1HIMH

Structural evidence for induced fit as a mechanism for antibody-antigen recognition
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
217
structure length
217
Chain Sequence
b'DIVMTQSPSSLTVTAGEKVTMSCTSSQSLFNSGKQKNYLTWYQQKPGQPPKVLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCQNDYSNPLTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 50
structure length 217
sequence length 217
chains with identical sequence J
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himH01
5DC4B 4DUXA 3SQOL 5ID1B 4HWUA 4JAMB 4TPRH 4XPAL 1AP2A 2HKHH 2R2HA 3LRHA 4HS8H 1TXKA 3Q1SL 1NCCL 1KJ3H 3CC5B 4OCRL 1EEQA 3KLAA 4XMPH 2OBGA 4DOHE 2E7LC 5EUOB 3KPLB 2RIKA 4HWEH 1IEAB 1QA9A 3O4LE 4QHUB 5DGQA 4RMQA 1PVHA 5DZOA 4NQED 2F19H 3MNWA 4QXGL 4F33A 5HDLA 3PF2A 2DDQH 4BH8B 3I2CL 4D8PA 2DJSA 3CFCH 2JK5A 4MQXD 3D0VA 2PYFB 1WAAE 4NZJA 3VWKD 4HWNA 2HYMA 2IAMC 1IM9B 1E4WH 3VJ6B 3MRLB 4V2CB 1CR9H 4LK4A 3QG7H 5HHOA 3ARGC 4L4JA 5C0CD 4PRHA 3S8WA 3UTTA 3STLB 1A7RH 3MRMB 3BT2L 4CVXA 1T20B 3D1MC 4KK6D 3JWOL 3UJTH 3V95A 4G6FB 1MNUH 3O4OB 1YZZA 1T5XB 5LCVL 4Y5YC 4DZBB 2C3WA 1ZTXH 3PUCA 3TJEH 4UQ3A 1LQSR 4N8VB 4QRQA 5TF0A 3GM0A 4NO3B 3TO4C 4HT1L 2PYEB 3Q3GA 2D4DA 2ICWB 2YD4A 1ZV5A 3FT4A 4X6CF 5C7XH 4OLXH 5K59F 4DWHA 5GS3A 1YEHH 4H88L 3KPRD 3KDMB 4UINL 4XVSL 2HT3D 2AABL 2NY4D 2QADC 4OGZA 5C86A 1AC0A 2EYTB 2NNAA 3VDBA 3RTQD 2IBZY 3BP4B 3THMH 3U2SA 3H2WA 5D72H 1UWXH 3STBA 3WFEL 3W2DL 5MHSE 5I9QC 3X12B 1S5IH 2NY6C 1U3HD 3WLBB 4WY7L 3T0EB 4Y2DD 4LNRA 5HJ3A 4GG6F 5DEZA 1QQDB 1ZT7B 3VE0B 4QHKI 4PGEB 5DD1H 3VGDA 5DMJB 4FQLL 3UPAA 4PJCB 5I6XC 3IETA 4HKJA 1JYXA 1DTUA 2FH8A 2AI0L 1RUKL 1JPGA 2EE6A 4XZUB 2E9IA 4R0LA 1FNGB 4K7FA 1YQVL 2I07A 1ZANL 2DLFH 4GLRH 3TIDA 2P24B 5DRWB 2F9BT 2Z31B 4P99A 1F3DJ 3PDOB 5EPMA 5LVEA 2A9MH 1KPRB 1O7SA 3QEGH 1ZAGA 3JTTA 4PGDB 1DUZB 4W6WB 3QI9C 5GGRA 1LDSA 3K74B 3FHAA 4FQCL 5MEPA 5C0CB 2ZCHH 3WIHH 1IGTB 2LAGB 3IDGB 1G7PB 3IXTA 4KAQH 4LPVA 4KGJA 1LVEA 5CWSB 2X7LB 2H32H 4JLRA 1XF3A 3Q6FA 5DRZA 5BW7C 1RJLB 3U4BH 2WAHA 2CMRL 4PRIB 1UB5A 4JANA 1F5WA 2E9WA 4U3XA 5IOPA 3F7QA 4LAQH 4GRWF 5CIPB 5I8OL 3EOBA 1XMWA 3OJVC 4DN4H 4GS7B 2DMBA 2J8UE 4NRXB 2NW2A 3JTSA 4OQTL 3V6OC 5CGYD 1MFDH 4XMKL 1XGQA 2BMKB 3FO1A 4OF0A 3OKKB 3FB5A 2NX5A 1U8LB 4R7DA 1FH5H 2B1AH 2XPGA 2X4OA 3OPZH 4HFUL 1B90A 4NHCL 4LDEB 3RTQB 2M26A 4TNWK 2MHAB 2NYYD 3TZVA 1U8MA 1BWMA 4KDWA 1CFVH 4KZEL 4GRWH 4WHYG 2H32B 2P8PA 4OD1H 3NZ8A 4HIXH 1S7TA 3MLRH 3BD5A 4Z76A 4G8EA 4X7EC 4FQ1H 4JHWL 1S9YB 5T1MA 4RMSA 35C8L 4PY7B 5T3ZD 4M7LT 4GO6B 4WUKH 5FKPA 4UDTB 1I8LC 1DBKH 2V7HB 2G60H 5E8PB 1F2QA 5GISL 1EJOH 1E4XI 5FYKU 2LVEA 1AGFB 2FD6H 5CJXC 4EN3C 4Y5VA 3C5JB 3UO1H 1OCWL 1FV1A 3NCMA 4GAJL 4YFLI 1HNGA 3G6DL 3MCKA 1GH7A 4M1GL 2AQ3A 5KTEH 1J87A 1BFOA 1I7RB 4GAGL 3QUML 4PV9A 1FRGL 4U3CA 5KVDH 3ESUF 4PJEA 5HDOA 4WU5A 1XCQA 3QUXB 4YDKL 5DD6A 5GGQH 5J9PB 2XKNB 1ZSDB 1MI5D 2EIZA 2IH3B 3FN0H 4HLJA 4YO0B 3V4VL 2VABA 1R24A 5EFIA 3ROLB 3G6JB 5KAQF 1PSKH 3FAWA 3MJ8B 3RVWD 3VXRE 1QBBA 2WINB 4O5LL 1OAZL 5E7BA 5BS0A 5FYJD 4ETQB 3DOSA 1QRNE 4XCFL 2HT4C 4KTEL 3NA9H 4NQDA 4R3SA 5IIEA 1JNNH 3HPJB 4AMKL 2LFGA 1OGAD 3RAJH 4FZ8L 4IM8A 3PWNB 4MB5A 3LVEA 2V6HA 4JFED 4QTIL 2P44B 3P40A 4PRDA 5FFLA 3QULB 1F8TL 3MRNA 5KANG 3UTPD 4PBVC 2HRPL 4NT6B 5C6WH 5L8JB 2Q7YA 3TO2A 4NN7B 5E2UL 3D69A 5IR1B 3LS5H 3IDMA 1F00I 1NAMH 2R1XB 4JG0H 3TH2T 2C5DC 5IEHA 2VITA 1Z5LB 1XIWA 1JGDA 3KHQA 3H6JA 1Q9LA 1LK2A 3QO1B 1QFUH 1NEZG 5JR1L 5IJKC 1IAKA 4MZ3A 4JRYD 5EU7C 1OAUH 3OKOA 3MRFA 1J0JA 3FB8B 5C0JB 4QHLA 4GAFB 2E9JA 4MNGA 4YBLC 5C09A 5HGHB 2BXYA 2E7HA 2FL5A 2ZUTA 2DJUA 1J0KA 3SGJC 1MUJA 4P57B 5TDNA 4Q6IB 4E41A 2BXZA 43CAA 4BKLA 4OKVB 2BJML 3WNKA 4LCYB 4LVOB 5J3HC 5FECB 4MA1C 3KPMB 5GRVK 1VFMA 5KVFH 3AC0A 2PW2B 4G9FA 4HS3B 3AROA 4LLDB 4X8XA 1UADC 4DKFL 2HJFA 2WQ8A 1MCHA 4IRSA 1S9KC 4OM1H 3LPGA 3T3PF 3LPWA 2PNDA 4ZUTA 4U1KB 3KGRA 3TC9A 4X7SH 1A6ZB 3KPPB 3PNWB 4UAOC 5EOTA 1N5YH 2OZ4A 4X9IA 2W38A 4P23A 2AXFA 1H5BC 4OZHE 3ZKXB 4S2SA 3ES6A 3WXWH 3HE7A 3LKSA 3BH9B 4H0GA 1WK0A 3MOQA 2FX8H 2DQCH 3PP3K 5EU5B 2X4NB 2AJUL 4JFEB 3FFCD 2W91A 3BPNC 2IANE 5FEBA 1DQLH 2PW1A 4RNRA 5CEZL 5D5MB 2YHGA 1CLYL 4KJYA 1F42A 1YEDB 3WIIH 4QRRD 1NC2B 2HVJB 4X80L 3MOBH 4MVBC 3U4EB 4IOFD 2ADFH 3TYGH 4WTZA 4ZUWB 4DK3A 3ARVA 3BHBA 3ARFA 1NCTA 5BCAA 2D7PA 3CX2A 4R4FL 1I8KA 3RY6C 3MQIA 4J3OC 4NKOB 4FQJH 3OBAA 2J1KA 4LSPL 4URTB 5JTWA 1CE6B 1G7QA 3WN5A 2H2PC 1HH9B 2FIRT 2OP4H 5A2KH 4TRPL 2ICEA 4PJ8D 4H1LB 2AK4A 2NTFA 1QVOA 2EDHA 2NQCA 5CS7A 5I71C 3MXWL 5DJ8A 2P5WA 2AJZB 5EU6A 3WL9B 5D9SA 1TENA 1H3VA 4QGTA 5TQ2H 1H3PH 5DUBA 4APQD 1T1ZB 3DV6A 3S88H 2RCSH 3EYSL 5F3HB 5D93C 3RUGF 4K71C 1NUNB 3V0VB 3ZDXE 3SE3C 1TJGH 3GSNH 3L9RA 3W11D 4FABH 2BSSA 1I3RB 5CCKL 1JRHL 1KB5H 1PY9A 3GMPB 2A9NH 4O2FB 4GKSB 2XWJA 3ZL4H 4CVZB 2P7TB 3L3OB 1LD9B 1TCRA 2VLRB 1YY8A 2DJ4A 4RGND 3HB3D 1AJ7L 3HKFA 5IBTL 5GJTL 3CSGA 1WBYB 3CLEH 2J4WL 3BQUA 1DN0B 3EYOB 2D9CA 4KRPC 3FFCB 4QWWC 3H7LA 5CZVL 1AO7A 3KPSB 1LO2L 1LWRA 4YIQA 1CXFA 3QFJA 1IAIL 4OZGE 3BWUC 1U8IA 3SDAD 3KR3H 4OM0H 4IIQB 1HKLH 2Q8BL 4OLYH 1NSNL 3GSNB 4LLYA 4P2QA 4WFED 2FGZA 2P46B 2YUXA 1AQDA 4AT6B 3V5KA 1KB5B 4N5EC 5FYKL 4ZQKA 1CGYA 1WWWX 2CKBB 3O0RH 1QR1B 1IC7H 1UM5H 2F54B 1N7ML 5KSVA 1WSST 2IC2A 4KKLC 1EHXA 2H8PB 4YDJA 1WBXB 1KNOB 4NWUL 2ARJQ 4Y0GA 3L5JA 4JHZA 1ZA6B 4DQOL 4Z77A 5A43C 1Q0YH 2YZ8A 2PO6A 3WFHB 3C60D 2Z92B 3L5XL 4EI5C 4I13B 1EA9C 2B4CC 4MQSB 3MLZL 4JM2C 4PS4L 1U8OB 2QR0B 2BK8A 4Y16D 1W2KT 5KSAB 3CFEB 3SDDA 3GIVB 4JJ5B 4M7LL 4NNXB 4EOWH 4APQB 1FVCA 4XPBH 1MCNA 3JUZA 4LEOA 1VGEH 1EMTL 3C8KA 3GUTB 1CF8H 3CCHB 1K6QL 2B0SL 4JO4H 1Y6KR 3CAFA 4OD3H 4X7TB 4FXGB 1CD8A 5AUMB 2G5BB 1EEYA 3B43A 2E27H 4YHOL 5L6YH 3LN4A 2QBWA 3QIWA 3ARTA 1SM3H 5DFVD 1UQSA 3U30B 1NANI 3MV8A 1GSMA 2DS4A 5ETUA 3CVIH 1JI2A 3DGGB 1I9RL 4LDLB 5HHMD 2DBJA 3TVMD 5M94B 3MYJA 1T2XA 4UTAL 5L2JA 4MD5B 1A6TB 3DI3B 32C2B 5I1LA 3EZ8A 3MGTB 4P3DB 2IFFL 3EJYC 2PTTA 2VE6B 4NUJA 2VN7A 1NFIA 2PXYA 4C4KT 3MLSH 3AY4A 5T1KD 2NY1B 3GIZL 3BEVA 4XH2B 5L7XL 1XR9B 1MFBH 1J8HA 3TM6A 5ID0A 5DVOA 3GSUB 3GMMB 2A83A 4UU9B 1DLHB 4Y4KB 4E0RA 5BVJA 4OTXL 3U9UA 2DWEA 4J8RA 3SJVD 4N5UA 5DLMH 2R8SL 4WHTB 2HLFD 2VLKA 4M61A 5F70A 3ULUE 3MRKA 2BNRE 2PR4L 3EO1B 5BXFB 4C4KO 3F62A 3MCLL 3MC0A 1V3MA 1TVBA 4XP4H 4CN1A 5DVMA 3GMQA 2E7LA 4K3GA 1EVUA 4KKBC 4TOYL 1INQA 3PHQA 2V7NB 2C1PA 5AAWA 2V2XA 5E5RB 4HPYL 3C5ZD 1MFCL 1NLDL 1TITA 4YR6B 4QXWA 4K3EL 5DMIL 4PJ5E 2HVKB 5FUZH 3HNSL 3VFRB 3HUJB 4X7FC 4EDWH 3SKNA 3VD5A 5D7IB 1D6EB 2I24N 3HG1D 2UWEF 1L7TH 2JELL 3VXPB 1RURL 1UM6H 4JHBA 4GXUN 3O4OC 3EYQC 3ILPA 1FZKA 3MRRB 3GKWL 3ARGA 1Y18A 4HMEA 5SWZA 4F9LC 5JLZB 5GSRB 1GPOH 3WFCH 1NGYA 3SY0B 3TVMB 5FOJA 3IDJA 4KJWC 3DRQB 1A21A 4ERSL 1UYWL 3C5SB 4ZO6A 2FIKB 1F4XL 1GGYA 3MLXL 3K8LA 4QF1B 4HUMB 1U3ZA 3SPVA 5GGSA 1U8HB 5D2NB 6CGTA 1G9NL 5C8JB 1I3GH 2HFGH 4W81A 4Y1AB 2NXZD 5F1SA 1I1YB 5HHOE 4PRHE 1AHWA 3IF1B 4RSVA 2VXQH 1JYWA 4M6AA 3FQRB 1QBAA 3L3DA 1KLFA 1JWUB 4U1MA 4O9HL 2EYSA 2VH5H 2Y4SA 2DBLH 3SJVB 4OZ4B 2D31B 4M5ZH 5GS1C 4EBQH 1AFVL 2DQHH 1F4AA 2I60L 3M07A 3GSOA 1FAIH 2APVA 3AUVA 4R4BA 3MODL 1MJ7L 4OJFL 2XZZA 5D7LD 2QLVB 3WFBL 5FYLH 4Z7NF 1MLBB 1U8QB 2EECA 2CJUH 2JCCA 3LHPL 2UWEB 3OZ9L 1ITCA 1XZ0A 3B3IA 4MQXC 2CDGA 4QY8B 4JFQA 5EO1A 3VWKC 4I8DA 1RZKH 3MNZA 5B21A 4AL8L 2YRPA 4RWYH 3C5ZB 5D2LA 5DXWA 1WWBX 4NCC2 4WUUA 1L9NA 2EH8H 4Y5XC 2OJEB 2KQMA 3QFDA 3VFVA 5FOBB 3MACL 2N56A 5I75C 3QEQA 4D9QD 1Z3GH 4OB5L 1UACH 5BZWA 4WHYH 4N0RA 4KK6C 2VDMH 5JPMB 2BCKA 1SY6H 4HIEA 5FHBL 4JFOB 2OK0H 1MCBA 5ILTL 3QNYB 4OLVH 4GQ9L 4R26H 4K9EL 3TT3L 3QI9A 4ZO9A 1LO5A 1FL6B 3CFKA 5D70H 3V9FA 4L3AA 2BRRH 1YC8A 1YYLL 3D39D 1RMFL 1BZ7A 2Y6SD 3QEHB 5JW4M 3PWLA 4GS7C 4EI6B 1QEWA 4NGHH 2X4SB 5DDHB 4F7EA 4Q2ZA 1RU9L 2HT3C 4LARL 5FKAA 3GHEH 1F6AA 5BW7A 2VLJE 2NY4C 1NH6A 5HVWA 4JFPB 4PREA 3S96B 3VXMD 3RTQC 3VFGH 3C9NB 5D71H 5E4EC 1B2WH 2AJXH 4PJIB 1CGTA 3CU1A 4OBSA 4EVNB 1TPXC 1U3HC 3PWJB 4E9LA 1X4ZA 1MQKL 1I4FA 4Y2DC 2C4XA 3V6OA 1VESA 1KEMH 4M02A 2HN7A 4U1SB 3VFUA 4HHAB 2YPLD 2DKMA 5EA0H 4HC1H 3L3HB 4UILH 3BN9D 4I0PB 1FFQA 3F5WA 2IG2H 1EHLH 1I7UA 1F45A 4OF7A 4KDVA 5K9QG 1C8PA 5B38A 4M3KB 3OKDB 4JQVC 3EHBD 3Q5YA 4L4VD 4FZEL 3IT8D 5E8NB 1A6PA 1JV5A 4DKEL 2DQGH 3QZWB 3I75A 5E5UB 1I8LA 3RNQA 1TZHB 2X42A 1P4IL 5CJXA 1D5IL 3RWHB 4PRPB 3PGFL 4M6NL 3RBSA 4L29B 1M71B 1RK1A 1F3DH 4ZPVB 1JE6A 3W0WD 2VL4A 4ZXBB 2Z35B 3VXSD 5EOCL 3BKCH 4JR9H 3H9SD 5F1NB 4IMLB 5DO2D 4WFFE 3MGOA 4MAUH 2VISB 1DR9A 3PJSB 4YX2L 4A2MA 2F53A 5JOFA 2ZOKA 1OPGH 4HZLB 2OR9L 2EE2A 3IFNL 2W65B 5H2BB 2AEPH 5CGYC 1RHHA 1U8PB 4QYOA 1IQDB 5C2UB 2NXYB 1BGXL 4M7JL 2X70B 3QCTL 5HGAB 1ZK9A 4QEGA 3LKPB 3V4PL 2BFVH 2NYYC 5DQJA 1QFPA 5E8OA 3GBML 2V2WA 3C09C 3TCLB 4RFNB 2BSRB 3NGBC 4ZUSB 5CHNB 3QB7C 3BPOB 2BHZA 1WCBB 4L8CB 2GJ6E 5BS0E 1HIML 4NQXB 5JDSB 3V5HA 5E6IB 1GHFL 2X4UA 1A9BB 1KCVH 1SJEA 2JIXD 3O6LH 3H9HA 4E42A 4ZFOB 2VAAA 3T0BA 5AG8A 5HXMA 4LIQH 5ACLA 3VWJD 3JV6A 1V7NH 3BKMH 5F88A 1LK3L 3BP5B 4P59H 2XTJD 5DHVH 2A77L 2R1YA 4DGIH 3O2WH 4UUJB 3MTRA 5IJKA 3S3JA 5D7KE 4LF3B 4YGVB 4XT1C 2AERT 5TDPA 4NNPH 1EBAA 3GSQA 3IDNB 4L9LA 4LKXA 2IPKA 3MX0A 4GMSH 3NFNB 1YMHB 4HV8A 2FLBT 4RGOH 5I1GL 3HC0A 1MFEL 1MAJA 4P5TA 3S4SA 5E4IA 1YNTA 3FHQA 3P9WB 5LGHH 3RVWC 4MCZB 1BOGB 2O5XH 4RAHA 3H9SB 5F3BA 1WVZA 4G7VL 2DYPB 4PP1D 3UZVB 1FC2D 1MY5A 1W0VB 2DMKA 4MNGE 5IFHL 3DXAD 5DHVB 1EAPA 1JHLL 2W60A 4NJAL 5A16A 1QD0A 3ULVD 1JI1A 1EO8L 5ALBH 1WT5C 4CJ1A 5CFHA 3L3GA 3N1PC 3QUYD 4E41E 4XRCB 2R69L 3MLTA 4NKQB 1IKFH 3B2UD 1Q8MA 1H5BA 5MERA 1BBDH 5T3XD 2FNBA 5DD0H 1KXQE 2D7MA 2ZJSH 3Q6GH 3GBNL 1CFSA 4G9DA 5TQ0H 3P4OB 4NSKB 2DAVA 3P4NB 2J6EH 3DWTA 5KVEH 2ATPB 3WNMA 1I1RA 1ZLWK 2I9LA 3P9LB 3ULVF 5GIRB 4XVUD 2HP4A 4S1RH 1YN7A 2XICA 1HI6A 2PF6A 2CGRH 2YK1H 3O6KL 3SDYL 2BP3A 4BQBA 1HHIA 1HOCA 5FO7A 3G5ZA 1A6UL 1BVKA 5BRZA 3WYRA 4JPVL 2CIKB 2VZVA 4RFOL 3RIAF 1WJ3A 3PHOB 5HYJB 2BERA 2VAJA 3RY6A 5J6GA 3QPXL 2IALA 2GY7B 4N1EA 4TVPH 3RVXC 1MF2H 3CUPA 3VWJB 1U3YA 4U6VH 2PTUA 2ZUUA 1KN2L 2RFXA 3NAAL 2XTJB 2IADB 5F9OH 3BGMB 3HNVL 3ULVH 4G8GA 3CVHA 1JHKL 3PP4H 5CGMA 4PGCA 2AVGA 3SBWA 3R8QA 2DQJL 4I9WD 5DTFB 3PWPA 1A7QH 4FXKA 4Y8DC 3O3AB 5T3XH 1KIRB 4EIGB 2V2TB 3S6CA 2VDQL 1NCAH 4N1CA 1A47A 4NO0D 3IFLL 1UWGL 2C3VA 4PJXB 4DFIA 1LP9B 4WI7A 4P46D 1S7SA 2DMCA 1A7NL 4OSUL 4BZ2H 3NBNA 3MRHB 5JHDA 2JTDA 3S36X 5I73B 2WK2A 5JZ7D 1RZJH 3VFPA 2P5WE 2NCMA 5EU6E 5TF1L 1FBIL 1DL7H 1MCPL 3BGFB 5I8EA 5L9DH 1AXIB 3SE9L 3HI6L 4JO1L 1BIIA 3DXAB 3I6KB 2A2QT 4S0SD 1SMAA 1D9KD 2Q76B 4P2OB 5IFAH 3BKYL 1E6OL 4EEEA 4O4YL 4UT6H 4P2RB 4ODXA 1QO3B 4IOFC 3WKMH 3KLHD 4XCEA 2BVYA 4JFHE 4A6YA 5CP3A 4HKXA 1K3IA 4FFVD 4I3GA 4L4TA 1UWEH 3T3MF 1HHKA 1OSPH 2K7QA 5DJXA 1OW0C 3TPUB 1OSZB 4EIZC 1MREL 4PJ9D 2QL1A 3TYFA 3HR5B 4QOKB 2O61B 4H5SB 4PJHF 2M2DA 4LSVH 2V17L 5D4QA 2ILLA 4GMTH 2MPAH 5BO1H 3L3KA 3MRIA 3TA3D 3DARA 1AE6L 1AGCA 4Y4HB 3SCMD 2AP2A 3OX8A 1M7IB 1MFAH 3QFJE 1T80A 1F58L 4OCYL 1I8MA 2YD9A 5E70A 4APQC 4TQEH 4HKZB 2WQRA 2R0LH 4U6YA 4ZD3L 4O02H 1DBML 5F7DA 5SX4I 1UKQA 5ELIA 1FNLA 2ERJB 1DBJL 3G6AB 4JM2A 4DOHB 3W11C 4KMQA 3X3FL 3TH3T 5IMKA 1CD1A 3A6CH 4CMHC 3QISA 3UJIL 5JQ6H 1NBYB 2P8MB 4KK5D 4M7ZC 4BK5A 4S11A 4LSUL 1JZ7A 4P46B 5IB5B 4AQ1B 3ARRA 5DMKA 4YC2C 1MLCA 3ZMRA 4RGNC 1PYWB 4U1HA 3KLDA 5J89A 3HB3C 2R23A 2AJYL 5GRWA 3E3QE 1MQ8A 4GG8B 1LO0H 1D5ZB 3PWUA 4C83B 4LLMA 3G04B 2ZKHL 5I66B 4IOIA 2NY1C 5KSUA 3MREB 3P0YH 4Y8AA 4RFEB 1TQBC 1X4YA 3HZKA 1YY9D 2ESVD 3GI9H 5JNYB 4ZTOL 1SJHA 1QSEA 1NGZB 4PJHB 3SDAC 4OGYH 5E2WL 3O6FD 4XXDB 2R4SL 1FFRA 2I5YH 1OF2B 3LY6A 2ZOLB 4CDGC 4CVUA 3EGSB 4BSJA 3DHJA 5HVHB 3U46B 1T1XB 4DVBA 3CNKA 1C7SA 4XAWL 5E9DD 5IW3A 2GCYB 3ZE2F 3C60C 3GEWB 2G5RA 2O26U 1N0XH 5IW6A 4IRZL 2JB6B 4LLVA 3GJEA 1MCSA 3TA3B 5HYIA 4NHUB 4JFFA 2KUTA 4UT9H 4WDIA 1FYTA 4HJ0D 5SX4H 5L2KA 3QQ4B 3D85B 2YWZA 1QKZL 5ESQB 2XWTA 1E4JA 1QACA 3VD7A 5KW9L 4X5WA 4KROB 3WLWD 1KPVB 3C2SA 4OLZL 1OARH 4WENB 1CFTB 5I8CA 5DVKA 4R2GB 3EYUH 3B8SA 3GO1L 5D1QA 2OX5A 2VLKE 4RZCB 3FT3B 3X13B 4B50A 4LSQH 5DFVC 3GSXB 3WNOA 1OP5K 3UX9B 2DQTL 3OR7B 3TFKC 2HG5B 5IV2B 3U36A 1G0XA 1PLGH 5JUEH 1JBJA 1KCKA 3TVMC 1QSFB 5CEYB 2XZCL 4LHQB 1A1MB 5CZKA 1N0LA 3JV0A 1HILB 3LD8B 3CSYB 4G7YL 1T22B 4OV5B 2ZUYA 1DFBH 5I1IH 5JHLL 3VGHA 3FQUA 1D5BA 2FYYA 4YHNA 2FCBA 2EDTA 2A6IA 1DQQB 3EFFB 5C0GA 4F9LA 2OR8A 2IFGA 1UCBL 4HUXB 4LHJB 4PRAB 2PYEA 5HHVH 3L3JA 1PG7H 4FTVA 5IP4A 4GOSA 4BYHA 3MLWH 1PX3A 5ANMA 4S0TD 5EN2B 3STZB 1OAYH 2R2CA 2QHRH 4X7CC 2HLFC 4ZNEA 1X3DA 5IBUB 3QDJA 4HWZB 1RZGB 5EC1A 1FN4A 4D9LH 1QNZH 1OY3B 3B8YA 2J8UB 4AEIH 2C7UB 1NLBH 3UYRH 4LPTA 3U1SL 4OT1L 1DDHB 3ALXA 5GS1A 5HHNB 2EDQA 1X5IA 2ENSA 1ADQH 1KPUA 2NLJA 4ZDHA 4NQEA 4ONHA 3C5ZC 4OFPA 5ICYB 2ATKB 4G3YL 1OAQH 1MCEA 1V05A 3EYFB 3NIGE 4PUBH 2VDRL 4CRPA 4XNXH 1T2QL 1VACA 1WFUA 3NFPA 3N1FC 2WWKT 4X4XB 3VWKA 1WUNT 1K9TA 4CW1B 3DRTA 5KSBF 4QHNB 2ZSVA 5EBMB 3BVNB 1VFAA 3R06B 1V8HA 1DN2A 3LSOA 4Y5XA 1U93A 5C0CA 2EDDA 4X6CA 3VRIB 2JCCE 3SO3C 1EFXD 1E4KC 1I9JH 4RX4D 4WFHE 3FTGA 3TBTA 3UMTA 4QRPD 1JNLH 4PV8A 4TTGA 1DSFL 2CRYA 4LVEA 5D2LE 5GRJL 2E7CA 4WUUE 4GBXD 2NXZC 4F58H 4UIMB 4F57L 1M05B 3QEQE 1XR8B 1IC4L 2LVCA 5CINH 3MUGA 4ODWA 4GG6A 3ZT6A 4P5KA 4YDLB 2Q86B 5CJQH 4HIHA 1FO0H 4FOMA 3KPRA 4JCMA 2BNUB 1HHHB 1NAKL 2ZUVA 2HLAB 3F12A 2CQVA 1QRNB 3WIHA 5FAAA 1P1ZA 4IHOA 1IBGL 3FCTA 2WUBL 3QSKB 2MJWA 1WGOA 4HGKC 2GTWB 1GGIL 3SQOH 1U3HA 3VG9C 4A6YL 4XPAH 4Y2DA 5JO5A 2NY3B 3PXHA 1YNKL 3Q1SH 1NCCH 4OCRH 2UV3A 3L6FB 5EO9A 4D0BA 1SEBB 3WDHA 1CCZA 4JRWA 3U82B 4Y4FB 2R56L 4Z7QE 5C0FB 3IYLW 2LTQB 4WNQB 2I9TA 2Z4QA 3ZE0F 5EZJA 4JQVA 4QXGH 3IVKB 1FO0B 2X4TB 4XBGB 1MIML 4ELME 4Y19D 3V6OE 4LASL 4MQ7B 3I2CH 2J88L 5E2TL 5E99L 2X10A 3AXLA 3ZSTA 1NUDA 2R0KL 2CLRB 2VJXA 3IU3A 3D87B 4F8QA 1QG3A 2FJHB 4HULB 1T3FA 1MH5A 1C5CL 1TVHA 2G9HB 3RNKA 5A2JH 3FONB 2IH3A 2D7OA 4AENB 2Y6SC 1EFXB 2IMNA 3NIDF 1MCKA 3BT2H 3PDDA 3RPIB 3JWOH 4ORGB 4BK4A 5HGDB 1QFOA 4KK8D 1CTOA 5LCVH 3BZDA 3ZO0A 4GBXB 1UC6A 5SV4A 2ARJA 3IKKA 1INDL 1XF1A 4GKZA 4GW4B 4JO2L 4HT1H 5JIKA 5HVGB 2ED8A 4GKOA 5HHQB 4H88H 3MRDA 4KMTL 1NL0L 1YNLL 3S7GA 4OFIA 4UINH 4XVSH 4M48L 2AABH 1VFBA 4NO5B 4OZHB 5F21B 3BN9C 2F53E 4XC1L 1P84K 2DQFB 4YAQA 4JHAL 1NCDL 3I02A 3WFEH 3QP3A 4UOJA 3EHBC 3T4YB 1CBVL 1G1CA 4L8BA 2GSGA 4WY7H 3H3KA 4BJLA 2IANB 3MR9B 5IVXF 3U7WL 4P4RB 4ENED 5JXAL 3SGKC 4P4KB 1WTLA 2VZ1A 3MPCA 2ADIB 4FQLH 4M43L 5MEOB 4YZFE 4RRPA 5FGSA 4IS6B 4FQXB 2AI0H 5DK3A 1RUKH 2WIIA 3OKEB 4QT5B 3OGCA 1AGEB 5HGHA 3M17A 1YQVH 3PL6D 5D8JH 3UBXG 3AGVA 1ZANH 2FX7L 3MJGX 4U2YA 2FO1A 1B0RB 2NZ9D 3MJ7B 4V1DB 3TBWB 1I3VA 1BAFL 2UUDH 3PDGA 2L7JA 3LN9A 4UBDD 4XMLL 5EOCJ 1XAUA 5CD5D 5DO2C 4JDTL 4HX1B 1NGXB 1O0VA 1NAMA 4ZYKB 4NNYB 1U3JA 3VFNA 5DEFB 1YMME 4FQCH 3WS3B 2AJ3A 4RDQG 1MI5A 1OP3H 3I6LE 3DX7B 1HQRA 4RAUB 5D7JB 3U0PA 2ZG2A 2A0LD 3CH8A 5EU7E 1ZLUK 1QPXA 5CUSL 2B2XL 5INCB 1KG0A 1HHJB 4YDVB 3GK8L 1OGAA 3BH9A 3RKDD 1KC5L 1N6VA 2WP3T 4YPJA 2CMRH 2DM7A 1IEHA 1WT5A 2Y07L 5I8OH 5E1HB 2CRIA 1NFDF 3QUZB 4YWGL 5LXGL 4EUPG 1XF5B 2AEQL 1CQKA 4I0CC 4YHZL 4OQTH 2YA2A 4FHBD 2VLMD 4MXQD 1JGUL 4XMKH 3GI8L 2AXGA 1DVFD 3DNKA 4ZUWA 3TBSA 2YD2A 4LKCB 2FEEI 5E95B 2UYLB 4HFUH 4NHCH 1DBAL 5FYJU 1W72B 2Y25A 1VHPA 4J3UA 4ZSOB 1X4XA 3VWJC 5LG1A 4J4PD 2OLDA 3BP6A 3WUWA 4KZEH 4P48A 2XTJC 1CE6A 1FZMA 2GITA 2ED7A 2WP3O 1UB6B 4JRYA 3ISWA 2BDNL 1N5AA 4MJ6B 1UZ8B 35C8H 1T7VA 4S1SL 1IGJA 4ZS6D 4KPHL 3HMWL 2VIRB 5GISH 2NY2B 3KPQA 4G42B 1OCWH 2V5MA 1YEKL 5HI4D 1UKSA 3A67L 1LEKB 4GAJH 3G6DH 4M1GH 2FZ3A 1X5KA 4FQIL 5BRZE 3F7PC 1QPPA 3U9PL 1VADA 3QWOA 4PP1C 4GAGH 3QUMH 3QIBB 1FRGH 1A14L 4G6KH 4UNUA 3BGFC 3V5DA 5KJRH 2QKIA 4X0KB 4MJ4A 4RMVA 3ULVC 1NFDB 4MNQD 4P2OC 3V4VH 4Z7VA 4R97B 3FQTB 2XA3A 4G8GE 3QUYC 4WW2F 5GRVL 4O5LH 4LEXL 3B2UC 3BIBX 1OAZH 2HH0L 3PV7A 5DJDB 2YUVA 4XCFH 4KTEH 1U8JB 1L7IL 2CLVB 2HA1A 3OAYK 3X3GL 4AMKH 5IG7B 2P47B 3CZFB 4FZ8H 1VA9A 2W0FB 4HGWB 5FXCH 1UXWB 3DBXB 1PQZA 1IVLA 3Q48A 2OMNA 4QTIH 3EDDA 4XVUC 1NC4B 1KN4L 2P45B 4JJHA 5JHDE 1JZ4A 4QRRA 2X1OA 3MV01 1RZJC 1F8TH 3QUMB 1KGCD 1FGVL 2HRPH 1DVFB 4Z0XB 4DGYL 4MAYB 4PBWD 4PJDF 5E2UH 3AREB 2G2RA 3D0LA 3VGFA 5FM5O 3EOAA 3MV9B 2X4RA 1F13A 5JORB 4RISL 4ZTPL 1OW0A 1AIFB 2XYCA 3LV3B 4DTGL 1MIEL 5C07E 3MGAA 2EXWD 4PLOB 5C0BB 3RUGA 4PJ8A 5JR1H 4F7MA 5JXED 1ED3B 4G80B 2ERJC 4F7PA 1KB9K 4J3WA 3WFDL 4L4TE 4KFZC 1BQHB 1K5NA 2A73A 4PJAE 2X41A 3FOMA 4HFWB 3MLUL 3VXQB 1JHTB 3EFDL 4P46C 4Z78A 3FOLA 1BQLL 4P0DA 3ZTJG 3HTLX 2OM5A 2SEBA 2J5LC 2BJMH 5EULV 4ODTL 4IOSD 1DQML 5JZ7C 3I9GL 4C55A 3RP1A 1S7UB 3WMSA 3CXDH 4Q9QL 1QLRA 3VXUD 4WTWA 3V7AE 2MQ0A 4LCIL 4DKFH 3KXFA 2GFBB 1D9KC 1FNFA 3NA4A 5EC2A 4U7KA 1IEBA 1AP2B 3L1OL 4CU7A 3KLAB 4O51A 1BFVL 3KLHC 1MHPL 4JPIA 4AEEA 2MKLC 1QA9B 1JPTH 1BLNA 4FFVC 2AJUH 5K9OA 3MNWB 5HVHC 2CK0L 4F33B 2I26N 4ZOEA 5CEZH 4PJ9C 3SDAA 1P53A 5IMOA 5SX5H 1CLYH 3VMPA 4D8PB 3QRGL 5CMAA 4X80H 5EZLA 2JK5B 3D0VB 4PJBF 4KKNA 4GXVL 3MRQA 4CN4A 4MA8L 4R4FH 3TA3C 1Y0LA 3O8XD 2Q6WA 3SCMC 5HHOB 1QYGL 3KNBA 3D2UD 1KJVA 4PRHB 2UY7A 4LSPH 1QFWL 3UTTB 4HJJH 5C0AD 5EWIL 4BQ9A 3C60A 4CVXB 4TRPH 4K8RD 1FNEA 3CMOL 1PJ9A 1C1EL 3MXWH 1CD9B 2XA8L 5BOPA 4Y16A 4LMQE 2XZQL 4KK5C 4QRQB 3WXVL 3P9MA 3Q3GB 1T21A 3QQNA 1PGRB 3FT4B 1T7YA 3EJZD 5J11C 1GAFL 3EYSH 5FYKD 5F1IA 3O3UN 1JK8A 4LPCA 3OL2A 1FNAA 2NNAB 4JFFE 2XG5A 5L2KE 5CCKH 3GDBA 3U7YL 3U2SB 2CO7B 1YY9C 1JPFA 1JJUA 2WNGA 4PY8I 5CP7A 4LNRB 5HJ3B 3O6FC 2B5IB 5F9DC 1EDQA 5ACZA 5IBTH 5F96H 4LPXA 2J4WH 5FYJL 3IETB 2A6JA 4HKJB 5T1KA 2EZ0D 1JPGB 4R0LB 2AQ2A 5CZVH 4K7FB 4P2CG 3RX8A 3K2UL 1LO2H 1RULL 4GRLA 2BRQA 2I07B 3TIDB 2F58L 5KG9A 2Q8BH 1B4JL 1NSNH 5EPMB 1KIQA 2FHBA 2IJ0C 3JTTB 5FYKH 3N9GL 2CDEA 5C0RH 3O8XB 4HJ0C 5GGRB 5AYUL 2PYEE 5MEPB 2DWDB 1N7MH 2Y06L 5F7EL 5JOEA 3O2VL 5IQ9A 2VTFA 2UWEA 4FTVE 3IXTB 4JG1L 2QSCL 5DJ2B 3PV6A 4NWUH 4GKNA 4MJID 1PZUB 1DEEA 2Z0BA 3HZYA 4DQOH 5ANME 1OT1A 3L5XH 4AIOA 3ZTNH 3MLZH 1SQ2N 3PIQA 4JLRB 4NQDD 1XF3B 3Q6FB 4N0FA 5DRZB 3AVEA 2NPLX 2B8OT 1P5VA 3ARPA 1UB5B 4JANB 1ORQA 1RAMA 5IOPB 4QRSB 4M7LH 5JIPA 4Q9CA 3EOBB 4J12A 3HG1A 1CFQA 1EMTH 1T4KB 2NW2B 3JTSB 4LRIC 4UOW1 1K6QH 2B0SH 2VUYA 3BIAX 1IC5L 5I17A 1XGQB 1J86A 3AS0A 3FO1B 4PJCE 3H3PL 3QAZC 3FB5B 2NX5B 4R7DB 1A3LL 3BSZL 3C08L 4YHOH 4YUEL 4BZYA 2XPGB 2X4OB 3MJ9A 4JFZL 3TZVB 1U8MB 1LEGA 3QXAA 4FFYL 1E4KA 4DGVL 1T6VN 1GRWA 3DVGA 4YDLC 4QKXB 2P8PB 4UTAH 3NZ8B 5H35B 3MOAL 1S7TB 2LABA 4Z76B 2IFFH 4G8EB 3JSSA 5T1MB 3L95A 2VDPL 5GGUB 5FKPB 3S96A 4ZFZA 3CJJA 3GFUA 4LVHC 5C0CE 1Z9OA 1DBBL 1YQ2A 5F7LB 4NO2A 4X6CE 5L7XH 4JE4B 4Y5VB 4BFGA 5K59E 5ESVA 3BGAA 4I5BA 2AW2A 4FMFA 4HXBL 4ZO8A 1FV1B 1SY6A 1XF2A 2Q20A 3HPLA 4OTXH 2AJSL 3MCKB 2YRLA 3MFGB 4M4RA 4NBYB 1BFOB 3DJ9A 3MUHL 5DK0A 4PV9B 1V3KA 4HCRL 1P4BL 2R8SH 4PJGF 4G9FD 2LTQC 4PJEB 1WFTA 1XEDA 4WU5B 5D7LA 1XCQB 4TNVF 4X98A 5DD6B 1N2RA 4XPHL 4GG6E 1BOYA 4NC0B 1ZGLB 2PR4H 2EIZB 5EDXA 3B9DA 2VABB 1G6RA 1E28A 1R24B 5EFIB 2XRAL 3KPRE 5F9JA 3CSBA 3MCLH 2EIDA 4Z0BL 4PB0L 4OF5A 4TOYH 5BS0B 4R3SB 4NQDB 5SX5K 3SKOA 5IIEB 3E2HB 3P4MA 2ZPKL 4HPYH 4YHPA 2KBGA 1UVQA 1MFCH 1NLDH 3O41A 5FGBA 2YWYA 4K3EH 2VR5A 3KAAA 3HNSH 5LJYH 4PRDB 4HC1A 5LGJA 3KVQA 1RURH 3MRNB 1ROWA 2Q7YB 3TV3L 1CGXA 1FFOA 3TO2B 5HDBF 2EEBA 4GBXC 3LQAC 3D69B 1J7VR 3GKWH 3IDMB 3IAQA 3D39A 4RDQF 4NOBA 2VITB 1XIWB 1JGDB 3M1BA 1IAIM 4WWID 1T0NA 1Q9LB 1LK2B 1UYWH 4ERSH 3S35X 1F4XH 3INUL 3MLXH 1IAKB 4BELD 3IRZA 3OKOB 3MRFB 3QRFM 2AK4D 1KLGA 3VXMA 3P30H 4GRWE 1G9NH 3JWDL 2GYSA 4QHLB 4M6OL 5I19L 2D0FA 4MNGB 5C09B 2KL6A 2FL5B 5LAXA 5I0DA 2E6QA 1J05A 3JWOC 1MUJB 1NEZA 4CDHA 5TDNB 3LAFA 2UVEA 4E41B 2YPLA 1CE1L 3MBXL 4O9HH 3U7AA 3ZYJA 43CAB 4BKLB 3MNVA 3DIFA 1IZKA 1S5HA 5K33A 1AFVH 4G9FB 2I60H 3F6IA 3V4UL 2DKSA 1J9CT 1PX4A 2HJFB 1EUTA 1MJ7H 4OJFH 4IRSB 4L4VA 5F9WB 3WFBH 4XP1L 2VMFA 1NFKA 3LHPH 1P4LA 3OMZA 4ZUTB 3OZ9H 4XX1E 1TQCB 4EUPH 3BEWA 5EOTB 3IDNA 4P23B 2AXFB 4RBPH 5GRUL 5DD5L 2XY2A 4S2SB 6FABL 3ES6B 1XGYL 1YECL 4AL8H 3RX7A 5B8CB 4YBHA 3LKSB 4U1JA 3ILQD 1P7HL 3DV4A 3LZFL 3GSRA 3MACH 3JVGC 5D7JC 2DD8L 1LHZA 2PW1B 4OB5H 3W0WA 2Y9RT 4KJYB 3VXSA 1ZGLM 1XGUA 5T3ZE 4IDLA 3FL7A 3C8HA 4OD2A 1YEJL 4P2QD 5FHBH 1KYOJ 1IGIL 5ILTH 4KK8C 4GQ9H 4K9EH 3TT3H 3MXVH 3ARFB 4HEME 4I48A 1I8KB 1YYLH 4XI5D 5JW5A 1HSBA 4ONGL 3K1KC 1RMFH 3OJDB 2YA1A 4DEPC 2PTVA 1G7QB 3WN5B 4HF5L 4BA8A 1QFHA 5GS0H 5DVNA 5CILL 1RU9H 2ICEB 4LARH 4HEPG 5AWNH 2AK4B 2NTFB 1QVOB 2KQNA 5DJ8B 2P5WB 4HUKB 4FG6D 1MI5E 5D9SB 4OF8A 5C08D 3RIFF 4PRNB 4GH7B 3V8OA 1X5HA 1MQKH 1KT2A 5DUBB 5FYJE 1QHOA 3DV6B 1A6AA 4ENEC 3O3EA 1TETL 2JIXA 3LCYA 4MNHA 1OGAE 4XWGH 1CL7I 3L9RB 4JEGB 4XNQA 4Y2OA 4JFEE 4WFGD 3LKQA 3UC0L 2W0PA 2BSSB 3PL6C 1EGJA 5FCUL 4OIAA 1I7TA 2VDNL 4FZEH 1KULA 2F5BL 1Q1JL 2BC4A 4JO3L 2NZ9C 2XWJB 4DKEH 3W9DA 1YY8B 2C3XA 4YXHH 4UBDC 4AEHL 3RWIA 2J6EA 4XB8A 5CD5C 1LILA 4GRMA 4BUHA 3KYKL 4XHJD 3BO8A 3BQUB 2PXYD 1P4IH 1D5IH 4QXTA 3PGFH 4M6NH 4UV4L 1AO7B 2E7MA 1EEZA 3S97C 1TIUA 4R97C 3QFJB 1CDGA 2A0LC 1U8IB 3JUYA 4JRYE 1P9MC 4PG2C 4KTDL 5EOCH 4LLYB 4YHKL 4P2QB 4AIZA 1BQUA 1AQDB 5HYSG 3RKDC 1T7ZA 3V5KB 1LNUA 3RWJA 5A40E 3BRFA 4ZQKB 3UTZA 3T3PE 3EO0A 5KSVB 3QUYA 1RIHL 2OR9H 1OLZA 4YHLL 3IFNH 5EORL 3HAEG 4H20L 2Y23A 1AD9B 1T04A 4MXQC 4JZOA 3S34L 1RZIA 2X4QA 4I3RL 4Z77B 4X6FA 1DVFC 2PO6B 4TNVK 2UZYB 3QCUL 1BGXH 5I1CL 4M7JH 4OV6F 3V4PH 1AKJD 4KVCL 1JGLH 4J4PC 1VEMA 5JW4R 3SDDB 3MMEA 3HR5A 1FVCB 4F15C 3KLSA 4LEOB 3C8KB 2MNUA 1HIMH 2DI9A 1PW3A 1GHFH 1A3RL 3QPQD 4DK6A 2GAZA 1EEYB 3ET9F 4ZS6C 2AS5M 5DK2A 3FFCE 1FIEA 1RJZA 2A1WH 3GB7B 3LN4B 3QIWB 5JW3L 1UQSB 3MV8B 5DT1L 4FFZL 5ETUB 5C0DA 1G6VK 4C56A 1LK3H 5HI4C 3TGXA 4QRRE 3NABL 4KUCD 2A77H 3MYJB 4JQIL 3QQ9D 5L2JB 1N6QL 4R8WL 5I1LB 2FRGP 2W9LA 1G6RL 1ZXQA 5DJAA 1ND0A 2FWOB 5K9KA 5BZDA 4K55A 4NKDA 2PTTB 2EC8A 1E6JL 2HT2D 1IJ9A 4KRLB 4NUJB 3UROR 1NFIB 2PXYB 2F54E 1MFEH 1GGUA 4KHTL 4NO0A 3BEVB 1H3GA 1IARB 1J8HB 3BW9A 3T08A 5ID0B 3RUGE 2A83B 4KUCF 4E0RB 5BVJB 4QNPE 3SKMA 5IQ7L 5DUML 3U9UB 4XAKD 4G7VH 2DWEB 4J8RB 5IFHH 3MREA 2VLKB 1D9KA 4XPTH 4M61B 1JHLH 3CGTA 1AR1D 5MP6L 1EO8H 4XCNA 2FBOJ 1BIHA 3MRKB 4PJHA 2HMID 4LCUA 2R69H 1I9EA 1MHCA 3BOVA 4Q0XL 3T77A 1TVBB 3O6ML 3GMQB 3GBNH 5E1AA 1GCFA 3ULSA 2AGJH 1INQB 3PHQB 4ACPA 2C1PB 2V2XB 3VD9A 3CU7A 1CWVA 4U33A 3AB0C 1BP3B 1TJIL 1CGSL 3HC3L 4OCSH 3U46A 4PJ9A 1ORSA 3VD4A 2BOCB 1YEGL 2XQBL 2RJMA 4RGNE 1L4IA 3RZCD 3T1WA 2EXWC 1NKOA 3SKNB 2OSLA 1XT5A 3O6KH 3SDYH 5HDQL 5JXEC 1ETZA 1A6UH 4M9OA 4JPVH 1BJMA 4RFOH 3TA3A 4PJ7F 3QPXH 3SCMA 3ILPB 1ES0A 1FZKB 1K4DA 3ARGB 1Y18B 5ESQA 5E2VL 5SWZB 1KN2H 3NAAH 5T1LD 3HNVH 4G43A 1GIGH 1M7DA 3IDJB 3BKJL 4WFEE 1X5XA 2DQJH 5SWSD 4RA3A 3IU4L 4L9DA 2ZCKL 4HSQA 4BUGA 2J2ZA 3SPVB 5GGSB 2VDQH 1YA5A 1EV2E 1AHWB 3IFLH 1UWGH 1L6XA 4OSUH 1A7NH 3L3DB 1EXUA 1LO4L 1VEPA 2B5IC 4U1MB 5GQBA 2EYSB 3H9ZA 3RIFK 1T22A 1LE5A 3ARWA 2QADB 5TF1H 1ZHBA 1FBIH 1MCPH 1MELA 4W4OC 3SE9H 1DQQA 1WLHA 3ARDD 3HI6H 3GSOB 3NZHH 2ESVA 4R4BB 4HUXA 5I9QB 5GRZA 1PKQA 4OZFG 3BE1L 4L1HA 3BKYH 1E6OH 4O4YH 3VFWA 1QBML 2JCCB 3O6FA 1XZ0B 3B3IB 1S9WB 1MCFA 2CDGB 3VGEA 3HZVA 4JFQB 2FHCA 5EO1B 5EN2A 1INEL 1A3QA 3I3EA 2A6DA 4AG4L 3KG5A 3K4ZA 3MNZB 5HGBA 1WZ1L 3O8XC 2Z8SA 4WUUB 1J10A 5HHME 1PD6A 2C26A 3QFDB 3VFVB 1CVSC 3QEQB 5B39G 2P42B 1X5JA 1MREH 4OFDA 1HNFA 1ACYL 5E9DA 5BZWB 5FGRA 1C5BL 4TULL 5HHNA 2V17H 2BCKB 3C8DA 4HIEB 2HFEA 5EO0A 5ICYA 3QI9B 1AE6H 1G9EA 1LO5B 3CFKB 1NGPL 4ZFGL 1F58H 4OCYH 4X6DA 1BZ7B 4MS8D 3ZKSD 3QCVL 1EGJL 4KI1A 1GYAA 3PWLB 3EJZC 5FO8A 1P7QD 1QEWB 3SJVE 4X4XA 4F7EB 2WUCL 1DBJH 4Q2ZB 2CPCA 4CW1A 1F6AB 3RU8L 3AU1A 1K8IA 5GZOD 3X3FH 3IDUA 4TUOA 2FGWL 3UJIH 4U7SA 2UWEE 4LSUH 1OTTD 1Z0MA 2EEAA 1I4FB 4LRIA 4LLAA 4S1QL 3TNNA 2AJYH 2HN7B 3VFUB 1Q72L 3V8CA 2ZKHH 3R1GL 3F5WB 3GSWA 3ARDB 1I7UB 2EZ0C 1GZPA 4CL7A 3K80A 4ZTOH 1R3HA 5H37G 3HG1E 3TCXA 3B2VL 1YDPA 5MEQA 4A2LA 1JZ2A 5E2WH 4XHQA 1JV5B 1AXTL 4U7MA 2R4SH 1U41A 3TT1L 2YKLH 3RNQB 3W81A 1WBZA 5D1XD 5IHZA 2GTWA 3WEXA 3HI5H 4H8WL 4P5TD 3T4AA 2ITDA 5TGBA 2GHWB 5EIVA 3IDIA 1RK1B 2D9QB 2ZCLL 4KI5D 3MLYL 5EH1A 5KSBA 4UTBL 4PYHA 4JKLA 4IRZH 3MGOB 4N90D 5IB2B 4Q7DA 1MCRA 4HMCA 2F53B 5JOFB 2YPVL 2QEJA 1KJMA 1QKZH 2ZOKB 1CDBA 1RJCA 5KW9H 4OLZH 1TMCB 1WWAX 3ALWA 4HIIA 4KI5F 4QYOB 1CZ8L 1F02I 3IXAA 4YFDB 3GO1H 5F9AC 2CSPA 1D6VL 3TIEA 4BSWA 2G9HA 3GZKA 5DQJB 5E8OB 2I27N 2DQTH 2V2WB 4XCYA 1DE4A 3HS0A 1EFXA 3AS2A 4RX4A 2XZCH 1H3WM 4RQQA 1HCVA 4QRPA 2OTWA 3V5HB 2X4UB 3ZDXF 1JFQL 3OXSA 1A7PL 1SJEB 1ZVHA 2OS7A 3H9HB 4E42B 5JHLH 4CU8A 4GBXA 2Y1VA 2VAAB 4LSSL 4C58B 4D9QE 3JV6B 4HBCL 4HK3N 5F88B 4X5XA 3RVTD 3N1GC 1OM3L 2R1YB 2R0ZL 5GGVY 4I18C 5TDPB 5CBEA 3GSQB 4LKXB 4L9LB 2BVTA 3V0WL 4N1HB 3S5LG 4OGXL 2RQ8A 5DF0A 3PWPD 2DLTA 4HV8B 5T5NF 3D39E 3MBEA 4YBLB 1L0QA 3NCFB 3HC0B 4P5TB 3QHFL 3S4SB 3GMLA 4PB9L 4OZGF 1YNTB 3RZWA 1YYML 1OD7A 1FL5B 2WLYA 3ARSA 1ZMYA 3U1SH 4OT1H 1TVDA 1G9NC 3EDJA 4MA1B 5F3BB 3DVNA 4ODSL 1MRCL 2FECI 3MZGB 5B8CC 3PG2A 1MHEA 4G3YH 3OGOE 2KKQA 1EAPB 5A16B 4Y19A 3TLRA 2VDRH 3CDYA 3L3GB 2ORBL 1WZMA 1T2QH 2YPLE 4UAOB 4H26A 3MLTB 3WHXA 1H5BB 5MERB 4BFIB 3SGDI 1CFSB 4ZYKA 3CZJA 1MHHA 4G9DB 5FDWA 3FAXA 3ARFC 2Z93A 5MEND 2JJVA 4L4VE 3JVGA 3BWAA 5JDJA 1H9VA 2BHUA 2I9LB 3BPNB 4OIIH 4DZ8A 1UENA 3JV4A 5DI8A 2DN7A 5AD0A 1HI6B 1A0QL 5INCA 1YEEL 2F74A 1BVLA 1HHIB 1HOCB 5FO7B 1HHJA 3G5ZB 1BVKB 1DSFH 5BRZB 3QG7L 4HXAL 5GRJH 2XG4A 5J6GB 2IALB 4F57H 1I1AD 2VLLA 3CUPB 4QTHB 1IC4H 2NR6D 4NN5B 2RFXB 5IVXA 1KEGL 3W0WE 3VXSE 4G8GB 3H9SE 3CVHB 5F7UA 4PGCB 4LIQE 1NAKH 4K9EC 2H1PL 3TJEL 2B20A 3T0DA 2JJUA 3PWPB 4FXKB 1IBGH 1TTUA 4RA0C 1T03L 1CGUA 2EDOA 5C9JA 1UJ3C 2BNRD 1U8KB 1GGIH 2YBRA 4A6YH 1IGML 2C3VB 4HIJA 2Q3AA 1YNKH 1S7SB 2D7TL 5JHDB 4K71B 3VFPB 2R56H 3SKJL 4LMQI 3BISA 1QLEL 3QJFA 3CH1A 1FG9C 4WI3A 5I8EB 3ILQC 4Y7MA 3PL6A 1BIIB 2LQRA 4AY0A 4PJ5D 4M8VA 1MIMH 3AM8A 4LASH 3KJ6L 4NQCD 2J88H 5E2TH 5E99H 4ODXB 5C70A 5HYJE 4XCEB 5D7SH 1M6OA 3RKPA 1CXEA 4A6YB 3VFTA 2GT9A 4KRPB 4CUCA 2FR4A 4HKXB 1C5CH 5ESAA 4L4TB 2VZSA 4GW1A 4MLIA 4XI5C 3I3DA 1HHKB 2XTJE 3OTTA 2AK1L 3UTOA 4WCYL 4HDIA 5FIEA 1S7QA 5DJXB 5DSCA 2JB5L 3TYFB 1P9MA 4PG2A 1A64A 2X09A 4U0QB 3MRPA 4M1DL 4KVNL 4YDIL 4NM4L 3L3KB 2W0FA 3MRIB 1ZLVH 4FG6C 1YJDL 5F6HJ 1AGCB 1INDH 1NBVL 3QWRA 3VA2C 4TYUA 4JO2H 2BOBA 1VEOA 3OX8B 1AGDA 4D0CA 1I8MB 1YN6A 4HJGB 3MLVL 2XACC 4U6YB 1Q9OA 3SO5A 3VMOA 5F8RC 4BM7A 2UZIL 1DVFA 1NL0H 1YNLH 4KMTH 4Q6YA 3L5IA 4XP9L 5F7DB 1ZHKA 4O58L 4JB9L 4M48H 1GXEA 4DW2H 4JM2B 3DXAE 4LL9A 3ULVE 5IMKB 1CD1B 4J4PA 4JHAH 4J7RA 1HDMA 1NCDH 1BBJA 3MUJA 1CBVH 4BFBD 5T3XE 2DIJA 1DLFL 5DMKB 3U7WH 1MLCB 2EE3A 4U1HB 2R29H 2R23B 2BY0A 4M43H 3WIFA 3PWUB 3DSNA 4NIKB 4LLMB 4AM0A 4XHJC 3FB6B 4PJFF 3MYZA 2HTLD 5HPMA 5FF6A 2PXYC 4IOIB 4YQXL 5BJTA 5KSUB 1RUML 2GQHA 3HZKB 4WW2A 3T0AA 3MRCA 2FX7H 4QOKE 1SJHB 1QSEB 4WTXA 1S9XA 1BAFH 1K8DA 1SVZA 4AH2A 4XMLH 1ZA3A 5DS8A 1IAOA 5I15L 4JDTH 4X8JA 5JW4N 3L5WA 2BNQA 3FQXB 4PGZA 1GOGA 4MNQA 2VZ3A 5GGVL 3QDJD 4Z6AT 5KTEL 1NMAL 4GT7A 2YN3A 4UDUA 4DVBB 4I9WE 4PJDA 1J11A 2B2XH 1A22B 3HE6D 3GK8H 5IW6B 1KC5H 3SDCD 4LLVB 2R2EA 3GJEB 4JY4A 3N85H 1RY7B 2XXMB 3VRLF 4JFFB 4WDIB 1FYTB 5CBAA 2Y07H 5L2KB 5B4MD 2VXSL 3LQAL 1UG9A 2XWTB 1OTSC 4YWGH 5LXGH 2AEQH 3NA9L 4YHZH 4X5WB 4QRTA 4NQSA 1JGUH 3GI8H 2IF7A 4WI9A 5I8CB 4GLRI 5D6DC 4PJFB 3T3ME 3D6GA 5D1QB 5C71A 1DBAH 5K93A 5SWQA 1F3JA 3TNMA 2IH1A 2P43B 1LO3L 4PJHE 3LB6D 3U36B 3QQ9C 4K3HA 2CO6B 4XCCL 5JXEA 1KSRA 4OLWL 1IKNC 1X7QA 4P5MA 2BDNH 4F7TA 4PLNC 5DD3L 4GSDL 4S1SH 1S3KL 1LE9A 2HT2C 3HMWH 4KPHH 3FQUB 1D5BB 2FYYB 4MD4A 4YHNB 3UZEA 3BN3B 2A6IB 2XQYG 5C0GB 3O3DA 1AHWC 1E4XL 2EIBA 4XNMA 1AI1L 1YEKH 4ZODA 3A67H 1HHGA 3L3JB 1OAUL 2B1HL 2HAZA 4N9GA 4OBRA 4FTVB 4KKCD 3G5YA 2R2BA 4HQQL 3RWEA 3U9PH 5ANMB 1U2HA 4HWBA 4X9FA 1A14H 3QDMD 5E00A 5B3NA 3RJDA 3VXUA 1WF5A 3OSKA 2FJGA 3VXOA 1JPST 8FABA 1AR1C 3OKLA 3QDJB 1OQOA 1K4CA 8CGTA 1H8SA 1WISA 3WBDA 1C16A 5EC1B 1KTKE 1FN4B 4LEXH 2HH0H 4LFHG 4PJBA 3BP7A 2K9UA 3DETD 1L7IH 5F7WC 3O9WD 3OWEA 3X3GH 4W4OA 5GS1B 1T7XA 3VCLA 1UXSA 1KPUB 1YEFL 5HY9A 2NLJB 4ZDHB 3DX9A 4NQEB 4ONHB 5FA4A 4HBQA 1MJUH 1SYVA 1QSFE 2VKXA 1KN4H 1P7KA 3IJHA 1A9EA 3RZCC 1MAKA 1GOFA 1T1YA 3RWFA 5DHXB 1VACB 3DO3A 1FGVH 1S7XA 3NFPB 4K3DH 3PP3H 4DGYH 4R96B 2DQCL 3VWKB 1T83C 3DRTB 2DQEL 2VL5A 4WO4D 4PLJD 5J56B 2ZSVB 2ESVE 3O8XA 5KOVC 3G08A 1VFAB 3LSOB 4Y5XB 1KYOK 1U93B 2DWDA 1PKQE 3D2UA 3WIIL 5C6TL 4RISH 4ZTPH 5I75B 3S37H 1CICD 4D94A 4X6CB 5C0AA 4DTGH 5DJ2A 1MIEH 1ZLVK 4LLUA 5H37H 4POZD 3FTGB 4RIRA 3TBTB 2Z8VC 1TLKA 5EZIL 2PCPB 4PV8B 4K7PX 3WFDH 3UP1A 5IUSA 4K2UL 1ONQA 4QRSA 3MLUH 1MRFH 3EFDH 1FORL 3MUGB 4ODWB 5E9DE 5EBWA 4GG6B 1T4KA 4P5KB 1BQLH 2PKDA 2EYRB 4HIHB 3KPRB 4ODTH 1DQMH 2X89D 2NY4B 3I9GH 4U4BA 3F12B 1P1ZB 4IHOB 4Q9QH 2BSTA 3ARDC 3FCTB 4O2EA 4LCIH 5E4EB 4U0RC 5ADPL 4BFEA 1TPXB 1U3HB 4LCCB 5I16A 2E6JA 2RCSL 3L1OH 4Y2DB 1CXHA 5JO5B 5H35A 1TZGL 3ZHKA 1TJGL 2PUQT 5EO9B 4D0BB 4OFYD 1C12A 3OG6B 1FHGA 4UNTA 5GGUA 4R7NA 3UPCA 4XPGL 2CKBL 2I9TB 2Z4QB 1HSAA 5EZJB 3QHZL 2CK0H 4Z7UA 4OLUL 1O5DT 2VDLL 3TF7C 3H42L 3QRGH 1MCDA 5CJOL 4NCC1 4NRZA 4AJ0A 4S10A 3RWGA 3AXLB 4MA3A 1IGFL 2ITCA 4MA8H 5IBLD 1C7TA 4ZG1A 3IU3B 1EZVX 4GRWB 1T3FB 2H45A 1JTTA 1MH5B 1TVHB 1QYGH 3RNKB 3ARBD 1ZGLA 1HKLL 1QFWH 4WVRA 1W8OA 1XGPA 4MS8C 2HJKA 1EO5A 4MJIA 3RL2A 2CLZA 4OQ1A 3DX8B 3QDGA 1IFHL 3CMOH 3RY5A 5GZOC 4NBZB 4JFDD 2XA8H 4L3ED 3DO7A 5T3ZH 3PABA 2AV7A 1JYNA 2XZQH 2ARJB 4GKZB 1OTTC 3WXVH 4CAGA 4M1CD 5KSBE 1GAFH 1JZ5A 3MRDB 3IKCA 4Y89A 1FL3A 4D0DA 2B7DT 1VFBB 2HFTA 2GI7A 3RGVD 3K0WA 1FAKT 1UZ6F 3U7YH 4YAQB 3I02B 3C09B 5T33L 2CRZA 3O11A 2VQ1B 3CFJA 3NGBB 3UZQA 4L8BB 2GSGB 1G7MA 3CK0L 5L0QC 3PGDA 1NCWL 3T2PA 3CLFH 4KQ4L 5ERWA 2LU3A 3QXDA 4L9LC 2QQKL 4PJGA 1Q0XL 3DSFL 5FYJH 3EDEA 4XNUL 5D1XC 3H0TA 2WIIB 1R0AL 3OGCB 3M17B 1IM3A 1RULH 4P5TC 1QHPA 4ZS7L 1F4WL 2GKIA 2WBJA 4O00A 5DRXA 2UVFA 1MRDL 4I18A 4QRPE 3B9KD 4KI5C 5LBSL 1B4JH 4ODUA 3OAZK 1AY1L 1FVDA 5KBNC 2K1MA 3U0WL 1NAMB 3NN8A 3ECBA 4WHDA 1T89A 1S7VA 3N9GH 5KS9F 1CD0A 5HI3D 3UBXA 3VFNB 2R4RL 5AYUH 2AJ3B 4F3FA 1KCUL 1MI5B 2Y06H 5F7EH 5BMFL 3O2VH 1HQRB 4FQ2L 3U0PB 4JG1H 1EFQA 2QSCH 3S37X 1UGNA 3DTXA 3IFPA 1KG0B 3ZE0E 5B8CA 1OGAB 2O5YL 4P9HL 3QO0A 2Y5TA 4I4WA 5ITBL 4L5FL 4FN0A 3TBVA 4EXKA 3A6OA 4Z7VF 1A1OA 3WO3B 1XGRB 3FQWA 4TSAH 1T5WA 1JGEA 2AXGB 3H3PH 3TBSB 4M9PA 3VG0L 1A3LH 5CEXA 3BSZH 3C08H 4YUEH 3NCYP 4ZMAT 4EDWL 4JFZH 4HWBL 4OFVA 5EUKA 3NIDE 4FFYH 4ODHL 4EUPA 3OJDA 3BP6B 4NN5C 4J3TA 3WUWB 3RVTC 4V1DE 4DGVH 4Z7OF 3DUUA 2AV1A 4UQ2A 1FZMB 2GITB 5DA4A 3MOAH 1JPSL 3BH8B 4JRYB 3SBWC 1N5AB 7CGTA 5CJBA 5C0IA 2VDPH 4LAJH 1IGJB 3RQ3A 1A1NA 3K4DA 1DBBH 4PRNA 4CJ0A 2GSIA 3KPQB 5IMLA 1LGVA 1QFWM 4HXBH 5DJYA 5BOZG 4ETYA 5INDA 4CMMA 2AJSH 3WO4B 2FZ3B 4KHXL 3QIUD 3ARQA 1VADB 2AKRA 3QWOB 4YHYC 5FB8A 1U95A 5E94A 5IT2L 4HCRH 3V5DB 1P4BH 3G5VA 2H6PA 1UJ3A 2QKIB 1Q9KA 3KXFD 1IGYA 5BVPL 4XPHH 5IVXE 3WCYA 4HMDA 4F2MA 1CLOL 3N1MC 3EAKA 4Z7VB 4MZ2A 2XRAH 1B9ZA 4UV7H 3RY4A 3T1FA 4CNIA 1S8DA 4Z0BH 2DQHL 4PB0H 1A7BA 2R1WA 2MSPA 2RB8A 1DUYA 4NC1C 2ZPKH 4ZSOE 1IL1A 1WQVT 1ZWIB 2A38A 1RZ7H 4K8RL 5FYLL 1HINH 2QSVA 4MXVE 4XVJL 1NDGA 1ITBB 2ZP0T 5C0NC 1PQZB 4PTTA 4FQHA 1PAMA 2ICWJ 5GGTL 4NQTA 5BQ7A 1FZJA 4LCWD 3UPRA 3ZKMD 4QRRB 3BX7C 3RVVD 1CK0L 4CBPA 3TV3H 3UYPA 2EH8L 3U6RA 1NJ9A 4OI8A 2IQ9L 2G2RB 5DJZA 3D0LB 2X1QA 4IRJD 1I1AC 1Z3GL 4F7CB 3EOAB 1KTDA 3EIFA 2NR6C 2X4RB 4KMLB 3BPLC 2W59A 4JREB 1LDPH 4K23L 1AD9A 1UT9A 1A6VL 3RUGB 4PJ8B 3INUH 4F7MB 1VKXA 4QXUL 4F7PB 2Q3ZA 1HXMA 3JWDH 3WD5L 1NFDE 2GTZA 4M6OH 5C08A 5I19H 1K5NB 2A73B 3FOMB 5A1AA 1FG2A 2Z8WC 1UFUA 1PEWA 4NRYA 4Z78B 3FOLB 1CE1H 3MBXH 3OAUL 2SEBB 1IRAY 1T66D 3O4LA 5L88L 1P84J 3CMGA 3FO0L 3GB7A 3IDYC 1SMOA 3TO4D 1QLRB 3BXNB 3EKCA 4I3SL 3V4UH 4CMHB 2FEDD 3KXFB 1MY7A 2APTA 3FRPG 3MRBA 3ABZA 4M7ZB 4HUVA 4WGVB 4XP1H 5EC2B 5IF0A 1IEBB 1BD2D 2VLME 4YC2B 3V6BR 1V7MH 4RGNB 1EHLL 4O51B 5GRUH 2FWOA 5DD5H 4XWOD 5GRYA 6FABH 4JPIB 1YECH 1XGYH 2YSSA 2NY6D 3MV9E 3N1QC 2OQJA 3RHWF 1BLNB 3P3YA 1TQBB 3NIGF 3PGCA 3UAJD 5K9OB 3DMMD 3K3QA 4AIXA 4GRLD 2DD8H 5IB1A 5C0BE 3D3VD 3SDAB 5IMOB 1FPTL 4LFHD 1F4HA 5CMAB 5EZLB 2OTUA 3VH8G 5C92A 1EO7A 1IGIH 1OHQA 3W39A 4XXCC 4YXLL 3MRQB 1A5FL 5FM5M 4LQFL 3S36L 1Y0LB 3MA7A 3FN3A 2Q6WB 4BQ8A 3KNBB 1KJVB 1X5YA 4JR9L 1QUNA 2APFA 1Z6JT 5IKCA 4HF5H 1ERNA 5CILH 4JKPH 4YJZL 3C60B 1ZT4A 3UTSD 3U48A 2H2SD 3RDTD 1NDMB 5ICZA 1JWMA 1FNEB 4ZFOL 4LU5L 5D1QC 4ORZC 5D1ZA 1AKJA 1I75A 4Y16B 4JPKL 3DURA 4L8DA 4Q58C 2BOCA 1URLA 3P9MB 1T21B 3M45A 4PJDE 1FGNL 2EDFA 1TETH 1IC1A 5F1IB 2OXHA 3PQYD 3NMEA 5D6DA 1JK8B 1CQYA 4QHKJ 2IPTL 2HTLC 1FC1A 4N8VG 4OCXL 3UC0H 4Z95L 5FCUH 1NQBA 3MFFA 1JPFB 2MQCA 3IJSA 1SJXA 3P2TA 2VDNH 2X5PA 5HHMB 2F5BH 2E3VA 4P49A 1KGCE 1Q1JH 3B9AA 4JO3H 1XCTA 2V9TA 5CP7B 1IKNA 3HZMA 1X5LA 4AEHH 4P2YA 5ACZB 3GHBL 5I1DA 3KYKH 2VZUA 4K07A 3LKOA 2A6JB 1CN4A 3CFBA 4P59L 5T1KB 3NH7L 4NWTL 4DGIL 2AXJA 3UTTE 4OCMC 4UV4H 4ELMF 5ISZD 3SDXF 4GRLB 2DQDL 3QHTC 4OZIF 3D3VB 5EIIA 2X1PA 3T0XA 5F6IC 5KG9B 3H3BC 4KTDH 2ADJA 4YHKH 1KIQB 3HE6C 3DYMA 2PETA 3SDCC 5CEZE 4NM8L 2CDEB 4LSTL 2D3VA 5B4MC 3L7FB 2JF1A 1LMKA 1RIHH 3MJ9H 5IQ9B 4YHLH 5EORH 4H20H 3PV6B 4GKNB 1DEEB 1S9WA 2ADGA 4LRNL 3S34H 2C1OA 3HZYB 4JDZA 4I3RH 3DGCR 3ROOA 3LEVL 3QCUH 4PJ7A 5I1CH 3VXUE 5J06A 3PIQB 4QO1A 4N0FB 3OXRA 4KVCH 5LWYL 2XIDA 1X5FA 3FRUA 1ORQB 4CGTA 5BV7C 4X6EA 3ARUA 4HGMA 3LB6C 1JN6A 4LOUD 1JTPA 3RZCA 2FBJL 3EDFA 3HG1B 1CFQB 2LU4A 3E6FA 5I76A 2F5AL 3F7VA 1QOKA 1OQXA 1A3RH 4WEUD 5I17B 1T83A 1ZLWH 1U6AL 2GJJA 2DM4A 4S1RL 5JW3H 1MOEA 3SE8L 3SDXB 5T1LA 4FFZH 3I50H 1LEGB 3QXAB 1YEIH 3SO3B 3NABH 4J3SA 3DVGB 4KKCC 1KB9J 4JQIH 1N6QH 2YPKA 4R8WH 4KJPD 5SWSA 3RX5A 1G6RH 25C8L 4TVPL 4JQXA 5KZCD 3L95B 1E6JH 1YMMD 3UCRA 3R8BB 4ZFZB 4HUWA 4Z7WF 2NXZB 4KHTH 1RUAL 4ZAKA 2VWEC 3PP4L 4NO2B 2N4IA 5C0AE 3VXRA 2YUZA 4LCCC 5JA9A 5ISZB 1S78D 2FO4B 5ESVB 4I5BB 2DRUA 1XF2B 3HPLB 3EOTL 2EXYD 5IQ7H 3DETC 3GMOA 5DUMH 1NCAL 3QNXA 4F9PC 3O9WC 4UB0L 4LLQA 2C4FT 5DK0B 3T65A 5E8DH 3ARDA 4AZ8A 1F90L 1BFTA 1T0MA 2OL3A 2VDKL 5MP6H 5D7LB 3VG9B 4X98B 4ODVH 1N2RB 3MV7D 4NP4L 3HHRB 1G6RB 1E28B 5F9JB 4HK0A 5FYKE 4Q0XH 5A2FA 5L9DL 1R5WA 3NTCL 3WJJA 2NX5E 3SKOB 3P0VL 4WO4C 4PLJC 2R15A 3GJFK 3P4MB 2Y7QA 4YHPB 1FJ1A 3MCG1 1UVQB 4MSWA 4G6JL 15C8L 3QUKA 2YRZA 1TJIH 1CGSH 3O41B 3HC3H 3MO1A 1ZHLA 1CICC 4MDIA 3EO9L 5HHXL 2XQBH 1YEGH 3EUUA 3HFML 5J1TC 2C4FU 4NZRL 2W92A 3RHWK 5LGJB 4POZC 5HDQH 2XQYK 4JRXD 4YLQT 1FFOB 5IB2A 5D96C 4GAYA 2PN5A 4QHMA 3D39B 5E2VH 3CXHJ 4NYLA 3TH4T 1ZT1B 3BKJH 3M1BB 1P7QA 4GMTL 4YK4C 1T0NB 4PR5A 4HLZG 4U1NA 4FQQA 2VRAA 3IU4H 2XKUA 2ZCKH 1WC7A 3RI5F 1KLGB 2NY5L 4PJEE 1TCMA 3VXMB 43C9A 4Z5RA 4M62L 3KHOA 4O02L 1B0GA 1KLUA 1QTYT 4MJIE 5LAXB 1J05B 2KPNA 1NEZB 1Z9MA 1LO4H 4NKIL 2AEWA 1L0YA 1I1CA 5TFSL 2YPLB 4NQDE 3A6CL 3MNVB 1SVCP 4W68A 3DIFB 1S5HB 3QBTB 5GSVA 4EKXA 4EDXA 4POYA 5I1AA 2HJLA 3D9AL 1R3IH 4C57C 1B6UA 3RL1B 4L4VB 3BE1H 4YEFA 4ISVA 3C6LD 5LGKA 1QBMH 1P4LB 5D6CA 3BEWB 2Y72A 1INEH 2EDLA 3V79C 4AG4H 5D1XA 5IBLC 2YD5A 3OF6D 1GZQA 4RMWA 2YMXL 1WZ1H 2JKXA 4U1JB 1QLFA 3ARBC 3DV4B 4OGYL 3GSRB 5C07D 1HYRC 3I3BA 1FL5A 3Q5TA 1ACYH 2K3TA 4MWFA 1KXTB 3W0WB 3KJ4B 3VXSB 1RIUL 1XGUB 1C5BH 4TULH 4WIQA 4PJGE 4OD2B 3E8UL 1CXLA 1XGTA 2CUIA 3CX5J 3HCVA 5C09E 3QA3A 4I48B 1NGPH 1AXSB 2WIMA 4ZFGH 3KYOA 5JW5B 3JV5A 1HSBB 3QCVH 1EGJH 5EG6C 3SGEH 4JDVA 1TZIA 4M1CC 4N5ED 5DVLA 4PTUA 4BFIA 2WUCH 1MWAL 4G9FE 3RU8H 5F7NC 4J2XA 2FGWH 3RGVC 4PJAF 4ALAL 1MCWW 3ZDYE 5DURD 3W9EA 1V3JA 4EI5D 1KT2B 4H1LG 3B9EA 1U58A 3Q5OA 4S1QH 5HDBE 1A6AB 5H94A 3O3EB 1Q72H 1OP5H 2JIXB 2RBLA 4MNHB 4NDMA 5HD8D 3R1GH 1MPAL 1FVEA 4JY6A 4KDTC 4J3VA 4BH7A 4XNQB 3LKQB 4QTHA 4OZGA 4PPTA 1FSKC 1I7TB 4C56D 3B2VH 5EBLB 4L3CA 3WDIA 2BC4B 2ZUSA 3B9KC 4N68A 3W9DB 3WO4C 4N8PA 1AXTH 1FFPA 3RWIB 5I1EL 1JCKA 4GRMB 2ID5A 1RJYA 2NY0D 3VI4E 5HI3C 3BO8B 1U8KA 3BFOA 4H8WH 4QXTB 1UH4A 1CXKA 1I9IL 5ICXA 1EEZB 3MLWL 2P5ED 4JN2A 2ZCLH 1KUMA 3VI3E 5FV1L 2AK4E 4UTBH 1YPZF 4AIZB 1ZOXA 3T0WA 3R4DA 3VGBA 1LNUB 3RWJB 2DLEA 3UTZB 3BDYL 4D9LL 1QNZL 2YPVH 2UY6A 4FS0A 3O3BA 4B0MM 1NLBL 3GGWA 2R39A 3EO0B 3K8KA 3QUYB 4DJMA 1T04B 4JZOB 1RZIB 2X4QB 1CZ8H 5HYSA 4X6FB 1OAQL 4U6XA 3RRQA 1D6VH 4YE4L 5MENA 2M8XA 3DPBA 4UIKL 3C2AL 3HAEA 3MMEB 5IK3B 1ULVA 2CIIA 4JREC 1D5MA 5HYEA 5EUOF 3DI2B 4B53A 4PJ8C 3P77A 1IM9D 4XBPA 1PBYA 4D9RE 1A7PH 2GAZB 1N6UA 3W5MA 4UT7L 4LSSH 1Z2KA 1I1AA 4WEBL 1RJZB 5DK2B 4LVNB 1AO7E 3WNNA 4HBCH 5HHPA 1P2CA 2OL3L 5C0DB 4HJGA 4C56B 1OM3H 2ZUQC 1GL4B 3REWA 4WRLA 4G6FD 4BQ6A 3T09A 2R0ZH 4P2QE 3EYQD 3C6SA 5A2IH 4ZUVA 4ODBD 3QIUC 3QYCA 2EDNA 5SV3A 5DJAB 1ND0B 4C59B 4OGXH 5K9KB 2NY0B 5E03A 5BZDB 4NKDB 4H0HB 3W82A 4FFWD 2BNRA 4UMGA 1FCCA 4WU7A 5CJQL 2EDRA 4NO0B 1FO0L 3VFOA 3QHFH 4PB9H 1YYMH 3BW9B 3AS3A 3RI5K 1RFDL 5LQBL 1A4KA 3BD4A 2J5LB 3ARZA 1K2DA 3SKMB 3JWDC 3I6GA 3FB6A 3E6HA 1MRCH 4LSDA 4ODSH 5E6ZA 3ZDZF 5C08E 3QG6B 2FATL 3T0ED 4PJ5A 5C3TA 1D9KB 1OT2A 5TDOA 2V5TA 1SEQL 3MUZ1 4XCNB 3QH3A 4WWKA 4F37F 3V6FA 2ORBH 1CTNA 4NQCA 3ZKMC 2JJTC 4LCUB 3RVVC 2H3NA 1MHCB 3VH8B 2G75A 4O2CA 3T77B 1OP9A 5E1AB 3ULSB 4WFGE 2HKFH 3FQXA 4FNLL 1YUHA 3AAZA 1OB1A 3F7YA 3MV8E 4IRJC 2Z31D 2XY1A 1CDIA 1VERA 1CXIA 1J5OL 1DJSA 4PJ9B 1ORSB 3BZFA 2Z91A 3IDXL 1SBSL 2QQLL 1A0QH 2OSLB 4PJCF 1YEEH 1BMGA 4RMRA 1ETZB 4I77H 4NZTL 4XXCA 2DF3A 1L0XA 4HXAH 4Y16C 5K9JL 1KCLA 3H9YA 4PGBA 3SCMB 1ES0B 1K4DB 1J8HE 2DTSA 1CDYA 1EUUA 1KEGH 5FM4A 4I0KA 4G43B 1M7DB 4JFXA 4W6YB 5IB4A 1T66C 2H1PH 4PRID 4PJFA 3RA7L 3FQNA 3K8MA 1T03H 5IVNA 2FEDC 1BX2B 4D3CL 1IGMH 4XB7A 1IGCL 3T04D 1ZHNA 2NMSA 4X6DF 2D7TH 3VDAA 1EXUB 5J11B 1VB9A 5JMOC 5K9QI 4XWOC 1LE5B 2OI9C 3MRJA 5KVGL 3SKJH 1EEUA 1ZHBB 1QLEH 4KZDL 3UAJC 2ESVB 3DMMC 4GRLC 3QNZA 4XPFL 1PKQB 3FO9A 1VENA 3KJ6H 3VFWB 3KWWA 3O6FB 2YXMA 3TN0A 1NBZA 3B9VA 3HZVB 4JVWA 5D8JL 4YPGA 5C1MB 2R0WL 2W07A 4JPWL 3TJHD 1EHNA 3UTQA 2A6DB 1MCCA 4X7DC 2D0GA 5HTSA 5SWZE 3X11A 5FA3A 5HGBB 1Y6MR 4YNYA 4OZFA 5CIPH 1G1YA 1VPOL 2AK1H 1BF2A 2W1NA 4WCYH 3G5XB 2JB5H 4JZJC 5E9DB 4QCIA 3PWVA 1HH6A 2VLJA 3OB0K 2YR3A 3QR2A 4J6RH 2H2SC 3RDTC 3HE6A 3T8XA 3QUXD 2W9DL 4M1DH 1F97A 3SDCA 4KVNH 4YDIH 1BM3L 2HFEB 4NM4H 1W72L 1OOAA 5EO0B 1FLTX 1YJDH 1W8NA 1NBVH 1IZJA 3DLQR 4XP6L 5B39A 1ZLUH 5EZOL 4G6ML 2VR9A 4MMZC 2WBWB 5CD3A 5JQHC 4X6DB 3MLVH 1JMZA 2BY3A 4XAKE 4YXKL 5IJVA 2UZIH 5FO8B 4R96A 1CI5A 4XP9H 4O58H 4JB9H 3VGAC 1D5XA 1KBGL 2JJSC 3AU1B 1K8IB 2LE9A 4TUOB 3TP4A 3G6JF 3HI1A 1GC1L 5GGRY 2CUMA 4W4NA 1NMCB 4H25A 5CLWA 1DLFH 1L9MA 3TNNB 4RMUA 4CADA 4PJ7E 2PCPA 3QAZB 4N8CL 5IEKA 1F11A 4XC3L 4N0UA 3GSWB 1GZPB 4YQXH 1RUMH 2WWKO 2WANA 1R3HB 1OD9A 3PE9A 4LPUA 1TTFA 4NQVA 1JWSA 1YDPB 2EYRA 1N26A 5MEQB 1VDGA 1G7JA 5IESL 1RUPL 2Z9TA 3LH2L 5I15H 3BPCA 3ORJA 3QDMA 1SJVA 3D18A 1I3UA 1ZLSL 4LHUG 1MCIA 4LVHB 1AD0A 1IAMA 1WBZB 1GVIA 3N0PB 5IHZB 3MBED 1OWWA 3OKYA 3WEXB 4LCCA 7FABL 4PBXA 5GGVH 3T4AB 3P0GB 1NMAH 2ITDB 5TGBB 3QZWG 4MD0A 5SWSE 4G6KL 5IW1A 3IDIB 3V6ZA 4E5XA 4HAGA 5KJRL 3CFDA 3O9WA 4M5YL 4F9PA 4LBEA 3ZE1F 5KSBB 4G5ZL 2OJZL 4HLZH 1JMXA 2NW3A 1WCQA 2FJFA 4G6AD 1HQ4B 3BYTA 4PD4K 5DQ9A 3NPSC 5DC9B 4NFBA 1FDLL 3FN9A 2COQA 1VCAA 1KJMB 2VXSH 3LQAH 5FGBC 2GJ6A 4LOUC 3KYMA 3OAYH 1YC7A 4TSCL 4OI9A 4HIIB 1WV7T 4MHHI 2YUWA 4WO4A 3IXAB 4F37K 1D3CA 2D7QA 3TIEB 4BSWB 2FEEL 1PZ5A 4MJ5A 1J18A 3ZKND 1CICA 3ULUL 1HXYA 3QXTA 1LO3H 5DWUL 1NC2D 4XCYB 4ZFFA 1DE4B 3HS0B 3ZKQD 3IS0X 4HH9A 4LPWA 4YFLF 4XCCH 4OLWH 4RQQB 4KJPC 3DX8A 1I1FA 4WV1A 4S1DD 4QRPB 1JF5A 3B4NA 2OTWB 5DD3H 4GSDH 1JUFA 4OUUA 1S3KH 2DI7A 3OXSB 3CPLA 4LGRB 2Q1EA 1FFNA 5D5MF 5EOQL 1E4XH 3VXNA 1AI1H 1S78C 2B1HH 4X5XB 1OL0A 2EXYC 1PG7X 4ONOA 2X89A 2XOTA 4HQQH 1FP5A 5CBEB 3RVXD 3NACL 1MCWM 4WW1A 5IGXL 1A6WL 2JE8A 4RAVA 4YHIA 3MBEB 3W2DH 1SYSA 1UWXK 2VQ1A 3GMLB 5J1SC 4OFYA 5FV2A 3CXDL 3S5LA 5DRNA 2XZAL 3DVNB 2CK2A 4GUPB 1YEFH 2ICCA 2X9WA 1MHEB 1U91A 2VLRD 1RV6X 3S9DB 4Y19B 4UI2A 3IGAA 5TPWL 3EDKA 1N8ZA 5C9KA 3KJ4C 4OCWL 4H26B 4H1LH 1ZKAA 1JPTL 3WHXB 2YD3A 5F1OB 1IILE 2DQEH 3JBG7 3KPSD 1MHHB 1CT8A 2H9GB 5FDWB 3T2QA 1MEXL 2Z93B 1FLRL 3ARBA 1UKTA 4QLRA 5CAYB 1WIOA 5C6TH 3BWAB 4DZ8B 5C0EA 3V52L 1HZHL 1EHAA 1N64L 3JV4B 5DI8B 5AD0B 5M7QA 2F74B 1BVLB 1M1SA 5EZIH 3LIZL 4JFDA 4L3EA 4X4YA 2F54D 4K2UH 4HJJL 3GRWA 2KZ1B 2VLLB 3QWRD 3LN5A 5HSFA 1FORH 2BVOA 4DEPB 2GY5A 5IVXB 1CDJA 1DQDL 4KI5E 4LSRL 1XGRA 4X83A 1AC6A 1HKFA 1BZQK 3HA0A 5KSAD 4N90E 1M4KA 4GW5A 5FGCE 5FM8A 2VUOA 3RGVA 1BZ9A 1S7WA 4ZOBA 2EE9A 4IDJL 2BZDA 2O93L 5ADPH 5C9JB 2EICA 2VN4A 5I1KL 5J12C 2YBRB 4DKAA 1R3LB 3C6LC 4HIJB 4YBQD 4QNPF 3BH8A 1A2YA 1TZGH 1NCBL 1QP1A 5GHWL 2X4PA 2YEZA 1J0IA 1Q94A 5J0BA 2DL2A 3HLAA 4JHWH 3HC4L 2V9RA 3OHXA 4KU1A 2AXHA 5KS9A 1OAKL 5EU4A 4KDTA 2GUOA 1KV3A 3QJFB 4XPGH 3CH1B 2CKBH 3PL6B 3S35L 3VRJA 3QHZH 3GMRA 5HYQA 4OLUH 2VDLH 5F96L 3B9KA 3H42H 3U83A 2YC1A 1W0YT 5AZEL 5CJOH 5JOPD 3BIKA 2NY1D 5IMMA 3KPNA 1NGWA 3LRGA 3BZ4A 1M6OB 1IGFH 4EZMA