 2H1PL 3H6JA 4Y1AB 2NY0D 4XH2B 1VPOH 2Z4QA 4UILH 4JJHA 5DHYB 1CDCA 3CX2A 3QEHB 5DQ9B 2Z8SA 1KGCD 5H94B 1P4BH 3MTRA 3V52L 3LDBC 4LLVA 4RRPA 5D2NE 2NXZD 2AEQL 5E70A 1WWWX 3SGKC 5GS0C 3BX7C 1A47A 4N0FB 1UXWA 3VXRA 1DE4B 4ZUVA 3MRBB 1CXFA 3MRRB 3D87B 3EAKA 4KVNL 5E8DL 5E6ID 5M95B 4MJIA 3MPCA 2DQIL 1VDGA 4M7LT 4DVRH 4POYA 4Z76B 3VFPA 3KLHD 4Y5VC 4X5WB 1DQTA 4OT1H 2EDWA 4WU7B 5IHZA 4KRMB 4PJBB 3DBXA 1A1NB 2UWEA 3OAZH 4ETQA 5JPNA 5I30H 4GQ9H 3D85A 1C1EH 2CLZA 2DQTH 3TYGL 5ITFB 1G6RB 3NIDE 4PG2A 4PJCE 2VC2L 1QFUL 3I50L 3GBNH 1XR9A 1YUHB 1CF8H 4MSWA 4Z7UF 3MROB 1LDSA 2Q86A 2Q8BL 1PEZA 4ODTH 3NAAL 1KCUH 4NHUB 1D5BB 2O5XL 3GMMA 4YFDB 4Z78B 1CDIA 2L4OA 4D8PA 5ESQA 1HYRC 5BS0A 3PGDB 5F96H 4OCLC 5CJ8A 1L6ZA 4I2XA 5IP4A 3MODH 5J1AB 4CAGA 4F7EB 1J5OL 4XNZC 1YMME 4GLRI 3MRKA 2XRAH 2KUTA 3RGVD 3JV4B 2Q7YA 3ARTA 5ALCH 5L0QC 1QKZH 1CL7H 2E5EA 4RMTA 5JW5B 2AK4B 1VB9A 3JWOH 5J6GB 1MJUL 1A3LH 1I1AB 3PP4L 3NACH 4PLJC 1WTLA 1CXLA 3RX5A 4IDLA 5F1NA 3TCXA 1OP3K 4JO4H 3ZKMD 1DQDH 4XTRD 4PJHB 3S4SG 4I4WA 2BVOA 4U05A 1J0YA 1JPTL 1T1YA 5DZOA 1T7VA 3NCMA 2Y6SC 4YK4C 5IVXF 2ICES 4J23A 5H94A 5BVPL 2VSCA 3MA9L 5D5ME 1RZGA 3PWPA 1EO8L 3VXTA 4JDTL 2ZUQB 5IBTH 1SEBB 5DK0B 3LN9A 4R3SB 5CP3H 4NM4H 3CFKB 3GI8H 4PBWD 5GRJH 4Y16B 2X4SB 2FIKA 1INDH 4QRQA 5HDOA 3RY5A 4XVUC 4HJJH 5F9DC 4X5XB 2GAZB 5AZ2L 1Y6MR 1Q9WA 5D72L 3VFMB 3ZO0A 1FDLH 4ZOCA 1AXSB 3L7EA 4JHAL 4RAUB 1RUKH 3VXUE 4ZD3H 1ZGLB 2F8XC 1GJIA 5BVJA 4R7NA 4FFZH 5T1DH 1RULH 4KHXH 4QHUB 3BMWA 1QBML 5GSVA 3EW3B 2ADJB 1AY1L 4J4PA 1I8MA 1F4XH 3CK0H 3NPZB 1TZGH 4NT6A 5CAYB 5KG9B 1C5BL 2IPKA 1KNOA 1T1WA 1MCQA 4UT7H 1N2RB 5EOQH 3IKCA 4OFYD 1JRHI 5HYQA 5HD8D 3JV6A 2Q76A 1UEMA 1HHKA 1LILA 4O9HH 1CGUA 2A73A 4GMSH 4YGAB 4FFZL 3LQAL 4XNXH 4AEHH 1ZTXH 3I75A 3MV7E 5EU6B 3ZSSA 4UBDD 2L0DA 4X6DE 3X17A 5IW6B 1S7XB 4XPGL 3H9SD 1R3KB 2NTSP 2X4UB 3TV3L 3AMLA 5J56B 3QUMH 2YD3A 2X70A 2DIJA 5D7JC 5GRXG 2HT2C 3CFCH 4Y2DC 3VFRB 2YUWA 4Z77A 3TA3D 4JHZA 3LEYH 4WO4B 5K93A 3E2HB 3WN5B 2O61A 1JPGA 1NBVL 2KH2B 4HKXB 4O2EA 2WIIA 3PDOA 3MA9H 1E27A 5DJDA 4X6EB 3G5VA 5CCKL 4ZUWB 3RGVB 4LLWB 5T1MB 5KS9B 3BSZL 1R24A 1MREH 1CL7I 1CXIA 3PGCA 5IVZA 3FO1A 5EWIL 5KZCD 1DP0A 4WJ5B 4LAJH 4D9QD 5L2JA 1V7NH 1PBYA 2DF3A 3PGFH 3CFBA 4PIRF 3SGJC 1P1ZB 1AHWC 2WP3T 2GQHA 5D1ZC 2YPVL 4OGXL 2C4FT 2QLVB 3NVQA 3N1QC 5ALCL 2XRAL 4XP9L 3WLBB 4PLKD 1Q94A 2X4TA 4WUUA 3DVGA 2ZSWB 5DT1H 2CGRL 4WHTB 1UCBL 5EZOH 1ERNA 1NCNA 4UMGA 3SCMA 1ZANH 1DLFL 4QNPE 2W60B 1S7UA 1TVHB 2HG5A 3QQ9D 1U8NA 3QDJA 5HHVL 1CT8A 1RMFL 4JY6B 1SVCP 4TVPD 4NJAH 3UTTD 3LN4B 4LVOB 1YMMB 4BFGA 3PWNA 5GRWA 4Q9QL 3GNML 3MV8D 1UKTA 5EFIA 3BN9C 5AAWA 3MV9A 3TESA 1YNLL 4RZCB 4CVWA 1E28A 1G9NL 3P0YL 4QRPA 2J5LB 1JYWA 3EOAB 3S97C 5I18L 3QQ9C 4MVBD 1CU4L 2R1WA 4YHYB 4HIHB 4DGVH 2D03H 5FA3A 3O9WB 1ONQB 1ADQA 3LZFL 5IV2B 1FO0H 3SY0A 1QD0A 1RK1A 1U8OB 2YKLL 3MYZA 2DLGA 4GBXB 1R3JA 1N5AB 3H9HB 2CRYA 3TIEB 1S7SA 3Q1SH 3DECA 4XBEH 3RX7A 1J9CT 4FG6C 5LWYL 4ELMA 1NC4A 1OGAE 5IB5A 3PWPE 3QQNA 4P57A 2AEIT 1ED3A 4HUVB 2FL5B 2HFEB 3SKMA 3QNZB 3LQAH 1MFCL 4MD5B 5I8CB 5CKAA 2QADD 4WW1B 2NTFB 3RWGB 4JGJA 4ORGA 5I74C 5M94B 3X13B 4K71C 1GZQB 4LLAA 2VDPL 4U1LB 1LO5B 4UUJA 1A5FH 4Z0XB 2EH7L 2AI0L 3A6CL 5DRXA 3T8XB 4EEEA 1MNUH 2BNQB 3EDDA 2HVKB 3QZWA 4MDJB 1AJ7L 4OLXL 3RVTD 3VMNA 5CEYB 4HT1H 2R0KL 4H0GA 1F6AA 1D3CA 4HPYH 4P2YA 5FKAA 3AM8C 1AI1H 3U4AA 1EERB 1D6EA 3CH1B 2QSVA 4Y5VB 3VFGH 5HHOE 1OAYH 1IQWH 1J18A 2IG2L 3C6SB 5T3XH 4J3WA 3HC4H 1RJLB 3KLDA 3L7FA 2NZ9C 3VFUA 2QKIA 3V6FA 2IPTL 4KKAD 4NO3B 4LSUH 5TH2A 3UTSA 1H8SA 3EO1A 1EFXB 5IBUB 5IROC 4KVCL 4ONGH 1UC6A 2AV1B 2HVJB 1A7PL 4D0DB 3CUPA 3O3BA 2ZPKH 3BZEB 1FZKB 4U7MA 3U1SL 2IH3A 4POUB 3HI1A 4MD4B 4BZ1L 1A6ZB 3LKPA 5T1LB 1I75A 2A74B 1VERA 4NC2B 5L6YH 1QYGH 3WNLA 4MJ4A 3WCYA 4ISVA 2P24B 2HMID 2HT3D 1ORQB 4PJGA 5KSAA 4Y19A 5DURD 2PYEB 1AD9B 1PLGL 1QKZL 2NY5C 4PRPA 1KPUB 3GO1H 1E4XH 1OM3H 2VL5A 3GK8H 3MJ9L 1INQA 5FDWA 3LN5A 5E6IB 1L7TH 5D1QB 4UU9A 3PP3H 1AGCB 3RBGA 1EAPA 3V6ZA 1JTPA 2JB5H 2X7LB 4D3CH 2E9JA 1U8PB 4BM7A 3CFIC 1X5XA 3FOMA 4HKBA 3RL2B 5JW3H 3D39A 4RBPH 5IVXE 4HQQL 4K3DL 2F5AL 3HB3C 4PJHE 4Z95H 3FFCE 1MFDL 1TJHH 1KTDB 3GBNL 5TE6H 1GGIL 5LGJB 5JPMA 3I6KA 3V4PL 4OCWH 1T5WA 4UQ2B 3MFFB 4MB3A 4MAUL 5C08E 1CFNA 2IFGA 4K7FA 5AAMA 4NIKB 5EC1A 4I0PC 1OWRM 3KPOA 3MLZL 2Q20A 2AXJA 3U1SH 4MJ6A 2Q3AA 1P5VA 5K9JH 4NN6B 1C16B 1N6QL 3OB8A 2Z91A 4MQXC 3SQOH 4XAKE 1MCNA 9CGTA 3ARXA 1QLEL 3S88H 5FHAH 1MVUB 2A6JB 3UYOD 5F8QC 3CCHA 4XCCL 43CAB 3PV7A 4WUUD 5DQDH 1U92B 3ZYIA 5AD0B 4Y2DD 1MJ8H 3IXTB 1IEAA 3EJYC 5L2KB 3MJ6A 3BZ4A 1MCPL 1NCCL 5JOFA 4EN3C 1HI6A 4PJBE 2ID5A 5BOZG 5EZLA 2J2ZA 3NIFF 4H5SA 1NFDE 1JIBA 4U2ZA 5JQ6L 3GSRA 1OTSD 3KLAB 3QWOA 4MNHA 2BX5A 2Y7QB 1Q9KA 1S9XA 2JJTC 5EIIA 1FIGH 4Y4HB 2IH1A 3RUGB 4Y0GA 1F4WL 2CMRH 5HI3C 4LGPB 2PETA 4HDIB 4JR9H 3HS0A 3EYSH 4S1RL 4GW4A 4BZ2L 3U0WH 3Q5YA 4A6YH 3BIKA 3DX9B 3NOIA 5D6CA 1YN6B 3UTPE 5IROA 4G5ZL 1UZ6E 1VEPA 4MAYA 4YHYC 5IJKA 3U2SB 3LPFA 4NKOB 1MHCA 3IDMB 2VB5A 5IFHH 3LKRB 3WKMH 2D4FA 2E6JA 1EEUA 5FOJA 2D2OA 3NPSB 3LRSA 1OCWH 5FK9B 1U3HD 4KI5C 4U31A 4OGAC 5C0CA 5D5MA 4OF6A 1F97A 5C7XL 2HN7B 4JM2B 4PRHD 5F8RC 1Z6JT 1FFOB 4PJ5B 4M7KH 4GXVH 4YFEA 2PN5A 3I2CH 2C9AA 4G42B 1PG7X 3CPLA 3UAJC 2YMXL 2VZ1A 4NUJA 32C2B 3PWUA 1WBXA 4JKLA 5DJYB 4NRXA 4ZUTA 3VGFA 1KPRB 1F11A 2MCPH 3NIFE 2WINB 4HLJA 1GZPA 4OZFB 5I71C 5D7LD 5DSCA 1DUYB 4LNRB 5TDPA 4MXWL 3ULUD 4FXKB 3ZYOA 5L8KB 1T4KB 4E42A 3R06B 3S4SB 4C56D 2VR9A 3O2VL 2VMFA 3E3QC 3QUZB 3UTTA 3T0VA 3U6RA 3V0VA 1UG9A 1IAOA 4I1NB 3QUMB 1BD2E 2GITB 4ZUUB 5D1ZA 5IHBA 2P49B 4PJ8A 2FJGB 2VDNL 3VFNB 2NXYB 2XFXA 4PJ9B 3VG0L 2VUYA 5DTFA 5FXCH 1SBSH 4M4RA 3WO3B 5EBLA 1CWVA 4X7CC 4UDTA 3OKDB 4LSSL 4EOWL 4P5TD 4QLRA 2D0GA 2Q3ZA 4HCRA 1JZ7A 1ZWIB 4PRPD 3ZHDA 4QRRD 2H9GB 5T5FL 1O7SA 5CLWA 1PVHA 5F1KC 2JJUA 4X6DF 1LO4L 4N8VG 4JRWA 3M17B 2XQYG 4KY1H 4Y4HD 1I7RB 5IR1A 4TQEL 4F33A 3LEXB 3GSQB 4PG9B 4QO1A 4GAYB 2BMKB 3OHXA 2OK0H 1FFNB 4PBVC 3GGWA 3MBXH 4U0RB 3QPQD 4OFDA 3HE6B 5F3BB 4M7JH 2P5ED 1MJ7H 4M93B 3TVMB 4PGEB 1YEIH 1J8HD 2IPUG 3P9WB 4WWKC 1JHKL 3BRFA 3RA7H 4P2RA 1NGPH 4AM0B 4O5LL 2HFFB 4WFFD 3DNKA 5BCAA 4HG4K 2N1KA 2I9LB 3RVVD 4WVRA 1KCUL 2AXGB 1JGUL 1MIMH 5ICXA 4HUUA 1HH9B 4GXUN 5D1ZB 3SBWA 5I75C 1MVFA 2Z93A 2NXZB 1MWAB 2VC2H 4LQ1A 4CU6A 3FCTA 3NN8A 3RWCB 2EXWD 4FG6D 3S5LA 3S96B 2CIIA 2B39A 5DLMH 1NUGA 3U36B 2YWZA 3MRPB 4XVTL 5F9JA 3C2AL 4PRDB 4E42B 1MHHA 4YHPA 2R23A 1A2YB 2A9NL 4MD0B 5TGBA 3HAEA 5KVGH 4BZYA 2FD6L 1PKQE 2IBZX 4PJFF 4FFVC 3ZHKA 5FCUH 1JWMA 5I1CH 1H3PL 3P11L 4UINH 3BIBX 1T89A 4JFHD 3QIBB 1P9MC 1KTKE 2BRRH 5EH1A 4YQXL 2VH5L 4NQVB 1MCWW 3QHZH 1TNMA 1A22B 2AJ3B 3BEVB 4YBLB 1OAKL 4AEFA 1U3JA 4JHBA 1EV2E 1FYTE 2AJSH 4R90H 2APTA 4JAMA 4NQDE 4XTRC 5IOPB 2ZWLT 3S35L 1IM9D 2OI9B 2AV7B 3RZCD 3WDHA 3ZZ1A 4UDUA 2HLAB 5F7LB 5AYUL 3KYMB 4HH8A 5EO0A 1DVFB 3LKRA 3BWUC 2P47B 3LQZA 1SQ2N 5CJXC 4M8VA 4LSPL 3H3PH 2XKUA 3WFBL 3FB7A 1CQYA 2EECA 3MOBH 4GKOA 2VXUL 4EI5A 5D6CB 1DQMH 5I8KH 5D1XD 4JRYE 4GS7C 1T20A 1WC7B 3BO8B 4JPKH 5C2BL 2LTQC 1RFDH 4OAWA 2XV6B 4C54A 3S9DB 2Z35A 4XP1H 4HWBA 4D0BA 1H5BB 2FEEI 4ALAL 2A9MH 2P48B 3SPVB 4LCWA 1RD6A 3UBXG 2PR4H 5I17B 2R1XA 5F9OH 5CEZE 4LU5L 3QWOB 4MNHB 3KLAA 2G5BA 4LSRL 1EEYA 3TYGH 2CRZA 4HF5L 2EDKA 3QISA 5DDHA 1IEBA 5EZLB 4J3SA 4XWGL 3N06B 2JELL 1A7RL 2A2QT 3MUJA 3IDIB 4I5BA 2OXGA 5KSUA 4F7MB 2HYMA 4JJ5B 1IGML 5LQBL 5T1LD 1KB5B 1IC4L 2X6MA 4DWHA 4U6XA 5EOTA 1QOKA 3ULSA 1CLCA 5GGRB 4JG1L 2ED9A 2FO1A 4G8GD 4YHKL 1ZLVK 1WV7T 3CDGA 4JLRA 2FO4B 4H25A 5FECA 5JHDA 3OKOB 3P77B 4PBXA 1JNNL 1JGDB 2BVYA 4RWYL 3BW9A 2JB5L 4YPGB 5T5NG 5HYSA 5I0ZA 1X5JA 2Z91B 3ZYZA 5I6XC 4RFEA 1EA9C 4LVOC 4PP2A 1UXSA 5A16B 2A1WH 4XMKH 2XZZA 3UTQB 3A6OA 1MF2H 1F4AA 1KB5L 2XWJB 2AK1L 3VFSB 2J1KA 4IMLB 4PRHA 3BPCA 4NGHL 2GSGB 4MJ5B 4D9QE 2P7TB 3EZ8A 5D8JL 2AK4D 1EHXA 4V1DA 1UJTA 2AABL 5ACZB 3I6KB 5HYSG 1YEGL 2XZQL 4JKPL 3CLFL 1VACA 1OAUL 1CICC 2R2EA 5CEXA 5DEGA 1NAKL 4OBSA 5D7LE 1JHTB 4AYFA 4LRIA 1AIFB 2AEPH 4GW1B 3D48R 2PW2B 4K8RD 3M8OL 3GSWA 1R5VA 1ZLWH 2NW3B 4L8BB 4NSKA 4LSUL 5CGMA 3MV01 1BFSA 5HJ3A 2YZ8A 1XGUB 2XN9B 4PJ9C 4PJXE 5AEAA 2VL5B 4FFVD 4PJEA 3LH2L 1IGYB 2QADB 5BO1H 4FXGB 3QJHB 1MFEH 3HFML 5DJ8A 2FLBT 3QXDB 5CJQH 3ZTNL 3DX8B 5MI0B 4BK4A 2VQUA 3OTTA 4QCIA 2XPGB 4WO4C 1IRAY 3ARBD 4BQBA 4I18C 2H3NB 2APXA 4JFOB 4GKZB 2PW2A 1A6ZA 2VAAA 3HI1B 3VXMD 4KQ4H 2AJVL 4PREA 3ZE2F 2R69H 4WI6A 5JTWA 4EXPX 5B38B 3UTSD 2FECI 3VFGL 1B4JL 2P7TA 1KC5L 4YNYA 5EUKA 3F12B 1Q1JH 4C55A 2VDOH 3ARGB 2HJLB 3KPSB 4A6YA 3V7AG 1AGFA 1CE6B 1EGJL 4KKBD 5TE4L 5EOTB 1HYSD 2WBJC 1UACH 3ARDA 2XACC 4Z9KB 1BJ1H 43C9B 1CTNA 4H20L 3SO5A 4R8WL 2XQBH 1II4E 4JPWL 4DAGL 2X1WL 2R2BB 3Q6GL 4Y1AE 3DRQA 3HRZB 1TVBB 4NC0B 4P5KA 3RTQC 3CDGB 2KBGA 5K59F 3KPMA 2R0ZL 3IETB 3LS4H 4W81A 2H45A 4JFZL 4M1DH 5DZLA 3ILQD 4WCYL 2GI7A 1A7OH 5I6XB 4I18A 4NRZB 1UKQA 4Y4HC 3U7YL 1NFDF 3IJSB 1F4WH 2CMRL 3O6MH 5E2WH 5GZND 4YHIB 4HGMA 4G8FA 3IDIA 3QDAA 2E7CA 3K46A 1FNHA 4PP1D 4D0BB 3P30L 1OAZH 2BNRE 3O6KL 1U8QB 3MJ9H 3QHTC 4Y4FA 4N0RA 3OMZA 2YWYA 5GGUA 3C2SA 1TETH 1ED3B 3IAPA 4HUVA 3TBTA 1CN4A 2OJEA 3OSKA 5HHVH 4R0LB 4LPXA 3O11B 5I1AA 4QT5B 4IJ3B 5KANI 4FQQB 4P9HH 3CFJB 3OKEB 4GRWB 5F6HJ 1LWRA 2AJZB 1DVFA 3KDMA 5FM4A 3T3ME 4YR6B 4YGVB 5LCVL 1QO3B 4UDUB 4NQCA 3C8KB 3MRQB 3UCRA 1ZT4B 2ZJSL 2YEZA 3LQAC 2R8SL 2NY1D 3SE9L 3LKNA 4TTDC 1M71B 5DUBB 5E7FA 2FX7L 3ARVA 4L1DA 5IB1A 5D2LB 3HPJB 4ZAKC 4KI5D 4NQVA 2PF6A 3LN4A 5I8EB 4MB5A 3HC3H 2HLAA 5E4IA 3GMNB 5BW7C 4PJ8C 3ET9F 4X6FA 5BQ7B 2Z9TA 1ZLUH 1ZVYA 3AS3A 5SWQB 4ZQKA 4X6BA 2OI9C 4XCNB 4LLYB 5FM8A 3LV3B 1WF5A 3OGCB 3P30H 5C9JB 4R7DA 1HK6A 3HLAA 3BJ91 4Z7VE 1Z5LA 3S5LB 1INEH 5FB8B 5JW3L 4EUPA 4LKXA 4XNXL 1T22B 1F2QA 3V4VH 4JO2H 4IHOB 4JFFE 5ID0A 4RX4A 1DBJL 4N0UA 2PW1A 3AUVA 4HFWA 1WFOA 2F54A 2X4QA 4JVUA 5J11C 4YWGL 3FO9B 3GMQB 5EC2B 4P2RB 5J7CC 1DLHB 1SY6H 3QFJB 3LHPL 4BH7B 1C5BH 2I24N 3FCTB 4OTXH 3TBSB 1NKOA 3QT2A 3FAWA 4MJIE 1URLA 2O61B 3P4OA 3LDBB 4U6TA 3ALXA 3Q1SL 1EGJH 5TE4H 3SJVD 4V2CB 3OF6D 3VFRA 2DB8A 2VDMH 3C6LB 1UJ3A 5DD5H 1I7RA 1F90L 1FNSL 3PJSA 4C4KO 2BDNL 1C5CL 2X4UA 4HUNB 5TFSH 3RWDB 3NMEA 4XP5H 1H3WM 5E99H 1AGEA 1T2XA 1X5YA 5IW6A 3T0EC 2QR0B 1GGUA 1ZLSL 1T03L 4HF5H 1Z9SA 2KZWA 2ZJSH 2D7PA 3RVTC 2IANB 4Z0BL 1G9NH 3P0YH 4NZRH 2F5BL 1EHLH 5EBLB 3ALPA 1XF3A 3BPNC 2BMKA 3OHXB 2J8UB 5KVFH 4GG6F 5IR1B 5LAXA 5DMGD 3EOYG 3KPNA 2RFXA 2WM0A 3AMKA 4I77H 1DVFC 3IKCB 1LD9B 3A0OA 4HX1B 4PRAB 2H9GA 5BS0D 1TCRA 2GITA 4ZUUA 4YHMH 1RAMA 1DBML 1FC2D 4PJ5D 1BJMA 4JM2C 5F7HA 2A6DB 3UX9B 1S9WA 4NKDB 5LXGL 2I27N 5BO1L 5DC4B 1G7IA 1XR8B 1PYWB 1A4KB 2EYSB 3CXHJ 1RIVL 3MACH 4NM4L 5ETUB 1WCBA 3LRGA 1AHWA 2LU7A 4WFGE 3LHPH 4X5XA 4Y5XC 4KJPC 2PYEE 1TPXC 4QRQB 5TDNB 5KSBB 4LPCA 5CD5C 4Z8FL 4PR5A 1WT5C 1Z5LB 4NRXB 1T7XA 4OM1H 5D2LE 4F8QA 4ODSL 1HHJA 35C8H 1FNSH 1D5MA 3GSUB 5ISZD 4KI1A 4ELMF 1U58A 3QIWB 4M9PA 4PJ5A 2PTVA 4L4VA 3HRPA 1N8ZB 1XGRB 2X4PB 5ALBL 4WFHE 3L3KA 1IC4H 4XX1E 1UZ6F 3DX7B 4S0TD 2A1WL 1QQDB 2VDRH 1LEIA 2P5WB 4OZGB 2MWCA 3PWVA 5IB1B 4GQ9L 3QA3B 3MBEB 1FRGH 2Z8RA 2XICA 4OKDA 4C57C 3S7GA 2HH0L 2I60L 3KYKH 1FYTD 5FUCE 4JRYD 4PD4J 2Q7YB 2V5RA 1KELH 3D9AH 3IDYB 4Y8AA 4UT6L 4LQFH 2HA1A 1HXYB 3BIKB 3DX9A 2BJML 5BJTA 1TNNA 4U1SA 4I2XE 3H9YA 4YR6A 5TPWL 2Z8VC 5FFLA 1RVFL 1I7TB 4P2QA 2HKHH 5GQBA 3S36H 1F45A 4BA8A 3C6LD 1S7VB 3BQUB 3H7BA 3TO4D 3U2SA 3CX5K 3G08A 5GGQH 1W2KT 2Q86B 1CZ8H 2H26A 5EIVA 5F88B 5D7LB 4AT6B 1YUHA 1XR9B 1KXQE 1TIUA 1I1YB 3HNTL 4KK9C 5FGBC 3HMWH 3LPGA 3HS0B 1FORH 3UJJH 3DBXB 3UP1A 2D3VA 1A1MA 1HI6B 2IH1B 1LVEA 4CVUA 3GNMH 1LO4H 3BZ4B 4EIGB 3D0LB 3EIFA 4UTAL 2Y72A 2Z0BA 2EXYD 3EOBA 3RIFK 1OARL 1N5YH 3U4BL 2B20A 4LAQL 4PJCF 3BPOB 4TNWK 5C3LD 1NGZA 4LRNL 1TTUA 3B8SA 3MXWL 4H5SB 5F72S 4P5KB 3SE8L 4RRPG 4GKSA 4HH9B 3MUY1 5IM7B 3TZVD 2R2BA 3EYOA 4P0DA 3VXRB 1NEZB 4JG0L 1G7HA 1QSFD 1AXTL 1OHQA 4YQXH 4QTHB 4PJ5E 2M8XA 1CVSC 1Z3GL 5LG1A 4G6ML 3K80A 5KSVB 4C59B 1R3IL 4Y5YB 3BKYL 4TUKH 1MLBA 4HEPG 1YYLL 43CAA 1J5OH 4E5XA 1JYXA 1JNJA 1NJ9A 4XI5C 1I3GH 1E4KA 3TNNA 3TV3H 3MFFA 1MVUA 1AE6L 1CL7L 3KYNA 5LGJA 1DBAH 5LKNA 3KJ4C 4QHLA 1KTDA 4M6AA 1N6UA 2DBLL 3VGAB 1NBYA 1BOGB 2P44B 4QHKJ 3TIDA 1T7YA 3WDJA 2XTJD 1G6VK 1CVRA 4G6KL 3BPLB 5C86A 5HHXL 2ILLA 5CKGA 4U1KA 2CR6A 4QCIB 4U49A 5B8CA 5JPMB 3MMEA 4R9HA 1D5XB 4UU9B 3MUHL 1K4CB 3OAUH 4KFZC 3EOTL 1DR9A 5DJ8B 3W0WD 2PCPA 3O0RL 4X9HA 1MSPA 4ZOAA 2PYEA 1I1FB 1MQ8A 4NRYB 1T0NA 4LCUA 1BF8A 4OGZA 2MHAA 2PR4L 1IFHH 2O26U 4XP6L 5B39B 4Q9QH 5E00A 1RV6X 3AU1A 1TQCC 1BZQK 3G5ZA 3HE6C 5T1LA 3BISA 1YNKL 3C5ZC 3DSFH 3OAYH 5C8JB 4ODWB 5I15L 4TUJB 1HIMH 5FKPA 1JHTA 2J8UE 1J10A 1AD9A 4P48A 5A40E 3QPXH 3OG6B 4MS8D 1M6OA 3VXUB 3CUPB 3O3BB 3U0WL 2FBJH 1F58L 1X7QA 5BRZE 3SO3C 1VGKA 5E1AB 5DRZA 2VIRB 4Y7MA 1RFDL 3L9RB 4BSVB 5F6IB 5ACZA 1RZ8B 5HYJE 1CLOL 1PGRB 1ZHBA 1FQ9C 5IBUG 2GSGA 4QWWC 1FIGL 1IKFH 4RFNB 4P2QD 1BHGA 1VFOA 4BQ8A 4NO2B 4YAQB 2D7TL 4LSPH 2BC4B 2BHZA 3HZVB 5ECJE 4NN7B 3QCTH 3BPOC 4MWFA 2FZ3B 1JFQL 2AV1A 4G43B 3B9KD 5IBTL 5MENB 2P5EA 5B4MD 3BW9B 4QKXB 1EFXA 3EO1B 3MLVL 2BHYA 4KJQC 3AFLA 3QJFB 3DGGB 3KNBA 1NGYA 5HI3D 3BP7A 3QHFH 2IJ0C 4DKEH 4QF1A 3B5GA 1RJZA 3IDGA 3OQ3B 4K71B 1T21B 1S7RA 4WTWA 3VXRE 3DUSA 3KHOA 1LE9B 1YEGH 1N4XL 3GIZL 4P2OA 4F7MA 4APQB 4XNZB 3QDMA 1MH5B 5I1IH 4XHJC 2UUDH 4KAQH 3BT2L 4M7KL 2PUQT 4Q0XL 2UWEF 3REVB 5IKCA 2JKXA 2W9DL 4G6JL 1Q0YH 4DQOL 4ELKB 4Z0XA 5CEZH 2BVPA 4KV5E 4LKCB 5D6DA 1T2QL 3G6AA 1KJMA 1Q38A 3HUJF 2DWDB 4FTVE 3WD5H 4KMTH 5KAQG 5E8OA 5E94B 3MUZ1 1PY9A 3WFHA 4JQIL 3IXAA 2BCKA 4LHUA 5DYOA 1L9MA 2CUMA 1NLBH 5GGVL 1XGYL 2WV3A 1HHIA 3R8QA 5ELIA 3VGBA 1TJHL 1L0XA 1I3UA 4NZDA 4H26A 5J6HA 1OD7A 5F1IB 3D1MC 1LP9E 3K81A 4M61B 2UWEE 3VRJA 3R1GH 2R15A 3U9PL 3H9HA 3MGOA 1HEZB 4M02A 5EFIB 1MJJA 2JB6B 3E6HA 1RK1B 1NMCC 4ZSOE 3DETD 3T08A 4ETYA 3FT3B 4DKEL 1FJ1B 3V5DB 3FO0H 4EQ3A 4LAQH 3CMGA 4IRJD 3H3PL 3WFBH 4NQDB 4CN1A 1ZMYA 4YBQD 4JY6A 3GI8L 1B0GA 2OMBA 3UMTA 2W60A 3MLVH 4EOWH 2XZAL 3T0BA 2KZ1B 2CIKA 4UILL 1E28B 1QBBA 4PTTA 4XWOD 2CUIA 4ZAKD 3GDBA 2V9QA 1BVKA 5C6TL 5HVFB 12E8L 2NZIA 3OR7B 3MBED 4FQ2H 2D0FA 4ZO9A 5D2NA 2VE6A 3NPSC 3TJEL 5C0BD 4PGBB 4JRYB 4I9WE 1XZ0B 4BYHA 1Q0XL 2GSIB 4KK8C 3GJFA 1FL6B 4F57L 3QQ4A 5AG8A 1JWMB 2YC1B 1E4KC 3HAEB 1M7DA 4ZS7L 1A3RL 4LEXL 5IVZB 5FYJU 5IG7A 2VDLH 2LFGA 1UM6H 5F9JB 3GBLA 1GGYA 2OL3A 1FSKB 5TE7L 1KJ2A 4ZPTB 4KMQA 1JMZA 3PDOB 5KVGL 1BM3H 1CD1B 1JL8A 4F9PC 1HQRA 2ICEB 2JE8A 3W9EB 3RIAF 2F9BT 4GFTB 3JV0A 3P4LA 1D5IL 4BKLA 4N1HB 1YECL 3CVHH 4NWTH 5J12B 5JR1H 2XN9D 2V17L 5C0ND 3TCLB 3SKUD 5C07E 5KW9L 3S88L 1TZIB 2F53A 3QEQB 5DHVH 1WFUA 5E6IC 4UOJA 1RVFH 4TPRH 2NX5E 3W0WA 4OD3L 3TBWA 5FCUL 3WN5A 2GCYB 1A1OA 4PG9A 4EDWH 3N50A 3UPRB 4B53A 3BPLC 3AVEA 3GMOB 35C8L 5H2BA 2C3WA 2X70B 2YD6A 4CNIB 4OT1L 3OKNA 2R4SL 3TZVB 1LEGA 3P4MB 1F13A 5IFJB 2D7MA 4JFDD 5HHMB 4AJ0A 1S5IH 2WUBL 4NZTL 1I8MB 4JRXE 4P4KD 5CP3A 1IAKB 1P7KA 5DRWA 1OAXH 1PEWA 4Y2DB 4KJWD 5I1JH 1A6AB 2VABB 3L3JA 4WW2A 1YY8A 3U48A 5L8LB 5JHDD 1TPXB 4G6FD 5CSZB 1YYML 3TGXA 4MB4A 1BGXL 1T1WB 1RZ7H 1U6AH 2FYYB 1S78C 2BERA 4LCIL 1SBSL 4OSUL 4RGMB 2VZ3A 4YDJA 4Y16A 5L0QB 3W81A 2ADJA 4JREB 3TN0C 3TO2A 1OWWA 1SEBA 5DK0A 4HHAA 4JFED 2BOCB 4Y89A 4O00A 4RMWA 4RSVA 3ARBC 3MUGB 5FOBB 2R8SH 3O2DA 4QY8B 5F6IC 4LCYA 2CK0H 5JQ6H 1DUYA 4Z18A 1QHPA 3THMH 4XBPA 4FMFA 1TJIL 4H1LA 4UTAH 3PQYB 3BN9D 5DQJB 2BVOB 1HCFX 1A9EA 5H37H 1SMOA 5D7KE 3WIIL 3VE0A 5IF0B 1DBMH 1WZ1L 4ZUTB 1KACB 4L5FL 1H15B 5KANG 3FB8B 3OAYK 4KKCC 4JQXA 3CPLB 3B9DA 4PJDF 1RZFH 4XMPH 3VXOA 1VCAA 1X4YA 3FFCB 4ONFH 1MCKA 2C7UA 2NY3D 3SE4C 3S37H 5D5MB 3VXMB 3BUYA 5EDXA 2BVUA 5E2TH 2CRIA 4OFKA 4IS6B 4K3HA 4N9OB 2F74A 2CUHA 5D2LF 4XP5L 3I02B 4XCYA 1ZVSA 4K2UH 4RGOH 3SQOL 3IVKA 3VWJB 4MXWH 2F58L 3LKSA 1JWUB 3ETBF 4NHUA 3L5WB 5SV4A 1RUQH 3HNSL 1FVDB 3MX0A 5AWNH 3RVWC 2VISA 1BREA 1FFRA 1G1CA 4GRWE 1I8KB 4JN2A 5DWUL 4LASL 3VA2C 2VDKH 5BW7A 4OTXL 1YEDB 1GGBH 1G6RA 4GW4B 3VA6A 4Z7VB 1OTSC 2HJKB 4XBEL 4NWUL 5ESAA 5BS0B 1UH2A 1UH3A 5EBWB 1DBJH 4Y4HA 1IJ9A 2SEBA 1F2XK 2E9WA 4HSQA 1RUQL 3HNSH 4WIQA 3RRQA 5HVHC 4KTYA 4DKFL 2RR3A 3D85B 5E5MA 2EYTB 3IFPB 4PUBH 2D4DA 2YUZA 3GB7B 1PW3A 4MCZB 1JI1A 5L6YL 1S78D 3H8NA 5I71B 3OJ2C 3VFPB 1NMAL 3EDEA 4M5YH 5C07A 3I9GL 4GAFB 1KEMH 4UI2A 1AY1H 1AFVH 3RUGE 5C3TA 1LK3L 3VMOA 4LVNB 1UCBH 1T1ZB 4OLZH 4TVSa 1A6WH 5BXFB 2MJWA 3V5HB 4CADB 3GIVB 1J8HE 3G6JE 1X5IA 5C0NC 3L5IA 2J8UF 4X99B 3V6OC 4R2GD 4NO5A 1XCTB 5IVXB 4X6DB 4XNMB 3GI9L 1CGXA 4QY8A 4UB0H 5CZVL 4Q97A 4L9LA 3QEHA 4FTVB 2V7NA 5DQ9A 5EO9A 2IQ9H 5FYKU 3JUYA 3H9SE 1B4RA 5DD1H 3QXAB 5CHNA 3WL9B 5GGVY 3H0TB 3WFEL 3FRPA 3TBVB 4G7YL 5JDSB 3FQTA 4Z7QE 4I48A 1L6XA 3GBMH 3IJYA 3N1FC 3OJDA 4QRUA 3C6LC 4NNPH 3BRDA 3LEVL 4PJ7F 1D9KB 5T1KD 2Y36L 3BD3A 5KSBE 2ZKHL 1MRDL 1QZ1A 3ZKXB 3BVNB 2BXZA 4E41A 4KGLA 2OSLB 4QXUH 4KUCF 1MWAL 1P7KB 1PQZA 4GRLC 3QUYC 4WWKB 2YA0A 3KPQA 3TT3L 4RMVA 1UWEH 4AMKH 4DZ8B 4XWOC 2EDFA 4EI5D 1WBZA 5HYJA 4RMRA 4Q9BA 4JFZH 3RX8A 1T66D 1UENA 4O9HL 1LEKA 2QBWA 4AEIL 2IMMA 2AKRA 3ULUE 4OGAD 3K4DA 4AIOA 3KAAA 5I76A 4HC1L 3CJJA 2CRMA 4Y19E 3ZYJA 5HGHA 1PDKA 2ZG3A 1HHGA 4J8RB 4Z95L 2AEWA 4FQ1H 3MRMA 3AS1A 5C0EB 5I9QC 1FL5A 1LDPL 1WGOA 3QDHA 4BUHA 5E8NB 1WLHA 3HUJE 5I8OL 1DUZB 5CP7B 3VRIB 2ATPA 3STZA 4HWUA 1I3RA 4ZNEE 1FO0L 5K9OB 3D39E 5KZCB 3QBTB 2GK0B 1DVFD 3C60A 4HMDA 4X9BA 5DO2C 2EH8H 2A6KA 2E6QA 4U1GB 1W0VB 3M1BB 4EJ1C 4PJXF 5FO7B 4XGZB 3SDXA 1KJ2B 4ZPTA 5CMAB 4P4KC 2R2HA 4POZC 1T0MA 3MLSH 3BT2H 4WEBL 4XX1G 4Y88A 2G75A 4XPAH 5IW3A 5T3XL 2ZUYA 3NGBB 4X8JA 1C8PA 4OV5B 3D3VE 2RQ8A 2FH6A 5GS1B 4N0YL 4PGBA 5TQ2L 3GHBH 1X5FA 4G9DA 2A6IA 3L3HB 2XKNA 1G7LB 5E6ZA 1GZQA 1JBJA 3T3MF 2ZOKA 1NGWA 4UT9L 3RAJL 2D31A 1NDMB 4GKNB 4PTTB 4DZBB 4F37K 1A3RH 2WANA 1W72H 4LEXH 5F3HB 2WIMA 1MOEA 1M05A 4E41E 5CMAA 1G9NC 3HN3A 3WS3B 1BIIA 2Z31C 4JPKL 5GSRA 1X5AA 3WEXB 5ICZB 3GHBL 1FJ1A 3G04A 3IYLW 4JZOA 3O45B 4M7LH 5IB5B 4F7CA 1SJEB 1GH7A 1PSKH 2M2DA 3NCJL 3BZFA 3MQIA 2UZIH 5T1KB 1HEZA 1U3HB 4PB0H 1H0DA 4HT1L 1R3JB 3ULVC 1OARH 2IQAA 2VDQH 1S3KH 3VRIA 3QPXL 2Q8BH 5D7JA 5E8NA 3MRDB 1IE5A 3DVFA 2VZSA 4EZMA 3UBXB 4H26B 1SY6L 2YD4A 4O2CB 5C0EA 4WU5B 4X83A 5B4MC 4RGNE 5CILL 2EDJA 4EDXB 2BXYA 2IQAB 2OR9L 1ZGLP 4CW1B 2XNAB 3WFHB 3WD5L 4EVNB 5JHDE 1LEKB 2VSDA 4NN5B 5K33A 2WNGA 4JCLA 3G04B 4JZOB 3L6FB 1A7NL 2VXQL 5GS0H 1NC2B 1GC1L 1ZSDB 1SJHB 4P46A 3MO1B 4KDTC 1YEEL 4H88L 3REVA 4P2OD 2A38A 4E41B 5JNYB 3MJ7A 1FAKT 3STLB 1FSKC 1Q9LA 4GKNA 4HXBL 3OXSB 4HC1H 5C08B 4JGUA 4NC1C 5I66B 8CGTA 3T0WA 2Y07H 3MNVB 4TUOB 3QSKB 3I85A 5AZ2H 4KJYA 2YK1H 2HJFA 3TBVA 2R0LH 2FATL 4GAGH 4WJ5A 2YPLE 2G2RA 4WI7A 5HHMD 1FVEA 4QRRA 1R3LB 3WIIH 4WENB 2VLRD 5CSGA 1MCCA 1LO2L 1ZS8A 2R2HB 4DCQA 4KK5D 4NO5B 1E27B 3RVVC 3CDYA 15C8H 4H8WH 4OZIE 1U91B 4MNQA 5IEHB 4M1CC 4F15B 1TJGH 5DD3L 1EHAA 1F3JA 5IW1B 4HKZB 3S36X 2XN9E 3IFLH 3QHZL 4PRIA 2UY6A 2CDGB 3NH7H 4WI4A 1R3KA 1A64A 4NFBA 4MA8L 3IDNB 3QUXC 4W4NA 4XPFH 1HXMB 5D7IB 1FZMB 3GKWH 3G5ZB 3GMRB 3WFCH 4HBCH 4AENB 4F58H 3Q6FB 3GB7A 1HHKB 5FUZL 1Z9MA 3O6ML 5HYQB 4G3YH 1MRFL 4MLIA 1QP1A 2DOCA 5IEKB 4S0SD 1WBZB 4RFOH 5HYJB 4XCFL 2DLFH 4XBGB 1NUFA 1JP5A 2VLLA 3RWIB 4OCRL 5JA8B 4DVBA 4DGIH 1E6JL 4Q6IA 3EDFA 1PG7H 3QXVA 4ODTL 1BX2A 2DTML 3MRHB 3EO0A 4ENEC 5B38G 2AAVA 2AP2A 1KCVH 5ABDE 1UB5A 3HUJB 3D2UB 1DEDA 3PHQB 4HKJA 3PL6A 2C4XA 2H2SD 3BE1H 3WHXA 5JDSA 1G6RH 1E4XI 5IMMB 2VLRE 2WP3O 4Q0XH 3HHRB 2YPLA 1QFPA 4F80A 1E6JH 1MELA 2V7NB 4DGIL 2F74B 4E5XB 1BQHA 3HI6H 3MJGX 3NZHL 2F8OA 4XNUL 5D2NC 5CBEB 1CXEA 2Q8AL 2DBJA 4U1GC 5CEZD 1OP5K 5DJXB 4PJHA 3IU4L 1ZHKB 5F1NB 4Q2ZB 4DW2H 2V6HA 3ZE1F 2B4CH 2DKMA 1S7QA 4S11A 2PKDA 2YPLB 5JW5A 1BQHG 4GKSB 4HH9A 2FJHB 4MZ3A 4ZFGH 5A2JH 1I3GL 3KR3L 3S6CA 1QFWL 3EFFB 1ZEAL 5DJXA 1ZHLB 1BZ9B 1LMKA 4RA3A 4WEMB 4Q58C 5DQJA 1N5YL 1WCQA 4B41A 4LLUA 3ARGC 4OCYL 4F9PA 1Z3GH 1V5JA 2OP4H 1G84A 1MCWM 3KXFA 4JFDB 5ESQB 2JCCF 5BVPH 1CD8A 3RY6C 3VI3F 2QSTA 4Q6IB 3F6IA 1ZT7A 4QOKD 1FNGB 5E5MB 5IMMA 5MERA 1KENL 1I1YA 3HAEH 4LARL 5DEFB 2XA3A 3SDDC 3FT4B 3FT2A 3P2TA 5D7JD 3W82A 1IGIH 2H26B 3ZL4L 5C0JB 2A0LC 3QUXB 2ZUVA 5A2IH 1U95A 2VTFA 3S5LG 3PWJB 1XIWB 4U1HA 4WDIB 4F3FA 1XMWA 4K3GA 1YEFL 4FZEL 2O93L 2W9LA 4O51A 5FGSA 1GGTA 4UIKH 4ZYKB 3O2WH 5CD3B 1TMCB 4X5WA 5F70A 4U1SB 1IC5H 3MRGA 3WE6B 4LSTH 4Z76A 1B2WL 1KELL 1LK3H 1YPZB 1NCWH 2CDGA 4WWKD 3ARPA 3RIAK 5JXAH 3D18B 2FWOB 3IVKB 2ADFH 1UXWB 2IGFL 4JPIB 1T6VN 3VXRD 1NAMA 4IOSD 3S36L 2ICWA 2DRUA 3DYMA 3TBWB 3GSOB 3ZE2E 2EYRA 1QACA 3WJJA 1BBDH 3FAXA 3RHWK 1IM3A 5GXBB 3WYRA 4IOIA 3WLWC 1RURH 2IMNA 1HOCB 2IAND 5DHYA 2ESVD 3IRZA 1FVEB 2XYCA 4YIQB 3MRJB 4U6HA 4G8EB 4LDEB 3K1DA 5GIRB 2OK0L 3ECBB 2XZCL 4N5ED 3GSNH 7FABL 5TDNA 5T3XD 5F7DB 3MZTA 5KN5A 5KSBA 1LDPH 1NAML 4XBPB 3AXLA 3TP4A 1WCBB 3KWWB 3OXSA 5EU3A 1XF4B 5AWNL 4HK0B 3UZEA 1QRNB 1UB6B 1MLCA 3TO4C 3DVNB 3GHEH 3GM8A 2JCCB 1YJDC 5ADOL 3J7HA 1ETZA 1KC5H 4JHWH 1Y0LB 4N0CD 4AIXA 4QHNB 4ORZC 4TUOA 3FONA 4GRWH 4FQCH 5EU7E 4EVNA 3IS0X 2ZCKH 2JJVA 1G7PA 1NEUA 5LAXB 2IALA 1JWSA 5HPMA 5JNYA 4OUUA 1ZA3B 1Y6NR 1ZGLM 2DI9A 5L9DL 5HTSA 1BD2D 3MBEC 4XMPL 1W0WB 3A6BL 4UOW1 3HE6D 5F1OB 5DRWB 4JO3L 1AGDB 2VKXA 5HVHB 1LHZA 1ZKAA 5J11B 2HT4C 3MRIB 3RWEB 5IQ9A 4N0YH 1EUUA 3KPRA 4XPTH 3T65B 1N7ML 1LEGB 1CGTA 1E4JA 3NBNA 1U3HA 2FRGP 3AREB 4CW1A 1SJVA 1MEXH 4IDJH 2QQLH 2GJ6B 4UQ3B 2MTPA 4YDLC 1MFDH 1KEML 3DMMD 5E5RB 3P4OB 1F8TL 3G5XA 3W39B 3MRDA 1LO0H 1UADC 2EKSA 3C5SB 4FFYL 3I2CL 4L4VE 2Y5TA 3OKKB 1WICA 3QEQE 3VWJD 1XF2B 2BOBA 1I1AC 4OJFL 4U6YB 1H0DB 2CKBL 4MJ2A 1UFUA 3QCUL 3B9KB 4N0UB 2PXYB 3NCEB 2L7JA 2K7QA 5SWSA 3KYAA 2EC9U 4TSCH 4CJ1A 3QG7L 1JZ6A 1U8KB 3MNWA 5FB8A 4JZNA 1BIIB 1KJ2L 1R3HB 4L3EE 3CXHK 4B0MM 4LRIC 1W8NA 4G80B 2K7PA 3PUCA 5GZNC 4C56A 3HLAB 3BP6B 3O3UN 1B9ZA 2EE3A 3OWEA 3ESVF 5LGHH 2JJSC 2ZUQC 4PJFA 1N64H 5DK2B 1NGPL 4R96B 5ADPL 3ARFC 1LE5A 2CLVB 4JPVH 3SCMC 5F89A 4APQA 2D31B 1V05A 5IMOB 5JO5A 4MCYA 1KIPB 2BSSA 2X4NA 3MLXH 4IRSD 3HE7A 1MI5D 5C09D 4YE4L 4G9DB 3WIHA 3UC0H 3BUTA 3I3BA 3SE3A 3IAQA 4WFHD 5GS1A 5D2NB 3WNMA 4X8JB 1BBDL 5ERWB 5FM5O 3NABL 4KVCH 4QXUL 3MC0A 2DD8L 4KXZH 4LLQB 1P4IL 4XC3L 3LKNB 2FZ3A 3CZFB 3K4ZA 2OS7A 4ZFFB 2PTTB 1B88A 3MRQA 3ULVD 4FQIH 3W39A 1WUNT 1BFVL 4YGVA 3VWKB 4JFHE 2AS5M 3V5DA 3KDMB 3K2MC 2DM4A 3C60B 2B1HL 3QP3A 5DJ0A 3FL7A 1HKLH 3SOBH 2BNRA 3K1KC 2VXSL 4P23B 3VI4E 2V2TB 4LMQI 2AKRB 1L0QA 5DRZB 1I3RB 3SBWC 3B9VA 4WHDA 4LU5H 2OJZH 3CSYA 1QEWA 4ESKA 2VRAA 4WTZG 3VXSD 3PWLB 2BY1A 3EKCA 2HTLD 1G7JA 1IKNC 5GRUL 5SWZE 4AZ8A 5IUSA 5BV7B 1KGCE 2COQA 4NQEE 1NPUA 3MCLH 2EIZB 4FQHA 3AU1B 5HGBB 4Z7WE 1Q72H 1U8JA 4GW5A 5DVLA 1AXIB 1HKLL 2ZUSA 4LCUB 3EFDL 3PNWA 4X7SL 1UJ3C 1FN4A 4QRUB 2DIBA 4NP4H 1MNUL 3W2DH 3RGVC 3CFDB 5GGSA 1WBYB 4HS3B 1BPVA 1D5XA 3I6GB 1JRHL 1FV1B 3L5HA 2FSEA 1A7BA 3IGAB 4K55A 3HKFA 4OIAA 1AKJB 1A6TB 4PUBL 1IVLA 1C12A 1IGTB 4PV9B 3RNQB 3TPUA 5F9WB 2J6EA 1RJZB 2VDOL 3IDGB 5H35B 2D7OA 5GIRA 5HHPB 2WK2A 4Q6IC 4PGCB 2CH8A 4HMEA 2Q8AH 3DMMA 4YIQA 4YC2B 3CSBA 1UT9A 2AVGA 3H3BC 3QDMD 1JGVH 3FN0L 4FRWA 5AYQA 4NJAL 3T2NH 2VDKL 3S3JA 2GJJA 2EYRB 1EDQA 5CINL 4FQJH 1QYGL 4W6XB 4ZUSB 3I3DA 5C70A 4JFXA 4WW2C 1KCRL 1G7HB 1JPST 4CADA 5LXGH 3FQXB 1LGVA 2XPGA 3CH8A 3LB6C 3V7AE 5DJZB 3C9NB 3HMXH 2W1NA 3EYOB 3U83A 2BK8A 2J4WH 3PV6A 2X09A 2QQKH 4PJCA 5JW4Q 5SWZD 4JQXC 3RNKA 4HS6B 3GJEA 4U1MA 4FQLL 4P3WA 5C07B 1SM3H 1ZAGA 1FGVL 3KJ4B 4PJEB 5DJ2B 2GTWA 1GXEA 4OKVB 2P8MB 4YZFE 4EUPH 3K7UA 5EBWA 1GAFH 5I1DA 4WI5A 1BLNA 4F3FB 2PNDA 3QDGA 2B1HH 2OM5A 2GFBB 2NX5D 3MLYH 4G6FB 4NRYA 4Y2OA 2RAMA 2EEDA 1KENH 4E41D 5D7LA 4AT6A 5IJKC 1JFQH 4YDKL 5DEFA 1FVDA 4MNGB 4DKDC 3IDYC 4Y4KA 1A9BA 4M1GL 4ZXBA 2NCMA 1I9RL 1JTTA 4OF5A 3VWJA 1MY7A 2R1YB 2QQQA 4PG2C 1WITA 3VXNB 4JY4A 4XCYB 4MVBC 2HJKA 3OKLB 4IMLA 4JM2D 4PRHB 4RISH 3SE4A 1N6QH 2X9WA 3GSNL 7FABH 1MPAL 4GAGL 3SDAD 2HTKC 3P0GB 2R0LL 1SVZA 3JVGC 1YEJL 4DW2L 3WS6C 3FO0L 2M1KA 4OZHA 1KEGL 2X4OB 5E9DE 5CS7A 1KFAL 5DMGC 4LK4A 4RWYH 4YPGA 3IFNL 2VLME 1YA5A 2GIYA 3RTQA 3KYNB 4XHQA 4C83B 5TE6L 4MQTB 3VXPB 3DX7A 4OD3H 3I84A 4X4YA 4IS6A 3F62A 5A1AA 5HGDA 2BRRL 2NY2D 5J8OA 3VXMA 1N8ZA 1XIWD 2DN7A 1QFUH 3I50H 1OGAD 4H1LB 5CBEA 1TCMA 1QRKA 2APWA 2YK1L 3FZUD 2QQNL 1FZOA 5J3HC 1U58B 2DLTA 3QIWA 4YHLL 3EYUL 3EDKA 3VFWA 3LKOB 4I5BB 1DFBL 4ZFOB 4XWGH 2BOCA 3BKMH 3QUKA 1HHJB 3C2AH 4QXTA 3U7AA 3TO2B 3JVGA 3PXJA 1FG9C 4JANA 4GG8B 3FB6A 3IFOA 2LE9A 3PF2A 3SGEH 1HDMB 3WXVH 3PQYA 1UM6L 1RSFA 1YJDL 5CIPH 1MRCL 2R1XB 4LHUD 1PZUB 4Z7UE 3MUGA 5FOBA 3IJHB 3F65A 4WUUE 5C0BB 4LCWB 3QEUB 1BX2B 3MV8E 4WW2B 4RMUA 4TSAH 2H2PD 4N8PA 1D5IH 2H32A 3X12B 1XR8A 3MSPA 2OR7A 5I1HH 5I8KL 1J0JA 3HFMH 4BH8A 2C26A 4YDJB 5JMRA 2CDEA 1EUTA 2YD9A 4P9HL 2UYLA 2D7QA 1H9VA 4RIRA 4F37F 4G6JH 2PXYC 1EVTC 5HHNA 3QQ3B 5F9OL 3V9FA 1S7VA 3WFCL 4F58L 2CD0A 1T83C 4HGKC 2C1PA 5IQ7H 4KRPD 3VFOA 3BD5A 2ATKA 1CGVA 4DGYH 3HE7C 1CD9B 3QCVH 4JHWL 1MCFA 1YDPA 1AGEB 3IAGC 2VXUH 5HYEA 5C0DB 4J12A 4L8CA 1HINH 1UWGH 5IB3B 4XCEA 1CICA 5IOPA 4U1IA 5F7YC 2EXYC 3MBEA 4BKLB 4HKZA 5E8EA 2UY7A 1GAFL 4YBQC 1LEIB 1F3JB 3TYFA 4CRPA 4PJIA 1OQOA 3ARED 3WXVL 4J3OC 4I0PA 2PO6D 2W92A 2J12B 5IB4A 1DLHA 5JZ7C 1TENA 2NY7H 3DMMC 5E4EC 5JA9A 3W0WE 2I07A 1ZK9A 1IGCL 1K6QH 1NCBH 2KPNA 3MJ8B 5TFSL 1BQSA 4XVTH 3V0WH 3C60D 4QRRB 1RUPH 4GMTH 4W4OC 3ARBB 3QDJE 3U9UA 2X89A 1CGSH 3GFUA 1I1RA 1P2CA 2HKHL 1JZ4A 2VE6B 1G7QA 3S3PA 3ISWA 2WUCH 2FDBP 4HJGB 4G9FA 3BKCH 1D9KD 2AW2A 3MJ7B 3X14A 2FECL 2EYSA 3IFNH 2W59A 2OTWA 5BV7C 4CMMB 5L2KD 1FFPA 1U8MA 3O4LD 3RTQD 5FYKL 3EDJA 1OT2A 5IMLA 1EEZA 1NC2A 3BP4B 3OR7A 4IOFC 4ZS6C 3Q3GA 1CDBA 2DLEA 3MLWL 1IAIH 3RZCC 2B0SH 3IF1A 1J1PL 4HX1A 4F33B 5JIHA 3OR6A 2FIRT 1E4WL 2EDYA 4U1IB 3VD4A 1V3JA 3UZVB 4PV8B 5JIIA 2J8UA 4LIQE 1NCAL 1AR1C 4M93C 3TVMC 1NC4D 4JZJB 4P4RB 4J7RA 3FRUB 4YDKH 4J3UA 2OMNA 3NH7L 5CGTA 4XMLL 3V0AC 3UPCA 2EEBA 4JFQA 2FX9H 4GG6B 2AJZA 4MQ7B 4PLKC 4G8IB 5CFHA 2V5MA 2X10A 2XFXB 4M7LL 3V6OA 1KYOJ 5MEPB 4NDMA 1RIHH 1X5KA 4GSDL 1Q72L 3O45A 4F7CB 2DQGH 1NC2D 4E9LA 4QRSB 4CVXA 5MEOA 3H42L 1OLZA 1NCAH 5BRZA 4YC2C 4L4TB 3WS3A 4Y4FB 1QSFE 1B6DA 4PGDA 5A2FA 5EWIH 3GSXB 5IIEA 5DJ6B 2X4QB 5BMFH 1N26A 1MH5A 3RVUC 5E94A 1KN2L 1NGWB 3IJSA 5CJXA 4I77L 4OZFA 5CINH 3BN3B 4I18B 4NRZA 4X80H 5ID1B 4P9ML 4UB0L 2ZUWA 2OL3L 3E6FB 3FB6B 1OB1B 3MV7A 1WZMA 3TH2T 3E8UH 3N0PB 1JGVL 1U42A 4M7ZC 3STBA 3VXSB 2DM3A 3QPQC 4ZFOA 3LKOA 4XC3H 2ZUTA 5D1XB 3BAEL 2P5EB 2HLFD 4PTUA 4JY5L 4UAOB 4MWFB 4WTZA 3H9SA 2O5YH 4HWEL 3KPLB 1BVLB 3ARDB 4KPHL 1LE9A 1SYVB 1K85A 2KL6A 2HJLA 1Y18B 3SDXF 2WQRA 5I8EA 1BQLL 2IWGA 4OZGF 3VG9B 5L2KE 4YDVA 2VZOA 4MQXD 4QRPD 3RVXC 3VXPA 2NXZC 4HWBH 4UNVA 1U93A 2E8ZA 3ZDXF 4S10A 2VLJE 3VMPA 4B5EA 4NQDD 1I7ZA 1ACYL 3TO4A 1VGKB 5KBNC 4MGXA 5B22A 4BQ9A 4PREB 4X6CF 4RDQF 3C8KA 3ZDYF 1EO7A 4N90D 4HAGA 3BHBB 5D70L 4YAQA 2DBLH 1TDQA 1MFCH 3L3DA 4K23L 3RVXD 3VXNA 3FQRA 1GIGL 4RISL 4NOFA 1RZ8A 1W8OA 4HV8A 4P5MA 3RUGA 4U0RC 4TNVK 3MCG1 1RJYB 1T0NB 1YEJH 5ICYA 4HFUL 5KVEL 5FKPB 1LP9A 3UTZB 5HYIA 3TBTB 4LGRB 4DZ8A 1W72B 1QRNE 5GS3A 5KVDL 4G7VH 4BJLA 1A02N 1FE8H 2IC2A 1NMBH 3BYYA 2P5EE 4M43H 1QBLH 3BH8B 5DWUH 3O9WC 1AXTH 1AP2B 4QRTA 1BLNB 1MCPH 1KTLB 1NBZB 1S9VB 2P4AB 5EUOB 4U7SA 3MV9E 2DQDH 3OJDB 4GW1A 5E2VH 4H8WL 5F97E 3D2UD 1WK0A 4GXUM 3MLYL 1BWWA 5F7UA 5C71A 3IXTA 4KXZI 4U3XA 4HXAH 4LBEA 5KOVC 1QLRA 5FO9A 3T09A 1A3LL 4PJCB 3OB0K 4QHLB 1MJUH 2HTKD 4JRXB 2FGWH 3DRQB 4M00A 4TSBH 5C0FB 1V3MA 4LFHG 4MX7B 5EOCH 4ONFL 5GJSH 4CBPA 3FQXA 5F7EH 3TNNB 4WI8A 3OZ9H 4MJ5A 3UJJL 2QEJA 4X6CE 1CLYL 1UWXH 3QRGL 2HMIC 3P9LB 3CLEL 2EH8L 1A14H 1UXSB 1BOGA 1KN4H 1YY9D 4PJAA 3IT8D 3V8OA 2NZ9D 3VWJC 3H2WA 1BQUA 2XG4A 4PY7B 1HWGB 3V4UH 3V5HA 5A3IC 3TN0B 1GGIH 5C0RH 1BJ1J 3DMMB 5E4EB 4WEBH 3EYVB 5ANMB 4M6NL 1NJ9B 4PGCA 4PY7A 4PFEA 3C5JB 1MLBB 1YJDH 1XGQB 2H8PB 4DFIA 2IAMD 3ULSB 3WUZA 4ELME 5I16A 4OF7A 4JB9H 1OSPL 1RHHA 4CGTA 2WZPD 2DQUH 1D5ZB 1DQJA 1KCLA 3ARRA 3WNNA 2WBJB 2AXFB 4D3CL 5KSUB 1KTLA 1NBZA 1U8IB 2BDNH 4ODSH 2FSEB 3IGAA 4IOFD 4ZS6D 3EYUH 1RZ7L 1MHPL 4JFEA 1CS6A 2EYTA 3IFPA 5EA0H 4IRSC 3U30C 2B1AH 2Q7NA 3QIUD 2G5BB 1OAXL 3JXAA 2DICA 4NHCH 4C4KT 1G0XA 1ORQA 5DFWH 1I9RH 1HHHA 4Z7UB 1RJYA 3TBYA 4ISVB 1RUMH 1J0KA 3ZHLA 3MOAH 3H7BB 5IWLA 4NKMB 4X7SH 5HDQH 1Q1JL 1QG3A 5C09B 4HULB 4FQHB 2EIZA 3SDDA 4P2QB 1FCGA 1QFOA 3RI5K 1KEGH 5E0QA 2JJTA 1AIFA 3UTZA 2F15A 3WMSA 5GRUH 3ZTJG 3U0PB 2BVQB 1DQQA 3VJ6B 1I7ZB 3OXRA 3JUZA 2DLHA 3AB0C 3SEPA 3FHAA 3I02A 3S3SA 2VXSH 3CSGA 5JW4R 4RGNC 2C4FU 3B4NA 3SDYL 1Y18A 4F57H 4WI2A 4ZFZB 3VI3E 1WZ1H 2E9BA 4NNXB 2AV7A 4S2SA 5E2VL 1DQML 1WIOA 3OJMB 1RZFL 2GKIA 1BAFL 5INDA 4ZTOL 1KIUA 5DVNA 5J1SC 3QO1B 5CJOH 1BOYA 4PJDA 4XXCA 3WV0A 4ODBD 5IF0A 4X7EC 2OP4L 5DRXB 3T8XA 3REWA 1BD2A 1K4DA 2DM7A 4KROB 3EYFB 2BSSB 3D39D 4OSUH 4KK9D 3UEZA 1LE5B 3V95A 1HH6B 2PXYD 1OAUH 2VLKA 4OCWL 4MAYC 3BSZH 5HI4D 1CK0H 3IDUA 3S96A 1J8KA 1OSPH 4XVSH 3PP4H 1OB1A 3BI9X 4NKDA 1HWHB 4NHCL 3CVHA 5F7MC 3MLXL 1PJ9A 4NUGL 4QRSA 4M9OA 4CVXB 5MEOB 1HH9A 1AHWB 1F42A 3K2UH 1B6UA 4PRAA 8FABA 3PIQA 3DYPA 5D6DC 1YY8B 2RFXB 3QDME 1BWMA 3RVWD 3FRPG 4P99A 3KYOA 1NUDA 2Z31A 3O6LL 3UTSE 3OPZH 4FZ8L 4JFQB 5JUEH 2DDQL 4LOUC 1U8HA 4JKWA 4WWID 4JDVA 1I8IA 1KCSH 5IFJA 4GAYA 2FX7H 4JFPA 4MA3B 4NDMB 2NQCA 5MEPA 4FQPA 4ZAKB 4P2CG 4ZAKA 4LLDB 1UJ3B 2E7MA 5I1EL 4UT7L 1YECH 4NWTL 1UYWH 1XT5A 1A1OB 1U3HC 3KYMA 4U7KA 4JDVB 2GCYA 4MZ2A 3W0WB 4NBYB 2NY4B 5EBMA 3FRUA 2HG5B 5GS0D 4HUKB 2NLJB 4KDTA 3P73A 2OZ4A 4N8CH 5DD1L 3FKUS 3LPWA 2HKFL 2ZSWA 3NGBC 1N7MH 4HFWB 3PJSB 1V8HA 3WLBA 1OAQL 1I1CA 2XWBA 4HIEB 3WBDA 3MYJB 2YPVH 3SKOA 3R4DA 4IRJC 1HQRB 4IBLT 3A6BH 4U33A 2NY0C 4BH7A 3MLPA 1MHEA 4Q9CA 4F9LA 2DQGL 3ILPB 4UNUA 5C08D 1BF2A 2OL3B 3CXDL 2YXMA 1K5NB 5HYJD 3T0DA 1MLCB 4ZFGL 1F5WA 2J8OA 3JTSA 4LLYA 4FXKA 1A7QH 2R0KH 4LNRA 4MA7L 5DD0L 3TWCL 5ILTH 3MRPA 1CFVL 3QQ4B 1T22A 3WSQL 3ARZA 1MHEB 2VDNH 1XZ0A 4LF3B 4I3RH 1U6AL 3REWB 1MUJA 1OL0A 1JI2A 1TJIH 1CDJA 4DN3H 3DROA 2VDPH 5DJYA 1A0QH 1JNLL 1EK3A 4UV4L 3O2VH 3OGCA 2J5LC 1AR1D 5DUBA 2HRPH 2NX5B 1CICB 3ZKMC 4Y4KD 2AJUL 2WUBH 2B4CL 4NZTH 3Q48A 1IM3B 1ZTXL 2AJSL 3M8OH 2HP4A 3TVMA 2GY7B 2FBJL 2G60L 1NAKH 3SQBA 3O6FD 3CDCA 3FT3A 5EORL 5LWYH 3QULA 2DQUL 3LEXA 4P23D 4AY0A 1JV5A 1YY9C 4F8TA 5I9QB 4YX2H 1KJVA 5EU5A 1JF6A 4Y4FC 4Q9RL 4OLYH 1QO3A 1G7MA 5KW9H 1U8HB 5GRYA 5GGUB 4GUPA 1RULL 4EBQL 5MEQA 4WY7H 2ADFL 4QHUA 5DVKA 3SDDB 3O0RH 2Z31B 1YNTA 3ZT7A 5L7XL 4Q74A 5B3NA 4BZ1H 1FH5H 1EPFA 1XIWA 2GY5A 4U1HB 1ZA6B 4G8FB 4JHAH 1MQKL 4NQEB 3SDCB 2ZCLL 5C0BA 1KIRB 1AXSA 4RAUA 4KQ3H 5E8OB 4OBRA 4DTGH 5C0JA 4PJ8B 4TUKL 5L9DH 2BVPB 5E6YA 3C5ZB 3V0VB 3U6RB 2DL2A 3IETA 2V9RA 4I13B 4WGWB 1FNGA 2HAZA 2FB4L 4FFWC 3S4SA 2CGRH 1Q9OB 4XP1L 4P5TA 2WBJA 4HGWB 4ZTPL 1OTUD 2RGSA 5KVMC 3EYFA 3DUSB 4A2MA 3LIZL 4S1QL 3RDTA 1JNHA 2VOTA 1BZ9A 1FIEA 1H8NA 5I75B 2ZG1A 2VR5A 3LH2H 3LMJL 2DLIA 5HGDB 3IFOB 5KSBF 4GG8A 4MNGE 1P7QD 4G6AC 4LCWD 2FJHA 3EYVA 5ANMA 3CCHB 3RFZC 3WSQH 3RTQB 4IIQC 5B38A 3D25B 1Z0NA 4PJAF 5JHLH 3D69B 3F5WA 3SDAB 3EHBC 4S2SB 2BC4A 4JEGB 3B83A 1WT5A 3AY4A 3KPSA 5D5MF 4KUCD 2EDRA 4X4YB 5HDQL 3F12A 3GEWB 2FBOJ 4P5TC 3B6SB 3HCVB 5EC1B 5CUSH 3U9PH 3RPIA 2R1YA 3AM8A 4ZXBD 3VJ6A 4FP8L 4XXCC 4Z78A 4F7PB 1HIML 4Y4KB 4MAYB 1VGEH 3EHBD 1YN6A 3PHQA 4HKJB 1FORL 4MDIB 4OQTL 5A2KH 4ODWA 5FYKH 3DIFB 3DI2B 4GKZA 2GFBA 3ARQA 3IKKA 5I30L 3JZ7A 4MQSB 4WV1A 4ONOA 4ETQB 3SJVE 1CZ8L 1EXUA 2JF1A 1LO3L 3MGAA 4TVPE 1NANI 1R5VB 4EBQH 1YQ2A 3O4LE 2GTWB 4M5ZH 3NAAH 5B21A 1W72A 5C0GA 1KPUA 3D5OF 1TZHB 4L4VD 5C07D 4YH6A 4JKMA 4Y19B 2C3VA 4QTIH 4L3AA 4MJIB 4YFLF 2NY1B 5HJ3B 5EN2B 1LNUA 2V7HB 1RUPL 4J6RH 2BRQA 1OCWL 3RWHB 4ZDHB 1U8IA 3TT1H 4AENA 3WIHH 5FUZH 4JFXB 2F8VA 1FNLA 1A14L 1T3FB 1UA6L 4KDWA 4PRID 2BVEA 3IDNA 2PTUA 4QRRE 3OB0H 3RJQB 4LLVB 1NBYB 2R2EB 1MCRA 4WRLA 4TVPH 1TLKA 3T04D 3TO4B 2VDLL 1MAKA 1W72L 5C2UB 2XIDA 2IFFH 1BEYH 4NYLB 5T5FH 3RPIB 5TQ0L 2QKIB 3V6FB 4I0KA 5JHDB 3WS6A 1U0QA 4NJ9H 5FECB 2V9TA 3N85L 4MA8H 3VFSA 1XGPA 3G5YB 3GZKA 4PP1C 4O58H 1U91A 2R29H 3ZKQD 4PJAB 5KSVA 2RIKA 4KI5E 4OV6F 4PP2B 4FQ2L 5A16A 4UV7H 4MJ6B 3D69A 3H9SB 4QTHA 3CH1A 5EIQA 1P69B 1JJUA 1V7MH 5JXEA 4ZODA 3FN9A 3MRLA 3KPRE 3O6FC 3IU4H 1V3KA 5DVMA 1L7IH 4HLZH 3MLSL 4LP5A 1M7XA 3IRPX 3K4AA 5BV7H 5GGSB 4OZIA 5H35A 3GRWL 1NGZB 4OCXL 3QNYB 3VD3A 1IZJA 2EDNA 1GPOL 4PJ7B 5SX5H 3CIQA 3LIZH 4S1QH 5TQ2H 4K8RC 5T33L 1AH1A 2DI7A 2ZUUA 3FHQA 4YDLB 3V8CA 2MSPA 1Q9OA 2FATH 1H5BA 1P6FA 4GW5B 4QRTB 2QQNH 3TPKA 2CKBA 5DI8A 1IEBB 1WBYA 3NFSH 2VLMD 5I8OH 1T20B 3JWDL 4QTIL 4NQXA 3WO4C 2R4RH 4P46B 3WUWG 4P57B 1G7JB 3ROOA 4NKQB 4UINL 1XGYH 1GOHA 2E27H 1T1XA 3ES6A 4GBXC 1MIEH 1HYSC 3VCLA 1LO3H 1R5WA 3CVIH 1WTGT 3LQZB 4NQEA 3SDCA 1ZA6A 5HHXH 3B9EA 4U0QB 4KMTL 4G8IA 1MI5A 5TF0A 4XB7A 2NY0B 2J6EH 3BO8A 1WC7A 4GUPB 3F58H 2DQHL 2GW5A 3D9AL 4X0KB 4MD4A 1JZ3A 1ORSA 3O6LH 4OLYL 1K6QL 1F4YL 4J1UA 4L3EB 3UPAA 4NC1E 2RCSL 3N1PC 3NCBB 1XEDA 3CSYB 5D72H 1JV5B 2VKWA 5FGRA 4PRHE 1U93B 3U7WL 3MFGB 4NO3A 4PB0L 2P5WA 1OP3H 5BZWA 4WO4D 1SYSB 4KRPB 1KG0A 4G6MH 5BV7L 3BDYH 3SDCC 3BP4A 1EEZB 1CFBA 2WSKA 3DURA 3OAZK 4NN6C 4Q7DA 3SGKA 2AJXH 4B7LA 4S1RH 3AY4C 4CMMA 3MLRL 2VLKE 1SYVA 2OTWB 2AQ2A 3BRGC 3GO1L 1H3UA 4JAMB 2QHRL 4X4ZA 2HT3C 4YHPB 2EO1A 3VXSA 3X3FH 2FEDC 3VGHA 2Q1EA 1YEHL 3MACL 3GKZA 2OTPA 2BNQA 1KBGH 1UZ8A 3AB0B 1R3HA 4NNPL 4N1CA 5HVWA 5IHUL 4LF3A 3CFBB 4AG4L 4F15C 3E3QE 4OV5A 1BVZA 3ARBA 1KIPA 2HTLC 2JTDA 2A83B 4R4BA 3VG0H 1KN4L 3C8HA 1ZANL 2CLVA 4ORGB 4FHBD 1NUNB 3JTSB 2N56A 3EFDH 2R23B 2DI8A 4WW1A 2HFFA 4LLWA 3BXNB 2HFGL 4LOUD 5IB4B 5DJDB 5JW4M 2XTJB 3N9GL 5T3ZE 1MWAA 2P43B 2EIEA 5DQDL 5DA4A 3BFOA 3MRCB 5IHUH 2MKLC 3TYFB 3MYJA 2NY3B 3B2VL 4IEFB 2XWBB 1JN6B 5IJVB 3WNOA 3FZUC 4FQXB 3B9KA 3AS2A 3M17A 5SX4H 3ZDXE 2DD8H 2Q6WA 4K3JL 1U8OA 2Y23A 4OGYH 5IV2A 3HNTH 3G5XB 1V3LA 4HUXA 3MLRH 4P46D 3C09C 2R1WB 4JQVA 5D1QC 1A7OL 2ARJQ 3GJFK 3OKDA 4HPOL 3O9WD 1HQ4A 5IFHL 1ZVHA 4YHOH 3KGRA 3PDGA 2D9CA 4PV8A 5KSAC 1YYMH 4PJ9A 4LLDA 2VDRL 5MP6L 5ISZB 3DXAD 2P8LA 3QQ3A 4ERSL 1J8HB 3G6JB 4OZHF 2OYPA 4RNRA 1J05B 2V5YA 1D6VL 5FYJL 1YEEH 4H88H 4H1LH 5C7XH 3MRIA 3JWNC 1MCOL 1AGDA 2YD1A 5JUEL 1QRND 3QFJA 2W9EL 1H3TA 1PKQA 2YD8A 1RY7B 3SCMB 3X12A 3KYOB 2H32B 5EU6E 2IAMA 3ZE0E 1O0VA 3X14B 2XA8L 2VLRB 2NY1C 1G7PB 1KJ3H 2VJXA 4UTBH 5EU3B 1YC8A 1NCDH 3BIAX 4ERSH 5DSCB 3P4NA 4JB9L 5CIPA 4DN3L 3JSSA 4LKXB 4NQED 2FIKB 4KROC 3SDCD 4RX4D 2E7BA 1VPOL 1KPRA 3CFKA 4K3DH 2XG5A 4BZ2H 3WL9A 1AQDB 2QJDA 1TTFA 2VLKB 1RZGB 4Z5RA 5T1DL 4J3XA 2AXHA 1MAML 2BHUA 3FJTA 3FO1B 5AZEL 1OTTD 1J7VR 3KWWA 4KZDH 3G5VB 1TQBB 4XNMA 4HUWB 4ZTPH 4GRWF 1MFEL 5C0AA 1CDHA 3ZE0F 3U4BH 1F11B 3GSOA 4M4PA 5TE7H 3ZE1E 4S1SH 2ITDA 4ONGL 3GIVA 4WO4A 4EN3D 3PQYE 2B5IC 4NUJB 5J9PA 4C83A 3VW3L 4G42A 4GBXD 4BK5A 4TYUA 1FGVH 5D7IE 5INDB 5IB2B 5C0DA 4I3SH 1FFQA 1XAUA 5I0DA 4ZFZA 5FK9A 3LAFA 5C0BE 5CD3A 3GSNA 5EO1A 2A73B 4MCZA 4HDIA 4JY4B 5IFAL 2C1PB 4M1CD 1DJSA 5I73B 3OKEA 1JUFA 3D18A 1SJXA 1O7VA 2IPTH 1U95B 4M5YL 4X4MA 3VD5A 1F4HA 2ITCA 2EH7H 3O11A 3MROA 4NZRL 5I1AB 2ZOLA 5J12C 2OJEB 2CDEB 3RL1B 3MRGB 3WE6A 4XMKL 1IQWL 2IG2H 3GMLB 3OPZL 5MERB 5A3ID 3R0MA 2B2XL 5BVJB 1EZVY 1W0YT 4HD9A 5E2WL 4FA8A 4NQUA 1K8DA 1IC1A 3C60C 3L7EB 2ZG2A 4YUEL 4OKVA 1NLDH 2JK5B 4L29A 1JGEB 5DJ2A 3GSRB 5I1LB 3FT4A 5LGKA 1H3XA 3MCKB 1QR1A 2EDOA 5GGTH 2NXYD 1TVBA 5C0RL 5ITBH 4AEHL 4L8SA 3VXTB 4P2OC 5DJZA 4KZEH 4N0FA 2EZ0C 1S7QB 1NCUA 4PLNC 1NFKA 4NO0B 3KXFB 4FNLL 2JELH 3MGTB 3RZCA 4FTVD 4KHTH 1RI8A 1D9KC 4I4WB 4LSTL 1AGFB 1CE6A 1PLGH 3QRGH 2IQ9L 3C5JA 1OQXA 1CFNB 1LQSR 4GRMB 1B0WA 4Z7NF 2FGWL 1T5WB 3NFSL 4UQ2A 3QUZC 4MXVE 1J12A 1R5IB 3UO1L 4DK6A 1ZHKA 3V0WL 3LZFH 3TNMA 2X4OA 4Y8DC 1A9EB 3NTCL 5T33H 1ROWA 3VXQA 3HC3L 4GJTB 2D0HA 3QEGL 3SOBL 2Z92B 2BSTA 2I5YL 2AJYH 4J4PD 4UOW0 4HS3A 1I85C 1A9BB 2VLLB 4BSWB 3CFDA 1INQB 2UUDK 4XPBH 4H0HB 5FIEA 1IGYA 2XXMB 1OAYL 4HW6A 2FYYA 4JVWA 4JCMA 3D39B 4UV7L 2AQ3A 3OG4B 2CLZB 5EUOA 1S9VA 2VABA 1BGXH 3L3JB 1A1NA 1I9JL 1MCJA 2UWEB 4XI5D <