1HIML

Structural evidence for induced fit as a mechanism for antibody-antigen recognition
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
total genus 39
structure length 214
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himL01
4M48L 3EYOB 2AXJA 4MJ6A 3LZFL 1RULH 3TBTA 2WUCH 5F21B 4L4VB 2G75B 3V5KA 3CCHB 5DRXB 2P8PB 2R56L 3LAFA 4A6YA 4WFGE 2D7OA 3W2DL 2YHGA 5FOBA 5TE6L 4N68A 3RDTA 4BK5A 1IC5H 2VSCA 3HUJB 4KK6C 3B6SB 4KVCH 5GJSL 4OF5A 1J88A 4RMSA 1JGEA 1JWUB 1UXWB 2PUQT 1C5BL 4YHKH 2EDOA 4QHUA 4CVXB 3KJ6H 1N8ZA 3DX9A 5FKAA 1UJ3B 5IMKB 3QG7L 3EBAA 3DHJA 4OCXH 3EDJA 3F62A 1HHIA 4NQVB 5CBEA 3QNXA 4U1HB 4WEBH 5HYFA 4DVBB 2Q8AH 2VXUH 3S96B 3CDFA 5BZDB 1YMHA 3ZDYF 5I66A 2D31A 3OPZH 1LO4H 3QHTC 4JPKH 4OFDA 5JTWA 2NXYB 1T3FA 5D7JA 3EKCA 4BZ2H 2Q8BL 3DROA 2XI9A 1CWVA 3AS1A 3L3IA 1BOGA 2ERJC 1BEYL 2FD6L 3WLWD 5LBSH 2Z4QB 1NUNB 3O6MH 1K2DA 1Z3GH 2VDNL 1OAYL 2F5BL 3MOAH 1XGYL 2JJWA 4LGSB 2C1PB 4MA1B 4Q9QL 2R15A 2CDGB 1CIUA 4QOKA 4FMKA 4ZXBA 5IQ7L 1L4IA 1SEQL 5EO9B 4HIHA 1T83C 2M2DA 3IFPA 1S7RA 1KCVL 4FABH 2ED7A 3BO8B 1X7QB 5DHYA 5ID0A 1I1RA 4PGJA 4UIKH 5D2LB 1GGBH 2V9TA 4HWBL 4PV9A 4LEOB 3CFJB 2J3SA 5D70L 4WHTA 4N0FB 4WUKL 1JPGB 1CXLA 4GS7C 3IDMA 1AI1H 1EEQA 2FNBA 3UTQB 4NUGL 4GAGL 3IAPA 4FZ8L 3U36B 5F96H 3LPWA 2IGFH 2VDQL 1QZ1A 3TC9A 3RWCB 4X6CF 2VDLL 5GJTH 4XNYH 4Q7DA 4LSTL 1EFQA 3LOWA 4EXPX 5CJ5A 4DCQA 2NX5A 1JP5A 1QA9B 1MJJA 3B8YA 7FABH 2AABH 3O8XB 4CADA 1XF3B 2JCCB 4XBEH 2H3NA 4YX2H 3ZT6A 2E6JA 2GT9B 4BFGA 2OR9H 4YUEL 4X4YA 3UPRB 3L3KB 4JO2H 4X6DB 1IC4L 3UXFA 3DECA 2B5IB 3PXJA 1K8DB 3QUYD 3DPBA 2O5ZH 3LIZH 1QHPA 4P2QD 5ANME 3DYOA 3PL6D 2EE6A 4I0PA 3SCMC 2VC2H 2ZSVB 1MHPH 2E27L 2ZOKA 2AK1L 1LO5A 1YYML 4PBWD 4IHOA 2I25N 1LDPL 4LLMB 3NZHH 2VITB 3MYZA 2XOTA 4OSUL 3ULUC 5IG7A 4ODBD 3AREB 4F3FB 4K3EL 2ADFH 3NH7H 4KDVA 4TUJB 3WLBB 4R2GC 2W92A 5DDHA 5FYJD 5C07E 5ICYA 2E8YA 4BSWA 2YD9A 2ADGA 5TJWK 1J8HE 1HXYA 1WCQA 3ZTJG 4ETYA 1OB1A 2XKUA 5FYKL 1U0QA 3PHOB 3ZKQD 1IEBB 2Z9TA 4QRRA 1G7PB 4FXKB 1JWUA 4X9HA 5ACZA 1XAUA 2CD0A 1B0GB 1DN0A 1LP9F 1FCGA 4YHPA 5GRJH 1EAPB 5FM4A 5ESQB 1RZ8A 3HR5A 3LRGA 1EXUA 2AEQL 2IANB 3BWUC 3U2SB 3H0TA 4QTIH 5F3HB 3FN0L 4F37K 3CSGA 3S7GA 4AT6A 2XG4A 3PQYB 1CGSL 4J8RA 3L7FB 5C08D 4OZHB 4PGDB 1M71B 4YE4L 3A67L 2ZUWA 1VFMA 3RWIA 1EJ6A 1KTKE 3AM8C 4Q58C 2WM0A 3EO9L 4QHLB 2F58L 2NY0B 2VISA 3VMOA 3U46A 3GMQB 4OT1L 3QUMB 5DMKB 2PTTB 3LQAH 5JW4M 1FVDB 5DQ9A 5GGSY 2AQ1A 1IC7L 1ACYL 3V4PH 3IDIB 4NQCA 3WV0A 1FFRA 5IP4A 1JBJA 1BIHA 4PJXF 1MFCL 3GMNB 3NCJH 5FM5M 2QSQA 4G6KL 5EOTA 2DQIL 2MQ3A 4RMQA 1SYSB 5DJDB 5FKPB 5D2LA 1QRNA 4JPIB 3SN6N 2Q86A 4WUKH 3WE6B 4HIIA 1JYVA 2BNQB 2QSCL 1I1FB 1MVUB 1FN4B 4NHCH 2YN3A 2W65B 3GSVB 4YHYB 3T3MF 5F1NB 3GDBA 1YNKH 5BJTA 3B9KD 4JRXB 4Z8FH 3I50H 1FC2D 3M1BA 1JGDA 2VDLH 4U1IA 5F89B 4P23C 3VXSE 3PDGA 1T22A 1XF4A 3KGRA 4I0PC 4PLKD 1HINH 3N1FC 3HZMB 4V2BA 5EN2A 3B8SA 1OP5K 3IB4A 5BRZA 4Z7QE 1F5WA 3D25B 3N1GC 3O3AB 4LHUG 2HFFB 3KXFB 1MRDH 3WXWL 1G9MC 2BRRL 1SVCP 5CJOL 4KWUA 5KVGL 5FA3B 2CLVB 2DQEL 5I8EB 1MI5B 2JJTC 2YWZA 3AXLB 3BOVA 5D7LE 4NNXA 1UKTA 2BHZA 5T1LD 4AIZB 2F54A 4NC1E 1QHOA 4FQQB 4BQCA 4A6YB 4XVUC 3BISA 2NXZD 4F7MB 4NQXA 5T33H 2YD6A 3CXDL 1RJLB 4PJDA 4JDZA 4LSUH 1N64L 1A1OA 3ZE0F 2B4CL 4OUUA 43CAA 5I75C 2XKNA 4ODXA 3EYOA 3BDYL 2P5WE 4MAYD 1D9KC 2GJ6E 1CZ8H 2IFFL 1QSED 4OZFB 2LU7A 2VMFA 2X4QA 3MUGB 2DQGL 1D6EB 3VI3F 2EDJA 3QAZB 1PYWA 3PHQB 3FQUA 3QUMH 4HIXH 4X80L 5KSAB 2X4TA 1WF5A 2FIKA 3OJVC 1QYGH 2ITDA 1ZVSA 4PRPD 4M6NL 3LEVH 4NNYA 1QLEH 2F8OA 5D72H 3DMMA 4JHZA 1LE9A 2QR0B 2Z31B 4PG2C 3L9RA 3QWOB 1S3KH 4YXKL 5ACZB 3BYYA 4I18A 4I0KA 4MHHG 5LGJB 3RVUD 2V2XA 3KJ6L 2BNQE 4LMQI 5EZJB 4RGNE 4YQXL 3J8F7 4HCRL 2HMID 1XF5A 1QD0A 3T0WA 3I75A 4MX7A 2QADD 4OM0H 1T3FB 2YMXL 1Q1JH 3C2AL 3KDMA 3O8XD 5DMGC 4DVRH 4EI5A 4NOBA 3P3YA 4G8GB 4PP1C 5HGHA 5JXAH 5A2FA 5K93A 4RRPA 3NFPB 1RK1B 4N9GA 1GAFL 2FJFA 3L3GA 4R7DA 5F71A 1KBGH 4NJAL 5SWSD 1T1WA 2HTLD 3HI1A 4JGJA 3ULVF 1XZ0A 4MLIA 3V4PL 4K94L 2XXCB 2J8UA 4LSRH 2D03H 2KH2B 3ZTNH 3S5LB 1UXSB 4PGCB 4NFDA 3VFMA 1UA6L 3ZTJH 3MRRA 1NGXA 3KYKH 5D7IE 5D8JL 4B7LA 1EAJA 4KTEL 3BP5B 4ZQKB 4AENA 3I50L 2W9EL 3OZ9L 1S9XA 4O2EB 1AH1A 1HILA 4GFTB 1NANI 5FDWA 3QUZC 1J86A 2ZJSH 2FX8H 1P9MA 5MHSE 3QCVH 3RP1A 2AK4B 1KCRL 4P59L 2GK0B 3CAFA 3FB7A 2YXFA 3ES6B 1UB5A 1XF4B 5BXFB 1ZLUK 2E9JA 1A7RL 1TENA 5CZVH 5KAQG 1SJEB 1A1MB 3WJJA 3SO5A 4PRPE 2P5EB 1J0ZA 4XPGL 4NQCE 4AL8L 4X6CA 3THML 1S5IH 4ZYKA 1CD9B 1Q94B 1YEDB 4NM8H 1QBBA 3CSBA 4DTGH 3DVGB 4K3JL 4HUKB 5DK0B 1UH4A 1EUTA 4OF3A 3HS0A 1RHHA 5T3XD 1KJ2B 4L3EA 1EHXA 3LPFA 1J1PH 2DM7A 4F7MA 3HUJE 4Y5YB 4HBCH 2DL2A 4PJAE 4P48A 5E0QA 3DETD 1E6OH 3HI6L 2AK1H 5JXED 5FUZH 4WNQB 2C1PA 4OI8A 4XPFH 4C83B 2VXVL 2IWGA 1XGRA 3UJTH 3ARFC 4P2RB 4YBQC 3RWDB 4U49A 4M02A 3QIWD 4EXKA 3DSFL 3L3HA 4LFHG 1QYGL 1GGCH 1UM6H 2WBJD 2DQTL 1HHGA 3T0ED 4R2GD 5IB2B 3CFIC 3ORJA 4YLQT 1CE1L 3GSNL 4D0CA 1XGPB 1UWEL 3MV9D 5KSBE 1C5DB 5IVXA 1KB5A 4NP4H 2D7MA 1J8HA 1LQSR 4PRHE 3P9WB 1ZOXA 3VXNB 3K80A 2R29L 4FP8L 5D1QA 5DUML 5JDSB 4PG9B 5IJVA 5DQ9B 1T1XB 2XT1B 4XCYB 8FABA 1FZKA 1HHHA 5E5UB 3NVQA 2F54E 1T5WB 4WI7A 1CL7I 5C3TA 5IHUH 3LEXA 4UMGA 2VR4A 4S1QL 2WZPD 2OJZH 1QSFB 2OQJB 4PRPA 3S98A 5CZXD 4OD1L 1KJ3H 4L8DB 1UVQB 3ARBA 1XH3B 5ILTL 3D18A 4HUNB 4Y5XA 5HDOA 5EU6E 4MXWH 4PTTB 3FB5B 2JK5A 3QIBD 1Q9LA 1SJHB 4FG6D 4MXQD 4KUZL 4Y1AB 3SGDI 1KLUB 4NQCD 3VJ6A 3VXMA 3U79A 4OZIF 4DZBA 1X3DA 2FZ3A 3ARFA 4D0BA 4WO4A 2CRZA 4HAGA 1ZANL 5B39G 1GJIA 2OLDA 4LIQE 5I1CH 2G5RA 3SGKC 2DL9A 1HHJB 5CGTA 1TTFA 2R1XA 4QNPE 4OZGE 3JSSA 4PRID 1UZ6E 1BIIA 2V5SA 3KPSB 5D1ZB 1FZOB 5F8RC 5HVFB 4GQPH 4PJXA 4BSWB 3W5NA 3AAZB 3G08B 2VUYA 1EHAA 2IBZX 5D96C 2YD4A 1CBVL 3GI8L 2FR4B 3ARZA 3QQ9C 5BRZE 5HVHB 3OR6A 3Q3GA 1GH7A 3F7RA 2XA8L 3CFDA 3SKUD 4PY7B 4ERSL 5GGSA 5E2WL 2OSLA 5T3XH 1PKQA 2R2HB 2Z8WC 4HK0B 2HWZL 4AG4L 4Z7WB 4OM1L 2D4FA 3GEWB 5C7XL 5DURD 5MP6H 4K23L 1KTDA 5DJZA 1MF2H 1J1PL 4Z7VA 1HYRC 4PJFE 1T66D 2NQCA 2NR6C 4O58H 2ESVE 3JWDC 4Z7WE 4WTWA 3LD8B 4KKLC 5H35B 3GB7B 3WDHA 2CKNA 2B20A 3LH2L 5DD6B 1FRGH 4CDGC 5EZLB 3AS0A 5LGHH 4UAOB 2X1WL 2ZG1A 3LB6D 4LCUB 1X5AA 2GI7A 3ZO0A 2ID5A 4OLEA 4DGIL 1F02I 3DLQR 3VFOA 2HFEA 5INCA 2DI7A 2X89D 2MOVA 2WIIB 4K3DL 2VZVA 5BQ7B 2ZKHL 2IALB 1MJUH 4FTVA 3Q48A 3QI9A 3EW3B 4N0RA 1PSKL 1TZHA 4XWGL 1IC5L 1MCPH 3TPUB 4MLSA 1OSZB 1B2WH 3ARGB 3BI9X 1TQCB 3L95B 3RAJL 3U1SH 3KJ4B 4K7PL 1RZGB 1QOKA 1C5DA 5E00A 3WD5L 1JTTA 3CSYA 1ZA3A 1NAMB 4PJ5E 3QG7H 4OCXL 2BSED 1E27B 4O4YL 1Q0YL 1DBML 3CDGB 1OAXL 2MKLC 4O51B 4AM0B 4LNRA 2FGWH 1AY1L 3FT3A 1P4BL 4FQXB 4G8GA 5F9WB 3U4BL 2OX5A 2G9HA 5JMRA 1NAKH 4PRHD 4XCEB 2FD6H 4IEFB 5E8DL 5TF1H 2ZOLA 4ZFZA 5IV2A 4YDJA 1K8IA 1I8LC 3NIFE 1H9VA 3VD5A 4WI3A 5D1XD 4LVOC 1YNTB 5DURB 3CUPB 1KELL 3D18B 2G5BB 3N85L 3EJYD 2CXKA 4GAJH 5DHVB 4TUKL 5I1EL 4XMPH 1FNGA 4YFLI 4YC2B 4P3DA 4UUJB 2ESVA 5FYLE 3D48R 1BWMA 1BX2A 1G6RA 3TVMC 3GKWL 2AK4A 2EEAA 4MDJA 4WW2F 1NMAH 2VAJA 1YQ2A 2W38A 1HE7A 4KGJA 1UH2A 2R4RL 3H9SE 2HA1A 2VWEE 4P9MH 4HDIB 2X4PA 3ARVA 1RUPL 5JHLL 4LPYA 4ZOAA 5AZ2H 5KG9A 3FN3A 4XAWL 1TZGL 3NA4A 1D6EA 5JR1H 3V5KB 4B0MM 2VZOA 1MFNA 3K2MC 4HT1L 3BPLC 4NRXB 3IVKB 4GKNB 5DI8A 1O7VA 5F3BA 5IMMA 5HDQL 3HI5L 2AEIT 3VFPA 2FR4A 4OV5A 2GHWB 1A6WH 4I3GA 1P6FA 2XKSA 3T1WA 1JRHI 4WDIB 3RUGA 2PO6D 1JI2A 3C5ZD 4ZO7A 4L5FH 3I2CL 3VA6A 3I6KA 5TPWL 2VABA 2Y06L 4NKOB 3X3GL 2F15A 4L4TB 3U9PL 5MP6L 3QRGL 3WXVH 2HLAB 4G3YH 2M8XA 2EXWC 2FJGA 1DVFD 3P0YL 2C7UB 4OGYH 1B0RB 2AJ3A 1JK8A 3EHBD 1H5BC 2OI9C 3VGHA 4GW5B 4JM4H 5ICZA 5DRWB 4YGAB 3OKMB 3B6SA 1AIFA 1AGFA 3NAAH 1CGWA 4G42B 1Q9KB 1G0YR 4K2UH 3QCUL 2FO4B 3P73B 3P2TA 3J7HA 5DEFA 5I1IH 1BFTA 3MCLL 4XPFL 3JWDH 3V7AE 3C5ZC 2K9UA 3ZDYE 3V9FA 4XWGH 1DFBL 3WUWG 3ARPA 5GRVL 1OF2B 3W0WD 4WO4D 3TWCL 1BECA 3OKLA 3KPRD 5FYLD 5KSUB 5JPMA 4HWZB 1U3HC 4Z5RB 1HWHB 3MV9A 4QGYA 5L0QB 5I1LA 4DFHA 4LCCA 1ZLSH 4PJHA 4MD4B 1QACA 4HV8A 4PRIA 2Y72A 4XI5C 4ZSOA 4I3SL 4YHZH 5AEAA 3BD5A 3D85A 3FRUA 5LCVL 4K55A 3VGBA 4DEPC 1MHEA 2PTTA 3OAYH 1M4KA 4RNRA 2KBGA 4YK4C 3VFUB 5CJXC 1W72L 3O2DH 4NUJB 5A16B 2I07B 1UACH 1NAKL 4P4KB 1CG9B 1CGSH 1CVSC 2B4CC 2FH6A 3LQZA 4UIMA 1YEFL 4FTVD 3LKRB 4XPAL 4AH2A 4XP9H 4G7YL 5B8CC 1NBQA 5B21A 3V6FB 3B3IB 3IYLW 5I1DB 5GISL 3N9GL 5JUEH 3IXAA 2O61B 5L8LB 4PJAB 2R0KH 2CRIA 2XN9B 3PWUB 5DF0A 2VH5H 3EO9H 2W91A 4YDJB 5HGGS 1BFVH 1TFHA 1KELH 1J7VR 4NQSB 1ORQA 3GMOB 1G84A 4PGEA 1CICB 4HIEA 4F80A 4DWHA 2HT4C 5L2JB 4MXWL 1EGJA 3WFEH 3H3BC 4NM4H 3LS5L 2Q3ZA 3MRHB 1ZGLM 3MOBL 1WC7A 4NDMB 1PX3A 2FEDC 1KN2L 1R3KB 4S0TD 4WWKC 2R1XB 4H5SB 5I1CL 3LDBC 5TDPB 4TTDD 4ELMF 1RZ7H 2A77L 3Q5YA 1P9MC 4NFCA 3BGMA 3WFDL 3DMMC 3U48A 4TN9A 1W72B 1J1OH 2EIEA 1A5FH 4ZNEE 3ULVD 3ARRA 1W2KT 1OAUL 1F8TL 3BE1H 2VXUL 1DUZB 1BVKB 2R0ZL 1JNHB 3Q6FB 1HXYB 3FB8B 1KGCE 4JVWA 1EHLL 1BBJB 1J5OH 4F57L 4IDJH 3W0WE 5K59F 3ZL4H 5HHOD 3DMMD 1AD0A 3OHXA 1FL5A 4MD0B 1KIQB 1NFDF 4OZGB 4HKZA 4XMLH 1EZVX 3RKDD 3TYGH 2QV2A 3QRGH 1BQUA 2PCPA 4HLZH 2APWA 4JANA 4DK3A 4QRUA 2BK8A 4PRDB 5CFHA 4OZ4B 4PJBB 4G8GD 2LVCA 3AROA 3LEXB 1A2YA 2NY7H 1MOEA 4IRJB 1GGBL 1P4LB 4GW4B 4P57A 4JB9L 4I8DA 2DMKA 4GH7B 3ZHKA 2VLME 2EXYC 1OD7A 3MNWB 1RAMA 3EOAA 3A6BL 1U8HA 3CZJA 1P7QD 5EO9A 1CLZH 1EXUB 3ALPA 4Z7QF 4OZHF 2ENYA 3RVVD 2VZTA 5D93B 4FQJL 2FIRT 4RBPK 3IFLL 5C6TL 1KN4L 1L7TL 2M26A 1KJVB 4HEPG 5FYJL 4EI5B 3UP1A 2APFA 4GRLC 4LSSL 4LCWE 4Q74A 4WW2C 1F6AA 3R8BB 2J8UE 4RWYH 5DMIL 1ZA3B 3GMPB 5J0BA 5F1NA 5EULV 5KSBB 4JPWH 2BVQB 1HZHL 1D3CA 1KT2A 4LNRB 4QWWD 5ICXB 5J3HC 4ZUSB 3G6DL 1XZ0B 2YMXH 1TPXB 1IEBA 4R4FH 4JJ5A 2Q7YB 3NIDE 4KPHL 5KZCD 4PJ9C 4YO0A 3N0PB 4PRHA 2ZP0T 2MPAL 1M7DB 2ICWI 5GISH 5JUEL 1I8KA 3WNPA 1T20A 5HYSG 4F7CA 4GKSA 1JN6A 2YEZA 3E6HA 4B50A 5TGBA 3HG1E 2VL5A 4ODVH 2FWOB 1V8HA 1I1AA 1PLGL 5F7NC 2G75A 3V0WH 1G7JB 4KVNL 2VXTH 1DN2A 4X8JA 1CQYA 1KFAH 1OWWA 2CK2A 4L3ED 2GSIB 1T0NA 5MENE 2ZOKB 3KPOB 5DI8B 4X6CE 2F74B 3RVXD 2H9GB 5E6IC 3ULVH 5FGCB 4PTUA 3MV7B 4PJBE 5I1JH 1FVCB 1UWXH 5L9DL 5IVZB 3S8WA 3MLTA 1M05A 5CSZB 5CINL 2DYPD 4H25B 5GRJL 1YJDL 3VXSB 5JOPD 3DRQB 1TZGH 2WQRA 3QUYB 2VZ1A 1RU9H 3O4OB 4P2OB 5TDNB 2W60B 1ADQL 2F54B 2XZAH 1KIPA 1M6OB 5EA0L 3HRZB 2CLZB 4WJ5B 1BBJA 3N1MC 3ZL4L 2X42A 4X5XB 3RUGE 3VWKA 4JJHA 4LHUA 4ZFOL 5EDXA 4P5TB 4WWKD 4U33A 5AAWA 1WISA 5F9AC 5IIEA 3ZSTA 1F3DH 3CU7A 4IJ3B 3PABA 1AGEB 2IMNA 4L9LA 1SEBB 3EFFA 4P3CH 3PHQA 2F19L 4NN5C 4HS3B 4RMTA 4I77H 1TCRB 4K7FA 4IOIA 1P2CB 1A1NA 1OTTD 2VLLA 1TNMA 3DOSA 3LMJL 1FYHB 2Q20A 4LGPB 3WN5B 1CGTA 3K4AA 2QHRL 4Z7UF 1AHWB 1JGEB 3UJIH 5HGAB 2BDNH 2NW3B 4P57B 3RKDC 4QHUB 5T1KB 1VFBA 4I0CC 3PE9A 3QDMD 4JFDD 2D0HA 3A6BH 4ISVB 5J6HB 3G5ZB 3ZDXE 4G8GE 1YNKL 4PJ7F 3PJSA 4FNLL 4EKXA 2HRLA 3LN4B 2EDLA 4NN7C 5IFHH 4RNRB 3UYRL 1DTUA 1PX4A 1XCQA 5DK3A 4XCYA 4XXDB 8FABB 2XKNB 1HHHB 3VH8G 3OAZK 1XGQB 4XX1E 2XNAB 5DZLA 1OTSD 3MODL 1KJVA 1I1FA 1E6JL 4PRIB 2VR9A 3OB0K 1YQVL 3O81A 4PJCF 5DJAA 4M61B 3GJFH 5D7IF 1K9TA 1OWRM 4GMSL 2JF1A 3KPLB 3MV11 2DQEH 4UI2A 4PJGE 4LLWB 2NY1B 4DKEH 4J1UB 3PGDA 3PP3K 5L7XL 2BRQA 3RNQB 4Y2OA 3E2HC 3NTCH 3L6FB 3GSQA 1N4XH 5DJ8B 1S7RB 3OKKA 5EC2B 4QLRA 2NY4B 4JGMA 3IJYB 5E7FA 2OXGA 1YEFH 2QHLA 4NO2B 3VXUB 4ODVL 4ELKA 3JUYA 2AVGA 1KUMA 4PJGF 1FG2B 1JZ2A 4F9LC 2L7UA 2YEZB 3X3FL 3TEUA 2P7TB 2APVA 4YWGL 4PGEB 1T5XB 1NCNA 2MWCA 3AREA 2BY0A 3G6JA 1EO8H 5K9JH 4P5MB 1IQWL 1I3VA 4HXBH 4NHUB 5IJKC 3O9WC 4JFOA 3P77B 1GSMA 4PRAB 5IKCB 1D9KA 2CGRH 25C8H 5HI4C 2DQFA 4M5ZH 3C6LB 4L8SC 4AY0A 1R0AH 1MCCA 1FNEA 4KKBC 3MO1A 1YJDH 3B9AA 1H8SA 5GRUH 3QDMB 3DTXA 1FFQA 2IBGA 3MRNB 3ROOA 4HJ0D 1N8ZB 2FEEL 3FOMB 2WP3O 1A47A 4ONOA 3QO0B 2ORBH 4LPTA 2CMRL 3PQYA 3QZWA 5TE4L 1VEOA 5D9SB 4Q6IC 3QFDA 2JELL 3HUJA 4NQDE 3C6SB 1KYOJ 5DA4A 2W0KA 3OJ2C 3ZT7A 2RQ8A 2GY7B 5T3ZH 3WFHA 2A6DB 1U8IA 3UTZB 1IGCH 3EO1B 1NCCL 4U6XB 1G9MH 1BQHG 5EC1B 4Z7UA 5I9QC 4LLUA 3UC0L 4D9LL 3BKYL 1FVEA 3TVMD 4MD5B 3B9DA 5CIPA 4MAYC 4I77L 1NBVL 4UNUA 3TYGL 5IMOB 5J6GB 3CMGA 2F19H 4KK5C 2D03L 1OW0A 1U8JA 4JDTL 5IR1A 3A0OA 4D8PA 3B9VA 3ZSSA 3B3IA 1S7WB 5F9OH 4PRPB 3OQ3B 1B4JL 2X9YA 3AC0A 4NUGH 4QRRB 4E0RB 4UNVA 4KDTA 1SYVA 4WGWB 2P43B 3GMRB 2NY2B 4FNLH 1RUKH 1KTRL 1ZMYA 4XB7A 1NMBH 4ISVA 2NY6D 4U1NB 3SDAD 3UTSB 4OZHE 1MFAL 2VOTA 5CD5C 4GSDH 4EUPG 2W0FA 2XFXB 1OOAA 2AXFB 4Y5YA 4F37F 3BEVA 5J3HD 3DX7B 3ILQD 1E4KA 1CFBA 3V7AG 4IHOB 2ZSWA 2KKQA 5KSVA 4FXGB 2R2EB 1VB9A 3FO0H 1A7RH 1E6JH 1I3RB 3KVQA 1U8MB 4ZS7L 3SY0A 5CJQH 4JQIL 2H3NB 5KSBA 4OLUL 2R0WH 3QDGE 4WY7H 4JFPA 1ZLUH 5FB8A 2BOBB 2VDPH 4OCNC 1BIIB 4Q6IB 1LO0L 5JW5B 2DQHL 4NO0D 3S3SA 5FOJA 1KB5L 4PS4L 3KWWA 2BX5A 4L3CA 3BPOB 5IGXH 4L29A 4G8IA 3MGOA 2Y4SA 1P4IH 3SE4A 4DTGL 3K4ZA 4H26A 4OIAA 3STZB 4C57C 5E5RB 5BXFA 5HI5C 4HUUB 4QXGH 1CE6B 1WCBB 2VLRD 1J87A 1NFDE 3ARFD 1G9NL 4KRPC 3IDXH 4J3TA 5DC4B 1LDPH 1EPFA 2CQVA 3LKNB 4PJIA 3C6LC 2X05A 2D4DA 3W5MA 2WANA 2YA1A 3NIGF 4QRRE 4Y1AE 5CSGA 1AJ7L 2X4PB 3X3FH 1G1YA 4QTHB 2IPKB 3EGSA 1MQKL 1RIHH 1JGVH 1MCWW 2C5DC 5C08E 4KI5C 4EI6A 4TOYH 4HH9B 1UEMA 4EDXA 4GG6E 4JGUA 4PGZA 2ZWLT 2RCSL 2FX9H 3DX6B 4DN3H 2CR3A 5MEOB 2HRPL 1H0DA 1IKNC 4Y19A 3MJ7A 1HHKB 1JF1A 5ANMB 3CFEB 4HPOL 4NGHH 4EUPA 4HX1B 1L0YA 3BXNA 3UYPA 5LVEA 4MSWB 4FQHA 2JCCE 2YPVL 3KYOA 3VFNB 4J12A 2NY1C 5KBNC 4WI5A 4A2LA 1BFOB 4E41A 3QEHA 1HQRB 3BP7B 1M7IB 4NNXB 1TQBB 4R4ND 1WT5A 5JIPA 4F33B 1NH6A 2BP3A 1FV1A 4X7CC 3ZKSD 2VE6B 2Q8BH 2JCCF 2ZCLH 3ZYIA 1RJLA 2J6EA 4PJDB 4ONFL 2W65A 3GSVA 3JV0A 1NCCH 3S4SB 3BVNA 1G1CA 1NAMA 2DBLH 4WU7B 1HDMA 1A14L 1MY7A 2PYFA 1KT2B 3RRQA 4D9LH 2HFEB 1C8PA 1QBAA 1U8OB 1NCAH 5C0RL 2BNUA 4DQOH 4P2RD 5ACMA 1UCBL 2F5AH 4FQXA 2HJFB 1J0KA 3VW3H 4FTVB 3QI9B 1CGUA 5F1IB 2HFFA 1YEKL 4P3CL 3ARBC 5DGQA 1AHWC 3VG9C 4PPTA 1Q8MA 2BNRA 1YDPA 4PJEF 3KXFE 3RGHA 3VXUE 5F88A 2VISB 3TGXA 4JFFE 4NN5B 4LLVA 4RWHA 3X11B 4MQSB 4GAGH 2AJUH 5I1HH 2V2TA 4AIZA 2GTZA 35C8L 1NGWB 1K4CB 3NCBB 4ONHA 4AQOA 5BJTB 2DIAA 1WFTA 4ZFOA 4ORGB 2FHFA 1OPGL 2N56A 2EIZA 3TN0A 1AXTL 1F2QA 5AZEH 4OUUB 4XZUB 43CAB 1JCKA 5JW4Q 3MCG1 3LQZB 4ZFGH 3LV3A 3SGDH 4CGTA 1IGMH 4XCEA 4N90E 3SE8L 1WT5C 1HN1A 4OZFA 5C0FA 1AO7E 2F53D 5ERWB 1BLNA 3VXQB 2WP3T 1UWGH 3SJVB 3RI5K 2MKWA 3QEGL 4NKDA 4JHAL 4P2OC 3RWEB 2EDHA 2OP4H 4LSQL 4MAUL 1CDGA 1OB1B 4KHXH 3BYTA 5D5MB 5ISZD 1OQOA 3IDXL 5IM7A 1BX2B 4QXGL 1NDMB 4G9FA 3D9AH 5FF6A 1MHPL 1FNFA 3BMWA 4FQQA 4YJZL 1BREA 3QEQB 3ARXA 3W9EA 5DO2D 5HHOA 5CGYC 3LN9A 3B5HA 1G7IB 4CL7A 4XX1G 1YYMH 1AGDB 2VH5L 1B9ZA 2VKWA 2DQCH 4R7NB 3VH8B 5EO0B 1IAII 1PVHA 2N4IA 4C58B 1NGQL 4OLZL 3FCTB 4YGVA 1VKXB 3DWTA 4OZIA 3F7PC 3LKPB 4AEIL 1A6TA 1I1AC 5IKCA 1RZKH 5L88L 2FBJL 5DTFA 1KN2H 4LLAA 4QRRD 3FB8A 2DWEB 3I3BA 4BQ6A 4OFPA 3KLDA 1UB6B 3BQUC 3SGJA 5HYJA 3O45A 3ZYZA 3RAJH 3U1SL 2ED8A 2YN5A 4DW2H 4M5ZL 3GFUA 1U6AH 3IDIA 2NZ9C 4OLVL 3SOBH 2QQKL 5CKGA 3QWOA 4XWOC 2Z8SA 5IROC 4PG2A 4P2YA 3QDJE 3U83A 3T4AA 3NOIA 3LN4A 4MD5A 5DYOB 4HFUL 3RWGA 4JLRA 5BV7C 4LCIL 1K3IA 1QFUH 2DN7A 4HUVA 4IOFC 2VWEC 4OZ4A 5EWIH 4MDIA 4J3SA 5E1HB 3VFTB 1NBZA 5HD8C 4YPGB 3UTZA 1GOFA 1JWSB 2ZG3A 3F12B 4LCCB 4EI5C 1IARB 4JFDE 1YC7A 1YPZE 5EUKB 4XBPB 4DQOL 1VADA 1ZHBB 2KZWA 3KPLA 4NO0A 1IGCL 5E2JA 5C09D 4NSKA 4GAJL 4YH6A 3VGFA 2GJ6B 3SPVB 1ZT7A 1S9WA 4XMPL 2NX5D 4M6OL 3UBXA 2HT4D 3VW3L 3IFPB 4HEME 5C2BL 3ROLA 3RHWF 1W0YT 3UTTE 4QGTA 1WJ3A 1BFSA 1QRND 3MRLB 4N0FA 4IRJC 4HWZA 1IAMA 3CDYA 2FJFB 4HSQA 4M6MH 3B5GA 5FYJE 1MRCH 3MXVH 1YEDA 2E9BA 4CNIB 1G7QB 3W82A 5EBWA 1FZOA 1MY5A 4ZTOL 1N7MH 1CLZL 4OQTA 5TH2B 4ONHB 1AQDB 1WZ1H 2X7LB 4NZUH 3BZEB 4FQXD 5I1GH 4MCZB 4TULH 4JFFD 2NY0D 4UQ3B 5TDPA 3BPNB 1CL7H 3UBXG 2B2XH 4M8QA 3GHBH 3VCLA 5FKAB 2A83A 5CJOH 3BEWB 3CVHA 4JFEE 3IJHA 4PTTA 1AXSA 1FPTH 3MFFB 5HGBA 4H0HB 2ZSVA 4PBVC 3T08A 5CBAA 3DMMB 2XZZA 2FSEA 2RGSA 1NDMA 2MHAB 4ESKA 1NC2D 3L5XH 1S9YA 3LDBB 3KPOA 3ULUD 1A1MA 1MCBA 2EH7H 4BH7B 5GGUA 2AV7B 2P5EA 4OF8A 1KNOA 2WUCL 3MREA 4WWKA 2DQCL 1AGDA 4LLUB 4N1EA 4M48H 2N1KA 3VFOB 3EGSB 5JDSA 2AS5M 3BPOC 4MA8H 1PLGH 5HTSA 5T1DL 4ZPTB 3ILPB 1I85C 5E6YA 3KLAB 2EXWD 2P8MA 3QCTL 3GJFA 3T3PF 2HFGL 5FYJU 1BFOA 3O3BA 1WBZA 3O0RL 4QY8B 5EIQA 5GSRA 5HYJE 4LLQA 5BS0B 2WUBL 2WWMD 1JF6A 4UU9A 4HHAB 3SO3C 4YDIH 2AKRB 4M6NH 5I1JL 5FHBL 4KTYA 3TBSB 5B8CB 4W70A 4QF1B 5GS0L 4BELD 5FEBA 1KENH 2QQNL 3OHXB 3BIBX 1AGBB 1RZ8B 2Q8AL 1U93A 4P4KC 3D69A 5T1LB 3T3PE 2JIXD 2NY2C 1OARH 3BO8A 5KVDL 4ETQB 5MEQA 2IQAA 3NCFB 3W81A 4QO1A 3U82B 4GBXB 1AGEA 1KLGA 2IAMA 4M43H 4ODWB 2FECL 4MQ7A 4EEEA 2SEBA 1K6QL 2VLKE 1KTLB 3BP5A 2I9TB 1RQ5A 1H15A 4S2SA 4ALAH 1PKQE 4FQ1H 5F1IA 5D7JB 2VQUA 4G7YH 4JO1L 4ZUWA 1A1NB 2KPNA 5CS7A 4QRPE 4X5WB 4GRWB 4M9PA 3ZKNC 2X4NB 4DOHE 3SDCA 1P4LA 5C07B 3MRQA 5D1ZA 5KVMC 4KI5D 2PYFB 3X17A 3AMLA 3CUPA 1SEQH 2WLYA 4RAVA 5D2NC 5IQ7H 1B88A 3UPCA 2VDOL 1JUFB 4HUXA 5CJBA 5BQ7A 4NO5B 5C2BH 3UBXB 3ZE1F 1B6UA 4N1CA 5KSAD 3KS0J 1UYWL 1UCBH 2F5AL 2NY4D 4WO4B 1RUAH 2ATPA 3RZWA 2L0DA 4OV6F 4F7TA 2BSTA 4HLJA 3SKNA 4RDQF 4KZDH 3KPRB 3SKJL 5F70A 1WTGT 5IBLD 3TP4A 1Z9LA 3GBMH 4ACPA 1XGUB 2K7PA 3E6HB 1HKLH 1QR1B 4WTZA 3ZDZE 5DJAB 5EZOL 3HG1B 1EEUA 4R26H 1E4WL 4LSTH 2EDDA 5DFVD 4KQ4H 2FX8L 4L8BA 3GI8H 4NRXA 1IM9A 1OLZA 4YHML 4K3HA 1IBGL 1HXMB 4JFQB 3I6LD 4KROB 4NWUH 4OZFH 4P59H 4P4KD 5SX4H 5HI3D 8CGTA 2BVEA 3QWRD 2B2XL 2V7NB 5EZLA 1H3WM 3GBLA 2X70B 2D7QA 3E8UH 1WV7T 2QQLL 1Z0NA 4WFED 3EZJB 3DXAA 2GQHA 3FMGH 3WHE0 2WIIA 1F3RB 1IGML 3GUTA 1IC4H 3BSZH 3GM8A 4YDVB 3G5XA 4GMSH 3BEWA 1SBSL 4TQEH 4E42B 1FPTL 3NIGE 4NM8L 4F7PA 3PQYD 4B41A 1F3JA 4Y19E 1F45A 3L95A 4TVSa 2NY4C 4MYWB 5CEZD 5DMYA 3W9DA 3QULB 4HBCL 1LD9B 1QEWA 1L9MA 5D2LF 4Q9RH 3O6FD 1IGYA 3HI6H 2NPLX 5EBLA 4DUWA 3TYFB 1MEXL 1AC0A 4WCYL 3S37L 5DK2B 1BF8A 5HHVL 3TVMA 1MJUL 3EAKA 4C56A 2V7HA 1I9JH 4JRYB 3EZ8A 4GW1A 3O2WL 1LMKA 4BH8A 3E0GA 2EIBA 5DJYB 1JYXA 5L88H 2NZIA 4D9QE 2AKRA 1F90L 4LCWA 3DJ9A 3T0AA 4PJHB 5D6CB 3ALWA 4IRSC 4NN7B 4OLXH 1Q0YH 1NCBH 4UT9H 4ZO6A 2YD7A 2P5ED 4LF3A 1IGFL 3T4YA 5E7BA 2J6EH 3BHBA 1FGNL 2EIZB 5FUCE 3TN0B 2PYED 1NBZB 2DAVA 2R23B 4GKZB 4AH2B 5J7CC 4JFFA 1YMMB 4I2XA 2JJTA 1TQCC 3KPRE 3PUCA 2AI0L 2ILLA 4LOUD 3RWIB 4WV1A 4XNQB 4TUJA 4YR6B 3WLBA 5DRNB 1FIGL 4XGZA 4XCNA 5I19L 3S88L 4M62H 1GPOH 5C0BD 3SDDD 4N8VA 3HZYB 2ZCHL 4OLYL 2IQ9L 3QA3A 2WBJB 3RBSA 1WLHA 3SKJH 3IAGC 3D39B 4RAUA 3QEQE 1RUAL 5ADPL 1Q38A 5KVFL 3CC5B 4ELKB 5FA3A 1KXTB 1PJ9A 4NBXB 2R1YB 3U7YH 1I3RA 1RUKL 3LD8C 1QKZL 4LASL 2CDEB 1WZKA 2RR3A 3SDCD 2FJGB 3CH1A 1JPFB 2Y5TA 2MQCA 4LLWA 5DRWA 1FYTB 3TNMA 1WFNA 4ZMAT 3OXSA 3RPIB 3PIQA 3FMGL 5GS2D 1PZ5A 3QIUB 5DJ8A 3GKZA 3E8UL 3VFPB 4YPJA 4U7KA 3MLSL 3OG4B 1D6VL 3T0XA 1EO5A 3O3DB 3DXAB 4GJTB 3IXAB 1ETZB 4LP5A 4I13B 5I73C 1R6VA 1H3UA 5D96B 3V6OE 4UOW1 43C9A 4KUCD 1ORQB 3O6LL 4K23H 2LVEA 4IBLT 1YEGL 1BF2A 3AVEA 2CRYA 2R9HD 3QG6B 2E7LC 3KHQA 2XTJE 1S5HA 3NPSC 4MD4A 1T89C 1QBLL 2PN5A 3MRMB 1BBDL 1N64H 1ZLWK 1NLDH 5D1ZD 1F42A 3C9NA 4LKCA 4HKBA 1FDLL 4NUJA 5HHVH 3SBWC 3WO3B 2A73A 2PTUA 2KQNA 1JGUL 3MR9A 3P9LB 5TE6H 5BRZD 5E8NA 3RGVD 2AJSH 3V0AC 4X80H 1JK8B 2EDWA 4KMTL 3EO0A 3MBEA 5KS9B 5EOCJ 1Y0LB 4Y2DB 3Q6FA 5L6YL 4ZFZB 5IV2B 2AEWA 3B4NA 4MQ7B 1ZLSL 4BH8B 1T2QL 5T1MB 1IAOB 3IETB 3KYNA 4X4MA 1KV3A 4G7VH 3PF2A 4F33A 5JPMB 3GMLA 5I8EA 2WWKT 1HSBB 4UT9L 3D69B 5T1LA 1L6ZA 1A02N 2OK0L 1MFBH 4J3OC 2O5XH 3BVNB 3MJ9A 1Q0XH 1X5HA 4G8EB 4R8WL 3P77A 3LY6A 3O3EB 4MWFA 4P23D 1AY1H 1BQHB 1LO2L 3AM8A 2DKMA 1CDBA 1A6AB 2BVPB 2P46B 4M43L 4JR9H 3SKMB 4RMWA 2ZUTA 5C07A 5J9PA 5IHLB 1IGJA 4UZGA 4LCWD 1GXEA 1QVOB 3GRWA 5JQHC 4W4OA 1K5NB 4Y4HA 1FIGH 1EV2E 2LE9A 5HY9B 4U6YB 5F7LB 3I02A 4LRIA 5HDLA 4GAFB 3UTSA 4XT1C 4M1GL 3T2OA 2ZCHH 3VFWA 3ARFB 1EFXB 1R5IB 3ZDXF 4EZMA 5JZ7C 3H6JA 4UDTA 1I8MA 4KK9D 1VDGA 3EYUH 3RUGB 1F00I 1LE9B 3VFMB 2IJ0C 1JV5B 3HZVB 4LNVA 1UYWH 3PGFL 5DMJB 4I5BB 1YEHL 4QWWC 2V2XB 4MJ6B 4K07A 2W9EH 1OAQL 1OAUH 2EE9A 1HYSC 2P8MB 3OAUH 5J06A 1KLFA 1PBYA 5JQ6L 2UWEE 4R90H 2ORBL 3GO1H 3GSRB 4GRLA 5J1AA 3VFSA 2X4RA 3STZA 4ENED 4TYUA 1FBIH 1ED3A 3LHPL 1NEUA 1HHKA 4HJGB 2W0LA 1Z2KA 4PRHB 2OL3B 4XMLL 1A22B 4IIQC 4L5FL 2UWEF 3MZGB 4TSCH 3T2NL 4XNXL 43C9B 5E9DB 5IB2A 1VFAA 2C4FU 2NW2B 3IFOB 2O26U 4M7LL 3RU8H 4L4VE 4OCRH 4FA8A 1DBBL 3P0YH 1YMMD 1FE8L 4JRYA 3QG6A 3LN5B 5DC9B 2A6DA 2DQDL 3HNTH 2BOBA 1I7RA 5DZOA 3AS2A 5IW3A 3SBWA 3GSNA 3WUWA 3HNSH 1HDMB 3EDEA 2FB4L 3RY5A 1U58A 1G7MA 3ZHLA 3FAWA 3ELAT 4XPTH 4ZPVA 3I6GA 3EOAB 4M5YL 2IALA 2X44D 4NQED 4QRUB 2Q7YA 4JJ5B 5L6YH 5HD8D 1VHPA 2H45A 1A0QL 1IJ9A 3MRFA 4QT5A 4K94C 3WDIA 2OL3L 5L0QC 1QSFA 2OQJA 3KG5A 3G04B 4LVEA 1QFWH 1A4KA 1GOGA 1RUML 1D5XB 3QXWA 3KYNB 4XRCB 4DW2L 1KG0B 1MJ7H 5DD5L 3WNMA 1YY9D 4OI9A 4BUGA 5T5FL 3D85D 4NC1C 4JQIH 1TVDA 5GZND 5I17B 1IM3B 1DVFB 5DD1H 3V6ZA 1NCBL 2C26A 2APBA 3BPCB 3QDME 2ATKA 1DEDA 4DGVH 4MHHI 1UACL 3IKKA 3U7WH 3C60D 5JHDE 4I9WD 5EWIL 2FEDD 1FGNH 1T5WA 2Z0BA 4JFFB 2MJWA 2GKIA 1VGKA 4M7LT 2OI9B 1H5BB 2D7PA 1RJYB 5J12B 4OCWL 3L5HA 3NCYS 1MQ8A 1NFDB 4OZGF 5A43C 1RMFH 1JJUA 2Z92B 1MCNA 4KVNH 1RI8A 4AMKH 4F7EB 3UTTA 2PNDA 1H3PL 4F58H 1O5DT 4L29B 1U3JA 3MA7B 3V5DB 4Y8DC 1AGCA 1AO7A 1MQKH 1RIHL 4S11A 3WIHL 1BQLL 2RAMA 2MMXA 2CPCA 3D3VE 3N1QC 4D0CB 4PJBF 5D2NA 3IDUA 4ZFFA 3EYFB 3QUKA 2FZ3B 1D9KB 2P8LA 4I1NB 1WAAF 2QSCH 3FFDA 4X4XA 3CLFL 3JVGA 5IWLC 4D9RD 4NZDA 5CP3H 4A6YH 3BPLB 5FA4B 4HPOH 3VG0H 4F2MA 2P45B 4MJ4A 5DD0L 2V9RA 3L3OB 2QLVB 5IMLB 1SJXA 5J4MA 4MCYB 2XZAL 3FZUD 3O11B 1YEIL 1KIRA 1U3HD 1EZVY 1RUQH 3RNQA 3WXWH 1V7ML 2RHEA 3LHPH 1XH3A 2JJUA 3W9EB 4IMLB 4MQTB 4XP4H 3EDFA 1U2CA 4FQIH 5JDJA 3H2WA 3VXMD 2XN9D 2X4OB 2FHCA 4P23B 2O5ZL 3LIZL 4X6FB 3DSNA 1F6FB 1JVKA 4FXLA 4LVOB 2GYSA 2Q76A 4JG0H 1NL0H 3G6JB 3PGCB 4NOFA 3DVIA 1EUUA 4Z7OF 1DBBH 3IFOA 4O58L 4YHYC 2XNAA 5JORA 2R2BA 4D9QD 2HJKA 4MJIE 1GZPA 1T80A 3D39E 2VDRH 3TO2A 1BLNB 1FFPB 3SGKA 4K3GA 1A6UL 1UKSA 3CGTA 2P5WB 5CLTA 4YZFE 1BBDH 3RY6C 4P5KB 4DKFL 3KPPB 4GRWH 1ZEAL 3P4NA 1P7QA 4POZD 5LAXB 1VFBB 4K3DH 1D5BA 3I6GB 1C1EH 3FOMA 1L7IH 3OSKA 1JPTL 4PD4K 2ITCB 5SWZE 1WTLA 1EA9C 5D7SH 1MJJB 2IANE 5DYOA 1A0QH 3RWGB 1TCRA 5FO7B 4U3HA 5D72L 5KSUA 1OGTA 1JN6B 3ARGC 1B2WL 2YXMA 3Q5TA 3FQXA 2ZPKH 4M3JA 5EBMA 3OKEB 1R3LB 3FO2B 2N7BA 2W07A 4HW6A 4Q97A 5T5NF 4X8JB 3D2UD 1B0WA 2GTZB 1F11B 4JY4A 3O2VL 3V6OC 5JW3L 1V3KA 1HOCB 2PW2B 4PREB 4Z7WF 3U7WL 3OX8A 2E6PA 1NUFA 3NFNA 3QXDA 4UAOC 2FGWL 1HCFX 3V0VB 3SHSA 2R0LH 4DAGL 4NKIL 4ODSL 2BERA 4RIRB 3DV6A 3WBDA 4KKAC 1U8LA 4PJ5D 3R06B 5LQBL 4M9OA 4P2QB 3WNNA 5GXBB 3RKPA 4POYA 1YY8A 1IQDB 4F9LA 3BIKB 5SX4I 2DLTA 5IM7B 2NTFA 3AREC 4EDXB 4G9FB 3OGCB 3NCJL 3PWJA 2YK1L 3GSQB 1C08B 1LO3H 3HE7C 4K8RL 1IM9B 2FBJH 3OF6A 1A1OB 5HVHC 4BH7A 3D6GA 4Y19B 1U92A 1HWGB 1A7OH 3LQMA 5GRUL 2ICWB 4QNPF 2X70A 1YN6A 3HPLA 5BVJB 1KJ2H 3MXWL 3C9NB 4PLNC 2LU3A 4MNQB 3CLEL 5FYKE 2GUOA 4HBQA 3GNML 2AAVA 2XACC 1YEIH 3ILPA 3FO1A 2VAAA 3NCCB 3KPNA 3WIFB 5B4MD 2QTEA 2WMPA 2IMMA 1U9KA 3HI5H 1BVKA 3QQ4A 4GMTL 3MGOB 4M3KB 4D9RE 1OT1A 1QSFD 1AQKL 3MA9L 3SDXF 4Z95L 3UTQA 1U8QB 5IROA 1MRDL 4CAGA 4IMLA 2E8ZA 3UJJL 2E3VA 4KK6D 4TVPH 4OKDA 2JJSC 5FGSA 3ETBF 4QTHA 2OJEA 4HMDA 4MNGA 3UZEA 5HHMB 1R5VA 3MNZA 4OGYL 3CIQA 1HNFA 1GIGL 2EKSB 5BZWA 4LLQB 3MZTA 1OGAD 1MPAL 5K9KB 3UZVB 3PWPA 3H3PH 4XBPA 2P44B 4X9FA 4FS0A 5EIIB 4ELMA 4FFZH 1NDGA 4GG8B 2X10A 4YHIA 1PAMA 2BOCA 3FKUS 3KPPA 3HAEG 1KEMH 4H20H 5DUBB 2DYPB 4U3XA 5EIVA 1X6NA 3DI2B 4H8WH 1RIUH 1ZTXH 4U1NA 4JRXE 1S9YB 5AAMA 3MJ9L 2JIXA 2EYSA 2IPTH 3RHWK 3TA3D 5F1OB 3QQ9D 1R3KA 1S7WA 4HKJB 4ZSOE 2R23A 4HXAH 3BH9A 1FNAA 1KACB 4TULL 3JWOC 1MCSA 3OKEA 4D2NA 2HAZA 3QUXA 1C7SA 5IK3A 4WV1B 5LCVH 3F7YA 1HIML 4DAGH 4HCRH 5C0CE 5HGDA 4S1RL 5DD1L 4ZOEA 5MI0B 1R3HA 3V5HB 3C6LA 3K8KA 2CIKA 2DBJA 2FYYB 1Q1JL 1N0LA 4MB3A 3BP4A 2R2EA 4QHKJ 2YZ8A 1ERNA 3MRNA 4G80B 4PJCA 1AJ7H 5KN5A 5DEFB 1KPVB 4BQ9A 3ARUA 3EIFA 2RFXB 1QQDA 4HKZB 1JGVL 2IANA 4N90D 3U2SA 4OCWH 1LEGA 3VFVB 4F2MB 3HMXA 3Q0HA 4IRSD 1KXQE 5T1DH 2GY5A 3K2UL 4FABL 5HGBB 4F7PB 1VEMA 2LQRA 3CH1B 4G6AC 4X6BA 5DXWA 1JGLL 1VPOL 4RRPG 1TVBA 3PP4L 3FFDB 1KIRB 3MRHA 3QBTB 5GHWH 4PJ8C 4X4XB 1Y6NR 1WC7B 3QHFH 4IRJD 1RZ7L 2A77H 4S1SL 1QFPA 3WKML 4N8CL 2ICEB 3BGAA 1LK3L 2CLRA 3QUMA 2X4UB 2J8OA 1A4JB 1RZIA 5L2KB 3TO4A 1DQJB 4QEGA 5FHAH 3TJEL 4LK4A 3BKCH 5A3IC 1W0WB 1O7SA 3G5XB 5I16A 2IADA 4QCIA 3HE6B 3RQ3A 4P2OA 3MX0A 5DD0H 4K7PX 1SHMA 4WW2A 5KVDH 4XBGB 2YUWA 4XPHH 4JG1H 1VEPA 3VXUD 3IS0X 4GW4A 4R9HA 4XMKH 1RZKC 3S37X 5I8CB 1PEWA 2UVFA 1A6VL 3MRPA 5ABDE 5HYEA 4JFDA 3AU1B 3EOTH 4S1DD 3D2UB 4OM1H 5C7XH 1A7BA 3CZFB 4UT7L 3UJJH 4FQHB 4DZ8B 4PJAF 1SY6L 2VLKA 4L8BB 5C0IA 3QEUB 2V5MA 3THMH 4N0YL 2VC2L 3BPCA 1S7SA 5D1QB 4ORGA 5IJVB 4PJ9A 5K9OA 3SPVA 4XWOD 4Z77A 3BHBB 4WU5A 1F6LL 3RTQA 2G60H 4KJPC 3G9VA 4WUUB 1ZK9A 3VWKC 1P2CA 3DARA 4N0CC 3ISWA 4RGOH 5GRYA 1T20B 5HGAA 2CLVA 5IHZB 3VXRA 1MCDA 2BVYA 4ELMB 2DQUH 5EIIA 4RAVB 3BKJH 1FDLH 2QKIB 3SDAA 2FWOA 4Z78A 1NJ9B 1FNLA 1KEML 5IESL 1H3XA 3PJSB 3X11A 2QL1A 3DSFH 2V2TB 3SQOH 4QRSB 4N5EC 3G6JE 3MV8E 3QEQA 3G5YB 3V2AR 4YHMH 4WEUD 4X7SL 1KPUA 4CU6A 1L7TH 3SE8H 2W9LA 1F4WH 4AEEA 1BMGA 3QHZL 1XGUA 1H3GA 4ODTH 1QR1A 4O2CA 4JKKA 4EVNB 1DBAH 1VENA 2ZNWA 1DBMH 4X6DA 1OAXH 4L3AA 3QAZC 3CFCL 1D7FA 3DVGA 2EZ0C 4JPWL 2W9DL 3U0PB 2Y7QA 2A74B 5IT2L 2Z35A 1MIML 2W60A 5J11C 2R4SH 1FNHA 5MERB 1MREL 3KLHD 5I75B 1EEZB 2B1HL 3U4EB 3OAZH 2MPAH 3L9RB 3X12A 4GLRH 1MCQA 4XPBH 1GGUA 3BESR 4P5TD 1N5AA 5EZIL 1UADC 4YXHH 2KL6A 1M7IA 5DC0A 1KF9B 2FDBP 3O41A 5CZXC 3QUXD 2ZUQB 1JHTA 5D5MA 3W2DH 2NYYD 5E8EA 4JFED 1FV1B 4PJFA 1I3UA 2NNAB 4PLJD 2E6QA 1CD1B 4R3SB 3QQ4B 2FX9L 1OGAA 1R24A 2A9NH 4PJIF 5DZNA 5J1AB 2VLLB 4HUWA 3E3QE 4OFKA 5EUKA 2WBKA 1U6AL 1AE6H 3MRJB 4K7PY 3ARBD 5CINH 4QF1A 1I7TA 1GGIL 2Y07H 2BVQA 1CDJA 3JVGC 1DN0B 3QJHA 1SEBA 5LAXA 4B7IA 3SDDC 3QDGA 1RU9L 3OAUL 4EQ2A 4H25A 3MR9B 3P9LA 1WAAE 1MAMH 3MRCB 5ENWA 3T0EB 5MEND 4FRWA 3GO1L 1NGXB 3ZYOA 2NLJB 1CU4L 3GI9H 4D0DA 4HJ0C 1IFHL 3CFJA 1VSCA 5DRZA 1RURH 5T1KA 5KVGH 3RL2A 2GCYB 4EN3B 2RBLA 4R6UA 3KPMA 4M00A 2AV7A 5JOPE 1EVUA 4JY4B 4Y5VC 4LQFL 5TQ0L 2YPKB 4XNXH 4P3WA 1ZSDB 1P1ZB 4TSAH 5MEPA 1GCFA 1I9RH 2BVOB 3QJFA 5JLZB 1CXEA 4K71C 4I4WB 4KH2A 5KS9F 2NY0C 1NCWL 4MJIA 5D5MF 2VXQL 3T0BA 1NGYB 4WFGD 2LAGB 1LEKB 3ESUF 1ZT4B 3HMXL 2IBZY 4F15B 2NXZC 4G6MH 4U4BA 2YD3A 3CFKB 5D70H 1IL1A 1H3VA 3LH2H 3VWJD 2A83B 1PEZA 4PGBA 1BJ1J 4MZ2A 4NPYA 3I3EA 1RHFA 1MPAH 2FBOJ 2ENSA 1GC1H 5KW9L 1HSBA 15C8H 3H7BA 4M8VA 5C70A 1P84K 4H88L 1NJ9A 2ZKHH 4PRNA 3ARDC 1A3RL 4NZUL 3OKKB 3MMEA 2A6IA 3OKOB 1TTGA 3OBAA 1F4WL 5I1KH 4LHUD 1R3JA 3VFRA 1NC4A 2VIRB 4LVNC 7FABL 1N59A 3BUTA 2CSPA 1KB9J 3CC5A 4KXZH 3GIZL 4EN3C 4I5BA 4EDWL 2VNCA 4YFEA 4LVHB 4HKBB 2A2QT 3KPSD 1I9IL 2MQ0A 1J05B 4HWBA 1ZWIA 3BZ4A 3SDCC 3F7YB 1F97A 2P8PA 4HWNA 3QPQC 1Z5LB 3GGWB 4LSPL 4KKCC 2W9DH 3AXLA 5SWSA 3QI9D 1K85A 1J0HA 1AQDA 3LS4H 3TIDA 4ONGH 4HK3J 1YZZA 2YR3A 1PZ5B 2P42B 4NJ9L 3VXOA 1J8HB 3C8DA 4A2MA 4PYGA 5E6IA 3NZHL 5HPMA 3TIEA 3T8XB 3MUHL 1OP3K 5A1AA 3SCMB 5C8JB 1EERB 1EGJH 3SQBA 4Z7UB 5GSVA 4PG9A 3DX8A 3C8KA 3MREB 3SE4C 3ZE1E 3QCTH 5D7LB 1IZKA 4XCFL 4HUVB 4OF0A 2B5IC 1YUHA 2ZUQC 1CXFA 2HVKB 3RTQD 1QSFE 2J8UF 3GKWH 4D8PB 3O8XC 2R8SL 2MTPA 3U0TA 5E70A 3OV6A 1C7TA 2C3WA 2LTQB 1B90A 2F53B 2CLRB 1KENL 2QQNH 4BK4A 2DQFB 1MFDL 4CMHB 3MUY1 1J1OL 1ODAA 4P49A 4RX4D 2E9WA 3VG0L 1FVEB 4Z0XA 1LK3H 1WFUA 2VDKL 2OK0H 5JR1L 2CMRH 1PD6A 3PGDB 2XXMB 5EU3B 1CXKA 5FHAL 5DJCA 1XF2B 5T3ZD 1YJDC 1MAML 1D5ZB 2I26N 3MV9E 3M8OL 5LXGL 4IMKC 3NGBB 4HG4K 1OP9A 1FC1A 4LCIH 5ISZB 1SYSA 2X2YA 5DJDA 3OKLB 2R9HC 4GKZA 3VXUA 4WUUA 3G04A 3LN5A 2ZUUA 1YMMA 3F7VA 4UTAL 1UENA 2HJKB 4JG1L 4LQFH 5TQ0H 5FUCC 1CLOH 1MHHB 3RWFB 2Y1VA 1A6VH 3RX5A 1G0DA 1G9ML 4YR6A 3REWA 4OGZA 3EO1A 4U6XA 4QXWA 1QLFA 3OKDB 3BWAB 1TITA 3CVIL 4UOJA 3QDHA 3EYVB 2I07A 2HFTA 1YEEH 3VXPB 1KIUA 2O5YL 5D2LE 3ZE2E 1C16A 3QNZA 3MV7D 5DVMA 2GW5A 3RWHB 3V4VL 5F9OL 4JFZL 5BV7L 1AFVH 1LVEA 3MJ8B 1YNLH 4X4YB 4LCYB 2VXVH 1H5BA 2NXYC 1TVHB 4Y2DD 3ARYA 1T4KA 2WWKO 1A6UH 1IL1B 3CVHB 4YXLH 1G7HB 2WIMA 4LRIC 3KYAA 3E1F1 3VXSD 5E4EB 1A3RH 1QG3A 2VXSL 5IOPB 2YSSB 1FLRL 4PLJC 3QZWB 3H8NA 4OIIL 3DHMA 5CP3A 4ZFOB 4GUPB 5D1QC 1HINL 2E9IA 4OV5B 3QXAB 1EEYA 3ARQA 3QULA 4M7ZB 2QQLH 2Y36L 3SDXA 1IAKB 3FQRA 4OLUH 4WI6A 2BRRH 2VABB 1A4JA 4XHJC 3M45A 4LAQL 3QDJD 1DQJA 5DFVC 4ZS7H 1OP5H 2UVEA 1UKQA 3VWJA 1A9EA 3QNXB 2F53E 2V5YA 1JWMB 3KYOB 4X6CB 4ONGL 3D0VA 5I71C 3UTTD 2HN7A 1P4IL 3RVWC 1UM5L 2P4AB 3VFSB 4M7LH 5E8EB 3RU8L 3HS0B 2DMCA 2D7TL 4ZD3L 2V7NA 2LU4A 4UB0L 3OGCA 5HHOB 5H37G 1S7UB 2XV6B 4X6DF 5SV3A 4X9GA 1CZ8L 4YHLH 1MEXH 2EDRA 4BQBA 2YC1A 2HLFC 1IEAB 1X5FA 2Z93B 3V0WL 4PJ8B 4BJLA 2ESVD 1I1YB 4XPBL 2ATKB 5IBUB 5K9QG 3ALXA 5C0DA 5I30L 5IW6A 1CFSA 2FB4H 1CXIA 1A7NL 4IDLA 1ZANH 2Y25A 2LABA 5E2UL 1Z9SA 2R69L 3P4OA 4X6DE 4X99B 4Z5RA 3O0RH 3RIFF 3C60C 2E7MA 4RA3A 4HUWB 4NRZB 3IAQA 3FN9A 2GEEA 2BNRB 3U9UB 2OZ4L 1MFDH 4PJGA 3LEYL 2NY2D 3EFDH 1BQSA 1U91A 2J88L 2HT3C 1BAFH 5ANMA 3QQ3A 4FFWD 4HUXB 3G6JF 3M8OH 2DDQH 3QDAA 5HHNA 4CJ1A 1EJOH 4K8RC 3BE1L 3WKNA 1I7ZB 4F7TB 1NC2B 5BOPA 3QH3B 1JRHH 5FFLA 4G9FE 4WV1C 4XVTL 1AQKH 2YPLA 3MA9H 3WIIL 1PW3A 3WSQL 3DROB 5BMFH 1J1XH 4NNPL 2YD1A 3L5IA 4LHQB 4PB9L 3FO2A 1L0QA 4J4PA 1A14H 4P2QE 1WBYA 3BRGC 3RJDA 1DCLA 2AXHA 1QSEE 4RGNC 5E08H 4WFHE 1B6DA 2AEPH 3TV3H 5JOEA 1WBXA 3K4DA 1G7LB 3NABH 4MJ5A 4RISL 4X0KA 3IGAA 4AIXA 4TUOB 3DV6B 5JA9A 1SJEA 2YD8A 1ZLWH 3VD3A 3QNYA 3D3VB 2ICCA 4BSVA 2IGFL 2ARWA 5I1AA 1MH5A 3L1OL 2IBBA 4HK3N 5ALCL 3H9SA 1QKZH 2XRAH 3FONA 3CPLB 3GMLB 4NQDA 4FFZL 2VL5B 1RFDH 5TFSL 1MWAL 3QEHB 4JFYB 1JYWA 1E28B 3QCVL 2VYRE 5IBLC 3PWNA 1IM9D 1JZ3A 1UGNA 4AQ1B 2UUDH 3TFKD 2GSIA 5I2IB 3HPJA 3RVUC 4JDVA 1AKJB 3RDTB 4M1DH 5AZEL 1OY3B 3JTSA 4NT6B 5SWQB 3MRJA 4RFNC 5FYJH 3MV7A 4LSSH 4Q0XL 1INDH 4KJQD 5BVJA 4KJYA 5H2BB 3TO4D 1DDHB 4JREC 1ROWA 2OP4L 5EU5A 5KANG 5FECB 4YFLF 1P4BH 3QEGH 5JPNB 2Q6WA 5C6WH 5HY9A 1RV6X 4P2OD 2UZIH 1U95A 5FOBB 4G6FD 3ZYJA 1A2YB 3QO1B 2BHUA 3VRIA 4QRPD 3FT2A 1BVZA 5C0EB 3B83A 3PIQB 2D7TH 5D6CA 1ZHLA 5DWUH 5H35A 1HQ4A 1OD9A 1NLBH 2VLJE 2Z8VC 3F12A 2DRUA 3N85H 1IKNA 3LZFH 3AB0B 5H8DA 1U8HB 5I8OL 3O4LE 3IU3A 4O02L 2YRLA 3HE7B 4HXBL 4KV5F 4W6XB 4KKBD 1JTOA 1NGYA 2E7CA 3M17B 4HC1H 1MLCA 1I9JL 1N26A 4Y7MA 2R4RH 3ARWA 2ZCKH 3PHOA 2CKBL 4S1SH 4NP4L 1B3JA 1K8DA 5SX5K 3QWQB 5F9JB 4JCLA 4N0CD 1UVQA 3LEYH 1UB6A 5C0AE 4B53A 2DDQL 1U91B 4UT6L 2B0SH 5IF0B 1ZT7B 1G7QA 4NBYB 1FCCA 4J3VA 1MAKA 3D0LA 3KNBA 4MXVF 3VXMB 2OTPA 4U1IB 5F89A 3OR7A 3OKDA 4D0BB 2VLRB 5AD0A 4LARH 4XXCC 1S7TA 4PJXE 3G6AA 4UBDC 2AW2A 3CX5K 4JN2B 3TBYB 3E3QC 5I6XB 1BEYH 1F13A 3RWHA 4HKJA 3I2CH 4CADB 3U6RA 1XGYH 1OLLA 3U36A 3AS3A 1Z3GL 2GAZB 5DJ0A 2I60H 4QHLA 1IAIM 4EBQL 1INEL 3GSNB 1NBVH 3UTTB 3WUWB 2KQMA 1AR1D 4KUZH 1MCEA 1URLA 1FO0L 5IB4B 4NO3B 4KJQC 1ORSB 5DUBA 1KCVH 1IGIH 5KZCB 1GPOL 3BDXA 4X0KB 3O45B 1XF3A 2JCCA 5J1TC 1GHFL 4U1KA 1FL5B 2O5YH 3ARDD 4MD0A 3WIHA 1DLFL 1KIQA 2CUHA 3TA3A 2OMNA 1RFDL 2OSLB 5FUOL 1JPST 3FL7A 3U30B 1A4KB 1LP9E 1YNLL 2EICA 5B3JF 4L8CA 3WJLC 3GSWB 3BKJL 2V17L 4RFEB 2WV3A 5IG7B 1HEZB 1UC6A 1NUGA 3HMWH 1CCZA 4JY5L 3QSKB 4NHUA 5M94B 1TVBB 3O11A 3UYRH 2GJJA 1QRKA 5CILL 3CD4A 4Q0XH 4R97B 4M1DL 4KHTH 5I1GL 5J13B 4YX2L 6FABH 1LE5B 4C83A 3IDYC 3TZVB 2AABL 3PWVA 5B8CA 4GXVL 3L7EB 5FK9A 4KU1A 1FO0B 5CGMA 1T03H 2EC9U 2OL3A 3CU1A 3B9KC 4OAWB 4BFIB 2XWJB 4L4TA 1MCFA 2ADGB 3ROLB 4KK8D 5BS0A 2UZIL 3O41B 1F3JB 3IETA 2CJUH 3QO1A 4IOFD 4PFEA 3VRIB 4MGXA 3UO1H 5C0EA 2BHYA 2FLBT 4HQQH 5GRXG 4HLZG 3MRKB 4OQTL 5I8OH 3X13B 4HJGA 4JM2F 5FGRA 1OSPH 4UB0H 3WNKA 4ODXB 3B9KB 3VGAC 2HTLC 4LP4A 1JNJA 4PJ8A 1G6RL 4HIXL 3GBNH 3PNWA 2KUTA 5DJ6B 1R5WB 2GJ6D 4TPRH 1GL4B 4TOYL 3IDYB 3JXAA 2HT3D 1R3HB 3V5HA 5DQJB 1N5YH 4MA3B 1FYTD 4QOKD 2X89A 4LPVA 1WEJL 2ADFL 1T66C 3NH7L 4ZPTA 4WU5B 4DN3L 1S7QA 1S9KC 3MBED 3LQAC 1J0YA 1ZHKA 4U1SA 3IDGA 4QKXB 4CMMA 3MRFB 3WFDH 2GT9A 4YDIL 4ZQKA 3VCLB 1T2QH 3O3UN 4LIQH 1OAKL 2QJDA 5DSCA 3C87A 4JFDB 1GGIH 5HDBF 4UT6H 2AJXH 2GCYA 3REVA 1G7MB 3FQWA 4OM0L 4I18B 3FAXA 1OARL 3DV4A 1C12B 3RJQB 3E6FB 2P5EE 4FHBD 1BAFL 1JHKL 2APTA 4XXCA 1PG7W 1U93B 1P1ZA 2EDXA 4I4WA 1EEYB 3BW9A 3OG6B 4PJ9D 3DX7A 3S97C 1LK2B 3ULSB 1P69B 3S34H 5JW4N 4ONFH 4RIRA 3IGAB 1KLGB 2IAMB 4ODWA 5EN2B 2AJYL 1EVTC 5TF1L 3TO4B 2UY7A 3MRBA 4OI7A 4G43A 4FMFA 5CSZA 2F58H 4Y4KA 4Z7VE 5C0GB 3KPSA 5BMFL 1N6VA 1J1XL 4JAMB 3JTTB 3NCYP 4TSAL 3FZUC 4HJJL 5TDNA 5D71L 3LQAL 4Z78B 3QQNA 3O6FC 4U0QB 1I75A 1X4XA 4HFWB 5HJ3A 4R0LA 4UU9B 2Y5EA 5AG8A 4Y4FB 1DUYA 1BVLB 3IXTB 3FQNA 4YZFF 1NFIA 4H0IA 3VI4F 3QFJA 2EDBA 2XTJC 4NHCL 3HZKA 3PGFH 1KC5L 4XAWH 1E4WH 1XF5B 3ARED 5K9OB 4ZS6D 3T0DA 5EZOH 5F7YC 3ABZA 2QSTA 2YOCA 1IBGH 4G5ZH 3IFLH 5C6TH 4KQ4L 1EO7A 2J4WL 5HDQH 1Q72L 2GK0A 1RK1A 4N9GB 4JVPA 2AXGB 1R24B 2A6KA 4AL8H 12E8L 4RQQB 4LCWB 2QEJA 4EUPB 1DJSA 3P4NB 3STBA 3UMTA 1I9IH 4I3RL 3AB0C 1UQSB 1FFNA 5FM8A 5I16B 1JUFA 3WXVL 2FHBA 1T7WA 2V7HB 4YHOH 1KB5H 3F65A 4Y16B 1AC6A 2IPUG 4XHQA 3T09A 4OQTH 5C08B 2VDRL 3K3QA 1CD1A 1Z6JT 4EN3D 1I8LA 4WFEE 4JKWA 2YA2A 3H7LA 4LLDB 1N3NA 4LSUL 1HSAB 2EDQA 3D87B 3S37H 1J0JA 4KFZC 4JREB 3M07A 4NKMA 4HPYL 3CMOL 3L3GB 4RGMC 1HI6A 3AGVA 3MCLH 4EQ3A 1DQLL 3VJ6B 4XPTL 1UZ8A 4P4KA 3WO4C 3P9MA 1A64A 4FTVE 1RZJH 4N8VB 4Y4FD 5LWYH 3JBG7 1NCTA 3TLRA 4HIJA 1GGYA 2AK4E 3V6FA 2GSGB 3Q6GH 1F90H 2Q87A 1C5BH 1ZE3C 4PRIE 1BGXH 4CMMB 1DQDH 1QPXA 3BH9B 1OAKH 2XZQH 5GGTL 1QFWM 1X5XA 3H9YA 4J2XA 4PJDE 3UTSD 1L6XA 2VDKH 1BOYA 4YBHA 3P0VL 3QA3B 1D5BB 3FB6A 1EK3A 3S34L 5T5NG 2NMSA 3KS0H 5CCKH 1J0IA 3TBYA 5D7KE 2CIKB 1KOAA 4GQ9L 4JDZB 4Q6YA 3VXPA 3QIUA 1U41A 4Q9QH 1PG7H 3HNVL 5KG9B 5K9KA 1KPVA 5DJ0B 5IMLA 5E8OB 4PJ7E 4N0UB 2FX7L 3BUYB 4P0DA 2UWEA 3LRSB 3O4LB 3QO0A 3MLUL 4WI8A 2YWYA 4XP1H 5I74B 1Z0MA 5HYSB 1KBGL 1H3PH 1KGCD 4GG8A 4YHIB 3ZTNL 2AP2A 2PW1A 1XR9B 1LO3L 3WIHH 3BIKA 4LSRL 1KB5B 1BVLA 2QHRH 4YBLC 3SCMD 4XNZC 1T1YA 5KVFH 2AGJL 4N0UE 4FFYH 1ZA6B 2H26A 3NPSB 4R7NA 4ZTOH 5GRVK 2I9LB 3MRGA 4XC1H 3C8KB 5EO0A 5KTEL 3HC0A 3QUXC 5DK0A 5DMGD 4P2RA 5F6IB 4MVBD 4JRYD 3C60B 1MLCB 3HMWL 1U3HA 5LGKA 2FEEI 4IOSD 1AIFB 1QFHA 1OM3H 4JO2L 5I73B 1G7PA 4FXKA 4Z95H 3MQIA 5EU6A 3VXOB 2ICWJ 1SYVB 1X5GA 5GZOC 4UV7L 3QIUC 2IH3B 2LV4A 4NQEA 5DEZA 2DTMH 3BP6A 4IIQA 4OTXH 4YDKL 1ZLVH 1KULA 3LKQB 5FCUH 3QFJE 3PABB 2E27H 3NFSL 1XGPA 5AUMA 1DANT 1MHCA 1M71A 3EJZD 2GJZB 1ZHKB 3HKFA 4YPGA 1X9QA 1D9KD 4E41E 4AENB 3JUZA 1K8IB 3FOLB 3UPRA 1XIWA 2DM4A 2XTLA 2IG2L 3GMQA 3PWLA 2X1OA 5DT1H 1V05A 1VADB 2HP4A 2V5RA 5FUZL 1OSPL 5FDWB 1CFVH 3VFUA 2WBJC 5LWYL 2JB6B 1MCPL 3G5ZA 3I02B 1V3MA 1JZ4A 1ZS8B 4ZAKA 4HUUA 4UTBL 3Q1SH 2R69H 2EDFA 2NY5L 2C3XA 4YO0B 5D7SL 1RSFA 2XZQL 1I8MB 3CFKA 5DQDL 1PY9A 3DIFB 5GJSH 1JV5A 3HZVA 4WIQA 4LEOA 4R4BB 4XRCA 4U1LA 2RB8A 1JPGA 1MFBL 3FQWB 3EJYC 1U3YA 4LIQL 4EI6B 1T7YA 2OR8A 3U4BH 5E24E 3TN0C 3PWJB 2R29H 1OAZL 4FP8H 1F4HA 4O00A 3RL1B 3QXVA 4MAYA 4MS8D 4FN0A 3OPZL 3A67H 5GS0C 4S1QH 2XQYK 2HH0L 4LPCA 3MRDA 3WS3A 5INDB 5BO1L 2FX7H 1DLHA 3MLRL 1T4KB 1RIVH 5JMOC 3GM0A 1RJCA 1A7PH 3T04D 3PV6B 5J9PB 3MLUH 2VJXA 2VXTL 3IF1B 5ETUA 1NSNL 3QUZD 3PL6B 4LU5L 1MFCH 3X14B 4K9EH 5EB9A 1HH6B 3BD3A 3V52H 3HAEH 2FSEB 1U8QA 3OF6D 3QFJB 1MIEL 5EUOE 1NANH 3REWB 3BQUA 3IDJA 3SGJC 3MRIB 2VLKB 1A7QL 5L8KB 2VN4A 1I1YA 5HHXL 5TFSH 4CMHC 4KJYB 4PY8I 1CXHA 5BVPL 1KTDB 1OAQH 5DJZB 5H94A 4MA3A 3TN0D 5HPOA 4X7TB 1N7ML 4DCQB 2X09A 3U0PA 1A6AA 1YECH 1FBIL 1JNLH 1MNUH 4PJ5B 2VO5A 2J1KA 5FO8B 5D1XB 5F7DB 2BY3A 5B39B 1MCRA 5CEYB 2EDNA 4M7JH 1SY6H 1S7UA 3MRPB 5FV2A 3GHBL 4PR5B 4P3DB 1CICD 3DI3B 4OTXL 4KROC 3VFWB 1MF2L 3EDKA 4OCRL 1I3GH 2IPUK 1QTYT 2DMBA 3OTTA 1CI5A 5EO1B 4U0RB 3NN8A 4KTDL 5C2UB 3MRLA 2HKHL 3FTGA 1DL7L 1C5CH 1FN4A 5CEXB 5E00B 5F1SA 4JFZH 3L5XL 3W11D 1IAIH 4QRTA 3UJIL 1TJGL 4OBSA 1FL3B 3SDCB 2XY2A 4DGIH 1CYGA 1PQZA 4WO4C 3TPKA 5LGHL 4TSBH 4NZTH 3K81A 3UAJD 5C0BA 3SDDA 2D9CA 3BP4B 4ZO8A 2HFGH 4G6JH 1C16B 4M7KL 3MGAA 5D2NB 4ZFFB 2AXFA 3MUJA 3KXFD 4AZ8A 3ARDB 4K7PH 2XY1A 2RFXA 3P40A 5I0ZA 3DIFA 2EKJA 2Z92A 1J18A 4HK0A 1AR2A 1BGXL 3ULUH 2HVJB 1X5IA 4ZSOB 1H3TA 4YQXH 5E8OA 3FB6B 1E4KC 4J4PC 1FG9C 4J8RB 5HHMD 4GBXC 2NNAA 2UWEB 3FQUB 2R4SL 2NXZB 3EYFA 2J5LC 4X9IA 5CHNB 3RDTD 5IB4A 2NY3C 3WEXA 5L7XH 4M93B 1HXMA 4JFQA 1QNZL 3KLHC 5F6HI 5JXEA 3I84A 1AKJA 3B43A 4MS8C 4B5EA 4JHWH 1BHGA 2HH0H 5DD6A 1AD9A 2QSVA 1LNUA 3K0WA 4FOMA 4K71B 4GQ9H 4GG6B 2X40A 1RY7B 2I5YL 4Y5VB 2R1WA 4XNMB 3SO3B 3VFGL 1NGZA 4EBQH 4YAQB 4MCYA 4L4TD 3WS6C 3GSWA 4X9BA 4JEGB 4E5XA 3L3DB 3H7BB 4NQDD 1A9BB 5DJXA 1YEKH 4XP1L 4J7RA 4X7FC 1CVRA 1J10A 3KYKL 1ZAGA 3MLYH 3PP4H 4NQUA 4LLDA 1R3JB 1NMAL 3W9DB 4KZDL 4PV8B 1ZA6A 2H26B 3ZKXC 4NKOA 1A7QH 4U6HB 3PWVB 4J6RH 2GJ6A 4K8RD 3T2PA 3RY4A 2X41A 5F72S 1UFUA 5EU3A 3C60A 1XF2A 1BD2D 3I9GL 3N1PC 3BGFB 4JZOA 5CMAA 2I9TA 2JELH 4KMQA 5FGBA 4APQC 1U95B 3NACL 3QYCA 1XGTB 3MRCA 5ENWB 3EJZC 4LOUC 3WN5A 1MNUL 2CDFB 3STLA 3TIDB 3SEPA 1RJYA 1VACA 1IRAY 5C6PB 1Q9KA 3ZKND 4QRPA 5IHZA 5C0AA 3WIIH 3WSQH 1OM3L 5GGVL 1UWGL 4C4KO 5CD5D 5I1LB 1AXIB 1I7TB 1NCDL 4PJEE 1AO7D 4U6VH 2DKUA 5HPMB 1I9RL 1RVFL 1VFOA 3DGGA 2NY3D 5CKAA 5JNYB 3RWJB 2L7JA 3IU3B 4ZXBC 4U3CA 2HKHH 2OJEB 4NDMA 1MHEB 2DTML 1V3LA 1U8NA 1NC4B 2VIRA 4U1JB 2QADB 1EHNA 1UB5B 1XGQA 4WI4A 3GMMA 3QWRA 3PGCA 3U0WL 1K3ZA 1SQ2N 4JQVC 4UIMB 1YY9C 3TT3H 5B3JE 3MYJA 3OB8A 3DUUB 1ITCA 2LFGA 5L2KD 4RMUA 1TJGH 3BZ4B 4Y4KD 1YDPB 2L4OA 1TZIB 4KUCF 5IEHB 3BDYH 5JIHA 2Q6WB 1NGQH 4OLZH 1W0VA 4P2QA 1X4ZA 5J57B 3PG2A 3JWDL 2Z91B 5IF0A 3NCMA 4JFHD 2BVOA 3MACH 3C09C 4ZNCD 1DFBH 4LHJB 5MERA 2BMKA 3UAJC 1QRNE 1NGWA 5J56B 4CJ0A 3HE6D 3QUML 4KK9C 1UWXK 2ADIB 4KXZI 4XC3H 5AD0B 4PGCA 1ZT4A 2EYSB 32C2A 4BSVB 4WWID 2NY5H 4PJHE 4U1LB 5C9KA 4WDIA 4UQ2A 5FV1L 3MV7E 5K33A 4NPYB 4LCCC 4HG4J 1T21B 5CEZH 2VDPL 4LSPH 2NR6D 1IGFH 4JAMA 2DD8H 3F58L 3L3HB 4KMLB 5BV7B 2VL4A 5JW3H 1MFEH 1TJHH 3JTTA 4ODSH 1YYLH 3OX8B 1KIPB 1E4JA 1W72H 1T6WA 5HI4D 4XP9L 5SWQA 4DK6A 5ID1A 1Z9OA 3R0NA 5FF6B 4TTGA 2FATH 3HPLB 2IC2A 4CVXA 4AJ0A 5JXAL 5KN5B 1GGTA 2PO6B 3QJHB 4P5TA 3BXNB 4M4RA 4WVRA 1P7QB 3BQUB 3IDJB 1GAFH 5FECA 5CJXA 3CFBB 5FCSH 4M6OH 4NZRL 4U1HA 1I1AB 4L9LB 2XQYG 5I19H 4NM4L 4JFEA 4X7TA 1IQDA 1RZFH 3ULUE 2RCSH 1FSKC 3ET9F 2IQ9H 4KAQH 4NNYB 4XCCL 2VE6A 4OFVA 4L3EE 2X1QA 3MRIA 3MXWH 1AKJD 4HV8B 4OZGA 4PJGB 4YDLB 1A7OL 4L4TE 4PB0L 2D2OA 3DVNA 4FZ8H 1QSEB 3JV4B 1JZ5A 1S7VA 1XR8A 4Z9KB 2YPLE 2AERT 4QOKB 7CGTA 4ZUSA 1WWAX 4F8QA 5I76B 2OBGA 5K9QI 2UYLA 4R90L 4JO3H 2ZUXA 3CH8A 3QIBC 4BA8A 2V6HA 4S0SD 4JM2B 5TQ2L 3MGTB 2R0ZH 4OGAD 1U8LB 4TVPD 1EHLH 1INQB 1NCDH 1TJIH 3NFPA 4U6VL 4AIOA 3S36L 4OCYL 4U7MA 4HGKC 2HWZH 2YSSA 1SM3L 5IVNA 1OVZA 3QEUA 4O51A 1CTOA 4N9OB 5DD3L 1BM3H 5BW7A 3QXAA 4WRLA 1WBXB 1HHJA 2J12B 4WENB 1EX0A 5MI0C 2NZ9D 4HS3A 3MV01 1QR4A 3CDCA 3WFCL 3MRDB 4V2CB 5INDA 3WS3B 4RDQG 1K4DA 1U8MA 3SY0B 3WL9B 3DBXA 1BZQK 5GIRA 5GS2H 4EIGB 5DRXA 4DOHB 4C56D 1FLRH 4FQ2H 3ARBB 4L3CB 4Y5XB 3FFCE 3QI9C 5EBWB 2V17H 2V5TA 4HMEA 1JZ6A 2FYYA 4P46D 5MHSD 3F5WB 2H1PL 4FQJH 1J9CT 4QRSA 5GGRA 3B9EA 2O93L 1MWAA 3MV8D 3Q6GL 4UV4L 1RUMH 2X5PA 3GB7A 4HXAL 2COQA 3DETC 2VZSA 3RI5F 1NMCB 1TVHA 1DBKH 4LL9A 5FYLL 5C0JB 4O4YH 2H9GA 1UWEH 1MAJA 1ETZA 3BX7C 4JFHE 5A2IH 4UDUA 3F8UB 5EORL 4DKEL 3MLTB 5EH1A 1FZJB 2XICA 1FZMA 1X5KA 2IH1A 1IC1A 1NKRA 5IHBA 1LEIA 1CFTA 1TQBC 3P4OB 2D0FA 1JE6A 3AAZA 3D1MC 2EE3A 1LHZA 5T3XE 3MRMA 3T77A 3QXUA 2CJUL 5EU6D 4XB8A 2NW3A 3Q3GB 4YHLL 4V1DA 2ADJB 1CR9L 4OCMC 2JKXA 2YD5A 3LKSB 2VKXA 3BAEH 1EAPA 1W0WA 1T2XA 3FRPG 1KJ3L 3H9SB 4TUKH 2R2HA 1D5ZA 1Y6MR 5FIEA 3IDNB 3GBNL 4Z7WA 5DR5H 4TPRL 2JB5H 3VDCA 4W4OC 1AP2A 2AJ3B 4R96B 5IVXF 1RZKL 4JPVL 4P9ML 1EDQA 3F7VB 1I1CA 2FRGP 1XGTA 3MBEC 4QHKI 4Z7NF 4G42A 3RX7A 2QQQA 4A6YL 1QSZA 5E4IA 1NBYA 2FH8A 2HG5B 2WINA 3K8LA 5HYQA 5JHLH 2C4FT 2P47B 1FNEB 3VD7A 5JZ7D 3S36X 5BCAA 4FFYL 2ICEA 3DUHA 4Z0BL 4KQ3L 3BKCL 4NO0B 5HDBE 1HI6B 4XC1L 5TE4H 5H37H 1XCTB 2PXYD 4P46B 1T0PB 3V7MA 3L6FA 1LDSA 1P5UA 1UCTA 5JPNA 1RJZB 5FXCH 1TJIL 3MJ8A 5EA0H 3G5YA 4XMKL 4JN2A 3I6LE 4XXDA 3KPSE 5FKPA 4BZ2L 3MV9B 3FT2B 3I3DA 4GKOA 4ORZC 3SE9L 4M03A 5DUPH 5LJYH 3HLAA 2DOCA 1FIEA 3MOAL 2CDEA 4FZEH 4O2FA 3X3GH 3FB5A 3P4LA 4N0YH 4P5MA 4XAKE 1OCWL 5GGVH 3VXTA 3LSOA 4AG4H 1OP3H 3V8CA 4NO3A 2G60L 4PD4J 4RISH 4TVPE 5D7LD 4UDTB 4JZJB 3H9ZA 5GGVY 5HI3C 3A6CL 4LSDA 3WFCH 3GRWH 5GQBA 4GXUM 4RGOL 2ATPB 4ZXBD 1WAAA 3U0WH 4MNQD 3H42L 4Y5VA 3DO3A 2DKSA 1FRGL 4CU8A 2DQGH 2BDNL 2X4SB 2H1PH 1C1EL 3IRZA 3GSOA 5EOCH 3CPLA 3C6SA 2CUMA 4PRNB 5IB5B 1ZGLA 5GGRB 3FQNB 2CLZA 5ICZB 5DHVH 3FHAA 1HSAA 1N59B 3MODH 5I9QB 4H5SA 2EEBA 4ZG1A 3LKOA 5CLWA 4PV8A 3EYSL 3TZVA 3FFCD 3RVTD 4NC0B 4J3XA 3MO1B 4Z7VF 3FONB 5E2VH 2K3TA 5E95B 3P11L 4GAYB 2DM3A 1JTPA 3P9MB 1HH9A 1W8NA 2C3VB