1HILB

Structural evidence for induced fit as a mechanism for antigen-antibody recognition
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
220
structure length
214
Chain Sequence
b'EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
molecule tags Immunoglobulin
total genus 40
structure length 214
sequence length 220
chains with identical sequence D
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hilB01
4E0RB 1JPSH 3DVNB 1A9BB 4I18A 3SQOL 1N5AA 2JIXA 4NUGL 1VFAB 1F45A 1L7IH 4F37F 5AEAA 2HJLA 4H25B 2GJ6B 1BX2A 2Z8RA 1S5IH 4WUUD 1IEHA 1AGCB 4JZJB 1JGLL 2KL6A 1OTUC 1A6TA 2QADD 4AEFA 1X4ZA 2QSQA 4PJEA 3TO2B 5C8JB 4N0UE 4WHCA 2NY1D 1OTSD 3DX6B 4HPYL 3C60C 4PJ8B 1GHFH 4OI9A 2EO1A 4H5SB 4WU5B 4W81A 2APVA 1H3GA 5FEBA 4PJFE 1XZ0B 3MRRA 5IBTH 3SKUD 1DBJH 1DEDA 2HJKB 2LU3A 3G6DH 1RAMA 2NYYD 1E6OL 4M6MH 3WMSA 4BH7A 3BEWA 3MFGB 4M3KB 2NX5B 4WUUA 5FGCB 1KJMA 1IJ9A 4I8DA 4P3DB 3QP3A 1RURH 3TIEA 1YYLL 2I60L 3QEGL 4ZODA 3LD8C 1BQHB 2GK2A 4YWGH 4TOYH 2DWDB 4ZOAA 1CD8A 1T1YA 2IFFL 1I1FB 2GAZA 5HDLA 4JFXA 3TJEH 1CXKA 2R2BA 1FN4B 5GS1C 3MV7E 4H1LA 3QISA 5DVLA 3VXSE 1KCSL 3MRCA 5HHOE 5JIPA 1BJ1J 5DLML 5DJYA 1LO4H 1HCVA 2ZCHL 4GW4A 2V2TB 1AKJB 1WEJL 3U4BH 3OAYK 4XMKH 1OPGH 4MAYD 3OG6B 1N7MH 5E4EC 3WS6C 4MA3A 5IIEB 4FFYL 1A6PA 1XF1A 5ICZA 5FM8A 3SDXA 5M94B 2CR6A 1KPUB 3EYQD 3UO1H 4F7EA 3ZZ1A 4KJQD 3CFJA 5EBGA 3ARZA 2VNCA 4P5TC 4OLXH 4TUOB 4GKNB 3RWHB 1UXSA 4F15B 1WBZA 2IPKA 4FNLH 1W2KT 2F19H 2BRRH 3UYRL 1YC8A 4X4YA 4RBPK 1I1AA 4X6BB 4WEUD 4MXVE 3VXNB 5ESVB 2X4QA 1V3MA 3C6SA 5CBEA 2D9QB 1KB5A 4PJ5A 3PWPA 4ONGH 2IANE 4AG4H 4PP2B 4YNYB 4ODUA 3C5ZD 4RQQA 5D6CB 5IK3B 3ZE0E 5MEOB 4HJ0C 3PF2A 3SGDH 4FQQA 1IC7L 4HWZB 3HUJA 3QDGD 5DGRA 4AEEA 2JJSA 2FEEI 3GJFA 3C5JA 3I02A 4EI6A 4EDXB 5KOVC 5EWIL 3WIIL 3W81A 5ADPL 1KLFA 4FQXC 4H1LG 2PUQT 1NFIA 1A7PH 4Z5RB 5AYQA 5CFHA 3OHXB 3PWNA 5E94A 3QXUA 5I8EA 3VGAC 2EYRB 4U0QB 1HINH 2IADA 4MCZB 5L7XL 1QO3B 1WITA 3UX9B 4R4ND 2BCKA 2YHGA 4WO4B 3UBXI 2XYCA 2G5RA 4E5XA 2F5AH 5M95B 3L3DA 5ID0B 3HE6D 2ED7A 3EYUL 2QHRH 5D7JD 2DQUL 4Q6IB 4G9DA 1JGUH 4S10A 1PKQB 2EKSB 3Q6FA 4WY7H 3KPRD 3NH7L 4NNYB 4DZBA 4ZAKA 3DVGA 4X6EB 1QRNB 1FNAA 4I3SH 4U1LA 5T1LA 3BHBB 3V6OC 4I5BA 4G8FA 3PQYD 5GSRA 4KQ4L 4O4YL 4NO0B 2ESVE 1S3KL 3DVIA 3IXTB 5L88L 5HHME 2N7AA 4KMQA 1D5XA 2WQRA 4KKAD 4JO3H 4ZFZA 5EIQA 1SHMA 2XWBA 4K71C 3HC3H 2FATL 4OLZL 1E28A 4W4OC 4H8WH 1G7IA 4KZEH 5A2FA 4XMPH 3NZHH 2FJHA 1I8MB 4OSUL 5H94A 1CR9H 3IFOB 3WN5A 1X5LA 1Z6JT 1SMAA 3LS5L 2FGWL 2PYEB 5E8NA 5I19L 3HR6A 1SJHA 3QUZD 5DT1H 5I15L 5HHXL 1R3JA 5FKPA 1K3IA 4DEPC 4XC3L 4HEPG 5DFVC 3PV7A 4UI2A 5D1ZB 3GMPA 1N64L 3EFFB 1U0QA 3IKCB 4KK6C 3ARTA 4WFHD 1I8IA 4B50A 3KLDA 1D5MB 5CBAB 1EEZB 1H0DB 2QSCH 5CINH 3PUCA 3FQRB 3SJVA 1X7QB 4NRXB 4K8RD 2BXZA 3BGMA 3NA9H 1NGQL 3DI2B 5JMOC 5SWZD 5I1EH 3QHZH 2VZVA 1ZT7A 5F1NA 4Y16A 1TTUA 3K80A 3RY6C 2EE6A 5IMOB 4NHCL 1RUAL 3WFEH 1OW0A 4PRNA 3CJJA 3GMNA 2VLKD 1MNUH 2P4AB 3WIFB 3H8NA 1JUFA 2VQ1B 3UZEA 4MA1B 3MA7B 3CXHK 3BJ91 2WUBH 5L6YL 4LCWE 4L3EB 5C7XL 2GFBB 1UCBL 4XPGL 2W65A 1IGYA 2F54A 2JCCF 3UDWC 3QDJD 5FO7A 5GIRB 3I50H 4LNVA 2KDGA 2XTJE 4LCCA 5DUPH 2F5BL 3T0XA 1EEQA 3LQAL 4HC1A 1UH4A 1DQJA 1LE5A 3QT2A 4XNZB 4ZPTA 1B0RA 3BPCB 2YUVA 3GIZH 3FTGA 2VXQH 4HF5L 3B2VH 5IVXA 1DLHA 3ULVD 5JPNB 1C8PA 2VL4A 1U3YA 1Y18B 3ARGC 1E6JH 3QG6B 5CZVL 1HHIB 4E42A 4XNMA 3UXFA 2X4PA 1AJ7H 5TGBA 3SE3A 1JV5A 4K3EL 2FX9H 1AR2A 3B6SA 4MS8D 3QDJA 1KF9B 2DBLL 4PJFF 4NWTH 5TDNB 2VLLA 4MWFA 4YUEL 1BBDH 2R1XB 4P23B 3O4LA 2A6DA 5T3ZL 1AXSA 3DRQA 3QEHB 5C9KA 3MV9B 4QT5B 3U2SB 5BS0E 2VSCA 2Q8AH 4UV4H 2YD2A 2P48B 2VZ3A 4APQA 3SDCB 3LN4B 4WJ5B 5IP4A 4UZGA 1RZGB 2VDRL 3ULVH 1LO5B 5MI0B 4PLJC 3P3YA 4KVCH 1N8ZA 5TPWL 3RI5K 4NQCD 1A1MA 5AAWA 1NGZB 1GC1C 4LLQA 5SX4I 1UWEH 2AJYH 2GY5A 3CH1B 2H1PL 1DBBL 2BVOA 2NLJB 1YPZE 2RCSL 5GS0L 5MEQA 4K55A 1NGXB 3ECBB 4XNQA 1QHOA 4N90E 4Z7OE 3WD5H 3UTQB 1AXIB 4PP1C 5KOMC 1VESA 3BIKB 1CFTB 3JV0A 3CDFA 5DC4B 5I76A 1WBXB 2G2RB 3G5ZA 3JTSB 4PUBH 1PKQE 4FXKA 3THML 3SE9L 4EBQL 4GKSB 1K5NB 5BZWB 2OZ4L 4M6OL 3TBVB 5DHYB 2LVCA 4MNHB 4LIQH 4NQCA 4BQ9A 3ARBC 4X6FA 2MJWA 5DD5H 3L3GB 1KTLA 3VWJA 4OZHA 2DM2A 4AT6A 4BKLA 1XF5A 2NXYD 3LKSB 5C09A 4V1DB 2ENSA 5GRVK 1CDYA 4CU7A 4NT6A 1CBVL 5C0RH 3RA7L 4MXVF 1UB5A 4IRSD 4N5EC 4P4KD 4FFZL 1NLBH 2ERJC 1EV2E 1ND0B 1I8LC 1QBML 2HT4D 5ITFA 3RTQA 4LHUA 3TPUB 4HIJB 1R3IL 3ZE0F 4BSWA 4LAJH 1AGBB 1LP9E 1WCBB 3KLHD 1BJMA 5D1QB 2EIEA 2AI0L 2R23A 1UZ8A 5FV2A 3P4OA 2BHUA 3HNVL 3ZE2E 5GGUA 3L1OH 4R2GD 5E8EA 3DX7B 4YBLB 1DVFA 5JIHA 5E08H 4C59B 3HI1A 1XGQB 2F74A 4JQXA 5F1IB 1AHWC 4ODHL 3A67H 2YKLH 4P4KA 5BV7B 3V6ZB 3H0TA 1U2CA 3N1FC 4S1RH 5CEYA 3DHJA 1MI5B 3QCVL 5BOPA 3CZFB 2FR4A 1EO8H 3E3QC 5ETUA 1DBAL 4XPBH 4ZNEE 3DX8B 2B5IC 5IESL 4OUUA 4TSCH 5D2NB 4G9FA 4ODVH 4JZOB 4XPTH 1BF2A 5IR1A 3X17A 1XR9A 3SGEH 1A4JB 3OKMB 2G60H 3VG9B 2FIRT 3IJSB 1NDMA 5D2LE 3OJ2C 2HG5B 1XFPA 4I3RH 1A8JH 1V7NH 5F6IB 4R96B 2DI7A 3STLA 1FDLL 1BBJA 5IQ7H 1FYTB 5DJ8A 4MCYA 1CXFA 1YEGL 1J11A 5MERA 5FXCH 3TA3D 2VDPH 1MIMH 3SKNB 1XT5A 4MSWA 1SM3L 3RDTC 4ZUSA 1XF4B 4D2NA 1I9IL 1MFEL 4KRPB 3TH2T 1DQDL 4HG4J 2GITB 1S9XB 4HXAH 1JTOA 3W0WD 1U8PB 5TF0A 2OL3B 2L4OA 3QFDB 4TNVF 5DZNA 5GJSL 5HVWA 3H9HB 1N59A 2IEPA 3OKOB 4S1SH 5SWQA 1QP1A 2NR6D 5FO8B 4N0FB 2PXYD 2R0LL 3HE7D 3B4NA 2AQ3A 3BN3B 4O00A 2VN4A 5DZOA 5F9JA 2GK0A 5DMIH 2RJMA 2EH8H 4KPHH 3GSQA 3X13A 3FRUA 4P59H 1GGIH 3MMEA 3W0WA 5C0NC 2Z91A 5FYKD 3SCMD 1QFOA 2IQAA 4Y2OA 5CAYB 5TE4H 4ZFOB 3IFPB 1Q9WB 4GRLD 1D7FA 4OCRH 3P9LB 1IM9A 1XH3B 2HP4A 3BKJL 3HNTL 4MZ2A 2AJUL 2PETA 3AU1A 4YHML 2Y5TA 5DMJB 5AWNL 4CMHC 4XX1E 2PXYA 2D03L 1WUNT 3HE7A 1ZHKB 2R0ZH 3T2PA 3GI8H 2GEEA 2CQVA 3U82B 3RIAF 3W82A 4GXVH 2VTFA 1J8HD 1Z9MA 1KCRL 4U0RB 5L0QB 4W6XB 2IH1A 1IGFL 1B0GA 4PGBA 5HYQA 1SYSB 1MWAA 3WJLC 3BSZL 3DROA 1KYOJ 1WCQA 3MLXH 2EIBA 4QWWD 3O6FC 5FYLH 8FABB 3VFOA 1ZGLA 3GEWB 3QIUA 3QAZB 5FYKH 5LGHL 3NBNA 1CLZL 3OPZL 5K33A 1UH2A 4JJ5A 4OFKA 1ZAGA 5K9OA 4U49A 3BYTA 4ONFH 4YHZL 4XAKD 3K2MC 3MGAA 2AJXL 4JFPB 2JJTA 5E24E 1RUKH 1XGYL 3MLRL 1FO0B 5C0AE 1A7RH 4Y5VC 5FK9B 1J8HA 1ZTXL 5DURD 1CICA 1RZ7L 4TSAH 1FL5B 2A73B 2ICEA 4ZQKA 4OIIL 3C2AL 3DUUB 1TVDA 1DSFL 1FFNB 4QHNB 4HV8A 3MODL 1BVLB 3L3JA 5SWSB 2HFFB 3QHTC 4M61B 2QBWA 1QA9A 3S34L 4GQPH 1G0DA 1RJYB 4JO2L 5HYJD 1HNGA 1X5FA 4IS6B 4NOBA 1Q0YL 4I2XE 5JMRA 4IOFD 3CFKA 5DD0L 4CADA 4BQCA 4MJ5B 5FECA 2VIRB 1CFNA 1WWWX 3QZWA 1VA9A 2XG5A 1A6UL 4MX7B 3OZ9H 3JWDC 3PWJB 3SDYL 4RMTA 4GLRH 5TF1L 4R90L 1R5IB 5L2KA 1A3RH 1ZVHA 5EOCH 1G9EA 1U3HD 4LLWA 5E6IB 5DJDB 4EN3A 3GHEH 4NO3A 3LV3A 1JNJA 3FN3A 3ESUF 2B1AH 1OT1A 1AQKL 2HT2D 1MJ8L 2ZUSA 2WUCL 2YEZB 4OCSH 3AGVA 3KYKH 4UIKL 3RL2B 2CDGB 3VXUD 3NPZB 1QRKA 3MNVA 1CD1A 3WXVH 1TDQA 4PRHE 2HJFB 2UZYB 5KZCB 1YPZF 3T4YA 1ZE3C 2VDMH 4X7FC 4DAGH 1JP5A 2ITDA 4OCYH 1FNGA 4Z7OF 1AC6A 3VDBA 3Q5YA 5F9OH 2DM7A 3GJFK 5H37G 1U3HA 4EIZC 3BZEA 1F4AA 5IJKA 4JFFD 5JDSA 4PTTB 5BVJB 1T1XA 4PJBA 3IRZA 3RWJB 2APWA 2J5LC 2HLAA 3KLAA 3VH8A 1MCWM 1MHHB 3OBAA 4M62H 3L6FA 3QJFA 4G80B 3KXFD 2QADC 4JM2F 4ORZC 1M7XA 3BGFC 1GIGL 1NBVL 2VXTH 4HIHB 5E8PA 2KZWA 4FQHA 2NY1C 1OTSC 4LLUA 3MLSL 4PJAE 1NC4A 1LP9F 3KJ6H 1DR9A 1HHGB 3A6BH 2YBRB 3QZWG 3J8F7 5B8CB 2C3WA 5IEHB 3VFRB 2F53A 4K3JH 3QXDA 3ZE2F 1UGNA 3O2WH 5E6ZA 3QA3B 3GKZA 5F9WB 1W72H 4H88L 4AL8H 2NYYC 3RWIB 1JZ7A 1KN2L 1EMTL 4MD5B 3IDUA 3V0VA 4Z76A 5DC9B 4KI5D 3E6FA 4QOKD 1XF3A 3QI9B 5E1AB 3TBWA 4M5YH 2O26U 3UROR 3HHRB 5T3XL 5BJTB 1RU9L 3MGOA 3NABL 4HIEB 2P1YA 3R06B 1EXUB 1ACYH 2X1PA 4OCXH 4UTBL 4U2YA 5D2LF 1FNLA 5DI8A 4RAVB 4JQVA 4MAYC 1IZKA 2DJ4A 1H5BA 4Z7VE 3V0AC 1DJSA 2ID5A 4X5XA 1S7XA 2YWYA 4NQEE 3VH8G 3KR3L 2X4OA 4XCEB 3NCYS 2J88H 3EYQC 2OCFD 2EC8A 2AVGA 3W9EA 1BOGB 3MJ9L 4P9HH 2JELL 4W70A 3PDOA 4OD1H 4XC1L 3CGTA 4KJQC 5EBWA 5E8DL 4YEFA 3Q2CA 4JREC 4QHMA 2R1YB 1NCCL 2FZ3A 2H45A 1XMWA 1OLZA 2JJSC 2KQMA 5EN2B 3HZVB 5GRWA 3QQ4A 5CZXD 2GTWA 1NEZA 5J9PA 1OAYL 4D0BB 1J1PH 2EIZA 4OKVB 4YJZL 4L8SA 2ZOKA 5KSAA 1MCKA 2OR9H 3UJTL 2P5WE 4X7CC 3LKPA 1TFHA 4KKCD 4TN9A 3MNZB 3C5ZC 2HKFH 4EQ3A 4A2MA 5C2BL 4NM8H 1DQTA 1P7HL 1U2HA 4MNQE 4BZ2L 1IFHL 3JUYA 3WIHH 3D0VA 1U8LA 2W0FA 2BRQA 3QJHA 1C16B 4WDIA 4KDWA 1JTPA 4JCMA 1WWCA 1IBGL 2AXGA 5D96C 5ISZD 2XG4A 2WK2A 3OTTA 3QQ9D 4JG0H 2DM3A 4NKIH 3MOAL 5BXFA 2HLFD 3F58L 1V3JA 3T8XA 3FO2B 3F6IA 5GRJH 4S2SB 3UBXA 1VADA 1GC1L 3V52L 2HWZH 3VRIA 4QEGA 3LVEA 4Y8AA 4ZXBB 2NTFB 3VGEA 4R4NC 5T33H 1M7DA 4XB8A 1T21A 1UJ3A 4BQ6A 1MFDL 1NGWA 2YA2A 4JVUA 3U6RA 3HE6C 4H8WC 2NY7L 4HS6A 2YD9A 5D7JC 5FOBB 1YEKL 3K8MA 1ADQH 1KCVH 3FHAA 4QRTA 4BYHA 1U92A 2XZCH 2VDLL 4DKEH 5DEGB 4YFEA 5CD3B 3LEYH 2Q76A 4OZFH 1EDQA 1NEZG 4HUXA 4WI6A 4I13B 3MROA 3JBG7 5IFJA 4X7SH 4KTDL 4XGZA 2BXYA 2Q20A 5FUCE 4EDWL 2AJSH 4P4RB 1JPFB 3U7YH 5CP7A 3SGEI 4P5KB 1UT9A 3WFBH 3SDDA 1S7RA 2VE6B 3QUYD 3L95B 1I75A 4KKAC 2MFNA 2W92A 2AJZB 4L5FH 4PR5A 4BFEA 4M7ZB 1SEQH 3VWKA 3TFKD 4JHWL 1FIGL 4GAYA 5INCB 1PD6A 2CRYA 1LK3H 4XPAH 3FQUB 5IHZB 1Z3GH 1I3RA 4XVJL 1BQLH 2YPLD 4EUPA 4P99A 4K3DH 5A1AA 3BH9B 2AV1A 3UBXG 2M1KA 3OR7A 1A6WL 1FIEA 2XKSA 1IQWL 3QUZC 4LPXA 2FHFA 3DX9B 3REWA 2XQYG 4WFED 3GSOA 2B0SH 5C0GA 1IL1B 1KELH 3C9NA 4UINL 2GUOB 3FQNB 4ODBD 2DN7A 1F3RB 3RGVA 2VXUH 3VGGA 5AD0A 4NC1E 3VD5A 2YPLA 3MNWA 5F7WC 3IAQA 4MD4A 3QDMA 4K8RC 2PCPA 4HIXH 3I9GL 5EIIA 4OCWL 4LCCC 4JRYA 3OAUL 3MZTA 1FVEA 3RWCB 3IDIA 3WFHB 4C56D 2OTWB 4HKZA 1TENA 4DKFL 3LQZB 1S7VB 3BH8A 1VGEH 3HAEH 2QQNL 1KJVA 4YE4H 3IDMA 1FL6A 2VDOH 2XN9B 3QCTH 4OCMC 3GIVA 1YEIH 2P49B 2UWEB 2QQLL 1JTTA 1E4KA 1C7TA 3IDNA 2OTUB 1K6QL 2NY0D 1MCSA 4TTGA 3GMLA 4RRPA 2LTQB 4EUPG 4DTGL 1N6VA 1NC2A 1U58A 4WUKH 4LLDA 4ZOEA 5CSZB 3CSYA 4QRSA 3ULVC 2VJXA 4UT7L 3V2AR 1I9RL 5GRVL 5DJ6A 2YUWA 3MRHA 4X83A 4NO5B 4PJAF 3O3DA 4KROC 1RY7B 4Z0XA 3ULUE 4MS8C 1FBIL 4MA7L 2W91A 1B88A 4TVPD 5J06A 3GFUA 1N0LA 2JCCA 5E03A 1UYWH 1ZVSB 3G6AA 5E9DB 2EDRA 4NC2B 4QHKI 4E41D 3FAWA 4N9OB 5GZND 1P69B 3KPSA 2A9ML 3ARUA 3HAEG 3C09B 2BNQB 5FYJH 1PZ5B 4R8WH 4CVXA 4RFNB 1FZOA 1INQA 1KFAH 4RFEA 2X4NB 4M43H 2J6EA 2HRPH 4J8RB 3TH4T 2WBWB 4N0UA 2X4RB 1RUML 2IBGA 3P4MA 1N2RA 1N4XH 1F6FB 3ZLQC 1IC5L 1S7WB 1K8IB 2X40A 3VXME 5IEKB 1HSAA 4F7CA 4PJFA 3MZGB 1JHKH 3VXSD 1RK1B 1YEDA 2K3TA 4TVPH 4Z7VF 5IW1B 5HHOD 2CRMA 4HMDA 2B1HL 1QLEH 4RRPG 3B9KD 4DN3L 1CD0A 4HS8H 4YHLH 4DQOH 3U1SH 1CLCA 2E6PA 5CS7A 4U1KA 2IPTH 3ET9F 4JFQA 2FJGA 1RIVH 1U3JA 4DVRL 3B9VA 5DJ2B 1RD6A 1DL7L 3S3SA 5CEZD 4MZ3A 4FQXB 2BSTB 5I9QB 5I0ZA 1KPVA 2NXYC 3MV7A 5C0CE 3VXSA 1DVFC 5HHOA 3BQUB 3EAKA 3Q1SH 4IRSC 4JQXC 5DZLA 3VGAB 1BPVA 1NEUA 3B9KA 25C8L 1AO7D 2D0HA 1A7QH 4P4KC 5KG9B 2CKNA 2PYFA 1QFPA 2HT4C 4LRNH 5KJRH 1FQ9C 4OGZA 1QG3A 4LEXL 4XVSL 4HGWB 3KLHC 3D87B 4HEME 5FYJE 3V4VL 2FJFB 4N5UA 3D69B 5GGTA 3T0AA 1KIPA 5CIPB 3H3KA 4HKJA 4R2GC 4Z8FL 2X70A 3MRJA 4U1MA 2W1NA 1MFNA 3GSVA 3STZA 1T1WB 4PBVC 5J89A 3JWDL 2IFGA 1HKLL 3EW3B 1GRWA 3W2DL 4J7RA 5IBUG 4OD2A 1I9EA 1S7TB 4F7MB 5FDWA 3MRBA 2V5MA 1FAIH 3CFDB 4LK4A 1QEWB 2EE9A 2Z4QA 1MQKH 1C12B 5C3LD 1S7QA 4M1GH 2IANA 1S5IL 1AQDB 3CCHB 3PG2A 5D4QA 4AENB 4YHKH 1DUZB 4LASH 3FOMA 1OP9A 4PB9H 1FV1B 2W9EH 2ZSWA 2Y23A 2CR3A 1Q9OB 5KVDL 4ERSL 1R5VB 2P5ED 1GAFH 4YHPB 1FG9C 1F11A 1GHFL 4EEEA 2NY3B 1XGRA 3IDJB 1KT2B 4J3UA 1WWBX 2V2XB 4PRIB 2OXGA 5IBTL 5KSVB 1BVKB 3SHSA 1DBJL 4JY5L 3G6DL 5DJCB 4M6ML 3GMMB 3TBSA 4PRDA 3TA3C 4LKCB 4NKDA 3O9WA 2C3VA 2GSGA 1RURL 4TOYL 1FORH 4X9IA 3ELAT 5CEXA 2YSSB 4MJ2A 5JHDB 5JXEA 4M8VA 3TJEL 2H3NB 2ESVD 4HAFA 4R7NA 2EXWD 4WNQB 3M17B 4B7LA 4JO4H 5HHMD 4Y5XA 3OB0K 4F8QA 1HDMA 4B0MM 5K9QG 4LSVL 4ELKB 1KOAA 1X4YA 4WFGE 1NANI 2NR6C 4I48B 1OPGL 4XMKL 2GJ6D 1C08A 3GB7B 1K4CA 2BX5A 2PXYC 3OF6D 3HE7C 5SV4A 5ID1B 4Y2DB 4HPOL 1N7ML 3MCLH 4HJJL 3FZUD 3G5XA 5HI4D 3LHPL 5AZEH 3VI3E 2N7BA 2E7LC 1U8OB 3U30B 1DQQB 1QSZA 3VFSA 3KWWA 4LGSB 2VZUA 3AUVA 2AV7B 4YLQT 4PJ8D 3SCMC 4OLXL 3TBTB 3VFVA 3ARWA 1TJHH 4FNLL 4GRLC 5DD6A 2F19L 1ED3A 3O4OC 3S88L 4NQDE 3DO3A 4P46A 4X99B 1VFAA 2DD8H 3WV0A 2H32A 1MAMH 5BCAA 3W39B 3HZYB 2NX5D 1AGCA 4JZJA 1D5IH 5HGAA 3V0WH 5I73C 5LQBL 1C5BH 1ES0A 1MRDL 1GJIA 4AG4L 2FWOA 3BXNB 3MX0A 2VUYA 3TO2A 4CVUA 3MLWH 4JO1H 3KPLA 1XGUA 5FKAA 1JZ2A 4Z9KB 1U93B 3GHBH 4D3CH 1DEEA 5FB8A 3RNQA 3BT2H 2A6JB 4QWWC 1EUUA 4R3SA 1IC4H 1IAMA 3CDGB 3MYJA 4QLRA 3MRKA 2YRLA 3SE4A 1E27A 3OKLB 1AKJD 4HK3N 4UIMA 5J1AA 4QXGH 5A16B 4F37K 4OQTA 3DBXB 5JNYA 4K07A 2WP3T 2ARWA 4XBPB 3FB5B 3QXVA 3RL1B 3EOAB 4TNWF 3D9AH 3TF7C 3MRNB 1HQ4B 1A14H 2VDQH 4LAQH 3OG4B 3SY0A 1WZKA 3D39B 4Z7NE 2ZSVA 5EO1A 1NQBA 2F5AL 2V7NA 2OTPA 1CG9A 5C86A 5C6WH 1KJ2B 1CI5A 5D1XA 2QHRL 2YK1L 3EDEA 4HFWA 4PRAB 3D2UD 2V2TA 3T65A 1JGUL 3ULUF 1KG0B 4HUMB 3P0VL 4LCWA 3PHQA 1DZBA 1Q94A 1ZA3A 3UCRA 4IOFC 4QGYA 4PGEA 5HYIA 4BELD 6FABH 5F3HB 4HH9B 5EO0A 1AD9B 3IT8D 4HUUA 3CFIC 4ZMAT 1EFXA 3NTCL 4KRNA 5F89A 4ODWA 1A9EA 1TCMA 4WU7B 2OQJA 5IB4A 3X3FH 2BSRA 1J12A 4XXDB 4X7DC 2A9NL 4PY8J 1UKTA 1U3HC 2D31B 3D2UA 3WDJA 5IJKC 4X6BA 3GMRA 4QRPE 2B7DT 2HT2C 4BUGA 3HC3L 4K94H 5ESVA 3S5LA 3MUGB 2X9YA 4H8WL 1FG2A 2FBOJ 1F5WA 4KZEL 2A6IA 4XMPL 2CO6B 3NZHL 1KBGH 4YNYA 3VRLE 2Y1VA 2ERJB 1K8DA 5ADOH 5JO5A 1U41A 3BD3A 3QFJB 2E27H 1QBLL 3ZTNL 4WO4D 4P9ML 1GZPB 1Z2KA 4AMKH 5L9DH 1LDPL 3DURA 3MRDB 4NJ9H 5KSUB 1RZ8B 5DT1L 5BS0A 3PGFH 4RDQF 5HYFA 4M7KH 4O9HH 1MH5A 5IVZA 3BPNB 1FNHA 2W9DL 1LD9B 4ALAH 2GT9B 5JW5A 3X12B 1A6AB 4YGAB 3VD3A 4XZUA 2WMPA 5JLZB 3LB6D 4F7TA 3VFGH 3QWQB 1RZJC 5A2JH 2LVEA 3MCKA 5CINL 2EYRA 2P44B 1A5FL 3NA9L 3L3KA 3NN8B 2DF3A 1HWHB 1YPZA 3E2HB 3J7HA 3QHZL 4I0KA 5I1EL 1T0PB 3RX8A 3GZKA 5GRXG 5JOFA 4NO0D 4QRUA 1J5OL 4NWUL 1ONQA 3P77B 1YMHB 3GBLA 4U3XA 1KTDA 3L3OB 3FKUS 1KJ3H 1MNUL 4YR6B 3R8QA 3V6BR 5CJQH 1PKQA 2EKSA 1JNLH 4K3HA 4PFEA 3NA4A 2WUBL 1X5KA 4G42B 4LKXB 4EXKA 4YPGB 4XP6H 2GI7A 4LLYB 1NL0L 4Q2ZB 3S5LG 2MCPH 3BZFB 5F96L 4WV1A 4P9HC 3I50L 1RUQH 1EO7A 3EJZD 4JPIB 4JRXB 3UYOD 4KI5C 3AS3A 3ARDB 2YD6A 3HZKA 2FO4B 3HPLB 2UZIH 4PREA 1T7YA 4JM2A 4K8RL 1T6VN 3TM6A 3GIZL 4KTYA 2BZDA 3KVQA 1OSZA 2VXQL 3B2VL 2D7PA 2HT3D 3RKDD 5JOEA 4GRMA 5ACMA 1LP9A 5D1ZD 1ZGLP 1E6JL 2KZ1B 4U1GB 1AJ7L 2AABH 2Y72A 2BOBA 3BAEL 3MXWH 3MGTA 1HK6A 4IOIA 4MXQD 3M8OL 1W0VA 2H26B 3N1GC 4NZJA 1FFPB 5FOJA 5HHVH 4BFBD 2DQJL 3PGCB 5C0JA 2DKSA 4L8SC 4NWTL 5CP3A 1ZSDB 5LGJB 1G7LA 1RIHL 1SYVB 1YUHA 3FB7B 2X4TB 4ZO6A 1P7QB 3MCG1 1BBDL 3EYVA 5GJTH 1P1ZB 1PY9A 3HA0A 4WI5A 5EDXA 4PTUB 3G5VB 2Q8AL 4NFCA 4UV4L 3FQXB 2FEDD 3G9AB 4ZNEA 3DXAB 5CZXC 1G7PB 1H15B 4PRPB 4QGTA 4WI3A 3MV8B 4L3ED 3ULVL 2AGJH 3BJLA 4GBXD 1SY6H 5E99H 4UDUA 4MMXC 2BVTA 3MRIB 4OZGB 5D2LA 5DMGD 4KKCC 3D0LB 4DUVA 1TZIA 1UM5H 3GSNA 3D3VB 5B22A 4OFYA 1ZA6A 1YJDH 5F6HJ 3WD5L 2WLYA 1T6WA 3RWEB 2R39A 3MXVH 3OJVC 1YEJH 2Q6WB 5IWLC 2LV4A 1LO0H 4PUBL 1LEIB 3OQ3B 1HQRA 1TPXC 4DOHB 2DLIA 4GBXA 2VXSH 4DGIL 2GCYB 2DM4A 4DW2H 3HKFA 1JGEA 3CPLA 4HBQA 3EYOB 1QBAA 1M71B 2CKBA 3QH3A 4LP4A 5DD5L 2FD6L 4F7PB 3QQ9C 1WAAE 3B9DA 1BVZA 2HLFC 2EEDA 3UJIL 1A4KB 1Q9KA 4P23D 1CDUA 2R1WA 5C0RL 3V5DA 1RVFH 4OZ4A 3MV9D 4D9RE 2OS7A 5C3TA 4CN6A 2LU4A 2DQTH 3I75A 3AB0C 5DGQA 1NLBL 1QFWM 3BE1H 3EKCA 3OX8B 1Y18A 1CDCA 1F8TH 4OTXL 4RA0C 1TCRB 3WUWB 2UVFA 3M45A 4U33A 4WWKA 3PWVA 3P0GB 5BQ7A 2XPGA 2J3SA 3NZ8A 1YEFH 1NCUA 4DCQA 5EU3A 4L9LB 1JWSA 3QUMA 4HMEA 4YZFE 3WS3B 1QACA 5IT2H 1ZANH 1CVSC 3KYMA 4R0LC 4CW1B 4KJYA 4P48A 3CMOL 4ZFFB 4YK4B 4S1RL 4B53A 1JPGA 3QUYC 4MQTB 3LN4A 5F7LB 3H9ZA 2C3GA 1EO8L 1MIEH 4XPBL 4F58H 1FFQA 3N06B 3BP5B 4QTIH 5IMLB 1AXTL 3NIGE 1CD9B 1IVLA 4TSCL 1DP0A 3B3IA 3JTTA 3OKDB 3TFKC 4Z7NF 4ODVL 4XPTL 3EOBA 4Z95L 5C6PB 2G60L 4ZUTA 4U6YB 4G8GE 3RGVC 4V1DD 4I3RL 1V7NL 4I18B 4Y19E 4LPVA 4AEIH 1FCGA 1N5AB 2JIXB 1NGXA 3ECBA 4NCC2 1I7ZB 2HJLB 4M48L 4D0DA 1BX2B 1R0AH 3WL9A 3MJGX 5D7KD 5I74C 4K7PH 1A6TB 4NNPL 2VDPL 2O93L 4PJEB 5BZWA 5C0AA 4RCAA 3TBVA 5DHYA 5D1QD 4N0RA 4R4BA 3L3GA 4QF1A 2OLDA 3LKSA 3Q3GA 5E7FA 3MRRB 1WC7A 4R9HA 3MLYH 4V2CB 1E4WL 1WWAX 1WF5A 4BH7B 3BEWB 1K2DB 4WUUB 5ACLA 1OOAA 1KJMB 3ZDYE 2ICCA 1U8IA 2DQIH 3BGFB 4F9LC 3TIEB 3VRLF 1ZLWH 4I2XA 5C9JA 1AGBA 1MI5D 2N4IA 2I9LA 2GAZB 4XX1G 4JFXB 5DMIL 5DQ9B 3WHXA 4Q58C 4KPHL 4CMMA 1MPAL 3R1GH 3RX7A 2R2BB 4P59L 4H1LB 1LEKA 1GGIL 3MRCB 3O2DA 3U36A 5T5FH 4UNTA 3B8YA 3S3JA 2CJUL 5DJYB 2MMXA 1LGVA 3RWFA 4OI7A 4GW4B 2NY0C 1WSST 3MLUL 3GJEA 5EU6E 1IAII 4HWBA 3CU7A 3U0WH 3FQWA 3L3IA 5DRZA 4JKWA 2J2ZA 4K9EH 2X42A 5ICZB 3S37H 3SDXB 4C54A 2BSED 1MRCH 4PRHA 2R0ZL 3NCJH 4F7EB 3DXAE 5BV7H 3HG1E 5F71A 1NUNB 4NC0B 4GXVL 5GGVH 4KRPD 1UXSB 1RHHA 1WBZB 2IPKB 1S7SA 1LO3L 3SQOH 4X4YB 4NUGH 3O6LH 1I1AB 2IBZX 4R96A 3MLXL 1KB9K 1H3VA 1MHEA 2C4FU 5FM4A 2X4QB 5FYKL 5J4MA 3C6SB 5CBEB 1KB5B 4PJ5B 3PWPB 5BO1L 3OV6A 1T2JA 5A2IH 5GZNC 4FS0A 1MCBA 4ODUB 1D3CA 4ONFL 4RQQB 4DVBA 2DQHL 3VFNA 5EZLA 4DOHE 1T20A 1RUKL 3CXHJ 3HUJB 1A7RL 2YRPA 3GGWA 2MNUA 4NYLA 4FQ2H 2FSEA 3VCLA 4LRIA 5FGRA 3L9RA 4N0YH 2JK5A 3GBMH 1HNFA 3C5JB 4MB5A 1HWGB 3I02B 4PJAA 4EI6B 2K7QA 1B4JL 1E6OH 2XNAA 2AK4E 1WJ3A 1NFIB 3B43A 2XT1B 3ULSA 1BD2E 1FZJA 3PWNB 2I60H 3QEGH 5E94B 1NMAL 2OL3H 4FQLH 2FECL 5I8EB 4YGVA 4X9FA 5F7DA 2IFFH 3IS1X 3NCFB 3HFMH 3B9KC 2IADB 3LEVH 1MJJB 4NCC1 4X4ME 2BCKB 3ZTJG 4OF0A 5J6HA 1JJUA 4E5XB 1WZLA 3TO4D 3FAXA 3L3DB 3QULA 4KKBD 1X5JA 4HH8A 3VXQA 3OZ9L 5DLMH 2OR8A 4ZFOA 3NGBC 4G9DB 1SJEB 3O2VL 3BZ4A 1G7JA 3Q6FB 1DUYA 1A3RL 3N9GH 5IB3A 3PXHA 4TNVK 3GHEL 3RVVD 1FNEA 1VB9A 1XGTA 4U6HA 2UUDH 4DZBB 4ZAKB 2E9JA 1D9KA 4FFYH 4E9LA 4PBWD 2Z93A 4HUWA 3KYKL 4OCSL 1NMCC 1QZ1A 4UNUA 3MJ7A 5T1LB 4Z7VA 4I5BB 3WXVL 4G8FB 2YWZA 4NQEA 4DAGL 3TO4A 5IQ9A 4OCYL 1D5XB 5F9OL 4ZFZB 1ZV5A 1OSPH 2XWBB 3GM8A 2D0GA 4JFHE 1E28B 3S35X 3ES6A 1G7IB 2EYSA 4O5LH 2FJHB 4GMTL 2P8LB 2OJZH 3FO9A 2IBBA 1QUNA 1WAAF 4JFPA 2YD8A 3RVUD 1ZEAH 1IC7H 2JLLA 3WN5B 1OLLA 4JLRA 5E8NB 2P5WA 5IF0B 1SJHB 3RIAK 1FH5L 1R3JB 2R4RH 1FO0H 2X7LA 5FKPB 4HCRA 3VA6A 3P9MA 5ADPH 3T0BA 4OLVH 1Y0LB 3GMPB 3KJ6L 3A6BL 5E6ID 4MNQA 4IJ3C 4KDTA 4K3JL 1I8IB 5HDBE 4FA8A 4PGDA 1YN6A 4IS6A 3SJVB 1MEXH 1W72L 4YZFF 3BGMB 4Y4KD 3HI5H 4I0PA 1M6OA 5KZCD 1ZT7B 2VUOA 1JHTA 2VIRA 4Y16B 5F1NB 3UPAA 1R3HA 3DGCR 4DK3A 1YZZA 4PRNB 1KACB 1EAPA 1RZJL 3GMNB 3AROA 4M5YL 1R5IA 5EIVA 4YEEA 5J6GA 5E6IA 1JUFB 1WT5A 5I2IA 3Q5OA 1Z9LA 2EXWC 5CCKL 3NIGF 2XV6B 2W65B 3IDYB 1IGYB 2F54B 3PJSA 5EFIA 1NFKA 3MC0A 1TZGH 1Q0XL 4Y4KA 5FO7B 5HHNA 3PXJA 3VGHA 3OXSA 5CZKA 5HDOA 4LCCB 3S96A 4O4YH 3LKQA 1S3KH 5DJZA 5L88H 1DQJB 4JZJC 1LE5B 3RUGE 5HHPA 4ZPTB 1B0RB 3FZUC 5E2WL 5HI4C 1JZ3A 4O58H 4HDIA 2J88L 3NPSC 3FTGB 5IVXB 1DLHB 3TCXA 4P9HL 5FIEA 4OLZH 4LSDA 4E42B 4XNMB 2X4PB 4LQFL 5TGBB 3CVHA 1JV5B 2K9UA 4GXUN 5SX5H 3B6SB 4X5WA 3QDJB 4WHTB 2NY6B 2AXHA 4GG8A 5DR5H 2E3VA 1WFUA 1J1PL 2VLLB 1JGDA 3LS5H 2FGWH 4MWFB 5I19H 3O4LB 2A6DB 4HUKB 1AXSB 2OR9L 2XICA 3DRQB 3OGOE 2NZIA 3ZDYF 5MHSE 4NQVA 3QI9D 1PEZA 1TITA 3ZO0A 1N64H 2PW1A 4APQB 1UH3A 4DK6A 3MRQA 4NM8L 4KROB 4Z7WB 5CMAA 2I5YH 1P84K 1NCTA 2ICWA 1N8ZB 4RIRA 5DSCA 1KGCE 1N5YL 3K8LA 1A1MB 1NGQH 4LLQB 1KYOK 1YNTA 2V5YA 2R2EB 2BVOB 2E8ZA 4MQ7A 4JG0L 4XNQB 3TC9A 2PR4H 4NKIL 1IGML 5GRJL 1P6FA 1B3JA 4OF3A 4NP4H 3U48A 5FA4B 4DGVL 5BJTA 4AIZA 5I76B 3G5ZB 5L6YH 4RFOL 5T33L 3BVNA 3SO3B 5DQJB 1UCBH 2BVYA 4HMCA 4NBZB 4NQCB 4F15C 4YO0A 2BK8A 4X6FB 1KCVL 1KTLB 3VWJB 2F5BH 4OZHB 1K4DA 1OB1A 1XF5B 2C3HA 2XZCL 5C09B 4BKLB 5KSBE 1JK8A 3D18A 4G6MH 4JFYA 4NT6B 1W0WA 3WJJA 3LEYL 5E2JA 3ILPA 1G0YR 3KPNA 4JFDE 4L3AA 1QSFE 1UB5B 3GSRB 3QEQE 4WRLA 3C6LD 3EJJX 4WGVB 4HHAA 4X7SL 4D8PA 3TYGL 5I1AA 1OGAE 5ITFB 1CE1H 3RTQB 4LHUB 4BSWB 1CN4A 3I3DA 2AJSL 4J4PD 3C2SA 4K3EH 3U7YL 2JJVA 3IFNH 2J8UE 2R23B 1UZ8B 2DBLH 5GGUB 1SEQL 5E8EB 4YUEH 1DVFB 4U1IA 4L3CA 5T3ZH 3HI1B 4MDJA 2F74B 4TRPL 2AJ3A 3C6LA 4XPAL 1Z3GL 1NUGA 4P4KB 3MNZA 3H0TB 5LJYH 5E8OA 3NFSH 1CDJA 5CEYB 4K3DL 4J4PA 3BKYL 4ZXBD 2FR4B 2V2WA 3LPWA 5ETUB 4AQ1B 4LOUD 4WO4C 3K1DA 4OIAA 2YUXA 4OUUB 4NM4H 4BSVA 4G9FB 4LLMA 4UOJA 5IR1B 1XR9B 4LFHD 2B0SL 4Q6IC 5HYEA 5MENE 1JPTH 4OZIE 1NDMB 1KELL 2W07A 4UAOB 5DRWA 3RZCA 1J0YA 4L4VE 5TFSL 3LB6C 4GW1A 4G6FD 4ZO9A 2VXUL 3STLB 1BBJB 4XHQA 1U6AH 1O0VA 3SPVB 2VXVH 2UY7A 5DJ8B 4MCYB 3VXMA 2WIIB 3RNKA 4HIXL 3THMH 4EBQH 1LE9A 1EVTC 4MSWB 4ZUSB 3VW3H 4Y1AE 3K46A 2CO7B 2FHBA 2L7UA 5KS9E 2V5RA 2EZ0D 1LK2A 3FCTA 1MLBA 3QCTL 1TTFA 4Z78A 2V9TA 1YEIL 1N59B 2V7HB 5FM5O 1FRGL 3MV11 4FFZH 4GO6B 4P2RE 5CJOH 5T3ZE 5SWQB 1QBMH 1I3GL 3O3BA 5C0CA 5B3NA 2X89D 3EJZC 1U8KA 4CN1A 3BRGC 4MLIA 4L4JA 4F3FB 1IARB 4KHTH 5DDHA 1W8NA 5F9JB 2GK0B 1AFVH 1EPFA 1UVQA 3GSQB 3X13B 1H3XA 3FRUB 1JVKA 3RIFF 3TYFB 3MMEB 2HT3C 3RKDC 5D1ZC 2Z91B 3KJ4C 4PJXE 2IQAB 2UVEA 1IGCH 3TNMA 4ODHH 3O4LE 3TT3H 1DBKH 1A2YA 4MXQC 1IM9B 5KVEH 5D71H 2XZAL 3AU1B 5HDBF 2Y5TB 4OCLC 1CFBA 3CIQA 1YJDC 3CLFL 2PXYB 4YHNA 3HE7B 2AXFA 1UYWL 4LDOB 5IESH 1T0NA 4Z7WE 3DX9A 5KBNC 1U8QA 2OI9B 2A1WH 3OJDA 2IH1B 4HZLA 1B0GB 2FEDC 4PGBB 5HYQB 2VLME 2O5YH 1MWAB 4MA1C 2XN9D 3DROB 4M43L 1FDLH 2HRPL 4LFHG 2OXHA 4GBXC 1ZLWK 3VFOB 3QIUB 4RDQG 1YEGH 2EC9U 3SO5A 3FO0H 1V3KA 1N4XL 5JTWA 2ZUTA 3QXWA 4JJ5B 3DPBA 5DMGC 5KAQG 5HHQA 5JQ6L 1JHKL 1CLYL 1SM3H 4P2OA 1KN4H 4PJIB 1NFDE 3ZYJA 2AJVH 4PG2A 4TVPL 4XNZC 2Z8SA 5HXMA 1MFEH 1QSEE 3UJJH 4DKDC 1EHNA 1J8HB 4RWYH 4OBSA 5B3JE 1CICB 1QLEL 4WFGD 2NXZB 4HS8L 2ICEB 4ZQKB 4YHLL 4DQOL 3U1SL 2X9WA 2IPTL 2QR0B 35C8H 4PJ9D 3L3JB 1UM6H 1YQ2A 2D7NA 1QA9B 3S3PA 4KY1H 3WFZA 3O3UN 4BQ8A 2JJUA 4PJ7E 2Y36H 5B39A 1CGUA 4P23C 3CFKB 5FF6A 4NQDD 3MRFA 3Q1SL 5CSZA 4CADB 4HAGA 1NMBH 2MQCA 3P73A 1CFNB 4LSUL 2BNQD 5CGMA 5EUKA 3QZWB 2OK0L 4LRNL 5KJRL 4PJ9A 5ANME 5D7IE 3HB3C 1P9MA 5L2KB 4WI4A 4LLWB 4EN3B 3WDHA 4NO3B 3LV3B 4YHMH 5C0DA 1PDKA 3T2QA 3IAGC 4MB3A 1WGOA 4MMZC 3MNVB 4DGYL 1HZHL 2YC1A 2Z92A 5GGTL 1CD1B 4NQDA 5CEZL 1EGJA 3BYYA 3T4YB 1YY9D 3A6OA 4UNVA 1FAIL 2ITCA 4O51A 1YMME 3UTTE 5GS2H 2ITDB 3ZHKA 4LEOA 1FNGB 1MQKL 2R56L 5DHVA 3CFCH 3BSZH 2X4NA 4G5ZH 2YA1A 4J8RA 1U3HB 5FYKU 5GZOD 3BZEB 4LASL 2X4RA 2DQEL 2OSLA 4PB9L 5JDSB 5D8JL 2W9EL 1L4IA 3OPZH 1CLZH 1T1XB 5I8KL 3HRZA 4PLOB 4PJBB 4GG6E 1S7WA 1GAFL 1MCPH 4A6YA 2DQGL 2HLAB 3VH8B 1PX3A 5KSBF 5IW3A 1XGYH 5BW7A 3BQUD 5D7LE 3O0RH 1X5AA 3L6FB 1RZ7H 4MDIA 3QJFB 2D2OA 5B39G 2YMXH 4YC2B 4A2LA 4FQHB 3MODH 1FSKB 4LLUB 4NQUA 1NC4B 4LARL 5D1QC 1TIUA 3CSBA 1FORL 1P4BH 2GQHA 4Y4HA 5T1DL 2Y25A 2F53B 3QXDB 2GW5A 4NFDA 5AAMA 3VDAA 2JB5H 3V7MA 4YBLC 3KDMA 1L0YA 3BQUA 4K9EC 4JO4L 3RPIA 3K4ZA 2HTLD 3CSGA 3QNXA 3V0VB 5BV7C 4Z76B 5HVGB 1OTTD 1A6UH 5FGBC 5HDQL 3E6FB 3H6JA 1XF3B 3TBWB 4R90H 3MCLL 4P5MA 1P7KA 2B4CH 5SV3A 3U7WH 3MGOB 3LY6A 2AERT 5D2NC 5CIPA 1REIA 1JHLL 2VITA 2WUCH 1T1WA 4UIKH 3RRQA 4PLNC 3GRWH 2NY3D 4OZIF 3UTSB 3F12B 5DI8B 3RX5A 4LBEA 1Q9LA 5DEFA 4Z77A 3S36X 4GAFB 4QRPA 1H5BB 3RZWA 3VU2A 4PRID 1RZKH 4X5XB 3L3HA 1C12A 1S7XB 2DD8L 3DJ9A 1CTOA 4LSTH 1MAML 1EEYA 2NW2A 2X4OB 4GRWE 3OKNA 1D5IL 3V0WL 2Z0BA 4IOSD 1C5BL 5TDOB 3OAYH 3W9EB 2EDTA 3PDOB 4MB4A 5EBWB 1XEDA 2FZ3B 3VD9A 4KRPC 5E00B 1W0YT 5JHDD 1KTRL 1INDH 3MLWL 3IXAA 4JO1L 4LRIC 1DN0A 1P6AB 3QQ4B 2GTWB 1NEZB 3GHBL 4D3CL 5J9PB 5KS9F 1JGVH 1KT2A 1CL7H 3BT2L 4U7MA 3DGGA 2AAVA 2EIZB 3QWOA 4PJIE 4Q7DA 4RMWA 1KEMH 3QWRD 3LIZL 4YAQA 1T7VA 2ZOKB 3QIWB 5KSAB 3VE0A 4PPTA 1EUTA 3LKPB 4RBPH 1NBVH 2XQBH 3WE6A 4RNRA 4ZUUA 1K9TA 3MLSH 4JY6A 4Y2DD 4FXLA 2VZTA 3EYFB 1VFUA 4EI5A 1QFWL 4B5EA 3MBXH 2D7TH 3R0MA 3QUXA 1A14L 2VDQL 4LAQL 1D6VH 1U8LB 3D0VB 5A2LH 2W0FB 3EO9L 3S37X 3QJHB 4WDIB 3VI4E 1EMTH 1KN2H 3U4EA 4PJXF 5FHBH 2M2DA 2AXGB 4LU5H 2ADGA 1X5HA 2V9RA 5BXFB 3T8XB 3UBXB 3I85A 2X9XA 1VADB 1VACA 3VD4A 1NKRA 4X9GA 5T3XH 1KXTB 4GAGL 1RU9H 4QRQA 3VRIB 4I3GA 5JORA 3BRDA 1HHKA 2X4SA 1M7DB 4KUZH 5FCSH 3RJDA 3C87A 5T1MA 1UJ3B 4Z7WF 1NGWB 3TO4C 3DHMA 4KKBC 2UY6A 4U0RC 5L0QC 3U6RB 1FC2D 4XH2A 4HS6B 3LDBB 4PJGE 3TN0D 3X3FL 1U92B 3RWGA 3UC0H 4OLWH 4TPRH 3QAZC 4HWNA 4NZUH 3L5IA 3ROOA 1MCFA 2XZQH 1GGYA 4HUXB 4RGNB 2Q7NA 3AM8C 3V79C 3MROB 1QVOA 4K94L 5IFJB 2PO6D 2YZ8A 4JN1H 5CUSH 3DO7A 4XC1H 3HI6L 1OQXA 3BPLB 4XGZB 3KYAA 3AB0B 3N1PC 5CP7B 1NFDF 4AEHH 3SDDB 1S7RB 3WSQL 1OD9A 2E27L 5B3JF 3TN0A 1U93A 2DRUA 4PR5B 3D39D 5L9DL 3VFPA 4NJ9L 3VWKB 5C0FA 1MRFL 4GAYB 2DL2A 4M7KL 4N8PA 5TE7H 5EBMA 5T1KB 4ALAL 5KTEH 2PO6A 1I7TA 4KDTC 1I3RB 4M7LT 3QCUH 3MUZ1 2W59A 4EUPB 4D9QD 3HZMA 4XBPA 3P4NA 4KC3B 4MVBD 3VFGL 3RVUC 1H3TA 4PJ7F 2XRAH 4R7DA 4CDHA 5JDJA 5GHWL 43CAA 3OR7B 3GUTA 9CGTA 4X8XA 1OF2A 4CGTA 4PG9A 1PX4A 2EDWA 2FBJH 3GSOB 5C0GB 3KHOA 4FHBD 3C9NB 1IBGH 4I9WD 3QO0A 5D7IF 5E6IC 4L1HA 5CJQL 4UBDD 4JN2A 3EBAA 3MOAH 3RGVB 4BH8A 5AD0B 2V5SA 3F58H 3KPPA 3MNWB 1I4FB 1KJ2H 1UWXK 4MD4B 4YH6A 3QDMB 1GC1H 1KLGA 4Y4KC 3V52H 4XP6L 2PCPB 3HCVA 5BOZG 5DD1L 5EIIB 5F3HA 3IJHA 4HH9A 4FFWD 4JRYB 1WAAA 2AEQH 1FVEB 2MCPL 3E8UH 3IDIB 2R2CA 4HKZB 4TNWK 1CE6A 3BH8B 3QFJD 1ITBB 2P45B 3BX7C 3FN0H 4G7YH 2UZIL 5DUMH 1KJVB 1A22B 3O6ML 3WHE1 3MBEA 3P40A 4KHXH 3UTSE 2XY1A 1BM3H 2P7TA 3IDMB 1SBBA 1FL6B 2DLGA 3SKOA 3FONB 4JY4B 5I6XC 1QOKA 1PSKL 3IDNB 1UQSA 5CJXA 4GG6F 3L5WA 4KTDH 3LSOA 3GMLB 4EDWH 2NW3A 1A6ZA 1OAZL 3MREA 3O41A 5HHVL 4HJGA 3BGAA 1QR1A 1NC2B 1U58B 4LLDB 1F4XL 1QR4A 3CSYB 4JE4B 2X1QA 4NN7B 4QRSB 4ZSOE 5GJTL 3ARFA 5IHUL 2D4DA 1CF8H 2F15A 1FIGH 3K4AA 5DJ6B 3MRHB 1FC1A 3O3DB 5B8CC 3RJQB 4Z0XB 4NGHH 5JLZA 1DN2A 3ZHDA 4HULB 2X1XR 3TWCH 5F9WC 1A0QL 1A47A 4PY8I 2AGJL 1SY6L 5E99L 2JCCB 4HFUL 3G6AB 4G8GA 4Y19A 3KPSB 4JRXD 4GMSL 4D94A 3ARDD 1UM5L 4C55A 3QI9C 1B9ZA 1UM4H 1T80A 4CVXB 5DYOA 2ARJA 3DOSA 3BUYA 2DKUA 1FZOB 1INQB 1YJDL 1HHJA 3PHOA 4B7IA 4RFEB 3QB7C 1YEJL 3GSUA 4P49A 3GSNL 4N0UB 1LO0L 5IBUB 2BSSA 1AGDA 2OR7A 1N2RB 1QNZL 1YN7A 4OCWH 1A64A 3P11L 4G7VH 1B6UA 3OAUH 4JAMA 5LGKA 1HSAB 4F7CB 4PJFB 2Z31A 4H26A 1YEDB 4JPIA 1OGTA 2EE3A 1EAJA 3HPLA 2MTPA 4LLVA 3TP4A 2QQNH 3MQIA 1GGCH 4OGAD 2AP2A 3MUHL 5HI3D 2ICES 1NAMA 4U1KB 5JZ7D 2FLRT 2DQTL 4JFQB 3GI9L 3BE1L 2FJGB 4RAHA 4RGNE 1K6QH 4O2FA 3BMWA 3DXAD 5H35A 3PL6A 4PRPD 3HG1D 1TQCC 2DI8A 1KPVB 3MV8D 2H26A 1YEFL 3MV7B 3JWOH 1T7ZA 1CDIA 5I66A 4X6DE 1IEBA 5FUZL 5HHOB 4PJIF 5IV2A 1PLGL 4M93B 3WKMH 3EO0A 2HN7A 2X4TA 3BO8A 3H9SE 1MF2H 3C6LC 3B9KB 2OMBA 4FQIL 2BNRE 5EU6A 2PYFB 1J1OH 1I9RH 1ZANL 3D3VD 3M1BA 5IT2L 1UXWA 4P2QB 1IKNA 4J4PC 4NZRL 4Q9CA 3DXAA 1FVDA 1G7PA 3HG1A 1J0JA 1KIPB 3E3QE 5HPMA 4HKJB 4F58L 2R29H 2X70B 3MRJB 4U1MB 4HWEH 4QTIL 3VI4F 5EU4A 1NMCB 4OD2B 2A9MH 5FDWB 4M7JH 5B38A 3MRBB 3SKJL 4AEIL 1TJGH 2HFEA 2WWMD 2Z4QB 1H9VA 4PV9B 3RVXD 4G6AD 1S7QB 3T04D 1BD2D 3ROLA 2IANB 4ZXBC 4BZ1H 4LOUC 3RWEA 3FOMB 4PYGA 5C08E 3WLBB 4JVWA 4LCUA 1HXMA 2ZSWB 2GCYA 4OLYL 4XNXH 2EDKA 4HIIA 1JWUA 3EYOA 1F11B 3QDHA 4PJGF 1XGRB 4XTRD 1G6RA 2HAZA 3K74B 2XWJA 1PW3A 3P30H 5FDYA 3RPKA 4KUCF 3ARSA 3CX2A 4DN3H 4CVWA 2LU7A 2AK4A 5GS3A 3TBSB 4MJ6A 1BD2A 1NSNL 2M26A 4KFZC 4NKDB 1CQYA 3O9WB 2C3VB 2GSGB 4LPCA 3VJ6A 1M4KA 1NCDL 1PYWA 4DVRH 1DL7H 3FT3A 5CEXB 3QG7H 4QTHA 4X4MA 2FIKA 5F6HI 4QO1A 4M7ZC 2VLJE 4QNPF 2EZ0C 4IJ3B 2NTSP 5F7YC 5FHAL 4R7NB 4Y5XB 5K9JH 3AXLA 5T5FL 2CIIA 1HDMB 1H3PH 4IIQA 3SKMA 5C1MB 2JIXD 1XAUA 4JFHD 5F88A 3D85A 4LEXH 4CW1A 3S8WA 1C08B 3U0WL 1K4CB 3HRPA 3FFCE 5IMMA 1IT9H 4PY7A 4JHZA 3JV5A 4K9EL 1MLCA 3G5XB 1KNOA 4W6WB 5CKGA 1MRCL 1VEMA 3VFSB 5BV7L 3O45A 3KWWB 1JNNH 3OKDA 3JWDH 4QRRB 3MJ8A 1IGJA 5GGVL 4B41A 5IVNA 3FO1A 4U6YA 3VFVB 2A2QT 5E7BA 5DD6B 1ED3B 2AK1L 3KPSE 4GFTB 3V6FA 4P46B 3O6LL 4O2CB 1I7ZA 3NOIA 2H32B 4IM8A 4L4TE 4HLZG 5HGAB 2F9BT 5EG6C 4CKVX 1ES0B 2O61B 2VH5H 3NPSB 3AY4C 2FWOB 3T0WA 1CGXA 1YECH 4WW1A 4LSQH 1UB6A 5KVDH 1AD0A 4ERSH 1QLFA 1I85C 1XGUB 3KPLB 5FKAB 4JDTH 2DLFL 4FQ2L 1DEEB 3WUWG 5FB8B 3RNQB 1JFQH 4GAJH 4KTEL 3GBML 4N0YL 4R3SB 3TV3H 3CH8A 4JY5H 5DEZA 2XWTA 3MYJB 3T1WA 1FFOA 3MRKB 1FGVH 1E27B 1K2DA 1VSCA 2VLRE 3HC0B 4UIMB 5J1AB 3BP7A 2WLZA 5JNYB 4CRPA 5LKNA 3VXRE 2OL3L 2LTQC 5K9KA 4FQLL 2DQCH 5IM7A 4FTVE 2QQQA 4ZDHA 3HFML 4HT1H 3LEVL 5DQ9A 4LSSH 3OAZK 3SY0B 4HGKC 4LCIH 2ZSVB 5EO1B 2OP4H 2V7NB 4PJ9C 3ZDXE 1CG9B 5JOPE 2W0LA 4LSVH 5D1XB 4C83A 4HFWB 4R26L 4PGCA 1I1AD 3T65B 1OCWL 2O5XH 4H1LH 4LCWB 3N9GL 3PHQB 1Q94B 4WI9A 1ZA3B 1AP2A 4HPOH 2VN7A 2BOCA 4P2QE 4CL7A 4OF6A 4HJJH 3PWPD 1BZQK 4PJ5D 3LHPH 4PGEB 4ZFOL 1HH9A 1JYVA 3UP1A 5EO0B 1WZ1H 1ORQA 2XTJB 4XCCH 5TDPA 4HUUB 4XCFL 1ZOXA 3C09C 5C2UB 4L9DA 1EFXB 5F89B 4ODWB 1A9EB 3QPQD 3RUGA 4RFNC 1VEPA 2OQJB 5IB4B 1OAQH 3PV6A 2BSRB 2E7BA 4JDVA 5MHSD 3S88H 1RJCA 3D2UB 2YXFA 3GMRB 5GRYA 1SVCP 1OSPL 2Y06L 3S5LB 2DYPB 1FG2B 5LQBH 1MRDH 2A6IB 4O5LL 2BY0A 3F7PC 3QUKA 2OJZL 1K8DB 1YY9C 5JO5B 1CDBA 3MUY1 1UJTA 1KB5H 1ZEAL 1X9QA 43C9A 4FZEL 2LQRA 5I1LA 4XXCC 3MUJA 2MHAA 3DURB 5K59E 1YQVL 5GZOC 5BS0B 1WBYA 3QRGH 1T04A 2HTKD 2R4RL 1FO0L 1EJ6A 2F8OA 5EORH 2P42B 1MH5B 2HRLA 5IVZB 5JW5B 4OLVL 2IAMA 5I9QC 3V4PH 4XZUB 2I26N 3GJFH 4F7TB 2Q3AA 4ZAKD 2MQ0A 3BQUC 2B8OT 3MYZA 4X6DF 5TH2B 3MCKB 1MEXL 5T1LD 2B4CC 1F4WL 3HI5L 3L3KB 1MJJA 1YPZB 3CK0L 1RZFL 4F57H 2CPCA 5DMYA 5JOFB 4QRUB 5DUBB 5LBSH 1ONQB 2G9HA 4H0IA 2YK1H 2WBJA 3Q5TA 2YS4A 1KTDB 1SJEA 3BI9X 1OGAD 1X44A 3P0VH 3BPOB 2DWEA 1SJXA 2A74A 1PJ9A 1RZKC 3EOYG 1HN1A 2B20A 2HTLC 2OMNA 5GGSY 1IKFL 1EH9A 5HYSA 1TZGL 5KSBA 4WV1B 2C4XA 1OTTC 3NTCH 3TVMA 4JFDA 5E56A 4NO2A 3RWDB 3HZKB 1QSFA 3QEQA 4QRRE 4PREB 4JM2B 1F58L 1TXKA 2A9NH 5FUOH 5J11B 2APBA 5J0BA 4O58L 1X6NA 3V5KA 1OGAA 1OSZB 2ZCKL 2Y07L 4LNRA 2X4UA 4GRMB 1K85A 1LP9B 1UKSA 4OF7A 1SVZA 1V05A 3RKPA 2EDHA 2NY3C 3P9WB 2BOBB 2J8UA 3MGTB 4IOIB 4LVNB 2EICA 2P8LA 5EZJB 1KEGH 1W0VB 1SMOA 5C0JB 4G8IA 3SJVD 5DR5L 5MEND 4NSKA 1QBLH 1G7LB 1YUHB 1R3LA 3ZTNH 3OR6A 5L8LB 4P9MH 3EYVB 5IF0A 4Y16D 3BD4A 1LDPH 1XCQA 4XP4H 3ZDZE 1HH6A 2AS5M 4YBQD 1XIWA 4MHHI 4UV7H 4U4BA 2E6QA 2W9DH 5DVMA 4LGPB 1Y0LA 5I1HH 3KJ4B 3V5HA 3QDGE 3MA9L 4NNXA 2I5YL 5D70H 4Y1AD 4UDUB 2F54D 4OZIA 5MENA 1CVRA 1A5FH 5D2LB 5F1OB 5LAXA 5EZIH 4PD4K 4L4VA 1YEEH 1J5OH 1TZIB 1OQOA 4NWUH 1I7UA 3GSNB 4PBXA 2BDNL 4Y2DC 2PR4L 1ZA6B 3U30C 1AGFA 2ZUWA 4NP4L 3BRFA 1AE6H 1HQRB 4G8EA 4JGUA 4GBXB 4XRCA 4YDIH 4Y1AA 1JGEB 3CPLB 1NL0H 1I8KA 3WDIA 5KS9A 5F96H 3WFCH 3QH3B 2CKBB 2ZZUT 2NY6D 3BEVA 2X10A 1RUPL 1LDSA 3KPRE 5HVHB 1Q9KB 4G6ML 2R1WB 3O4LD 2HVJA 3V5DB 3QQNA 4K8RH 1T5XA 1I1YB 4P2RA 4OZ4B 5ECJE 2XKNA 1I1RA 3I75B 4JG1H 4HC1H 3HC4H 1CE1L 1J87A 3FHQA 4APQD 4X5LA 3PQYE 3BAEH 2L7JA 4WWKB 1KB9J 3TN0C 2RB8A 3N1QC 3PWVB 4KROD 3IFNL 3M8OH 2XPGB 5BQ7B 3NZ8B 4DCQB 5EU3B 3TNNA 2DQJH 4WHTA 1JWSB 3QUMB 1RIHH 5KANI 4PJXA 1HSBA 3CSPA 3CNKA 2R9HD 4JQIL 4JZNA 2PO6C 2Q3ZA 3ZYZA 2QKIA 3CC5A 3KYMB 4KJYB 3VXOA 1JIBA 1J1XL 3NFSL 1JPGB 4U7KA 4WW2A 2P24A 2VERN 2V6HA 1HILA 4YHYB 4Z7WA 1CS6A 1ORSA 2VOTA 3WUZA 2OZ4A 3JTTB 3B3IB 1MAJA 2EYTA 4NM4L 5J13B 4QXTA 4WFFD 3EOBB 3ZDXF 2NCMA 2XZZA 4U3CA 4ZPVA 3G9VA 5F7UA 4ZUTB 3UTZA 1JPTL 3VWJD 3TLRA 1OAKH 2R2EA 5C09D 2ATKA 2YPVH 3CFEA 4IMKA 3ZT7A 1DCLA 4MVBC 4WFHE 2A6KA 3JVGC 1U6AL 2BC4A 5DWUH 4D0DB 4HUVA 3F5WA 3WL9B 1AI1H 2VXVL 4PV8A 5FA4A 2BFVH 4RX4A 3TZVA 1ZHBB 1YA5A 5SWZE 3RTQD 4LHUD 1NFDA 5DQJA 5C0AB 4DGIH 1QSEA 4ZYKA 3GKWH 4TUJA 3VW3L 2PTTA 4R4BB 2VLKE 2FD6H 4QF1B 3GSWA 2KBGA 4W4NA 4UBDC 3U9UA 4OAWA 3Q3GB 3UJIH 1DVFD 1WC7B 4JANA 4WCYH 4ZTOH 3GSRA 5CJXC 1FPTH 1XCTB 3QYCA 1U8IB 1ACZA 4FFWC 5CJOL 4PJ7A 5D5ME 3WYRA 4FABL 5C0IA 4OTXH 4I2XB 5C9JB 1S9YA 4MAUH 4N1HB 3KPQA 4KHTL 2I9LB 5GSVA 1YNLL 3NFPA 1RI8A 1AFVL 3WHXB 4CMMB 3QRFM 1T89A 4G9FD 5K59F 1LEKB 3BPNC 3ULVE 4R97B 4G3YL 5ANMA 3U36B 5F1KC 5D7IA 1WIPA 1S9VA 3TIDA 1J05A 3RWFB 2KKQA 1IGCL 3TT3L 1DBKL 5TQ0L 2YZ1A 3F7VA 4MXWH 3GJEB 3CMOH 1B0WA 3FQWB 5KVEL 2FL5A 3L3IB 5D71L 5DRZB 1ULVA 4PJHE 4HKBA 1BFVH 5JW4Q 4GW5A 1NCWL 1Q38A 3E2HC 1IAKA 4MNGE 4PRHB 5IOPA 3PWUA 1AXTH 1F2QA 3UTTA 1YMMA 2OJEA 3E0GA 4Z95H 2A1WL 3EIFA 3F62A 3T08A 1RHHB 4LIQE 1S7SB 5GRZA 3PIQA 2O5YL 4N8CH 3U0PA 2R15A 3T0EE 4M48H 2BERA 3SPVA 3NFNA 1MHEB 4WEBL 4GG6A 3CLEL 3BP6A 3C60A 3FO0L 4CUCA 2WIIA 4NNPH 4DVBB 4ZD3H 5D7LA 3ARDC 3VFNB 4LSRL 4Z7UE 5EZLB 3KS0J 1T20B 1KN4L 2AJVL 4LHUG 3GGWB 3UJJL 4NYLB 4Z0BH 3DI3B 2FSEB 4RWYL 3VCLB 2MOVA 3C8DA 3L9RB 3SGJC 2IJ0C 2JK5B 5EA0L 3JWOC 3O3AA 4PJAB 3M07A 1E4WH 35C8L 5D6DC 4U1GC 2XNAB 5EH1A 1UM6L 2V7HA 5I30H 2CLVA 3ULSB 1IM9D 4KJWD 1FZJB 5IBLD 4KY1L 1ZHLA 4XP5L 5GS1A 4YGVB 4F3FA 4P57A 2Y36L 5F7DB 4L8CA 4DFIA 2GSIA 1KLUA 3L7FB 4OGAC 5HI3C 1DQML 1MPAH 3FOLA 3NCEB 1NCAL 1NMBL 3TYFA 5J6HB 5JZ7C 5I17A 3ZDZF 5EPMA 3DIFA 3QULB 4YX2H 1P4LA 3VXQB 2CJUH 3WS6A 4I4WB 3KNBA 3MLUH 4JM4L 3HN3A 3BZ4B 1G7JB 2W0PA 1DUYB 5IJVA 5IB3B 1MCHA 5HGDA 2DI9A 1FNEB 1XGTB 3QIUD 4U6HB 1S7UA 3SGDI 5KW9L 1D9KB 4HKXA 3F7YB 3QO1A 2Z93B 4HUWB 2UV3A 3U83A 1E4XL 3MJ7B 1FLRH 5HGGS 4Z7VB 4RGMB 4LMQE 4LVOB 3AMLA 4NQEB 3TO4B 3KGRA 5IQ9B 1P84J 1CICD 4YIQA 3W9DA 2NXZD 5I1JL 4UT6H 1LO3H 3CFCL 4G5ZL 3H3BC 5JW3L 1G1CA 2B2XL 5ENWA 3RGHA 2RAMA 3ES6B 2R4SL 4UDTA 4M6NL 5BO1H 5BMFL 2YD5A 2EYSB 1MWAH 1OY3B 2WWKO 5IB5A 2BVUA 3EZ8A 3LRSB 1BFOA 4FXGA 4HBCH 1LMKA 1MCPL 4GS7B 1EFQA 2DQHH 3WO4C 3C5SA 3FO9B 4PJIA 2VZSA 2WWMC 3NIFE 3MLPA 1ZS8A 3O0RL 3RVXC 3VFMA 1FVCA 4G6AC 4IBLT 4JLRB 3TH3T 2P5WB 3WNKA 2FRGP 3GNML 1F42A 1KENL 2X7LB 2YMXL 1B4JH 2QR0A 2DQFA 1JRHL 3P9MB 5H37H 3G5YB 3SEPA 4X0KA 5L2KD 5E6YA 4EN3D 1P4BL 4XTRC 5D7SH 4MNQB 1H8OA 4L9LC 1NMAH 5C92A 1U91A 2V17H 4PGDB 1FE8L 2WINA 1YN6B 2JB5L 2H8PB 2J12B 4I0PB 4C57C 1M6OB 3T3ME 1J8KA 5EUOE 1JHTB 4KUCD 5ILTL 1R3HB 1GCFA 4YK4C 1U3ZA 1EAPB 3V8CA 3UTPE 3O2VH 4LDLB 1KIRA 2VDKH 4EOWH 5JR1L 2B4CL 5J6GB 1I9JL 3U7WL 3MLVH 5I2IB 1JZ4A 5LXGL 5FYLE 3BDXA 4PJGA 3PJSB 3UEZA 4ZG1A 5FYKE 5EFIB 3GRWL 2E7HA 2Z35A 4Y4KB 5HHNB 1J0HA 4I18C 1WQVT 3OXSB 1NGYA 3B2UD 3S96B 2VWEC 3LKQB 3HLAB 3G08A 1S8DA 4UOW0 1U42A 4BK5A 1FJ1A 1RZKL 3OB0H 1V3LA 5DJZB 3JV4A 1HEZA 4W4OA 5HHPB 5C07B 3AC0A 4M7LH 4FQ1H 4LSTL 4Y5YB 4HDIB 2CUIA 4OI8A 4HLJA 1NC4D 1NJ9A 3ARRA 4U1NA 3CVHB 3BZDA 2CIKA 5I6XB 5E5UB 4GMTH 3IDXH 4ETQA 2F53D 1INDL 4X5WB 2CK0L 5IG7A 4GG8B 1JGVL 2M8XA 4UB0H 1CL7L 3IF1A 5HY9A 1JGDB 3TBYA 1G9NH 1KEML 4Z6AT 3VMPA 4YFLF 1FH5H 3TGXA 1QQDA 4KKLD 3RFZC 3BOVA 2XQBL 4NQVB 3WCYA 5D5MF 1KCKA 4XAKE 1T3FB 2PW1B 3B83A 3OGCA 1NCBH 2N56A 1RIUH 3MRQB 4O02L 4M5ZL 3MBXL 3EYSH 5CMAB 1GZQA 2D7TL 4ENED 1DBML 3GDBA 2ICWB 3RY6A 1MFBH 4RIRB 5DSCB 1ROWA 1BREA 1D6VL 3ULVF 2NY5C 2IALA 3UTSD 1YNTB 5F72S 1BF8A 5FHBL 1B2WL 1H3UA 1GH7A 4LU5L 4MQ7B 4HW6A 1MHPH 2ZOLA 1RZJH 2E5EA 5HYJE 3OKKA 3H3PH 4TQEL 2WV3A 3HS0A 4PJHF 4UQ2A 3VFUA 4AIZB 1MUJA 1JF1A 3UDWA 4JCLA 1F6LL 1RHFA 3MJ9A 1VENA 4KUZL 5IGXH 3BVNB 4YFLI 5CCKH 1PG7L 4DZ8A 4YO0B 1Q0XH 2JJWA 4OFIA 1SQ2N 2EDFA 3UTSA 3F12A 1I1AC 1K4DB 1OB1B 3L5XL 3UC0L 4OLWL 1JK8B 4TPRL 3D18B 4JFYB 5ABDE 1W0WB 3ILPB 3KPNB 3ARGA 4U1HA 5KSAD 3QIWD 4NZUL 4ZOCA 5E2WH 2XZQL 2J7LA 2D7MA 3DETD 1ZK9A 4HHAB 3VXUE 4JN1L 5TDOA 4D8PB 5I1AB 5CUSL 4ODTL 1OD7A 4NCDA 4YDLB 3UMTA 1ODAA 4LQFH 3QPQC 4Z7UF 5KN5A 1G1YA 4AEHL 5E00A 5LCVL 2ZPKL 4ZSOA 3DSNA 2RGSA 1TQCB 2Y5EA 3D25A 4EJ1C 5H2BA 4U1IB 4L3CB 4JFFE 3QIWA 4ONHA 4OQ1A 4MDJB 5TE7L 2AJ3B 5CSBA 3C6LB 4KVNH 5KTEL 3GK8L 5DVNA 2Q7YA 4RGOL 1EX0A 1YEHL 3QCUL 1JF5A 5E8OB 4X7TB 5AUMA 2HMIC 2XRAL 1LEGA 3EYFA 5C0BE 2V2WB 2OBGA 4YDVA 5ITBH 3KXFE 3X3GL 3WEXA 4BSVB 2HTKC 2EH7H 3PDDA 1N5YH 4LLMB 5I16A 4ODXA 2WBJC 5FO9A 2FBJL 1L0XA 2QSVA 3QQ3A 2DOCA 5DRWB 3RZCB 2VISB 4GW1B 2FH8A 4F9PA 4ZAKC 3AAZA 1IGMH 4RGND 3DUSA 3MLTA 4AK1A 1KJ2L 4DGVH 3VXMB 1ZGLM 2HVKB 2MKWA 3RNKB 1A3LH 4J2XA 4OV5A 4RFOH 2AEQL 3E8UL 3V95A 1LE9B 4KK8D 3SDDD 4KI5E 1I7RA 4U6XA 3U46A 4QOKE 1BGXL 3FN0L 4G7YL 5DUML 2NY2B 3QDAA 4KHXL 3VWKD 1BM3L 4WVRA 1LK2B 1I8LA 3AFLA 3FCTB 1MLBB 4G6FB 1Z5LA 4NDMA 1U8JA 4RMUA 4Z78B 1BHGA 1U8MA 4FOMA 1HE7A 5T1KD 4PJCE 5C07E 3TYGH 1V8HA 5DA4A 5TQ2L 3O3BB 3CVIL 5C0CB 2VMFA 3T3PE 1U8KB 4X6DA 3WN5C 1YYML 3NIFF 5DDHB 5HD8D 4M02A 3H9SA 2XACC 5EU7C 1UVQB 2BNRA 1AHWA 3IDGA 3LKNA 4KQ3H 1WZMA 1CF8L 1MY5A 1CYGA 2A77H 2D3VA 2DTMH 2RIKA 4TRPH 4LMQI 2CLZA 3TNMB 5T1KA 1A2YB 1OP3K 3RGVD 5JW4M 1FFRA 4NGHL 5J7CC 2XOTA 3TWCL 3QDMD 3BKYH 4YHNB 1F4YL 3O3EA 5MP6H 3LOWA 2AXFB 4KK5C 4JRYD 4Y16C 3T3MF 4EUPH 1VEOA 3PNWA 2DB8A 1T0NB 3EO1A 4GOSA 4OJFH 3DTXA 1N0XH 1OW0C 3FT2A 4YBQC 1U8QB 1BQUA 1MOEA 3OJDB 1UM4L 1J18A 1A7OL 4HZLB 4BFGA 1UZ6E 3LEXA 5TFSH 1IM3B 2ZNXA 1BEYL 5C08A 3HMXA 2ZUUA 2CDEA 1Q72H 3FJTA 4ISVA 4QHLA 1CFQA 3IDYC 1I4FA 2UYLA 3RDTA 3VXTA 2VLJD 2HH0H 4G7VL 5L2JB 5HHQB 5ISZE 4P2OB 4EZMA 1GYAA 1NC2D 1U9KA 5I1CL 1RULL 1IRAY 3V7AG 1FYHB 1GGCL 3K7UA 4UTAH 1TTGA 1UACH 5DK2A 5C6TH 3FONA 3SE3C 4JY4A 1FRGH 1EBAA 2CH8A 1AC0A 3L5HA 1I3GH 4L29B 1NAML 3QPXL 2VLJA 4HWUA 2NY6C 1OAUH 4POZD 1PKOA 1DANU 5B39B 1FLTX 3JWOL 1U95A 2PTUA 4Q0XL 1UADC 4HS3B 3WKML 5FF6B 3MRFB 1MF2L 3KPSD 4V2BA 3PP3K 2WAHA 3P73B 1BFSA 4MHHG 1J1OL 5EUKB 3B8SA 5DD3H 5DXWA 3FFCA 3EDFA 2J8HA 1G6VK 4APQC 4L8BA 1TJIH 4PJ9B 5BVPH 4WI2A 2RFXA 1BAFL 2AEWA 3MO1A 3OXRA 4GT7A 4S11A 2ZWLT 1OP5K 2XZAH 4NHUA 2R29L 5C0DB 3RVTD 3CLFH 2GJJA 4HWEL 2R9HC 2WSKA 4LPTA 2Z92B 2YC1B 5I8CA 1SEBA 5IB1A 4NQDB 2BHZA 3WJLA 3OMZA 4M7JL 4O51B 2ITCB 3O6FA 2ADFL 4L4TA 5ERWA 1TJGL 4LEOB 3RAJL 5DHVB 1WLHA 1CU4H 1HXYA 4BZ1L 2FECI 3B5GA 4BA8A 2FNBA 4NBXB 3SO3C 1Q1JL 2W38A 4XBGA 2OSLB 3DWTA 4C58B 3Q6GH 4UOW1 3OSKA 3HRZB 4XNXL 4Y5VA 4WFEE 3VWJC 2J6EH 4A6YB 4WHYH 4LGRB 3MV7D 1JF6A 5JQ6H 1CLYH 1F4HA 5JOPD 3P30L 2VZ1A 1G9MH 2MCG1 4GLRI 1ZLUK 2IBZY 4MDIB 2VLRA 3EGSB 1JBJA 2J8OA 1G6RL 3RTQC 3VXRA 4TTDD 4P2QD 3S4SB 4FTVA 4BFIA 4AYFA 1C5DA 4C56E 3LRGA 1WISA 3EFDH 1R24A 1NBZA 4WENB 4Y4HB 3QG7L 1RJLA 2BHYA 1FHGA 5DFTA 3BIBX 3KDMB 5ESQA 3RPIB 5K9JL 4LHJB 3QNXB 4LSUH 1H3PL 2OK0H 1LWRA 3MRPA 2XFXA 1BLNA 5D93B 4P2QA 3MRGA 1ZHNA 2IAND 2ICWJ 1IT9L 4P5MB 1P7KB 1JNHA 1X3DA 4XCNA 2X44D 2VITB 4M1DH 2C1PA 2ED9A 1JNNL 1GGBL 4WHYG 1DE4A 1F13A 3IETA 3HMWL 3QIBA 4DGYH 1X6LA 1HZHH 4UAOC 5GGTH 2XXCB 1DANT 5CEZH 2YN3A 4G6KL 4LBEB 1Q9LB 5DEFB 4Z77B 4QRPB 4ELME 4AM0A 3DMMD 3S97C 3L3HB 2R56H 4PV9A 4TVPE 3BUTA 3IS0X 5IFHH 1EEYB 2NW2B 4M8QA 1HOCA 5GXBB 2ZUXA 3OKNB 3X11A 2QLVB 4E41E 1EEUA 3O9WD 1M05A 2VH5L 2DQEH 3WLBA 3N50A 5D8JH 2OM5A 1YECL 5I8KH 4LSQL 4UT9L 1MFAL 4KI5F 2A0LD 1C1EL 5JXED 4YBHA 2DQGH 3IXAB 1KCUH 1DN0B 3CDCA 1F3JA 4JDTL 1MY7A 5A3ID 1MCWW 1VFOA 3DGGB 3QWOB 1JFQL 4GAJL 3DMMA 3TV3L 5BRZE 4YAQB 5IB2A 3VE0B 1FGVL 4PJCF 3WE6B 1MSPA 4RNRB 4ZUUB 3T3PF 4LARH 4JY6B 3AREB 5DJAA 2DQCL 1G7MA 5GGSA 5T1DH 4EI5B 4HT1L 4LSSL 3QUXB 1EO5A 4XWGL 2ZCLH 4OIBA 4QRRD 1AGEA 4LCIL 2OP4L 5FFLA 3G6JB 3U4EB 4KJWC 4P46D 2ADGB 5IBLC 5CEZE 1MVUA 2DQDH 5HDQH 2O5XL 1KC5H 4K7FA 1VACB 2NY5L 3DSFH 1VHPA 1VDGA 3CX5K 4QRQB 1E0OB 3TCLA 5DHXB 5JORB 1IZJA 1HHKB 2RQ8A 1JHLH 2X4SB 1WZ1L 1WK0A 4XCCL 1AO7E 2A38A 2C26A 3GBNH 5ALCH 5T1MB 2OI9C 4MAYA 3D48R 4QRRA 4K2UH 4QY8A 4XH2B 4QHUA 1OAQL 4AH2A 1UA6H 1UZ6F 4M4PA 3RWGB 1Y6MR 1IGTA 4MQXD 2FYYA 3QIUC 4O2CA 5IKCA 3ROOB 1QVOB 5CJ8A 2X41A 1CFVH 1KIQA 1S5HA 4YDKH 2Q8BL 3ZSTA 3DO7B 2O61A 4LCYA 3EJYD 2JJTC 1H8NA 4S1DD 2H32H 1CT8B 5EOTA 1IEAA 1MJUH 1CICC 1KB5L 4OGXH 1FZKA 1K3ZA 2NXZC 2G5BA 3TN0B 5CJBA 1T22A 3I2CH 3VFPB 3CU1A 5C0FB 1OARL 4NKOA 3C5ZA 2JTDA 1RK0A 3QRGL 3DYOA 3LIZH 2ADIA 5EORL 3KYNA 5D1XD 1SBSH 1PAMA 1L0QA 3HC0A 5EBMB 1WFTA 3QDGA 5ACZA 2W60A 2P5EE 2PO6B 3I3EA 4PJDE 1GOGA 1I7TB 3V4PL 4LCWD 3FQTA 12E8H 4D0CA 3WNPA 3HZMB 4LVHB 3P4NB 4CNIA 2VO5A 5D9SB 4R7DB 5F21B 43CAB 1QFWH 1D5ZA 2XTJD 4OQTH 3GUTB 15C8H 1OF2B 3NACH 4F57L 2EDQA 1EFXD 4PG9B 1UG9A 3EO9H 5LBSL 2VABA 4JKPH 1LQSR 2DJUA 3NAAH 3QO0B 1YDPA 4EN3C 4WHDA 3T4AA 4JN2B 4BH8B 1NDGA 3KPPB 4YFDB 1C5CH 2DYPD 3NCBB 3VA2C 4JHAH 4GAGH 5GQBA 1KLGB 3HE6A 3HCVB 5DC0A 2FX7H 5D7JA 3IJHB 5JHLH 2C7UA 1TVHB 2I07A 4XBEL 3KPRA 4PB0H 5F9DC 2ATPA 1CE6B 4FQCH 2GJ6E 5EOQL 1BZ7B 3CUPB 4JDZA 1FNFA 4XAWH 5FUOL 2DIAA 1J0KA 3MBEB 3U7AA 3UYPA 4JFOA 2P7TB 5BS0D 2ILLA 3SKOB 2YD3A 1ZKAA 1A21A 3G04A 2YUZA 3PQYA 4YXKL 2DYPA 1G9NC 3EOTH 1UQSB 3KS0H 3HI6H 3L5WB 1YY8A 1CGWA 3LSOB 4UILL 4NQXA 2NW3B 3B2UC 5CKAA 1KEGL 5E2VL 1A6ZB 3MREB 2SEBA 3O41B 4HK0A 3REVA 3PWLA 4HJGB 3WSQH 3LN9A 3TT1H 2VDNH 1QR1B 4KDVA 4HGMA 1TVBA 2NX5E 5FGCE 2O5ZL 4RSVA 3ARFB 4YC2C 4N90D 1FSKC 1MRFH 4XP4L 5EBLA 5I75B 3LZFL 1Y6KR 1RJZA 1MCOH 3V9FA 2WQ8A 5B21A 2E9IA 4UV7L 2PN5A 5I1HL 3QUZA 5GHWH 1CK0H 5D70L 5TH2A 2DDQL 2RHEA 2P8MA 4G8GB 5EZIL 4Y19B 1YEEL 3ESVF 4KKLC 4LF3A 1X5GA 2DMKA 5E4IA 3OKEA 5DUBA 1A1OA 3ILQD 1NLDL 4JM2D 5DYOB 2ARJB 3BUYB 3G6JE 3K1KC 1HHJB 3PHOB 4MLSA 3QEUA 5SWZA 1OWWA 2VR5A 1FZMA 1L7TL 1EZVY 3GSUB 4ENEC 1AE6L 2X6MA 2BSSB 3U79A 1AGDB 3BP4A 4YDIL 5IW6A 1YN7B 5DD1H 3T1FA 2VLKA 4JAMB 4JQVC 2Q87A 1H5BC 3WFCL 2Z31B 4H26B 4R4FL 1OGTB 4X98A 4ELMF 3RWDA 4LLVB 1INEH 3O6MH 4OD3H 4RZCA 3UPRA 3H9YA 1NAMB 2JB6A 5D5MA 1T4KB 4JG1L 4HC1L 3HC4L 4NRZA 4TUKL 3T2NH 1PSKH 5ICYA 2HFGL 4O2FB 2AXJA 1XF2A 5H35B 3PL6B 1T03H 2APTA 2VR4A 5EZJA 1OWRM 1OAZH 2IQ9H 3MOBH 2PKDA 5I66B 1IEBB 5KSAC 3QIWC 5IV2B 2ZKHL 3LCYA 4FG6D 3EO0B 1AIFA 2HN7B 1F4XH 3BO8B 2R2HA 3DETC 5EU6B 2FCBA 5IHUH 3T0ED 3M1BB 1UXWB 4OFYD 3N0PB 5CP3H 5I0DA 4GKZA 4PJHA 2Q86A 4HQQH 4IMLA 4MNGA 1HHHA 4JHBA 1FVDB 3HG1B 5F70A 4N68A 5DJ0A 2EDLA