1HILB

Structural evidence for induced fit as a mechanism for antigen-antibody recognition
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
214
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
molecule tags Immunoglobulin
total genus 40
structure length 214
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilB01
3PDDA 4ONFL 1F4XL 4JG0L 3NIDE 4QXWA 1QBML 4WW1B 5EUOA 1H3VA 3N1FC 1Z9SA 4OIAA 3HHRB 5JUEH 1JHLL 4D8PB 2Z31D 3GHEL 4DN3H 4K8RH 4NQDD 2YWYA 2WK2A 4U3XA 3U9UA 2NZIA 1ZLVH 1RIVL 4LF3A 1BHGA 3KYNA 4OQTL 2C3VB 5BQ7A 1FZOB 1G7MB 4ZFOL 1FGNL 2CKNA 1S9YB 2MCPH 2UUDH 1LP9F 1INEL 1ACYL 3N0PB 1NUGA 3DGGA 2BNQA 5FKAA 3WFEH 2YD3A 1ERNA 2BVOB 3N1GC 1T7ZA 4XCYA 4XZUB 1EZVY 4H20L 2OL3L 1N6QH 1AKJD 3ZHLA 2IPKB 1YY8A 4PJ9D 3ARQA 4U1SA 4RFNC 1OHQA 3VFNA 4OUOA 3TJEL 3EZ8A 2FECI 4FQQB 2PYED 5L2KD 1KIUA 2A9ML 5JMRA 2YWZA 3MRPA 2UV3A 1JFQL 2D4FA 1VERA 5HYSG 3QEQD 4KDWA 1BZ9A 2BOBA 3AU1A 5CFHA 3P0GB 1URLA 2L7JA 3MUY1 1EHAA 4XX1G 2EXWC 1E4WL 4F33A 4K3DL 1RZJH 4HMDA 3TP4A 1D3CA 4D9LL 5FB8A 3ZTJH 3GKWH 3I02B 4KGJA 3DV4A 4LKCB 3CH1B 1VPOH 3DX8B 5HVFB 1DQJB 4Z8FH 4K7FB 3SE3C 5A2KH 3DI2B 2C3WA 3BZEB 3VXTA 4D3CL 4M9OA 4BSWA 3LKOB 4MNQD 4QOKE 4RDQF 4JVPA 4KROD 3VD4A 4KPHH 1VFUA 1M6OB 1MCRA 1R3HA 1IAKB 3MRRB 1RV6X 3O6KH 1XR8B 3QXDA 1GGBH 3W0WE 4JY6A 4P23B 1KJ3H 1QVOA 2AXJA 1JPFB 5FYKL 4G5ZL 2FH6A 4CADB 1MUJA 1NKOA 5C8JB 1CFTB 1N0LA 2V6HA 4R7NB 1Q0XH 1AHWB 1NDMB 1YYMH 4I77H 5AUMB 1WBYB 4FFYH 3MO1B 5DC4B 4POUB 3BKJH 5F7FA 3S98A 3RVXC 4Y16D 3ULUL 4TOYH 4QTIH 1KJ2H 1RULH 3QSKB 2E7LA 4HFWB 1GC1C 3OJDB 3GUTA 1VGEL 3FAXA 2A6KA 1G9NC 3RWDB 2BY0A 1TQBB 4XAWH 3T3PF 3WFZA 4P2RE 4MD5B 3TT1H 5F8QC 5JUEL 4JQXA 5FYLD 4YDLC 3RGHA 1IC7H 4DN3L 1SVZA 2OMBA 4K8RL 3INUL 1KFAH 3QUXA 1W72B 4YNYB 1NAKL 1UKQA 1X5JA 5EUKA 2MCPL 3T0WA 4YFLF 3TH4T 2DLTA 3MX0A 3GSOB 4PJ8A 5FCSH 4XB8A 3AB0C 4HKXA 3K2UH 5GS3A 2OR8A 3VDAA 3OB0K 1U8LB 3WSQH 2ICWJ 4ONOA 1EJ6A 5DO2C 4ODWA 5J0BA 3PJSA 2OZ4H 3IXAB 1VFAA 1CD1B 3I3DA 4M4PA 1QFWL 4YPGA 5JIKA 1DP0A 1N6QL 3BH9A 3E3QC 2A77H 3U1SH 2DOCA 3MROA 1CFVL 5F70A 5J3HC 1FGVH 3GSVB 2JCCB 1R5IA 1EZVX 1HHGA 2WLZA 5ERWA 2OTUA 1RK0A 2BMKA 2A38A 4LP5A 5FF6A 4G9FE 4YDIL 5HGDB 1PYWB 2JJTC 4MXQC 3VFMB 1KXVC 3BPOC 1FC1A 3D85D 5EUOE 3DXAE 4QRUB 1MJ7H 3BDYH 5ITFB 5DYOA 4GRWB 1RZJL 5JW5A 1D5XB 1M7IA 3K4AA 4P57B 3OKOA 3U2SA 3ORJA 1JNJA 3CFDA 1VPOL 3PQYE 1MFEH 5E7BA 3UTPE 3CDCA 3NCMA 2DKMA 4Z8FL 4YDVA 1YMMA 1ZXQA 4WI3A 5KSAB 3WJJC 3QDME 5IVOA 4DW2H 3F7YA 2NYYD 1BX2A 4Y5VC 2IPUK 3SGKA 1BVKB 4JY5L 5DD6B 5DEZA 4KPHL 3QIWA 4JFYA 4ODUA 5IB5B 4IIQB 3L9RA 5JIPA 1EHXA 4ZUWA 2M1KA 3RWEA 2EICA 5E56A 2ICEB 1HI6A 3PL6B 4IOIA 1OP5K 5C0NC 1NCAL 4XI5C 2IQAB 3WHXB 1GGBL 4XRCA 3VXSA 1KJ3L 4L8SC 1N7MH 4G42A 5IEHB 1TCMA 1X4XA 5ISZB 3CZJA 1XFPA 5BZWA 4HG4J 4N0YH 4PUBH 1CE1L 5HGHB 4ZPVB 4X0KA 2BSED 1Q0XL 4HPOH 4QHKI 1ZLUK 5DJ6A 1YYML 4I77L 5C6PB 4FFYL 3BKJL 3L5JA 4KZDH 1KLGB 4Z7NF 4ELKB 3KHOA 4TOYL 3W5MA 1RZ8A 1KJ2L 1RULL 4GMSL 3BMWA 5ESQA 5FHAH 5LGJB 1MOEA 4NC1C 4TPRH 4PG9A 5JPNA 5HYJB 2X4UB 4PJIE 4XP6L 2I07B 2IPTH 3QCTL 3VRIA 3TCLB 3TJHD 3FO1B 3C5ZB 4QRPB 4NZUH 4XAWL 5EFIB 3P2TA 3MRKB 1RVFL 4PB9H 3TT1L 5D96B 3PGDA 4PP2A 3RNKA 3QIUC 1JNLH 4NIKB 3FT3A 1IC7L 4KXZI 4WNQB 2YC1A 3ARFC 4JR9H 4KKLC 1T5XA 4X8JB 3OXSB 4LIQH 5TH2A 1ZVSB 1Q94A 4MJIB 3K2UL 4P3CH 1OCWH 3QUMA 1U8MB 2ITCB 1YN7A 3VWKD 3VGDA 3TPUB 4DKFH 1B3JA 4X6EB 1OQXA 2DLFL 4HWZA 1X5AA 3U1SL 1A6ZB 3SDAA 1Z9MA 5LAXA 3PHOA 1FGVL 3U30C 4WHCA 4WFHD 2ZCKH 3EYSL 5ADOH 5FOJA 4N68A 3KYKH 3MGTA 1BZQK 5HHQA 5DVMA 3OAZK 3N9GH 5KVGL 3VXPA 5LBSL 2XTJD 1BD2D 4LCUB 4DKDC 4P2OD 1KB5A 3D0LA 1FZKA 1MJ7L 1MCPH 3BDYL 3SKOA 4D2NA 3E1F1 3UBXI 4KC3B 1FL3B 1I3GL 2FLRT 4M61B 4XMKH 4EEEA 1K2DA 4U0RC 3G9AB 1MFEL 5D1XC 3CPLA 4K71C 1JPSH 1KT2B 3LS5H 1HHKA 1BFVH 1D5IH 2DQCH 3SY0A 3MPCA 4E41D 4KK9D 2P48B 3O6FA 4NHCH 4PJGF 5B21A 5EOTA 2LAAA 3HR5A 2X4RA 4OGYH 2NY4D 1UGNA 4RFNB 2FO4B 4M8VA 4NQSA 3MA9H 4PGEB 1JGEA 1YNTA 1RJCA 3LPFA 3VFTA 3QI9D 4WU5A 1S7UB 5JW3H 4OZ4A 1PKQB 1N7ML 4DOHB 3LEXA 4KJWC 1QEWA 5IMMB 4HKBB 1WICA 3WFHB 1FVCB 5DRXA 4PRBB 1YECH 1QO3B 2VLRD 4PUBL 3I6KA 1ND0B 2WIMA 4LPWA 5H35A 4HPOL 4Q74A 5H8DA 3MRHB 2Y72A 4LHUB 5KANI 3MRIA 1A1MA 4ETQA 4QXUL 4KZDL 3S37H 4FMKA 1CTOA 4X99A 4YO0A 5F3HB 4F7EA 1T0MB 3O11A 1CDIA 5FHAL 2HLAA 2Y5TB 2JKXA 4TPRL 1U58B 2XKNB 4M48H 2EC9T 4X9HA 3TVMB 5ICZA 2Y6SD 4FFZH 4KU1A 1IM9A 6FABH 1TFHA 1MCLA 2IPTL 2X42A 1YMME 4UU9B 4RGMB 4N1CA 4NZUL 5HHOA 4JRXD 2KKQA 4NC2B 5I1IL 2AK1H 4PB9L 3UBXA 4RMRA 4DVBB 2EDXA 4R4ND 5EU6E 1JNLL 2R1WB 2WQRA 1KCUH 3LAFA 2XZZA 3PUCA 2W9DH 4M00A 1A1OA 5FYLH 2OLDA 4JR9L 5EOCJ 2ADJA 4Q6IA 2EZ0D 5CIPA 3BGMB 1AXIB 3T8XB 4GUPA 4HUVA 1FP5A 4PRPA 3VWJA 3D39B 4P3CL 1AQDA 1MCSA 1AD0B 2CO7B 4QTHB 2DMKA 3O8XA 5F88B 4X6CA 3DROA 4DKFL 1OTUD 2YPLA 4J3UA 1VA9A 4PJ7B 1I7ZA 1Y0LB 2WINB 4GW1B 4ZSOA 5E8OA 4IDJL 1YY9D 2DTMH 5F7EH 4XVTL 3DURB 5JDJA 3QG7L 5A2JH 2ZCKL 3IDJA 1OQOA 3C60C 5ADOL 2GFBA 2UVEA 5I16A 5HVGB 5EIVA 5CWSA 3WE6B 3X17A 3ZKNC 4YDLB 2R23B 1G7IA 4E42A 5DA4A 4LRNH 4UQ3B 3MLUH 4JPIA 2CDFB 3PWLA 4G8IB 1MCPL 4BFEA 3BN3B 1DCLA 4XMKL 2VLKA 2EKJA 3L7FA 2O93L 5DD5H 2EDLA 3ARDB 2WBWB 1GZPA 3HZKA 1JPSL 3RVWD 1MHPH 1Z5LA 1BFVL 1D5IL 2DQCL 4PJ5D 4LSDA 1F42A 4NRXB 4U31A 2B1HH 3SJVE 1TNNA 5GZND 4NHCL 4DFHA 4X4YA 4OGYL 3O3EB 4Q9RH 2MQ3A 2ARJQ 1HH6B 3LZFL 2VYRE 3MA9L 4PGDA 4A2LA 1SYVA 2R29H 4NKQB 4QT5A 5D2NB 3NABH 4AENA 1DLFH 3IFLH 4JVUA 1UH4A 3OF6D 4LVEA 1MSPA 3HAEA 3MFFA 2NLJA 5IOPA 5GRXG 1UB6B 3BPOB 4X4XB 3FRPA 5AG9A 1YECL 2Y06H 2QJDA 4HXAH 3S35X 3VFOA 2BVPA 4Z7VA 2A2QT 1DVFD 3K80A 5J89A 1UC6A 3QFJB 2YSSB 5DD0L 4EN3C 3S96A 5CZXD 5E99H 2B8OT 4CW1A 3S37L 3IJSB 4YGVB 3SGDI 4ZAKA 5BV7C 4J3VA 4WO4D 3NFNB 4QHNA 1DBBH 4Y5VB 3T0AA 3QNXA 3WNLA 4FFZL 3AM8A 1QYGH 5FCUH 4GG6B 1H8NA 3MUJA 1RD6A 1RUPH 1KIPB 5H2BA 5INDB 4K2UL 4I48A 1T7YA 1ZHLA 1FSKC 1VFOA 1GIGH 5FUZH 4GH7B 3FMGH 3X14A 4MZ2A 3G5ZA 4Y4FA 1OW0A 5K59E 2LTQB 1KCUL 4L8SB 4K3EH 4C56A 2LABA 5FYLL 4RMUA 3T1FA 4QRQA 4U05A 4PS4H 4XMPH 1T2QH 5KVDH 1A64A 3VG9C 4MJ6B 5T3ZD 4BUHA 1OD9A 5BS0B 3EOAB 1K5NA 1J1OH 3W9EB 4BH8B 1MVUA 1UJ3B 2Q86A 4XTRC 2N7BA 3QHZH 4KVCH 1FV1B 3O9WB 1QSZA 2DTML 5F7EL 4RMSA 4XGZA 2FCBA 3BD4A 4F80A 4LHQB 1I1AA 1PGRB 2EDEA 5EU4A 4KK5C 4NOBA 3RTQA 3I6GA 1FO0H 5BRZD 2QV2A 3QIUB 3OBAA 3NN8A 4CVXA 4MD4A 2X09A 3LMJH 4HIXH 5E94B 5ENWB 4OZGB 3TCXA 3MLUL 4LCYA 5HHOE 1H15B 4JO4H 4PLJD 5AAMA 1T22A 4EDXA 5TJWK 1OM3H 3MNVB 3LS4L 3MLRH 5DD5L 4L4TD 1RJYB 4Z77A 3DSNA 5IHLB 1MHPL 3BKYH 5IW1A 3VG0H 4RSVA 4WFGE 2YA1A 1UWGH 2IAND 4OF8A 4PRPE 5IB4B 2B1HL 2P24B 5FOBA 1I9RL 3VCLA 1A1NA 1BQHA 5HI4D 2E5EA 3LN4A 2HWZL 5KSVB 4X6DB 5JHDD 2D31A 4Q9RL 3GB7B 4X6CE 3DBXB 1J11A 2YPLE 3FTGB 1FLTX 5MHSD 3BUYA 1DLFL 32C2A 4NO2B 3IFLL 3RWCA 2I5YL 5LXGH 4DZBA 1JYNA 1C08A 5J12C 4IRJC 5DXWA 4F7MA 5I1EH 2X4OA 4P4KD 1WZLA 4OIIL 2HKFH 5DLMH 4JPVH 4P2QB 4AIZB 2Y06L 4HXAL 5I8KH 4YE4H 3HAEG 1U3JA 4GAGH 4NSKB 5T5NF 3MRDB 1U8PB 4KKBC 1DBJH 4U0RB 1XIWA 1HZHH 1INDH 1D9KD 2I60H 5DJ0A 1D5ZB 2CRMA 2YPKA 4JZOB 5E99L 4K71B 2FRGP 4HIEB 3VI4E 3KPNB 2V2WA 2XY2A 4LAQH 1CI5A 1DBBL 4HWEH 1VCAA 4LCWD 3TO4C 4QYOB 3HE7C 5FCUL 2XIDA 4FFWD 1RUPL 2XNAA 3ZDXE 5CD5D 1B0GB 3CZFA 5J57B 1PFCA 2DJSA 1TJIH 4RQQA 2F54B 4Z18A 3QIBB 4NJAH 5FUZL 1Y6KR 2BK8A 3FMGL 3P3YA 4BFIB 3ZYJA 4ENED 2QSCL 3NA9H 3CLEL 5J13C 1D9KA 1NMCB 3FFCE 1R5VB 4BA8A 1QR1B 4U1IA 3OG6B 4FFVD 1I7RA 4O2EB 1EVTC 4PS4L 4XMPL 1U8IB 1T2QL 4HBCH 5KVDL 5J1SC 1QSED 3RBGA 3EFDH 2ZCHH 5GRVL 1NSNH 1A3QA 5DK3A 3KLDA 4FTVD 4RGND 2XYCA 5DJZA 2Q20A 2GUOA 5C0CB 5DMIH 5FYKU 3BHBA 2V7NB 3HZYA 1EEYA 3ULUC 4MAYD 1H3XA 1BAFL 1L0XA 4KVCL 4L3EA 4AY0A 2P47B 3HCVB 3OXRA 4MWFB 5JHLH 4HG4K 2A0LD 4Z7WB 1ITCA 4YWGH 4KI5D 1ED3B 4TSAH 2VXUH 2LVCA 4D9RD 1CCZA 4B50A 1A9EB 3PE9A 1MAML 3RUGB 3TT3H 3LMJL 2V5MA 3CVHH 5I6XC 3X12B 3MBEA 3ZDYE 3QAZB 3T0ED 1I9IH 2CGRL 5HGAA 3WS6A 1BFSA 1QPXA 2DICA 4K8RC 4GBXA 4IBLT 4JO4L 3V6FB 4OZIA 4X6DF 2VQUA 2AV7B 4E0RB 4TNWF 1OM3L 3GSQB 5I19H 4C56E 3MLRL 5GS1C 4MNHA 1ZT7A 2OP4H 5HDOA 2P44B 1HOCB 4Q0XH 3BKYL 7FABL 4MLIA 3J8F7 1UWGL 1A2YA 2PCPA 2W9LA 3QDGD 4EOWH 2OQJA 5MEPA 5FO7B 2NTFA 5K9KA 4DUXA 3AROA 5EZLA 3QXAA 5JOFA 1BQHG 3ARXA 2CLRA 2JIXA 1WTLA 5LXGL 1UZ6E 5CP3A 1E28A 1IAMA 2PN5A 3W2DL 4F37F 5DJDA 3EHBD 5ANMA 5I1EL 2EDHA 5I17A 5CD3A 1NMBH 2XICA 2X4SA 4YEEA 4MDJB 4RIRB 2EDYA 2DAVA 2HKFL 4N9OB 5DLML 4F7CB 4JPVL 4JVWA 4NN7C 5BXFB 3PABB 5I8KL 3TYFB 3RWIA 4YE4L 4Y19B 5CS7A 3FO2A 1CFNA 2R15A 4NPYB 1RZJC 4YIQA 1CD9B 1HZHL 3OR7A 1INDL 2I60L 1CVRA 5AAWA 1OF2A 1CFQB 4W6WB 4BQBA 2AI0H 3TNMA 4XAKD 2EE3A 2HKHH 3RZCD 3DX7B 1SJVA 2R39A 4IMKA 3VH8A 3QO1B 4LAQL 2HT4C 4HWEL 4G8EA 4LRIC 1EVUA 4PYGA 2OXGA 1T80A 4UQ2B 3H7LA 4X7EC 5IUSA 2Z8WC 1TJIL 2EXYC 1P2CB 3AUVA 4QRSA 1Q9OA 3WUWA 1XGTA 3OPZL 2N7AA 3AAZA 1FL5B 2VOTA 4JFDB 4BQ9A 1LDPH 2ZSVA 4N0FA 3T04D 3V5DA 2JK5A 1FJ1A 1OAKH 1FG2A 1MCHA 4HBCL 1U6AH 4Z7WF 2VITB 3TFKD 5EIIA 4XCEA 1L6ZA 3EFDL 3M8OH 5J06A 4NJ9H 2ZCHL 3FZUC 5T3ZH 3JVGA 4N1HB 4EN3B 5AD0B 4XVUD 4MQ7B 2O26U 2PW2B 1Z0MA 3MJ8A 1TZIB 2VWEC 5GSVA 1QUNA 5GZOC 1TNMA 2QHLA 5EO0A 4WEMB 5IQ9A 5SWSA 4QOKD 4YK4C 1GAFH 1J0ZA 1MELA 5JHLL 3GMQA 1GRWA 5JW4M 4HWUA 2X89D 1WC7B 4MA3B 4YWGL 2VMFA 2ENYA 2Z8SA 4TSAL 4NZJA 5FUCE 3KPMA 4MQTB 1J1XH 4PRIA 2QADC 4HMEA 3TT3L 1CGVA 2WBJB 3CVHL 1YDPA 3QPQC 1I9IL 3FN0H 5K9JH 3L3JA 4NO0A 3EDDA 2GJ6D 5J6GB 4DUWA 3S88H 2WW8A 5C0GA 2WWMD 1HCFX 4Y2OA 1S8DB 3QHTC 1BBDH 5I19L 3MR9B 3Q1SH 1A4KA 3SDDC 2OP4L 1IAIH 1WFTA 2X89A 3VXMB 4JHZA 3QP3A 2JJWA 1HSAA 3REVB 1JN6B 4Y2DB 2AJ3A 3ILPA 5I8CB 4PTUB 5IT2H 2PTTA 2ATPA 1JZ6A 4PRDA 4PRNA 1EEZA 4MCYA 3SDCC 4EOWL 3GGWA 4M03A 3RBSA 4M1GH 1U3HB 2AQ2A 3B3IB 4LVOC 2VXVH 2R4SL 3S35H 4L3EE 5E6IC 4I4WB 4FG6C 2PO6A 4HK0A 2ZUTA 4B0MM 2HFFB 5KS9E 1NMBL 4EI5D 4FQXC 2D7QA 1NDGA 1JYVA 5HHPB 1WWWX 4FQIH 3DMMB 5FM5O 1QOKA 1CXLA 1ZSDA 3FHAA 4ZFOB 2CIKA 2J8OA 5SWZA 5DA0B 5L2JB 1CF8H 4NHUA 1TVHA 3SN6N 1F3RB 3OR6B 4OZFB 1AGEB 1BOGB 2PXYA 2AI0L 1C1EL 3MGAA 1F8TH 4OZIE 4UMGA 4ZOAA 2QTEA 2IADA 3T4YB 4C83A 2XI9A 1F3DJ 2OL3B 1ES0A 4GXUM 3UO1H 4NRYB 2CLVB 2H32A 1HQ4B 3KPSB 4RAUB 2BC4B 4EI5A 2D4DA 1LQSR 2EDBA 3VH8G 3O3DA 3KPOB 5EOCH 1HHHA 3UJTH 4RFEA 4HV8A 4HZLA 5L8LB 3F12A 2GTZB 1QLRA 1V5JA 2P7TA 3RGVB 3CSYA 1ZLVK 3E8UH 1LDPL 4XNYH 3IAGC 1Z9OA 1OAKL 4ZDHB 1H3PH 1Q9WB 3WUWG 3IU4H 3ARBA 3VFPA 3FQRB 4M1CD 4GXVL 4C4KO 1U6AL 2M2DA 3AY4C 3DXAD 3SCMD 1A21A 1MRDL 3M8OL 1YEIH 4NJ9L 5ANME 4PG2A 4O2CB 1T03H 3ZT6A 4F3FB 4CKVX 3O4LB 1FYTD 2DL9A 2AS5M 3ZKXC 5ILTL 3PQYD 2GTWA 4N1EA 4Z95L 3UTPD 2E7CA 1CICA 5DMYA 1A7RH 5KSBA 2DDQH 3S36X 5CGTA 5I0DA 3QDMD 3TO4B 1P1ZA 1GAFL 4J4PA 2Q6WA 5C07E 1NUNB 3C09B 5DZNA 3FRUA 5DVLA 4TVPD 5GGSY 4JRYB 1J1XL 1G7PB 4YDJB 1F90L 2V5YA 2BSTB 1CU4L 1QBAA 3FN0L 3X13A 2EIEA 5K9JL 4K07A 5HYFA 3QWQB 3S88L 4G3YH 1LWRA 5DD3H 4Q97A 4PJDA 1U0QA 4V1DE 1BBDL 5D70H 1MLBB 1OGTA 1K8DA 4CU6A 3Q1SL 1IAIL 1MH5A 3LPWA 2EYTA 5EH1A 4UNTA 2ITDA 3TN0A 4P46D 1KPVA 2C1PB 4M1DH 3U0WH 4RAHA 5F7MC 2OTWB 5EU3B 2DYPB 5L0QC 4LSUH 5IT2L 4QHKJ 2R1XA 2F5BL 1DDHA 3MRMA 5TGBA 4KRMB 4XP9L 5C9JB 3T3MF 5D5MB 1DLHB 2VXVL 2YS4A 4XBPB 3S35L 1UZ8A 3CDGA 4Y4HD 2P42B 4XNQB 3UAJD 1MFCH 5HVHB 4YQXH 2MTPA 4W4OA 4FQIL 1XF3B 1G7QA 1DJSA 1S7WA 4PRIE 3HE6A 4XPGH 4LLWB 3ROLB 1CF8L 1SHMA 3GK8H 5CSZB 3IETA 3JZ7A 4LASH 5GS1B 1YUHB 4N5ED 4YDKH 1F8TL 3WN5A 3ULVE 5ID1A 1DN0A 5HVWA 1UKSA 4OI9A 3D18A 3UO1L 4KWUA 1T6WA 3Q6FA 3PHSA 5GGRB 1ODAA 3UJJL 4Z78A 5I1DB 2J6EH 3ETBF 5FA3A 3GMNA 5D71H 2VDQH 5EOCL 5D1QB 2VE6A 3MCLH 2IH1A 4D0DB 2FJGA 4HLZH 1MCQA 5IF0A 2AJSL 5C0DA 1OAYH 2V5RA 2E7LC 3E8UL 4XNYL 3GSNH 2XPGB 1F3JA 2W91A 1FVEA 5HHXH 3IU4L 4NN7B 4FQJH 3T1WA 4YHNA 4L4VA 4CMMB 2A73A 1YEIL 3C2SA 1QFHA 5EA0L 1T03L 3QEUA 4I0PB 3LN5B 1SEQH 3L3DA 4OCNC 3U7WH 1JHTB 4HUXB 5CHNA 1DUZA 2ZJSH 5SWZE 4HWNA 4QXTA 5DJYB 1F45A 1BM3L 1BZ7B 2LAGB 3QEHA 1A6PA 5IBUG 4RISH 3B9EA 5D9SB 4GQPH 4JQVA 4EUPA 5CBAB 5HPOA 3CD4A 4U7SA 4P5KB 4ZOCA 2DS4A 1UM4H 3IGAB 4OV6F 4U1HA 5BVJA 5B22A 2VLJA 5I66B 1R3JB 1HXYB 1A22B 2EEBA 2UYLB 5INCB 4M3JA 4ZUUB 4G3YL 4L9LA 4Z5RB 5C0RL 1LP9A 5DD3L 2E7MA 2FLBT 2CXGA 5D70L 4R2GD 3UDWA 3IFPB 3MV9E 4OLXH 3FCTB 1IEBB 5ICYA 4C59B 5IB2A 2RIKA 3U7AA 2Q1EA 3ARGD 4M1DL 3U0WL 4JM2A 3WXWL 4MQXD 1KJ2B 1OL0A 1T0NA 3I75B 2QEJA 3EYFB 1MHHA 4LSUL 1QTYT 2UZYB 2VAJA 4AYFA 3WNNA 4K9EC 2P8PA 5IP4A 3HZVB 3RJQB 5C6WH 5ECJE 4X9BA 4M7LH 5E1AB 3GJFA 4NZTL 4JKKA 1MFCL 4P9MH 1IQDA 4YQXL 2QADB 1N59B 3BQUD 1G0YR 4WUUB 5AYUL 5EU6D 2VAAB 1TZHA 3R1GH 2GQHA 1KTLB 4QHLB 1NAMH 1WVZA 2IH3B 2P5EA 1FYHB 1QSFD 3N1PC 3TH3T 5HYSB 4XPGL 3HC0B 4ZG1A 2JB5H 5IKCA 4LLUA 1HWGB 4BJLA 4LASL 1N2RA 3SDDB 1CDBA 1E4JA 5GGQH 1FDLH 3CX5J 4YDKL 5I1CH 2APWA 2YN5A 4J2XA 2XWTA 1CLOH 3G6JB 4ODXA 4PJDE 3F58H 3SO5A 1CD8A 3BP5B 2AJUH 2IBBA 1ZGLB 1YZZA 1SY6A 3SDCB 1A9BA 2J6EL 1CWVA 2NYYC 4U49A 1CG9B 3A67H 4Z0XB 2VDQL 1U8QB 3MCLL 1MFDH 5DRWA 2O5YH 1ZT4B 3VD7A 1ZLSH 4O02H 5E6IB 3IS1X 2AW2A 3FFDA 3MYJA 4QGYA 5HHXL 5MENB 5I71C 3V5HB 4JFFB 2V9QA 4WW2B 3CSGA 1ZLWH 3MRGB 1X5FA 4WW1A 1IARB 2Z4QB 3P73B 4ODTH 1S7XB 4L8DB 3U7WL 4D8PA 1JIBA 2ZJSL 4FP8H 5C09B 1HIMH 3T09A 2C3VA 3GI9H 4PY7B 1FZOA 1G7MA 1X5XA 5D7SH 1A02N 1S9YA 1G9EA 4CDGC 3SJVD 5HHMD 4PLOB 1F58H 3LQMA 1NCUA 2EC8A 4RISL 1AGDB 5E70A 1U2HA 3UCRA 2QQKH 4ERSL 2BVOA 3EOYG 4XHQA 4EJ1C 4TVPH 3TJHC 3Q5YA 4XZUA 3I50H 3UXFA 5GIRB 2IPKA 3U4EB 3D69B 4WHYG 4PJFB 3L5HA 1AO7B 2FZ3B 4PY8I 1DQTA 4FQQA 3V0VB 5IWLC 3AMLA 3ESVF 4K94C 2F53B 3Q6GH 4OLXL 1U42A 5C86A 3UEZA 4L4VE 4MJ2A 4NBXB 1GL4B 1NFKA 1ROWA 3JUYA 3QUYB 3BDXA 1EJOL 3VFWB 1JMZA 5C0IB 1NGZB 1EMTH 1V7NH 3MRJB 1TTFA 2E9IA 4QRRD 4LKCA 3CH1A 3DX8A 1DQJA 3WL9B 2OI9C 3O6MH 4K7FA 4P9ML 4ZNCD 5T1DH 2EDQA 3BZEA 3LKOA 1OAUH 4ODVL 5CZVH 1YY8B 2Z31B 4NQDB 2XTJC 3FO0H 4LBEB 5JDSB 1M6OA 2JB5L 5DS8B 3D6GA 1IAKA 2VLJE 3MRRA 3L5XH 1XR8A 5GGQL 1FDLL 3IT8D 5L88H 5I1CL 4GLRI 4P23A 1CLOL 1LP9E 5E9DD 3ZTNH 1CVSC 1JPFA 4X80H 4DK3A 1FFNB 4CADA 2LU4A 5MP6L 2MOVA 5DJ2B 5IVZB 3VRLE 1FQ9C 5C8JA 4LNRB 5L0QB 1Q9KB 1H3UA 2AJUL 1CFTA 5GGVY 1AKJB 2K7PA 4WW2F 5TE7L 4R7NA 1AHWA 1QLFB 2NW3B 1NDMA 4KK9C 4U6YB 3BESR 5JW4Q 2X4QB 4PJ9B 5AUMA 2FR4B 1WBYA 3MO1A 1MFDL 4G6KH 3RJDA 2BRRH 2JELH 3ARYA 2O5YL 3V2AR 4O02L 1D6EB 3QRGL 3MV01 1TETH 3O2VH 2PYEB 5L2KB 4UBDC 4HFWA 4U1NB 1I7UB 5F1IB 3I84A 1NANH 3OJDA 3QEQB 3QI9C 4MJ5B 4BUGA 5C2UB 3QXUA 3WIHH 2C4XA 1DEEB 1AGCB 3RWDA 3WFBH 2DI9A 1WISA 1X5ZA 2H9GB 3MRQB 2XG4A 4MD5A 4S10A 3VXOB 4ODTL 2P5EE 1MI5E 4YEFA 1WIPA 4MCZB 2EECA 3PWNB 2MNUA 4FP8L 1W72A 1A7QH 4YNYA 1HIML 4F9PA 5D7SL 4Q6IC 4WTZA 3LY6A 3O3AB 3GSOA 1F58L 4LARL 4MNQB 3HPJB 4JHWH 4IDLA 1XMWA 5GS0D 4KROB 2Y6SC 4OM1H 1U8LA 1SMAA 3QR2A 3IXAA 1CD1A 1WT5A 1WCQA 2IAMD 4R4NC 1P7QD 4HAFA 3CUPB 3K74B 1ZHNB 1B9ZA 3GSVA 2BERA 2JCCA 1MAKA 3GBNH 4RWYH 2FB4L 3T0VA 1KNOB 5DT1H 4QNPF 1BMGA 4XT1C 3Q6GL 5C08B 5HGDA 4I3RH 3BPLB 1PYWA 3MZGB 5FA4B 3VFMA 5I1HH 2P43B 3LKSB 4M5ZH 2XTLA 1F6FB 4Y16B 4MDIB 3UPAA 1OTUC 4QRUA 5F1NB 4IRZH 5ITFA 1D5XA 1WGOA 3CFKB 4P57A 1V7NL 1PZUB 1YY9C 5AZEH 5E95B 1MCKA 1NCDL 2XQBH 5TDOB 3O6ML 5D1ZD 4WU7B 5E0QA 1PJ9A 3U7YH 5KSAA 1CXIA 1WV7T 1OAUL 5CZVL 2ICES 3FFCD 1BVKA 5DD6A 5KN5B 1DR9A 3FO0L 5IB5A 1WUNT 4IIQA 3NZ8B 3QDJD 5F3BB 3NTCH 2ICEA 2IG2L 3LVEA 4YX2H 3PL6A 5CEYB 3L5XL 2IQAA 4JCLA 5DVNA 3WHXA 5L88L 2DBLH 3ZTNL 1B2WL 4X80L 4JB9H 2VXSH 3ULSB 1VEPA 2ED8A 2VIRB 1OSPH 5ISZA 2VDKH 3RVWC 5IEHA 1X5KA 1DQMH 4MS8C 1VHPA 3ES6B 1S9WB 5HGHA 4ZPVA 3L7EB 1CT8B 3V4UL 1KCVH 4JKWA 4K23H 4LVNB 4G6KL 2BRRL 2JELL 1KLGA 5CJ5A 4ELKA 1FFPB 1TETL 2R69H 3PDGA 3O2VL 4H25B 4ZAKC 4NUGL 4LOUD 5LGJA 3LCYA 5ALBH 4DN4H 3FQTB 1FZJB 4MJID 4KKAD 1KCKA 3GM0A 3QB7C 4NDMB 5HYJA 2X4UA 1OOAA 2I07A 4I8DA 3D85B 4H0IA 1E4XH 3TCLA 3WFBL 3FO1A 1L4IA 3C5ZA 4KJPD 4QRPA 5EFIA 2DWEB 3RWEB 3MRKA 1LD9B 1DVFC 1YPZF 4Y4FC 5FV2A 5EB9A 3MJ9H 5D72H 2Z91B 5CILH 2AEQH 4WNQA 4M7JH 1A7QL 4ALAH 3KYOB 1T7WA 1C5BH 4P2CG 4F57H 4X8JA 4BQ6A 3OXSA 1RMFH 2AK4D 1ZVSA 4JHWL 3MV8D 4MJIA 3BKCH 5T3XE 5JOEA 1JTOA 1U8MA 3CIQA 2ITCA 3FAWA 4NGHH 4WTZG 3TPUA 3H8NA 4X6EA 5F1OB 1A6ZA 4O5LL 3HG1B 5I71B 4R6UA 3TBWB 1TPXC 4KVNH 1I1AC 3GBNL 3VGHA 4RWYL 1PG7H 4FNLH 4OLVL 1SBSH 5DZOA 1KLUB 5DT1L 3A0OA 3RTQC 4HF5H 1T66C 3KS0H 2VDPL 4ZYKB 4LCUA 4M5ZL 5EBWB 5ITBH 5AYQA 4MB5A 4IRZL 5TPWL 4KGLA 1FFOB 5HPMB 4GKZB 1NJ9B 3MLVH 1FL3A 2FGZA 4M61A 5AZEL 2XQBL 1T2JA 5E6YA 1TIUA 3GMOB 1IL1B 2VZTA 5L9DH 1KT2A 4PBWD 2BXZA 2ZUQC 1ZE3C 3U7YL 3X11B 3IRPX 3BT2H 3IFNH 5HD8D 5M94B 5LAXB 3SQBA 2E9BA 1GGYA 3RPKA 2FO4A 3DARA 3HC4L 2JTDA 1UCTA 3NTCL 4PGEA 1L6XA 4PLJC 2Y7QB 4YX2L 2GK2A 4P5TD 1RU9H 2KQMA 5IVXB 1S7UA 1FFRA 2JLLA 2JCCE 3BKML 1PKQA 2DBLL 3MA7B 3DLQR 4JB9L 3VWKB 2DL2A 1XGRB 2VXSL 2HJKB 1OSPL 1Z9LA 2VDKL 5IMMA 4HKBA 5L8JB 3WFHA 1FVCA 4PRBA 1DQML 1QO3A 5HDBF 3OSKA 3ZYOA 1ND0A 3NCBB 3QH3B 3IDMB 4K23L 2UZXB 2NXZD 3MRHA 4LHUA 5IQ7L 2R69L 4GRWE 5F3HA 1T0MA 1FO0B 2EKSB 5FUCC 2Y5TA 1U58A 2XKNA 1FE8H 3TVMA 2XTJB 1BD2B 3MMEB 4P4KC 4C57C 2K1MA 1NGPH 1E4XL 4P2OB 4UU9A 2AGJH 4WENB 3SDYH 5JOPE 4DVBA 4EI6B 3B2VH 2R1WA 3PDOB 3BAEH 3MJ9L 5D72L 5CILL 4Z7OE 1D9KC 2AEQL 4M7JL 1Q1JH 4ALAL 4JFOB 3A6BH 3H9ZA 5E8NB 2A6JB 3THMH 1C5BL 5ELIA 4F57L 3BSZH 3BGMA 1RMFL 2HA1A 3H9HB 3CFJB 4RZCB 3T8XA 1AD9B 4E41B 1CN4A 3MLTB 3BKCL 1RUKH 3EJZC 3D39A 1AD0A 4QTHA 2NY4B 3WIFB 5GS0H 3LSOB 5F88A 4NGHL 4FFWC 5ISZE 5CD5C 2GY7B 2VKWA 3OKMB 1MLCB 4KTEH 4PJ7A 3CX5K 1Y0LA 4GW1A 2WINA 1RZIB 1ACZA 4JPKL 3P4LA 5DK0B 2BVQB 3QI9B 4ENEC 3PGCB 4J12A 1A4JB 1IKFH 4KVNL 3DURA 5FGRA 1PD6A 1YEEH 3ARDD 5I1LB 4FFVC 4FNLL 5LG1A 1MCOL 1RPQA 1CIDA 2VLRB 3ZE2F 2J8UF 4NYLB 2CUMA 2PNDA 4HF5L 4JZNB 4TUJB 5HYJE 3WE6A 2RHEA 2R23A 4RMWA 5JMOC 1NBZB 4RGNC 3WS6C 4UQ3A 5J6HB 1KB5L 1X5GA 2CDFA 4HPYH 4O58L 4QRPE 4G8IA 4AJ0A 1CBVL 4OCYL 4BZYA 4RX4D 1A6AB 4UT6L 4UDUB 3MLVL 3O3UN 1EH9A 2X1PA 1BP3B 4N0UB 4N90D 3ARDA 4PJCB 5L9DL 4KI5C 4CJ1A 4JRXB 5BZDB 1D5BB 3BZDA 3P77B 4NRXA 2J1KA 2G5BB 3IF1B 4GXUN 2RJMA 3BT2L 3IFNL 2ICWB 3O3EA 3H9SD 3O3BB 3MREB 5TQ0H 2OS7A 5F9OL 4NKMB 1HH6A 1QKZH 2VR5A 3MJGX 1W0YT 3HC3H 5D2NA 4OAWB 1RU9L 4H26B 4ZUSB 4TUKH 2JJTA 2V2XB 2AXGB 4G6FD 5SWQB 1A47A 4LEXH 3ELAT 1UB6A 4X4XA 3U36B 4YHKL 1NLBH 5A2IH 3FO9B 4Q9BA 1NFIB 2H2PC 2VSDA 5I1KH 2CMRH 3LPGA 3QFJA 5DC0A 3MUGB 2YSSA 3ZO0A 4BSVB 4AEEA 3BEWB 3DUHA 1JNNL 3EKCA 2EE6A 3IJSA 4YGVA 5F97E 4LHUG 3WKMH 3NFNA 3E6HB 4KHXH 4IMKC 2VNCA 3CVHB 3UZVB 4HC1A 4Y5VA 2A1WH 2EIDA 2QHRH 5BS0D 1P7HL 1FE8L 1MEXH 3NPZB 4GG6A 4H8WH 1AQKL 1F2QA 1NGPL 1KIPA 2AGJL 5INDA 4ZUTB 5B4MD 3SDYL 1YEFH 1G9MH 5DVKA 2L4OA 3CXHJ 3PF2A 4L8SA 4EVNB 4WI4A 4JO2H 1Q1JL 3M1BB 4JGMA 3THML 2X7LB 3RZCC 1UH2A 3DOSA 5TFSH 4PJ5B 3BSZL 3JTTB 4MJ6A 3S8WA 1RUKL 4L3CB 5ALCH 5BS0A 4DOHE 3EOAA 3HUJB 1OAZH 3H2WA 4H1LH 3W9EA 4KTEL 4BH8A 4RA0C 1F13A 1UJ3A 5FIEA 1FV1A 1WWBX 1JYWA 3O9WA 4OZHE 1KB9J 1BWMA 1U95B 1IKFL 2FX9H 4U1JB 4HSQA 1YEEL 4P3DB 4PJAE 5C70A 3BMVA 2DI7A 5F71A 3TFKC 4PJCF 3ARVA 1DVFB 3EDFA 2DLEA 3QIUA 4LLMB 5ETUB 3H6JA 4JRWA 5JQHC 4F7PB 5E94A 5ENWA 4OD2B 4XVUC 4OZGA 1K3ZA 5I73B 1H15A 4WO4B 1G7HB 4LFHD 3RRQA 4XBEH 3P0YH 3MNVA 3TV3H 5D7KD 1MJUL 4GOSA 1EGJH 3BZFB 3EOBB 1LK2B 1RJYA 3MRLB 3BPCB 1M4KA 3RY6C 3LV3B 1LO5B 5IB4A 2P24A 3D39E 4DAGH 3B5GA 3DHJA 3FB5B 5KSVA 4X6DA 3F7VB 3OG4B 4UOW0 3GB7A 4FXLA 4S0SD 3DBXA 5GRJH 3FTGA 4BH7B 1QKZL 4JANB 4PJ7E 4G9DB 1PX4A 3HC3L 3HLAB 4UUJB 3GDBA 4NO2A 3NIFE 3F8UB 1MF2H 1ULVA 4MD4B 4TUKL 2PO6C 4ZODA 1HYSD 1R3KB 4LEXL 3VD5A 3FB8B 3ZKQD 3QQ4B 3MRNB 2ZUYA 5GGVH 4P2QA 4AIZA 2GHWB 4PJBF 1X5IA 4NSKA 5F7LB 3MRDA 3Q5OA 1U8PA 5I1KL 2CMRL 3B9AA 2UWEB 1D5ZA 4JZOA 1T7VA 2PXYC 1XF4B 2VLLB 1O7SA 3D87B 2YR3A 4PJXB 2R4RL 4HIEA 5FECB 3KPNA 3BW9B 3WKML 4KHXL 3TIEB 5BRZB 4LLAA 4CNIA 2A1WL 4ZS7H 2QHRL 1IGFH 5DJXB 1MEXL 4HIHB 4QYOA 1EXUB 3GMMB 4EI5C 4H8WL 3VA2C 4YHYC 3JWOH 1B0GA 2NPLX 3P0VH 4HLJA 2F54A 1YEFL 1WAAF 3QIBA 4Y4KD 4FXGB 5BOPA 1NEZB 4BFIA 4TYUA 3F7PC 3NBNA 1DQLH 4MHHI 3MV9D 5GS2D 1R5VA 1QR1A 1U92B 4L4TB 4WV1C 4N0CD 1DL7H 4W68A 4O2EA 1U8IA 4JKLA 2Y25A 2IANB 1YEGH 2BZDA 4I18C 3IDXL 5ALCL 3TWCH 1KGCE 2GK0B 5JHDB 1DBKH 2X5PA 5C0CA 2V7HB 1H3GA 3ZKMC 5B3NA 2V7NA 1CICC 3N1QC 4HK3N 1XGPB 4PJHB 1QRKA 3QFJE 2M26A 3HCVA 5HYQB 4MWFA 2FX9L 4P4KB 3HI1B 4Z7WA 4HJGB 1WCBB 1ED3A 4M1CC 3LD8C 2B2XH 3D3VD 1YA5A 3SCMC 1P5VA 1A9EA 3QWOB 4Y8AA 3RUGA 5BW7C 2P1YA 4GG6E 1D9KB 3X12A 3KR3H 1JTTA 3V6FA 2ERJC 2GSGA 2AV7A 4E0RA 3GSQA 4LCWB 3P0YL 4XBEL 3TV3L 4UOJA 1EGJL 3TN0C 2KDGA 5GGUB 1HOCA 1ZVHA 2W60B 5D7IE 1IVLA 2GITB 3BJ91 4LLDB 4DAGL 2DQGH 1JZ2A 1XGYH 4GAYB 5IHZB 5GHWL 1BJMA 4HJ0D 4G8GE 5FK9B 1H3WM 3DECA 5FO7A 5GRJL 4PGBB 4OFYD 4OI8A 1QSEB 4NC1E 1KELH 2YXFA 3UTSB 4PJXF 1B0RB 1MF2L 3BN9D 2V9TA 1CYGA 3TBTB 1UKTA 5DDHB 4TUOB 4FTVB 4RGNB 3T2OA 2OMNA 4MDJA 3VGAB 4U1MB 4RIRA 4P46C 1MRCH 4F7CA 5GGVL 3SDXF 5J11C 2BSSB 4PV8B 4AQOA 3IB4A 3PABA 3TYFA 5BXFA 4Y19A 4MAYB 3HE6C 2P49B 4NPYA 5CSBA 2D7OA 4PLKD 4JFDD 4OZGE 3WFDH 4WFFE 2N56A 1CFQA 1NC4B 1GH7A 3WN5C 3DX7A 1MHCB 2ZCLH 1A6TB 1RUQH 2FEDC 3DVGB 4Y4HC 5I1JH 3QO1A 3IAPA 4ZS7L 4G6AC 2YD8A 4G8FB 3UPRB 1F5WA 3DX6B 3T0EB 3BOVA 3WYRA 5CJ8A 2WUBH 4UQ2A 4YXLH 3JWOL 1ZA3A 3P0VL 3BEVA 1AR1D 3C08L 3WLWC 4JZJB 3ARED 1P2CA 4HIIB 4S0TD 3BGFC 2HG5B 4JDVB 2K7QA 1DQLL 1FL5A 4N5UA 3H3BC 3H0TB 4JFDA 3CGTA 4PJHF 4N5EC 2IBZX 1DL7L 1KIQB 2IQ9H 3DPBA 4M6OH 2VITA 4HXBH 1YEGL 4U3HA 2CR3A 4LSSH 4YBQD 5JO5B 3W81A 4EN3A 3P11L 5AD0A 3QDGB 1DBKL 4MQ7A 2PW2A 4HT1H 3RA7H 1WITA 4PGCB 3JTSB 1TZIA 1A14H 2QLVB 3GHBH 4OSUH 4NQCD 2BNUB 2O61B 2BFVL 2DIAA 4MXWH 1WBXB 3B9KD 4MA3A 3P9WB 3BPNB 1V3KA 2HFTA 2B2XL 2ADGB 4LSRH 3GKZA 5CLWA 2VDRL 3S3PA 1EFXD 2H8PB 1HSBB 4HGWB 2WBJA 1FNEB 3R4DA 5JXEA 3KR3L 2J3SA 1FG2B 2F54E 5DRNB 5GRWA 3RZCB 5J6GA 1S7RB 4JLRB 2DMCA 2GJZB 4L9LC 1S8DA 4WWID 3VFRB 1KEMH 3QQ3B 3FJTA 3MR9A 5E5MB 3SE9H 3VXMA 3DMMD 4XH2B 1NFDB 2DKSA 3KNBB 1ADQH 3REVA 1JN6A 2Y36H 4FN0A 4Y2DA 3F5WB 1H3TA 1KN2H 5I8CA 2QSTA 4PTUA 2PUQT 3GSNB 3RWHB 2DQGL 1XGYL 1IGJB 1BQUA 4ZS6D 2CR6A 3EOTH 3NH7H 3V6OA 1U3HA 3B3IA 4MHHG 4BELD 4D0BA 4YAQB 3NCFB 2X1WL 4ELMB 4I4WA 1NGXB 3C5SB 3JSSA 2E9JA 1S7QB 3ZDZF 2HFFA 3KPSD 4YXKL 1MI5D 2HRPL 5HHPA 4S1DC 3DMMA 1MRCL 4OQTA 3ARGC 1QHPA 1ZKAA 4ZFOA 4K3GA 4EXKA 4EQ3A 5L2JA 3RUGE 1BVZA 3WD5H 2PYFB 4QOKB 3OR6A 4OZFA 1AGEA 3WFDL 4ZXBD 3HI5H 5JIHA 1BOGA 1L7TL 3L3KB 3S34H 5BO1H 4LNVA 2B4CC 3T4YA 4OV5B 2VC2H 1WF5A 4YZFF 2ESVD 5I1JL 2OL3A 4LSTH 1SEBB 2J8HA 4NRYA 4WFEE 3BQUC 2CLVA 1HQ4A 1CGXA 3KPSA 4RAUA 2BC4A 4PRNB 4OLYL 2W0PA 2XN9E 4YXLL 3AVEA 3EYQD 2GJ6B 3KPOA 1ORQB 1NBYB 3U4AA 2GTZA 4GG8B 2A6DB 3QXTA 3BH8B 3RGVA 4NZDA 1RK1B 2BCKB 3NIDF 3RI5K 4ZDHA 1Q9WA 4PLNC 5GS2H 3FQRA 4DTGH 2IQ9L 5IJVB 4M6OL 4HXBL 4OFKA 4MJ4A 3PV6B 1A0QL 4LSSL 4NKDB 4O2CA 4F3FA 2LV4A 1UACH 1JHKL 2QR0B 1YNKL 3O4LA 3MCKB 4WIQA 4UB0L 5FGSA 4HT1L 2I26N 5FYKD 3RA7L 1PDKA 4Y19E 1UYWH 5D2LE 4X5WB 4RGOH 1BEYH 1XT5A 3GHBL 4OSUL 3RU8H 3V4VH 3ZMRA 1WWAX 4XMLH 3TO4A 3JBG7 4PP1D 1NAMB 4MXWL 4P3WA 4C58B 5FO9B 4YHYB 3BP7B 4RWHA 5IM7B 1L0YA 3S4SB 1I85C 4LGRB 4LSRL 2VLMD 4JRYA 1LEGB 1NFDF 1G7PA 1XAUA 3RVUD 2NY2D 4YDJA 1IZJA 2BSTA 3FOLB 5HTSA 1BFTA 3TBSB 4N8PA 4JO3H 4WV1B 4MXVE 1H5BC 2Y4SA 1FN4B 5CZKA 1GGTA 4BKLB 1A6VH 3PNWB 4WI7A 2D0GA 4I18B 1MLBA 1L0QA 3K8LA 2CRIA 3MODH 2BY2A 1N6VA 3G04B 3STLB 1MY7A 1ADQL 2C1PA 2Y36L 3CXHK 4KJQC 1VKXB 2OTWA 3ZE1F 5EU3A 2DYPA 1OAXH 2ZG1A 3FT2B 3JV6B 2R2BB 2ID5A 2E3VA 1E6JL 2DJUA 2WSKA 3EOTL 5ESAB 3NH7L 3FRUB 1CLCA 3DWTA 2HTKD 5C9JA 3LD8B 5D5MA 1DLHA 3CDYA 1P6AB 4XBPA 3DXAB 1I3RB 4OLZH 3SCMB 4XNQA 2APFA 4QHMB 1FYTB 3WMSA 3SKUD 4PJEB 3LRHA 5E03A 1F4YH 3PQYB 1XF3A 5IBLD 5FV1L 3QULB 3LB6D 4LLWA 3ROLA 3SOBH 1P4BH 4Y8DC 3QDMB 1AXTH 5CSZA 5IW3A 3WD5L 5GS1A 2WWKO 5T3XD 4FRWA 1YUHA 3S34L 5H37H 5D6DC 4JFPB 4P23C 1UWXH 1J8HE 2A9NH 2VC2L 4OZFG 4J3SA 1Q9LB 3TZVD 4LSTL 5IR1B 2VDLH 4JPWH 1HE7A 3TYGL 5GGRA 3VXME 5I1DA 1WIOA 1F11B 4O4YH 5D1QA 4I2XB 1X7QB 4D0DA 2X70B 5KVEH 2GT9B 3L3GB 4D0CB 3LH2H 4PR5B 1K6QH 4QHUB 3V6OE 4YLQT 2XPGA 4JJHA 1B6DA 5BJTB 4P46B 3RIFK 5J11B 5BCAA 4DTGL 3LQAC 1SVCP 1UM6L 2G75B 3ZYIA 4CMMA 3VJ6B 5T1KB 1UACL 4I0PA 3LN5A 4NFBA 2I25N 2BHYA 4PJIB 1LEIB 1JHTA 2C3GA 3HRPA 4HUXA 2NX5E 4NNXB 2IMNA 5ACZB 1R3IH 3RNQB 1UYWL 1FZMB 4FQ2H 4Y4HB 4RGOL 1BEYL 5DJYA 1FAIH 4F9PC 1BZ7A 2XZAL 4KK6D 4XMLL 4LRIA 3T3ME 2DM3A 4O2FB 1KJMB 1F2XK 3CFEB 1BGXH 2Z93B 3GJFK 3PV7A 5D9SA 1HWHB 5FA3B 1NLDL 5CBAA 4P5KA 4OCXH 3BGFB 2XZQL 1WT5C 3IGAA 1J10A 2GKIA 4R9HA 4CVUA 4JO3L 5I66A 1R3JA 4B5EA 1HXYA 5IMOB 2UYLA 4JCMA 5INCA 4ZUUA 1C16B 4Z5RA 4XHJD 4ONFH 5DURD 1KEGL 1F4XH 5EUOF 3O81A 3MODL 3BP6A 4JFED 3IFPA 1J7VR 5GS0C 3FCTA 1IEBA 3GFUA 2CQVA 3KXFD 5EBGA 1KJ2A 4F15C 1OAXL 3I75A 3EYFA 3UTZB 1IGTB 1LE9B 5SX4H 5EN2B 1ACYH 2XQYG 5GJTH 5DGRA 3OZ9L 4XWGH 3HZVA 1AJ7H 4G80B 5HHVH 3TA3D 5E1AA 1JZ5A 2ZG2A 4U4BA 1IZKA 1TQCB 2QL1A 2GI7A 1N59A 2FJHB 3O2DH 4WUUA 2VAAA 4FQLH 3QQ9D 3W11D 2OSLB 5DHXB 1F4YL 1KTLA 3MLSL 3HNSL 4QHLA 2IH3A 4JRYE 3B6SB 4LU5H 5HYSA 2X1QA 3SOBL 3HC0A 4IIQC 1P4BL 1AXTL 1T1WB 4GAFB 3GZKA 3SDDA 3PL6C 4QRTB 5MEND 3G6JA 1IAOB 1JL8A 2A9NL 2NZ9D 4FA8A 2LU7A 3BP5A 2VDLL 2VQ1B 4LCCC 2YD4A 4JPWL 1ZGLA 4Y89A 3O45B 4D9LH 3M17B 4JFXB 4JY4B 5CEZE 3SDCA 1CG9A 4Z0XA 3ULUE 1RJLB 1U8QA 3JWDH 4O4YL 5KTEH 2OJZL 4WWKD 5D6CB 4PJIF 5DUBB 1ZT4A 4YUEH 4PRHD 5E6IA 2NMSA 5KVEL 2P8LB 1HN1A 4R2GB 5J1TC 3LH2L 1K85A 1LE5B 5D5ME 5MENA 3DRQB 1DE4B 3ARGB 3V5HA 4JFFA 1CDCA 4WW2A 3GIVB 2FX7L 3MRGA 1OP9A 1U93B 2Z4QA 2OM5A 3P73A 1S7XA 4L8DA 3HI6H 1R3IL 1X3DA 4ODXB 3C6LD 3ZTJG 5C09A 1IGCL 1JF1B 4PY7A 5F7WC 1FAIL 2NNAB 4RBPH 2BNRE 4G43B 1RAMA 2Q76B 3BQUB 4LOUC 4X9GA 5EU6B 4JO1H 5T33H 1A9BB 1BGXL 1AGDA 4KKAC 4PIRF 4J6RH 4H8WC 5M7QA 1R0AH 1QSFB 3LKQB 4POYA 5SX5H 4OCXL 1TXKA 5CJBA 4KJPC 1JP5A 3QUYD 3H3KA 1G9MC 1FIEA 2DKUA 5GIRA 5FYJD 3RP1A 1JBJA 2YXMA 3HTLX 3U4EA 3D69A 4MB4A 1I1RA 3VE0B 1AO7A 1OT2A 2FZ3A 3D2UD 1WFUA 3V0VA 2DQIH 3OJ2C 3O0RL 4YBLC 1DFBL 2F53A 3L5WB 4Y1AE 5IBTH 3VFSB 3BO8B 3INUH 1NAKH 4CN1A 3QUYA 3KJ6H 3UYRH 2BVUA 2V9RA 3VFWA 4YHZH 3W9DB 5GJTL 5C0IA 1NGZA 5C0AE 5DF0A 2PW1B 3MRJA 4XWGL 4U1GC 1AJ7L 5CSGA 5HHVL 4ZD3H 4QEGA 3RDTB 3WL9A 3DTXB 5F89B 5GRUH 4ZQKB 4F8QA 1EUUA 3K1DA 1QFWH 3O2DL 4FQLL 5B3JE 1H5BB 1CFVH 4HD9A 2Z31A 2MHAB 4NQDA 4LU5L 4LBEA 5JDSA 2HN7B 1OP3K 2LE9A 4CDHA 3MV7E 5DS8A 3SJVB 5L7XH 5HHMB 2E7BA 5GGSB 2IALB 4YDIH 5T3XH 1Q8MA 1AC6A 5E2WH 3IVKB 2EXWD 5F9DC 4M3KB 1FFNA 4R96B 3R0MA 5DJ2A 5IVZA 3GNMH 4LNRA 4WEUD 1FC2D 1Q9KA 2NY0D 4N9GB 1AKJA 2EIBA 1QLFA 4U6YA 2NW3A 2VWEE 2X4QA 4PJ9A 2FR4A 4GKSB 5KTEL 3JWDL 4D9QD 5EZIH 1B4RA 4YUEL 1D6EA 2FBJL 3NPSC 2PYEA 5L2KA 5F1IA 2J12B 4U1NA 1I7UA 4P5TC 3QEQA 3RL1B 4LKXB 4OGAC 4JY5H 4MJ5A 3TVMC 4HMCA 3MFGB 4KI1A 1DEEA 1AGCA 4RGMC 1AC0A 2H9GA 3MRQA 4WUUE 3SEPA 1NCAH 1EAJA 3VXOA 4QRRB 3HI6L 1IM3B 4MCZA 3PWNA 2F9BT 4U3CA 4JGJA 2APTA 3TO2B 4ZO9A 4F9LA 3BP4B 1CE1H 1R24B 3O3AA 4XX1E 1IT9H 4H88H 4MNQA 1FNHA 4JO1L 2P4AB 4KMLB 3HPJA 5T33L 2QSVA 2DQHH 2XZCH 4J6RL 5C08D 3G6JE 1GZQB 1R0AL 5HGGS 3JV4B 1IJ9A 2FHCA 4GMSH 3KPRD 2WUCH 4NKOB 3SQOH 4FQCH 1LMKA 3CUPA 4IEFB 4R97C 1SYSB 1JK8B 1ZHNA 4XP6H 5E9DB 1JE6A 3MRBB 2VDNH 3QCTH 1N26A 2WM0A 1KNOA 5F7HA 1W0VB 1XF5B 1RVFH 2DQIL 4KUCF 5IBTL 5C08A 4WI5A 1OWRM 5DUPH 1JGDB 4JFFE 5FA4A 2N1KA 1HNFA 4U6VL 5DJ8B 2YKLH 5CJQH 5KAQF 3HS0B 5IB1B 3LKSA 2C9AA 1W8NA 2P5WD 4Y16A 4MDIA 3VXNB 5F1NA 3KJ6L 3UYRL 1T2XA 3WO4B 4YHZL 1OD7A 3CFKA 4PBVC 4Y0GA 5D7LE 3BIAX 4K3JH 1NUDA 5TDOA 4HKZB 1A7OH 5C09E 4PREB 4ZD3L 1U8KB 3ARDC 2VH5H 5GRUL 5EPMB 5IROC 4WU7A 5B38G 5J3HD 3GJEB 3SGEH 2DLFH 2HJLB 4NBYB 2NCMA 1T5WB 3V8CA 4NN5C 4OFDA 1PKOA 5KN5A 3VFVB 3OX8B 1ZANL 1V3JA 2QQNH 3NZ8A 5F3BA 3EYSH 3RHWK 5L7XL 5D2NC 1EHLH 5CEYA 1QNZH 3MUHL 4AEIH 4PJFE 5T3XL 4OD3H 5KVGH 3VW3H 3G5XB 3G5YB 5E2WL 3ALWA 4GT7A 1AO7E 5GRZA 5LBSH 2BSRB 8FABB 1AFVH 5FEBA 2WIIB 3ULSA 4F15B 2VIRA 3DX9B 2XKUA 4P48A 1EBPA 3GNML 3RWJB 3ES6A 1S9WA 2IAMB 3L7EA 2F53E 1CT8A 1NC2B 4KH2A 1EIBA 1P7QB 1I3GH 3ZE0F 4ZTPH 1QLEH 3EYVB 5EZIL 5EO1B 1FFPA 4LVHB 4H25A 4IRSD 4V2BA 3S97C 5DQJB 3FQTA 1FZJA 2BNQE 3VGGA 4TSCH 4NDMA 1WZMA 3G6AB 3D25B 5K59F 3FQXB 4YXHH 2Q3AA 5I1GH 3D85A 4P59H 5C0ND 3OKLB 2DWEA 5ESVB 3MBXL 1LD9A 1JNHB 3C8HA 5FUOH 5E00B 4BK4A 4NQDE 2LTQC 3HG1D 3MRFB 4FOMA 2Z91A 3VXQB 4K7PY 2JJUA 4LIQE 3MLYH 5DQDL 5D1ZB 4CN4A 3KYOA 1RZKC 4PJGB 1XF1A 4LCCB 4RMTA 4S1RH 1IQWH 1IT9L 4H88L 5F9AC 3SKMB 4KRLB 2APXA 2DQHL 2XZCL 2Q3ZA 3FFCB 3KLHC 1GHFH 4G8GD 5C2BH 2I24N 4QXUH 3VFUB 3QDJB 5HI3C 4RAVB 1UJ3C 2WUCL 4HW6A 3SQOL 3MOAH 2CJUH 4FQCL 3O9WC 5FYJH 3HG1A 3V5KB 3TBWA 2F74B 4ORZC 2DLIA 2VDNL 5I76B 4N8VB 5L2KE 1FNLA 3GMLB 2DM7A 1KLUA 5I1IH 4PBXA 4HX1B 1IEHA 4NOFA 3QEQE 5GISH 3ARFD 2YPVH 5DUPL 2AABH 1J86A 4ZYKA 4KKLD 2YKLL 5CJQL 4KY1H 4XB7A 5EBWA 5C3TA 1OWWA 1CK0H 3ARRA 1FFOA 5HPMA 4GKZA 3T0XA 1NJ9A 4UTBH 4K3JL 1HHIB 1A7OL 3GMOA 1ZLUH 1IL1A 4P5MB 2VH5L 4OFPA 4X6CF 3PWPD 4MNQE 3X11A 4IS6B 1YEDB 3K0WA 5K9OB 4MSWB 1U2CA 4IDJH 4NQUA 4EZMA 4XVTH 4NWTH 2HFGH 1I3VA 3QG7H 2QQNL 3STZB 3BWUC 2FBOJ 3IXTB 4NN6B 4NT6B 2AK4B 2Y7QA 4YBLB 5IWLA 1EHLL 5GGTH 4NQED 3MV8B 1QNZL 1S5HB 5IVXA 4AEIL 3VW3L 4OD3L 3BI9X 4XVSH 1BIIB 3MA7A 4H1LB 1AFVL 4UILH 4B7LA 4Q6YA 3VWKA 4MYWB 1XGRA 2HJKA 2BOCB 4JHAH 3M45A 3VGEA 1LEKB 3TBVB 3VI4F 3QH3A 4OF5A 3IDMA 5D1XD 2X9WA 2XWJB 4U1GB 4ZTPL 1QLEL 1CLYL 3QBTB 5C0JB 3VXRD 1C12B 4XP5H 3ZDXF 3K4ZA 3NZHL 1FO0A 4H0HB 1D5MB 2EKSA 2LQRA 3CCHB 1NBQA 1UJTA 4TSCL 5JA9A 1VFBB 2CUIA 5EZJB 1BD2A 3MMEA 1FLRH 4YXHL 5I1GL 4P59L 4P2OA 1WEJH 3LZFH 3FONB 1G7JB 3QIBC 1KYOK 1VB9A 3FOMB 4EI6A 5FUOL 5FYLE 3PDOA 3WO3B 2DF3A 4OFVA 3OKNB 1NMCC 5B8CB 3AXLB 4PRAB 3MLYL 4JFOA 5E8NA 2A6JA 2B0SH 4A6YH 1RSFA 3QWRD 4S1RL 1IQWL 4UNVA 3H9HA 1KN4H 3CFJA 1V7MH 1AD9A 4RZCA 4E41A 4HS6B 3MLTA 4K7PX 1NH6A 1GHFL 5DD0H 4IJ3B 3WIFA 5C2BL 3LSOA 4Y5XC 2Y23A 3OKMA 1FIGH 3DYMA 1MLCA 3NPSB 4Z6AT 3ZSSA 1GC1H 1KTRL 3L3OB 3QRFM 4P5TB 1RZIA 3MOAL 2CJUL 2BVQA 5DK0A 3QI9A 5FYJL 2X44D 3PGCA 1G9NH 4XNMB 2E7HA 1A4JA 2I9LB 4OJFH 4N0CC 3ZDYF 5C1MB 5I1LA 4UNUA 3QUKB 2A83B 4K2UH 2DB8A 2VLRA 4NYLA 3K2MC 5FFLA 2SEBB 3IKCB 1W0WB 4JZNA 4KHTH 1UADC 4TUJA 5GISL 3ABZA 2NXZB 4MB3A 2YPVL 2AABL 4GRLD 2CDEB 3QAZC 2EDFA 5FM5M 1NBZA 2DRUA 4KY1L 1G6VK 5J6HA 2X9YA 5DJAB 1CK0L 3KPQB 4XNZC 5FDWB 1RQ5A 4GKNB 4HDIB 3AGVA 1U8HB 1A6AA 4UDUA 4WFED 1NCNA 3VXSE 4UTBL 5AWNH 3NCEB 4X83A 4N0UA 2XN9D 2YD9A 3E2HC 5HGBB 4PJCA 3QT2A 4JRXA 5BZDA 3BE1H 1D5BA 3P77A 3TESA 3DYPA 2G5BA 3IF1A 1JZ8A 1UCBH 4DVRH 3UX9B 4DUVA 3VRJB 4R97B 1UZ6F 2ICWA 5BMFH 1X4ZA 4NWTL 5IV2B 2HFGL 3LKNB 3C60D 1A3RH 3O3BA 3MREA 2V17H 1YEJH 4NKMA 3T2QA 5D7JD 4OT1H 5GGTL 1ZA6B 4OAWA 4H26A 4U6XB 5E6ZA 4ZUSA 1JV5B 1S5IH 3LOWA 3ESUF 2V2XA 2AXGA 4XVSL 5SWQA 4UILL 4V2CB 1I8LA 3U36A 4JHAL 4OKVB 1PLGH 3U4BH 3FO9A 5KS9B 1NFIA 5E8DL 3T4AB 5LVEA 3LS4H 4NM8H 3MUGA 4Z0BL 4HJ0C 1N3NB 4POZD 2AJVH 4BSVA 3BEWA 4XP5L 2KZWA 1H8OA 3CMGA 2APBA 1PEWA 3E6HA 3CVHA 1I9RH 1C8PA 5MEQA 4NN5B 4KKNA 1ZOXA 1KV3A 2HWZH 3DVNB 1GOGA 3KYMB 1FLRL 4YR6B 4Y5YB 1WEJL 5DD1H 4ZUTA 3M07A 2NR6D 1JWMB 3GEWB 4AEHH 2I5YH 5C0BD 3S6CA 4J23A 4NUJB 3MUZ1 4PLKC 3NIGE 1FHGA 4EVNA 3M1BA 1F6LL 4OIIH 2X7LA 2B0SL 5F9WB 4A6YL 2VTFA 4PJ5A 3JTTA 2R2EB 1KN4L 5IVXE 1V7ML 3CC5B 4L3CA 2K3TA 2GSIB 3E6FB 5T1LD 3H9SB 1WAAA 3L6FB 3VXUD 3ZKSD 3HUJA 5FM4A 2QQLH 1FIGL 1GC1L 1JVKA 1RIHH 3KAAA 5GJSH 3OF6A 4TNWK 1G9NL 3ARPA 4G6FB 1U95A 5IEKB 4CMHC 4U1JA 4WFHE 2YD2A 4OJFL 4P3DA 1IMHC 3OB8A 4KHTL 4MA7H 3QUZD 1DVFA 4DZ8B 2QSCH 3QYCA 2A74B 2XTJE 3CLEH 1BD2E 4LLMA 4YBQC 5ETUA 5C07B 2WBJC 3EJYD 3T77B 1IRAY 4DCQB 4F7PA 3D0VB 2MPAL 2X1OA 4JREB 4OD2A 2EEDA 5JXEC 4LPXA 2DQFB 1J8HD 2Z92B 4WO4A 2MKWA 1G7HA 5LQBH 1U8NB 4KAQH 5AWNL 5DUMH 1IAII 2YD1A 3BZFA 1S9XB 3EOBA 3QXWA 3S7GA 4XTRD 1LK2A 3MRLA 4GRMB 5GSRB 2VABB 3P4NB 3BPCA 2D7TH 3BE1L 4V1DB 4Y2DC 3LV3A 1LO5A 2FEEL 4E41E 1BAFH 4FXKB 1UCBL 4DVRL 1CR9H 2OXHA 2C1OB 4Q58C 1TTUA 1EFQA 4XPBH 1BVLB 5BMFL 3FB5A 1F6AB 3F7VA 5KS9F 1A3RL 2J7LA 2V17L 1YEJL 3V6OC 4BH7A 4JANA 1U3HC 4G9DA 3PXJA 3BUTA 4OT1L 3HLAA 4UUJA 2JE8A 1MAMH 1S5IL 1BJ1J 1R3KA 2NX5D 2CGRH 2F15A 3FB8A 3DMMC 3QQ4A 3TH2T 2XT1B 3MRNA 5MI0C 1MIEL 3R06B 1HQRB 1PLGL 5DI8B 5E1HB 4OZIF 3U4BL 2GCYB 3I3EA 4TTDC 2XACC 3MOBL 2GEEA 4NRZB 3UTTD 1BQLH 4NM8L 2UWEA 3HZMB 4ZS6C 2AJVL 5IFAH 1XF4A 2VLLA 4QO1A 1KSRA 3MZTA 4PJXA 4K3HA 4LLYB 7FABH 5FECA 2K9UA 1INQB 3BW9A 4FQ1H 5BRZA 3TIEA 1MCEA 2Q8AH 5DJXA 4RNRB 4HIHA 1EXUA 3GMMA 1BBJB 3H9YA 4JRXE 5J7CC 5DD1L 4ZSOE 3GSWB 5DWUH 4FXGA 4IRJD 2R0ZH 3GMRB 5DTFB 4AEHL 1E27B 1NEZA 5JR1H 4ZNEA 3W2DH 3RGVC 2BDNH 5F72S 1T3FB 4ZXBC 3QNZB 1U92A 3P4MB 4L4TA 4HEME 1CGWA 3UYOD 4EBQL 1OGAD 5IG7B 4DQOH 1M1SA 1N4XH 2IANA 5FGBA 4XNXL 3RIAK 2GK0A 1QRND 5J9PB 5JHDA 3JWDC 2QQLL 2V7HA 3EYQC 2G9HB 2IWGA 3EO9H 1XGPA 1RIHL 4PJHA 3HE7D 2VLKE 4CNIB 5GJSL 1X4YA 5HYQA 2FSEB 4P4KA 3HI1A 3Q3GB 4HJGA 3C09C 3R8BB 1WCBA 2L0DA 4ACPA 4KUZH 1VSCA 3KYAA 4MA7L 3QWOA 3OPZH 2A6IB 3G08B 2FGWH 1QFWM 2AXFB 2HYMA 5KSUB 2AJXH 3UTSD 5LQBL 4KAQL 4OGZA 2HVJB 4LCWA 2VO5A 2IFFH 5DUML 4PP1C 4Y5XB 3DIFB 5GGUA 3KDMB 1OPGH 3JUZA 3PHQB 3DETC 4PJ5E 2W60A 2OR9H 2D7TL 2ZUUA 4Z7VE 4Y4KB 1T1YB 4NP4H 2GITA 1CR9L 3RVUC 4LLDA 3U9PH 4XPBL 2BVEA 4GAYA 3MV9B 5IHZA 3HUJE 3MACH 2RAMA 3O2WH 5FK9A 1NC4D 2CDGB 4PGBA 2B5IB 3DUSB 4Z7QE 1QSEA 3ROOB 1QP1A 3UTSA 1B0RA 5HVHC 4BFBD 3TBTA 5A1AA 1HDMB 1KC5H 5DDHA 4TUOA 4FTVA 3WXVH 2ATKB 4IOFD 1NKRA 4U1MA 4NNYB 2BSSA 4PV8A 4XNZB 3RWFB 3ULVF 3Q5TA 4MAYA 2GSGB 2BNRD 1J18A 2OBGA 1I9EA 1BQLL 3E2HB 2CSPA 5IFAL 1R6VA 1NC4A 4K55A 5HDLA 3D3VB 4UIMB 1MHCA 1A6TA 2ED7A 1E4KC 4M93B 4FQ1L 3DVGA 3K8MA 3QCVH 4G8FA 2Q8AL 3UPRA 3DX6A 3GIZH 3T0EA 4HAGA 3QQNA 5IBLC 1XZ0B 2XG5A 4JZJA 5D1QC 2R4SH 5DWUL 3LB6C 4P9HH 4HIIA 1VACB 2R0ZL 2HG5A 2FYYB 4JDVA 5JR1L 3ZSTA 4K7PH 2BDNL 3H0TA 4Y1AD 1KIQA 1NEZG 1NGWB 4DQOL 2ADFH 4HJJH 4L5FL 5T3ZE 4R4BB 1N4XL 4JKPL 3TZVC 2CXKA 1TVDA 5JO5A 3IRZA 4I0PC 3L3IB 2CKBH 3QDGA 4URTB 3MSPA 1C1EH 1FL6B 3PG2A 3PP3K 1J12A 1ZHBB 1ZV5A 2D03H 1I9JH 2VZOA 2WNGA 5BV7H 4PGCA 2HT4D 3JTSA 1MWAH 3EO9L 4DEPB 1JI2A 2EDTA 4QF1A 2BNUA 2O61A 4QCIB 2UWEE 5LGKA 1WBXA 1ZA3B 3BEVB 1NCTA 1OTTD 5JTWA 5DK2B 4PTTB 4KUZL 2ADGA 1NCBL 5BRZE 4APQD 2AJZB 3MV7D 4J3OC 2H8PA 1MFNA 1T0PB 1HSBA 4JN2B 4HGWA 1T1ZB 1FNEA 2I9TB 1Q72H 1HH9B 1PAMA 2HP4A 2VISB 4AZ8A 2FGWL 5DRNA 5IFJB 2LVEA 3RZCA 4GXVH 1S7RA 4JLRA 2GJZA 1UB5B 3FZUD 5TDPB 4ZNEE 1ZGLM 2AJXL 1MRDH 2DJ4A 2HLFC 4KK6C 2IFFL 5AG8A 3VFRA 2J6EA 3QQ3A 4L4TE 2Z35B 5E5MA 5ILTH 2EDDA 4Z95H 4XH2A 3SPVB 1OPGL 1NFDA 3AREB 3KNBA 4KRPD 2OR9L 3F5WA 1TITA 4NP4L 3GSNA 3RWHA 3U9PL 5JHDE 1IGJA 3F6IA 4PD4K 4CMHB 5E4IA 3CX2A 3MACL 3AS2A 1U91B 3O2WL 5MHSE 1GVIA 3SGJA 4YAQA 2FHFA 4XHJC 3AS0A 4ELMA 3K8KA 4HBQA 1CD0A 1NGXA 3C5SA 1F90H 1KC5L 1S7QA 2EE2A 3G6DH 3WDJA 1CU4H 3V9FA 3W0WD 3WXVL 2GW5A 3B8SA 4RRPA 1B88A 5DMKB 4CUCA 1AGFB 4PJDF 1MJJB 4NQCB 2PYFA 4PB0H 5C0FB 4QOKA 3MNWB 3WDHA 1MCWM 3B9KB 3L3KA 15C8H 3IS0X 4BSJA 1LO2H 4WUKL 1CIUA 1KULA 3RY6A 1JGUH 4OV5A 1T20B 1EFXB 3QCVL 4LCWE 4JDZB 1SEBA 1YN6B 2MCG1 4FZEH 4E5XB 5CJOH 3GIZL 2F5BH 3W11C 4XP4H 3OL2A 4MVBC 4S11A 2GJ6A 4XP9H 4YGAB 4FG6D 4D0BB 2JB6B 1MIMH 1ORQA 3SE4A 3QFDB 1NBYA 4B41A 4P9HL 1G6RH 2NY7H 4GG8A 1MY5A 2A6DA 4P2RD 4FQXD 4AIOA 3BH8A 4LHJB 4K7PL 2W0FB 1RK1A 2BCKA 3RY5A 5E8PB 2R56H 4RBPK 2VZ1A 2EE9A 5MI0B 4UAOC 1QSEE 2ADFL 1TMCB 4HJJL 5IJVA 1N64H 4WW2C 3PV6A 4NKDA 1NGQH 4FTVE 3OKKB 2QR0A 2XQYK 4RGNE 5SV4A 2DQUH 4M6AA 2CKBL 3MCKA 3AFLA 3SKNB 3B2UC 3UYPA 2D03L 3RKDD 1I9JL 5BV7L 1MWAL 1K4DB 1IBGH 1PY9A 3N85H 4X5WA 1NAMA 4KV5E 1MI5B 3QXVA 5MEOB 3C8DA 4KI5E 3UJJH 3NAAL 5FO9A 2VZUA 3BP7A 3X3GH 5DVOA 5IM7A 1FRGH 4NC0B 3S4SA 2GJJA 2F58H 4D9RE 3B9VA 1UEMA 2AJSH 1LEGA 3T0EE 4QKXB 5DFVC 3FOLA 4S2SB 4G9FD 4EDWH 3TBSA 4ZXBB 2VXTH 1Q72L 4WV1A 3NCCB 4CVZB 2UUDK 1FN4A 4HUNB 3LRGA 4BKLA 3C6LC 3PNWA 2ESVB 4I18A 4HK3J 5EA0H 3PGFH 3SHSA 1AI1H 3VMOA 4CVWA 3LHPL 3VGBA 1MREL 2RFXB 4ZFFB 3G04A 3STLA 4F2MB 1DZBA 2MMXA 5F7DB 2YRZA 3QO0B 1VKXA 2G60H 4BFGA 2YA2A 5IK3B 1HKLL 1BM3H 3RVTC 1CXEA 3QUYC 3FT2A 3JV6A 2W1NA 2R2BA 4ZMAT 4HCRH 3QDGE 4HLZG 2Y1VA 5ESAA 5DHVH 5I74C 3S37X 4XC3H 5HHNB 4GMTH 3U79A 5CGYC 2EO1A 3DXAA 1I3RA 1V3MA 3SCMA 1P84K 2HFEB 2HAZA 1PZ5B 5BW7A 3G6DL 4LSPH 1JUFB 4QHMA 1FYTA 4U1LB 4KFZC 3PP4H 4PJEA 5FYJU 3QDAA 3PQYA 3BJLA 2Z31C 2P45B 4HWBH 2YBRB 5C0RH 3QULA 3QDMA 2BRQA 4PB0L 3RIFF 3VRLF 5IHBA 4LDOB 5CP7B 4HZAA 5CBEB 4XAKE 3RL2B 5DR5L 2YOCA 15C8L 4RA3A 4RRPG 1LO2L 1IILE 2VN7A 1XCQB 4JFPA 1JGUL 4PFEA 3WXWH 4JM2F 1Q9LA 5IR1A 2NY2B 4FZEL 5T1KD 2YD7A 5CJOL 2W9EH 2BXYA 4XP4L 4NFDA 3HFMH 2ZKHH 1NFDE 1F11A 4PJ9C 1CL7H 5JLZB 4I2XA 1MIML 1X7QA 2W65B 1G6RL 2X70A 4NZTH 2NY7L 5SWSE 3ALXA 2F8OA 4WI8A 4OCSH 2Z8RA 2GT9A 3L3GA 2X4NB 1NANI 2C4FU 4D0CA 5AYUH 1I1YB 4W6XB 4PR5A 4QHUA 2R56L 5EG6C 5BJTA 1CFBA 4P46A 4ELME 3WS3B 1N64L 1XEDA 3QZWB 2EYRB 3EYOB 2G75A 4DWHA 1K8IB 3VJ6A 2NY0C 1MFAH 1NGQL 5T1KA 3HPLB 2DQUL 3ZE1E 3HMXH 4PJIA 1LEIA 4JGUA 4NNXA 5JORB 5ACZA 1REIA 1UXSA 3RNQA 1FZMA 1IBGL 8CGTA 1KCRL 3N85L 4UV4H 4RMVA 4Y4HA 1WZ1H 4F9LC 4O2FA 1KJMA 3D5OF 3CFEA 2Z93A 3X3GL 4KROC 1CXHA 1FRGL 1BOYA 2F58L 5K33A 2IC2A 2HMID 2W92A 3IDYC 3PWUB 1N5YL 2YHGA 4EDWL 3S4SG 2VXTL 2MWCA 2ZOKB 2R0WH 2GJ6E 4UDTB 5IMOA 1GOFA 1C16A 4I3SH 1BJ8A 5ID0B 1KTKE 3TZVB 3U0PB 3VGFA 3HNTH 3PGFL 1AI1L 1HHJB 5CEZL 4LLVB 3QUXD 1F4WH 3BPLC 4ZO7A 3CFCH 3TEUA 2G60L 4Y16C 4PJ8D 1EEUA 3UTZA 4X7DC 1IGTA 1LE9A 1DANU 4HCRL 4M7ZB 5EN2A 1PX3A 1BJ1H 1FG9C 3CFIC 2YMXL 4IMLB 3WIHA 4QLRA 4XC3L 4G80A 4XWOD 4GW4B 4GMTL 4ERSH 3HRZB 1N5AB 3MGOB 1QR4A 4LSPL 2FJHA 3OGCB 4G7VH 3PP4L 2OSLA 1GCFA 4HWBL 4X9FA 2X10A 3B6SA 4X5LA 1M7XA 1OB1B 1T1WA 4KJYB 4ODSH 4HS3B 3V79C 3BP6B 3WFEL 1D6VH 3P9MB 3LKRB 2OR7A 4QRTA 3LDBC 3VI3E 4OF3A 5IB3B 1IAOA 2KBGA 4L29B 3D9AH 3MXWH 1KLFA 1KUMA 1EUTA 3FB6B 2VQ1A 1K3IA 2EDWA 1EJOH 1VFMA 3GRWH 3O45A 2W9EL 3M17A 2KUTA 4JFXA 4JY4A 3HFML 2AV1B 2ZKHL 2WQ8A 1CXFA 1CL7L 1RJLA 4LVNC 4S1SH 5JQ6H 1KTDB 1YMMD 5KSBE 3CSPA 5D6CA 5DUBA 5DURB 2P8LA 4OCSL 4R3SB 2ED9A 4JFEB 4YFEA 4ODVH 1KPRB 4HGKC 3QIWD 1LE5A 2FO1A 3DRQA 1DE4A 3ARGA 3OAYH 5F93C 3KXFB 4OF6A 1E4XI 3IDNB 1KACB 3GIVA 3GKWL 1PW3A 2YA0A 3O41B 5DEGB 5F7UA 1FYTE 1MFAL 1U93A 4PJEE 3TLRA 3VXSD 5L8KB 3HMXL 5H94B 1WJ3A 3TA3B 9CGTA 1M05B 2ZP0T 3SBWA 1BECA 1QHOA 1X6LA 5MP6H 4YFLI 4UV4L 1FCCA 1JF1A 4UIKH 2ZOLB 5CCKH 1WZ1L 2NNAA 4G43A 2HTLD 2Q76A 3BQUA 4IRSC 1LO3H 5EC2B 5EU6A 4UT7H 5TE7H 5DJCA 1HEZB 2P8MB 4TVPE 3MRCB 1QSFA 3LKQA 3OMZA 3PIQB 3QRGH 3O6KL 3TM6A 1QG3A 1AY1H 1XH3B 2R0WL 4I2XE 4UAOB 4KDTA 4I3SL 3VE0A 3RDTD 4NO3B 3HNTL 1ETZB 2ICCA 4HUUB 4KUCD 3SE8H 2ADIB 2E8YA 1S78D 3ZHKA 3L5WA 1F4WL 3VFSA 3BO8A 5I1AB 4QTIL 4WWKB 3CFCL 5MERB 2GAZB 2H45A 2UZIH 4PRHB 5E4EB 2NTSP 1NMAH 4HS8H 1I8KB 3V0WH 4LARH 3W9DA 1EEQA 3VDCA 1UT9A 4PV9B 2PW1A 5IMKB 1I85A 1AIFB 4QWWD 3RDTA 4R7DB 3DTXA 5F89A 4ZQKA 4NCDA 43C9B 3SDAD 4X6FB 3WNMA 4G7VL 3MJ9A 1KFAL 3CK0H 3FQNB 1H5BA 1I4FB 1UXWB 3GSRB 4A2MA 2MHAA 3C6LB 2E6QA 2JCCF 2FB4H 2HN7A 3J7HA 4I3GA 4KMQA 4ODSL 3SJVA 3EO1B 3V8OA 3WHE1 5GGSA 1HILB 3RX7A 1D6VL 4LMQI 2IALA 3WSQL 4AIXA 1BREA 2OZ4L 3IVKA 3ARWA 1YQVH 3VWKC 3D9AL 4BM7A 3MXWL 4R96A 4XNUH 2WZPD 1JRHH 2A77L 4N9GA 2OJEB 4GJTB 4GRWF 4M02A 3GRWL 5I74B 5B38B 1NCDH 4GKSA 3WIIH 4S1SL 2H26B 5JQ6L 1YYLH 4X8XA 3MOQA 3D2UB 4XCNB 3V0AC 3O6FD 3QA3B 5A43C 4LPUA 4Y88A 3RL1A 3MV11 4LKXA 1NL0H 4Z7OF 4HGMA 4P2OC 4Z7UB 5JW4R 2IG2H 6CGTA 5D6DA 4QRRA 1IM3A 2AKRB 4X4ZA 1B2WH 2YEZB 2OX5A 3FL7A 4UIKL 4DW2L 5CCKL 2PTVA 2W07A 3TO2A 2R0KH 3BP4A 1R24A 1LO3L 5TDNB 4YHPB 1RFDH 1X9QA 4UT7L 3V4UH 5B39A 3DGCR 2NY1D 1GZQA 3T0DA 1G1YA 4RDQG 4XPHH 2NY4C 4UBDD 3JV4A 1P7KB 1GGCH 4NUGH 5FM8A 4NKOA 3OJMB 2EEAA 2CLZB 1IM9D 1AY1L 1J0YA 1T4KB 1WFOA 1SYSA 2L7UA 1JK8A 5E9DA 2ARJB 3MRBA 4N0YL 5HHOD 1XF2B 3TBYB 4NO5B 3S36H 1X5YA 3SE8L 2NY0B 4YBHA 1W0VA 1XF5A 1JF5A 3IDUA 3Q0HA 1SBBA 4OZHB 3RHWF 3B5TA 1JGDA 2HT3D 4PJAB 1J0IA 5DJ8A 3HS0A 5IB1A 2UZIL 4AG4H 3DO7B 3VXNA 4WFGD 1NMAL 4HS8L 4PRPD 3VWJD 1RHHB 3V0WL 2RQ8A 4L8CB 1JI1A 3O8XD 2BVYA 2D9QB 1A5FH 4HKZA 2YPLD 4PREA 1U8KA 3IDYB 2DLGA 1YPZB 5EPMA 2YZ8A 1CS6A 4JFHE 3CJJA 3GJEA 2JJSA 4NM4H 2HJLA 1NC2D 1YNLH 3B43A 1T5WA 3CK0L 4LP4A 3QJFA 4O5LH 1QSFE 5HSFA 1IEAB 4R90H 4YC2C 1AGBB 4GRLC 1GJIA 3VFVA 3OX8A 4LIQL 4A6YB 4I9WE 4OLVH 5KAQG 2BX5A 3V7AG 2EZ0C 35C8H 3QNYB 2E27H 1CFSB 3KHQA 4BQ8A 1OCWL 2VKXA 4DGYH 4R0LC 1A7NH 2LU3A 2VN4A 3F7RA 1CZ8H 4M7KH 2XFXB 2AAVA 2FWOB 3G5XA 3G5YA 2VQTA 2VDPH 8FABA 2BSRA 1YQVL 2WIIA 3LEVH 4XNUL 1I8LC 3DX9A 5ICXB 4O51B 1JRHL 5TPWH 3RWJA 3KPRB 2BJMH 2VLKD 1KPUB 2IAMA 4K9EH 1NC2A 1P7QA 4Z7UF 4UV7H 1K4CB 3WIIL 3EYVA 1YYLL 5EO1A 1S7TB 3KYKL 5D7JC 2XA3A 1AP2B 1XGUB 3N9GL 4P4RB 5DQJA 5E2VH 3T3PE 1NL0L 3G6AA 1FNSH 1U8OB 3D25A 1JYXA 3O6LH 3FQXA 4JJ5B 1FNGB 5KBNC 4OQ1A 3QJHB 2P5WB 3HC4H 1F3DH