1HIML

Structural evidence for induced fit as a mechanism for antibody-antigen recognition
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
214
Chain Sequence
EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
total genus 39
structure length 214
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himL01
3ZSTA 5IJVB 1P4IH 3QUYA 3D85D 5C9JB 4Y19B 1NBYA 1S9VB 2XZAL 3O0RL 3RP1A 5HI4D 3EDEA 3LKQA 3GK8H 3H42L 5F6IB 5GIRB 1J86A 1U3HA 4FQXD 3B2UC 3PV7A 5EPMB 3CH1A 3OAYH 5C09E 2AEQH 3O6LL 1KCRH 4BFGA 5TE4L 4QRTA 3LKOA 2QKIA 3AVEA 1CIUA 1WBYB 3H9HB 4FXLA 1UKQA 4XBGB 2V2XA 2AXGA 2OS7A 3M8OL 3E6HA 2IPTH 1NMBL 3H42H 1UWGH 3UZVB 3W39B 5KSAB 1QFUL 4LPCA 4WVRA 5KN5B 3MLZL 5LWYH 2Z31C 4PJXA 3BVNB 3VI3E 3V5HA 2BY1A 3ZYZA 5D9SA 4GSDH 2QADC 5EUOF 2DLFL 5IJKA 4J3TA 3LIZL 3F5WB 3PJSB 3EYFB 1KT2B 3BN9D 4B0MM 3KXFD 4JFXB 3Q1SH 3QEQD 3EO9L 3QI9D 1Q9LA 4W4NA 2FD6L 4EUPA 3OR7A 3V4VL 1T89C 3FCTA 5ALCL 4EVNB 3BFOA 1LMKA 1ZT1B 1XT5A 3ARTA 3SDXF 3WNNA 3FO0L 3NCEB 3QZWG 2ZNXA 1OPGL 5BS0D 4YEFA 3FZUD 1OF2A 1G9NH 2Y9RT 3NIDF 1XMWA 3MBXL 4U1IA 2ZUYA 1HN1A 3KLAA 4LVOC 5I1JH 4G7YH 3DOSA 3LSOB 3CX2A 1JNHB 3NFSL 1I7ZB 1A3QA 4P4KB 3QNZA 1IAKB 2GT9B 3PQYD 2Y5TA 4ORZC 3SCMC 4Y4FC 3I50H 1H3PL 3IAPA 3PDGA 3U36B 5L0QB 4JRYB 3MV11 5H94B 3GJFK 1QTYT 2P8MB 1L0XA 1MSPA 4XRCA 3NIGF 1T0NA 5AD0A 5E2VL 1JL8A 4E9LA 5HYJA 1R3KA 1B0RB 1YUHB 5KVGL 4W68A 3D39B 1TZIB 4Q9RH 3G9VA 5F1NA 4NFBA 4JFPB 2NZ9C 5T1LB 3D48R 5DJAA 4PRAB 5DRXA 1CGWA 2J7LA 4Y5VA 5GRVK 1T7ZA 5F6IC 3BEWB 3G5YB 1VESA 3ARRA 5T3XH 3ZYOA 2JJUA 2R4RH 3F7PC 4XNUL 1CFSB 4LRNH 1JYWA 5GSRA 3WD5H 2YPVL 1KNOA 4C4KT 4ETYA 1KJ3L 5C6TL 3N85L 1EXUA 3QP3A 2A6JA 2GCYA 3RUGE 1FLTX 2XKNB 4Z7QE 3DXAD 3TFKD 1EX0A 4PY8J 2PW1B 3WMSA 2C3VA 1VFMA 3QIUC 3S5LB 1QYGL 1BJ8A 4MB4A 4LSDA 1ADQA 5E6IC 4L4JA 1PKOA 2FYYA 4WU7B 1DBKL 4XWGH 4G9DB 4P3DB 3GDBA 5FOBB 4ZDHA 5IMLA 5I0DA 2EIZB 2NXZD 2R2EA 5GGVY 3UJIH 5D7SH 4NZTH 4G43B 5HTSA 5J6GB 4HXAH 4HT1L 1FFOB 3JWDC 4OZFA 4XZUA 25C8H 1RZJL 3DVGB 4ZYKA 1LE5A 1OGAA 1VENA 4FP8H 2DQDH 2NY0C 1HE7A 5KVDH 4RGND 5D2LB 2LU4A 2MFNA 1I75A 2B1AL 5GGQH 3P30H 1I4FB 4GAGL 3E6FA 1S7VB 3MROA 2CKNA 1LILA 1E4WH 1I8KB 4DK3A 2VZTA 1OT1A 1V7NH 2J8OA 1HKFA 4U0RC 1KT2A 4LSRL 3S35L 1QLEL 2EEBA 4F7PA 5D1ZB 2YZ8A 4WFFE 1U8NB 3I6KB 2A77H 5EBWA 1XF2A 4ENED 3FN3A 1UB5A 4WWKB 4NJ9H 4YWGH 5AZ2L 1ND0A 2G5BA 3HRZA 1SHMA 1I7UA 4M1DH 4PBXA 1T7VA 2QQLH 1B2WL 4KGLA 4P59L 4NZTL 2KQNA 3QIWD 1FC2D 1QBLH 1QFPA 3QG7H 2YPKA 3ULUD 3A0OA 1KGCD 1GPOH 5T5FL 1XF1A 4YXLL 2IAND 1AHWB 1LK3L 3TN0A 2AJ3A 3OKDA 5SWZB 3QFJB 5KVDL 3VMPA 3KXFA 5SX4I 1XR8A 3ARFB 2F8XC 2IQAB 4BSWA 4OLEA 2NXYB 4GT7A 5DD5L 2CJUH 4KJWC 3HN3A 5DZNA 1A2YA 1MEXL 3R0NA 4D9QE 2OR9L 5T3ZL 2R0LL 2PYEB 1VHPA 4HMEA 4P2QA 3EBAA 5GGSY 5DA0B 1CICC 5MEND 4LHUA 5J6HA 1WZ1L 4P2OC 1N2RB 4QRUB 4GBXC 3OJ2C 1ZA3B 4DTGH 2AJUH 4Z7UA 4N8VA 1IGYB 1GZQA 3IFLL 3DETC 5DJZB 3EYOA 4KDTC 1K6QL 1S7WB 4FFYH 4K94H 1GRWA 1K8IB 1I85A 4S1DC 1NGXB 3B2UD 5JA8B 3CFEA 1SYSB 1UJ3B 4PJHE 2YSSB 3UTOA 2OR9H 1WK0A 1NGXA 5IFJA 3CFCH 2J1KA 4CU7A 3NBNA 1Q0XL 4MJ4A 1RZJC 1A6TB 3L7EB 5DJDA 1NDGB 5D1XD 4M6OL 4H1LA 4XPBH 3MV8D 4NZRL 1P4LB 3TPKA 4AEFA 4G80B 3UYOD 3MA9L 5DQDL 3U83A 1KOAA 1P5UA 2QQQA 5KG9A 2NYYC 1P4IL 1X5YA 2FX7H 3VWKD 2X9XA 3GJFB 1UWXK 4OD2A 4XH2A 4PJFF 1YECL 5TE7H 1UM5L 3S96A 4MD4B 1YEJL 5GSVB 1IAIL 3GHEH 2R1WB 5KZCD 1RJYB 4N0YH 2X4SB 4HUMB 4PTTA 2BVPB 5JO5B 1NSNH 3MACH 4WU5A 1XIWD 3CFIC 2AVGA 3MRBA 4JFFA 3OKEB 4PJEF 4ENEC 3DYOA 1MJ8L 2ZUQB 4RX4A 4FP8L 3CX5J 1EIBA 2F19L 5BVJA 2WIIA 4LDLB 3PDOA 1RZJH 5GS0D 4KI5E 5D71H 3C2SA 5AAMA 2D7TH 3MUJA 1ZT4A 4YK4C 4O2CA 3CNKA 1A64A 4I77H 1UZ6E 4JZOA 4OSUL 1U91B 1I9EA 5IP4A 1CN4A 4QHLA 4KXZH 4LRIC 4P49A 5DJYA 1FAIH 4UNVA 3ELAT 1KPVB 5I6XB 1RZKC 2YD5A 4RQQA 3TO4D 5EN2A 4GKNA 4TTDD 3AS1A 2DYPB 4GBXB 2XQYG 4YFEA 1LD9A 1A6VL 5JZ7D 4HWUA 3PP3K 3EDKA 3EDFA 3OXRA 1FDLL 4PYGA 5C0AA 3DURB 3G08B 2VUYA 1EGJL 3HNTL 2DQGL 1GAFH 1Q72L 4XC3L 3L1OL 1QPPA 3VFSB 4ZUVA 4I5BA 3DUSB 1AGFA 4YBQD 5FGCE 2H32A 4G9FA 1S8DB 4U2ZA 3QDGE 3GSWA 5DD1H 1MJUH 1HIMH 4YDKL 3ARFD 2NZ9D 4UINL 5EU4A 3SGDI 1CD1A 2AXJA 4LKXA 3WNMA 3LMJH 1TJIH 1JP5A 1NCWH 1URLA 1ETZA 4EDWH 3FO9A 2AJZA 4X9GA 3ZKNC 1KN4H 4HAGA 2P5WE 5ILTH 5LGHL 4WU5B 5IVXA 1P7QA 4MA8L 5EOTB 3RDTC 3GBNH 1F4XH 4C57C 4IS6A 5EH1A 1CTNA 4WWKD 1N5YL 2VB5A 5I71B 1IAKA 1JZ3A 5I30L 2HH0H 4I0PD 4LSQH 3PGFL 3O3EB 4OCRH 1E4KA 2VABB 3KYNA 1AXTL 3CCHA 4JO4H 4Q74A 1U8HA 2X6MA 1MCDA 1U6AL 4PB0H 3BEWA 2G60H 4L9LB 5MEPB 2H6PA 4QKXB 2QHRH 2AGJL 3DYMA 3WFEL 1BWMA 3LS4H 4PJ5D 2AQ1A 1NLDH 3MREA 4XBEH 2YPKB 1EO5A 1BZQK 3FB8A 4G6KL 1KJVA 3PGDB 2R4SL 1CZ8L 3KYMA 3LN5B 3T4YB 1FGVH 5K9QI 4OT1H 4Z0XB 3X11B 4EXPX 1FZMA 4MMXC 1CLOL 1JPGA 2GY7B 2F74A 4EIGB 3LN4A 4F7EA 3QUKA 3BUTA 4KRNA 2G60L 3EJJX 5C1MB 3DUSA 4PREB 1NC4D 4K7FB 2FGZA 1FYTD 2FCBA 4MDJB 3TT1H 3K1KC 4ZTOL 1ZHBA 2NY5L 3Q6FA 5C0BA 2ZUWA 5IB1A 3QSKB 1KB5B 5GGVH 3BO8B 3QDJA 3UC0H 3QIUB 4LLDA 5JA9A 3MJ8A 1YQ2A 4UQ3A 4HXBH 5D8JH 4KZDL 2VN4A 4G8GE 2XRAH 2JB6B 1EK3A 5JUEL 1MJJA 4TSCH 3SOBL 2NY6B 4UT9H 1H0DB 2O61B 5IKCA 3BP4B 3CSBA 4MVBC 4JRWA 3RIFK 1UXWB 1RUQH 5E8NA 5C6WH 4F58L 2NTSP 5CJQH 1OGAE 1BZ7B 1AIFB 3UJTH 1D6EB 1MFBL 4JY6B 5J6GA 4BSVB 1SM3H 4WUUB 4XNYL 3SE3C 3C6LA 4WDIA 2FJHA 4QXGH 2XFXA 3O9WC 5J12C 4P4RA 3IXAB 1WAAA 1TXKA 1WCBA 3DMMB 1R24B 3ECBA 3NH7L 2FJGB 5BZDB 1B88A 4DVRH 2AXHA 4DGVL 1J12A 4R4FL 4ZS7H 1Z0MA 4OJFL 1FVDA 4APQB 3ZKMC 1MCCA 3TBSA 4DK6A 4H8WC 2IALA 4PBWD 4UILL 3GSNA 1A1MA 4Z0XA 1XGUA 1EXUB 4OGYL 1U42A 1ED3B 2WUBH 5HBBA 2HTKC 5CZVH 2FEEI 2E8YA 3C6LD 3AROA 2B1HL 3MV9B 5IVOA 4NRXB 2B0SH 5JNYB 3JWDH 1KYOK 4X98A 3SOBH 1XF4B 4KWUA 3B3IA 1W72A 3UAJC 1A4JB 2AI0H 2Y5EA 1DQTA 1HHGA 1AFVH 3D5OF 4HIXL 4XNUH 4RGNE 4X80H 1VFBA 1X4YA 4QWWC 4ELKB 5GGUA 3GMNB 4WFGD 4EI6B 3OKNA 3Q2CA 3UTQB 1JV5A 4MJIB 1YYLH 1LHZA 3QG6A 1GZQB 3QQ9D 5FKPB 3CXDH 5SWQB 1HYSD 1JV5B 5IV2B 2N56A 1N0XL 3E8UL 5HI3D 4J1UA 3G5XB 2R1XB 1HZHL 2QADB 4Y19E 1T66C 1T80A 1KIQB 3MRGB 1H15A 3MOAH 3HZVB 1NCAL 3DO7B 2ZPKL 1I7RB 4RAVA 3P3YA 1KN2L 4XP9H 2A0LD 2GQHA 1CXFA 5HGDB 2KZWA 4XPBL 3ZYJA 5DD3H 1L6XA 4OM1L 4H25B 1CFVH 1ED3A 3KPPA 3MRNA 1AGFB 2MOVA 4IRSC 1W8NA 4O2FB 3WUWA 3VRLE 2ADGA 3PL6D 1FVDB 4APQA 3UJJL 2D9CA 2OK0L 3AAZB 4JQVC 3G08A 2UVEA 2V5MA 3DURA 3GUTB 5GS0L 2HP4A 4YH6A 4B5EA 5DUPL 1Z2KA 2DKUA 1J0JA 4U1HB 1U3YA 5E24E 4Z7VF 3FOMA 4NM8H 4IIQA 3IKKA 2UV3A 4XX1G 4EJ1C 1A4KB 3VXRB 3QNZB 3LS5H 4JKKA 4JAMB 1DQJA 4XPHL 1CD1B 4PGBA 2EDBA 5TPWL 3JV6A 4JCLA 3GMOA 3SGJA 5DSCA 3R06A 2DM4A 3MNVB 4MAYC 5E1AB 1LO3L 2NW3A 1IGIH 5GS2D 3EFDH 4DN3L 3VFVB 4ZUVB 1HSBA 3MOAL 4RDQF 2RQ8A 4QXWA 2DMBA 5GS1B 5EU7C 2N7BA 5FYKU 3WJLC 4JQXC 4K3EL 4HQQL 2IPKA 2CK0H 4RGMC 4OSUH 4PGBB 4XNMA 2OSLB 1EDQA 1JCKA 1G7QA 1S7SB 3INUL 5I74C 5L8KB 3OSKA 4PLKD 3HKFA 3CXDL 1UZ8A 4NQCD 5C70A 2VXVL 5ABDE 2VSCA 3ZTNH 1CD9B 5D1XC 5CP3H 5JPNB 2VAAB 4OCYH 2P43B 1IKNA 4L8DB 1NBYB 3HAEH 3BMVA 4Y5XB 1EEYB 5ERWB 4HWZB 4ZUUB 2HT4C 4TSBL 2Q7YB 5IMOB 3PP4L 4A2LA 1RZIB 5IVNA 4HK0B 3ALPA 4Y1AA 3GSUB 2F74B 5CWSA 4P48A 3N06B 2XXCB 5J1AA 5BW7A 3VI4F 3LN5A 1UB6B 2WIIB 1HHKB 3LEVL 1ZLUH 3LQZB 1AC6A 4L29A 2F54E 5DWUH 4YLQT 3MRJA 3O41A 1RV6X 2FSEB 1OP5K 3FAXA 3I6LE 3IJSB 3I02A 4MD5A 3MRKA 3HMXL 4X6BB 5GRWA 4LARL 3QFDA 3VXTB 4KUZL 2DYPD 4GBXD 3G5VA 2V9QA 1DFBL 5HHOD 1P1ZB 4ODXB 2BFVH 3QUYD 1WT5C 4WV1C 1UB6A 3MO1B 1RUKH 1CFQB 4M1GL 4PRAA 2YD8A 3DX8A 4YPGB 5GGSA 3HUJE 5LBSL 5DMGC 2MQCA 3H7BA 4D9LL 1JYNA 1IGFH 1SEBB 4PP2A 4YXKH 1YMHB 4Q6IB 4ZPTA 5I75B 5DZOA 3QDGB 1S9WA 1AGEA 1NFDA 3AS3A 4YDIL 4HJ0D 3ARGC 4HJGB 4YHIA 2Y25A 3BKCH 4FTVD 1X5ZA 1KUMA 1LDSA 1NGYB 1S3KL 3RL1A 1HILB 4DFIA 4X7FC 1F00I 1T1ZA 5CHNB 3QCVL 3BWAA 2FX8L 5DJ2A 3BI9X 5HYSA 3B5GA 5DJYB 4J3SA 1FZJA 1RD6A 1ACYL 2G9HA 4JM4H 1BLNA 4ELMB 4QXUL 4JRYD 4OIBA 3IKCA 4P3CL 5TJWK 2GTWA 5DMKA 1EJ6A 4OKDA 3Q48A 1W0VA 4FZEL 3U9PL 5IVZA 4A2MA 2AERT 1IKFL 5D2LE 4JPIB 3FMGH 3UYRL 1I3UA 1QQDB 5DJXB 1HYRC 3EYSH 3HC0A 4ERSH 5IBLD 4R3SB 4L8SB 4MLSA 5I76A 3MCG1 1T1WA 4QHMB 3RFZC 3QIWC 5FCUH 4GRWF 3RDTA 4M43L 5MENE 4ISVA 3AU1B 5C0DA 4WV1B 3L3JB 4NRYB 3RHWK 2OBGA 3NVQA 4PS4H 3G6AB 4I18B 4ALAH 1H3XA 15C8L 5D7JA 1VGEL 1GJIA 1S7VA 3PWJA 4ONFH 4U1LB 2WBJB 1UXWA 4ZMAT 5J13B 5M94B 5EA0H 4P5TC 3G04A 4YHMH 1R3HB 2HVJA 1IM3B 2CK2A 1P9MC 1MNUH 4WW2B 2EDJA 3KPMB 2H26A 5C3LD 4CADB 1QSFB 3UYPA 4RAUA 3WIIH 3MV8E 4I0PB 1I7TB 4HCRL 3T2OA 5IHZA 5DRZA 2H45A 5JQ6H 3V8CA 3DGGA 2DQUH 1WZKA 3QFJE 5EO9B 3NOIA 1G7MA 2X42A 1NGPL 2O5XH 5SWZD 4LSPL 3LN4B 3QDHA 2F5AH 1JWMA 3SGKC 3L3JA 4NRYA 4ZAKA 4F15B 2Y1VA 1INQB 1JGUH 2PYEE 2RJMA 2DM7A 3VD7A 2HJKB 1JZ2A 1T1YB 8FABA 1AP2B 3REVB 2OJZL 1TVHB 5I9QC 4EDXB 2ADJB 5E8PA 2R8SH 3ABZA 3RZWA 3FO1A 4OD3L 4D9RD 4I9WE 1KLGA 3RGVD 2J4WL 3NIGE 4WHYH 2MCPH 3BRDA 5I1GH 1S7RA 1ZVYA 2ED8A 3MV9A 3LEYL 1RUQL 1N6UA 1FAKT 4JFQA 4LLVA 3V6OC 3X12A 2E9BA 5HHQB 1YMMB 3O6FC 4PG9B 1T3FB 2ZOKB 3C6SA 2I27N 3LOWA 1DBJH 4D3CL 1NDMA 4Y8AA 4MNQA 2R8SL 5I16B 3X12B 3HE7C 4XRCB 4WHDA 3C6LC 5HYSG 3OKKB 4Q9QL 3K8KA 3PIQB 4U4BA 2Q7YA 3U6RA 1LP9F 4G6FB 1ORSA 5I8CB 2Z31A 1IMHC 4HUKB 2AK4E 4LGRB 3G5ZB 5HD8D 2J5LC 3TZVA 5JPNA 3C2AL 3MOQA 1KN2H 2WUCH 2X4OB 2DKSA 3QUML 1JWUB 3VMOA 1KJ2A 3H9ZA 4MJ5B 2WK2A 4W6YB 4M5ZH 1HQRA 2X10A 3DX9B 3RI5F 5FUCC 3UTSD 5A2IH 4X6BA 4ZAKB 1XFPA 2DS4A 1OHQA 2EYTB 4G6JL 3VWKA 4OV5A 4GRWE 2VL5B 5DUML 2Y5TB 5CCKH 4WEBH 1YEGH 1KEML 1JMZA 3QQ3B 3AC0A 2PCPB 3A6CL 2XPGB 3D3VA 1Y6KR 3RRQA 2AJVH 2VDQL 4U1KA 5JXEA 1MOEA 3ALXA 4ODHH 3TBVB 4Q2ZB 5KSAA 5J56B 1NFIB 4KI5F 1XCTA 3HI6L 4EN3A 1XGYH 5I17B 5D70L 4L4VA 4TNWK 2E6JA 2P4AB 1A21A 3B5HA 4GG8A 2WWKO 1Z9MA 1MWAA 2Y7QA 4XVJH 5FXCH 2HJFB 4X6CB 4MX7A 5T3XE 2PO6A 1P84J 3WLBA 1GHFH 1IC5H 3N1PC 4LQFH 4JGUA 4G8IA 4J4PD 2FHFA 2Q86A 3MFFA 2BMKA 3WFDH 1RHFA 2EC9U 2PUQT 2NW3B 5C0RH 3DMMC 1WQVT 3EJYD 3VGHA 3F7VA 3OZ9L 2Q20A 4PJFA 1H15B 5I0ZA 3PWVA 4AH2B 1FJ1A 4JPVL 1O7VA 4IDJL 3L3IB 2VQUA 3BKML 3DECA 5IVZB 5LJYH 2XKNA 4OGAD 3VGFA 4YQXL 1VPOL 5BS0B 1IAII 3L3DA 2UZXB 5DEGB 5FF6A 3C9NA 3FQTB 4QRTB 1KPUB 1ZTXH 5HD8C 3VRIA 1DLFH 4JRYA 3OMZA 2EDQA 5GRUH 5F9OL 2VLJB 2PO6D 3LRSB 4V1DA 4WGWB 1XGQB 3VWKC 2K1MA 2XA3A 2XTJD 5E03A 4PJ5B 2F15A 5C08E 1X6LA 2GY5A 3OAZK 5DD6B 4PJ8C 3F7YB 3D0LA 1DBJL 4D3CH 4XPFH 3CGTA 3MLVL 1LE9A 3TGXA 4YBHA 3QPXL 4TSAH 5F9DC 5FYJU 3KS0J 2OQJB 5E70A 5ECJE 3KPTA 4F33A 2VZVA 2EXWD 5KSAD 4ZO8A 4FFVD 2OZ4A 3TH3T 5C0EA 2CRMA 1CFQA 4XAKE 1R5WB 4OUOA 4TQEL 3GIZL 3ZKXC 2BDNH 1M6OA 4LSVL 2HYMA 3PGCA 1ADQH 1IFHH 3TO2B 4LSSL 3CU7A 3D0VA 1CFTB 1AR1C 4RMVA 4LIQH 4OCXH 5EZLA 4OQ1A 4WCYH 4F2MA 2ATPB 1TZGL 3FKUS 4P2RD 5JW3L 4FXGA 4QT5B 2HVKB 5DK3A 2QSTA 4YHOH 2OP4H 1T21B 5EU4B 3O3AB 5TDOA 1NH6A 1DP0A 1RK1A 3V4UH 4K3JL 3HUJB 3MLSL 1UB5B 1EHAA 4UB0L 2E7LA 3TCLB 4M48H 1IFHL 4AEEA 1A4JA 1XF3B 1Q9WB 4G6ML 4QRPE 4FNLH 1U9KA 3P4LA 4JO1L 4M5YH 3GJEB 4H20L 1KPUA 4PTUB 2E7HA 4OZIB 5FHBH 1WT5A 4WV1A 3MJGX 3GKWL 1KULA 4X4YA 2DI7A 3AUVA 5ESAA 1JZ8A 1RIVH 2B4CL 3P4NA 4QOKE 4PRNB 4U1SA 2J5LB 4OB5H 3BO8A 3ESVF 4PJXB 5TE6L 4DOHB 5ANMA 3L5XH 2BXZA 2V7HB 2AJVL 2VDQH 4Z7WF 3LMJL 3PE9A 1TTGA 4ONGH 4EZMA 4ZNCD 2BERA 4JKPH 1CDGA 1A6WH 2XFXB 3KLSA 4UTBL 1E6OH 2AJYL 3T65B 3WIFB 3QDME 4YHNB 4AQ1B 4AQOA 1RIHH 3SKJH 3JWOL 2ZCHH 5T33H 5EULV 3IT8D 1TDQA 1QFWL 5FYKL 4YC2B 3QO1B 4R2GD 3RA7L 2HJFA 3L7EA 5CD5D 3PGDA 2CDGA 5E4EC 3DV4B 5HYSB 2AK1H 4HHAA 4JFDD 5KW9L 5F70A 2AJSL 4ZFOB 4ODVH 2X4UA 4PJAA 2Z9TA 1GXEA 5EORH 2CLZB 2NYYD 4DZ8A 4PJDE 4KQ4H 2C3VB 2EDHA 4LHUD 1E27A 3KYAA 3JWNC 1TENA 4Y19A 4ZQKB 4ODWB 5HYEA 5KVFL 1U8IA 5ICZB 3QXAA 4LLDB 3TV3H 4S1DD 4QHMA 1YY9C 2B8OT 2BHUA 3EHBC 3V4UL 2E27L 3ARBD 3BGMA 4GQ9L 2G2RB 1Z6JT 5GGRA 2EE3A 4KRMB 5D7JC 4UDUA 2H8PB 3MV8B 5K93A 5KVMC 2GAZB 4XMLL 4CVWA 3QNXA 1OLZA 4NHUB 1DE4A 1OM3H 3VFNB 4WTZA 2Z8RA 3HC4L 3ZDXE 2AK4A 1CU4H 4PJ7A 4QHUB 3LEYH 3FB5B 3P4MB 3VFNA 1P9MA 1G7LA 2X4PB 1KG0A 4M61A 2OTWA 4E0RB 4MA1C 3QG6B 3NPZB 4XXDA 4LHJB 5I8EA 4ZPVA 3MXVH 4NWUH 1N26A 1OTSD 5K9JL 1XF5B 4QXGL 5TGBA 4OCMC 4KHTH 5D7IE 4BA8A 1HH6B 5E8OB 1LP9A 5CGYD 1I9JL 3RAJL 4P5TB 3Q5TA 3MV01 4LPXA 1NAMH 4KAQH 4OUUA 1EGJA 3AXLB 2PXYD 3EDJA 4DGVH 4M61B 2XWJB 3VA2C 2HG5B 2EECA 1FGNL 1N3NA 4L3EB 2HKFL 4JR9L 3B2VL 2KDGA 2DIAA 3VU2A 3LKRB 2M8XA 1RURH 2EYSA 1ZTXL 3T77B 1A6AB 3QULA 2HFTA 5A3ID 5JIKA 4HKJB 1A9BA 4NC1C 5F1OB 4TVPD 5E8DL 1HQ4A 3KHQA 5JHDA 3QJHB 2ZOLB 5CAYB 1YNTA 4LEXL 2NY0D 4JANA 2DLHA 1NUNB 4YDJA 3HS0B 2VITB 3MRBB 3BW9A 4K94C 4OTXH 3W5NA 1DBML 3T4AA 1NCBL 4BK5A 3QISA 3F65A 2VDPL 4IJ3C 3X13A 2XNAA 2X70A 4XP4H 5ITFA 3LB6C 2MSPA 3KPRD 5FGBC 3CAFA 3U4BH 2BOBB 3OJDB 3CFKB 3ARYA 3DROB 1DEEA 2Y7QB 4PJCA 3O3DB 4RISL 3CMOL 4OCWL 4Y4HC 4GRWB 3RWGA 3VWJB 5KW9H 2FZ3A 3VXPB 4ZUTB 1HSBB 4NJAL 1JHLH 3P73A 4TPRH 1H3VA 4RMQA 1JZ6A 2F54B 1OQXA 4NNPL 5I1EH 4WI8A 1H9VA 4RGNC 4NDMA 5B8CB 4L8CA 4MZ3A 2NY2B 3U1SH 1DL7H 3UJJH 4UV4H 5EBLB 5GRXG 3ISWA 4PJIE 4RA0C 3C5ZA 2F53D 4U0RB 1YUHA 2BNRD 3NIDE 2HLAB 2VLRD 3E3QE 4ESKA 2V2TB 2VWEC 2HRPH 4N0CC 1FZMB 3F6IA 3QIBB 1CCZA 3WL9A 1A6UH 2C1OB 4N0YL 4GAJL 1U8LB 4PJGB 3MPCA 3VFUA 4WFEE 1KENL 2QQKL 3X3FL 2FRGP 5IBUB 3EYQD 1H3UA 1MQKL 2F5BH 3KDMA 3O8XD 4ZOCA 1TETL 2XA8L 2CXGA 2EO9A 4PRPA 3QEGL 4YX2H 1Q8MA 4JJ5A 1O0VA 4QLRA 1G6RL 3QNYA 1FNAA 1BFTA 3QCTL 4OF7A 2X89D 3M8OH 1KPRA 3HUJF 4OKVB 1BGXL 1DSFH 4J6RH 5IESH 2XXMB 4ODUB 4RGMB 4U1GC 1T1ZB 3UMTA 1B0RA 3WHE1 4OZGE 4X80L 3U6RB 2DJSA 5ID1B 1FAIL 3PGCB 5IGXL 2OZ4L 3SJVA 4FFYL 4WWKA 4RWYL 2J3SA 2R23A 4GMSL 2DF3A 4QY8A 1QLRA 3VFOA 4EOWL 4LCIH 2YA1A 5CKAA 4BUHA 2CUHA 1HH9B 2VLJE 3UO1L 4YBLB 5L88H 4JZJB 3FT2B 3L3IA 2IBBA 4PJ5E 1QFHA 4Z7QF 3WCYA 1GZPA 5HYIA 4OIIH 3QCVH 3MO1A 3MBEB 4AMKL 4K23L 2EZ0D 3QA3B 4BSWB 4JJ5B 4V1DB 2F58L 3C8DA 3TYFB 3VFTA 4WI2A 2RFXA 4U6YB 4D9RE 3GI8H 1FE8L 3QFDB 1QACA 5TDPB 5K9KB 3ARWA 4M5YL 4EDXA 1EERB 3O41B 1A1OB 4XWOC 5DD0H 3UTSB 5CJ8A 4K8RC 2F5AL 1CYGA 5C08D 2AXFA 3O2DH 1U3HB 1JPST 1UH2A 5C0GB 5CBAA 3LQMA 1I85C 3U30B 2VUOA 4AMKH 3RHWF 4R96A 2DAVA 4MZ2A 4G8EB 4H0GA 5C09D 3F58H 4KMTH 2MJWA 3AREB 1AE6L 3H2WA 4LSQL 1S5HB 4KDWA 3R1GL 3NGBC 2X1XR 2VIRA 43C9B 1DBMH 1RQ5A 1SBSL 3S5LA 2FEEL 1MJ7H 3RVXD 3X11A 4MX7B 4WI6A 5ETUB 1RIHL 3JV0A 1YMMD 3MA7A 3NCYP 1ZLUK 2Y07H 4PLJC 4OZIE 5ELIA 4UILH 4UQ2B 3RJDA 1N0LA 2V7HA 4LCYA 4MNGB 3UEZA 1VB9A 3QRGH 1JHKH 3A6BH 4ONHA 1GGTA 2IPUG 2LU7A 1RURL 4QOKB 4L3EA 1RJZB 4KROD 2GITA 1CDUA 2GIYA 5K9QG 3I9GL 4KKNA 3V2AR 4OFYD 4OD2B 2AV7B 3SKMA 3PNWB 1YEIL 4JVPA 2Q8AL 2EIBA 2XY2A 4WI7A 1NC2B 3VGAC 4NNYA 2ZUVA 3I75B 3HNSL 1FP5A 1JYXA 1AKJD 5FKAA 1FNLA 5DF0A 2E3VA 4APQC 1UWEH 3W9EB 1LNUB 3L5WB 32C2B 2Z0BA 1I8MA 1RHHB 3X14A 2W91A 4GQ9H 5IW1B 1PZ5A 2QSQA 1MCRA 2NY7H 3GSNH 3HTLX 2AK4B 4PJDB 5KVGH 1B6UA 1BGXH 1U8JA 3IFPB 3C09C 1K4CA 3DVFA 5F93C 3N50A 3D2UA 2X4OA 3RWDB 2CLVA 1IGYA 3JZ7A 3BZ4A 3HC3H 2CLRA 3IDMA 5BO1L 2ARJB 3E2HB 5IM7B 5KSBA 1I8MB 3VFGL 2YWZA 3BGMB 1KYOJ 4WNQB 4GMSH 5FK9A 1JHLL 4TPRL 5H35B 4QGYA 4EBQH 5JOFB 3ARED 1FYHB 4NQED 3PWUB 1K85A 3DRQB 5FK9B 5F88B 3SPVA 3DGCR 4HEME 1MI5E 4OAWB 5D7IF 5H37G 5SWQA 3SDAD 4Y16C 1OSZB 2YRZA 1Q1JH 3FRPA 5HI5C 2MPAH 2NY3C 1KEGL 1G6RA 1QBMH 1B0WA 2WUCL 5D9SB 1UYWL 2NNAA 4POYA 1A6ZB 1E4JA 4PRBB 3TBYA 25C8L 2HN7A 4KKLC 1UM6L 3O3BB 5FUOL 3W0WA 1JPSL 3CC5A 1LNUA 5L6YL 2QR0B 1J0ZA 4Z8FL 3MNWB 4MWFA 1CGUA 3VXUB 4DUVA 2V2XB 4XBGA 2XQYK 4HS3A 4I9WD 1WIPA 3HE7A 5E8DH 3K8LA 3IJYB 3VXPA 4YHZH 2LU3A 3HLAB 3MRFA 1N59B 5TE7L 3KYKH 4X6DB 1ZGLM 4X6FB 2W1NA 2YK1H 4RIRB 5LQBH 3GSRA 3C60D 2YS4A 1CXHA 4OFVA 5DT1L 5IMOA 5CP3A 4PY7A 4KROC 1MFCL 2FWOB 5TQ0L 4E42B 4Q9CA 4X5XB 4NWTL 3CJJA 2YD1A 5EN2B 4QRSA 5EOQH 2CUMA 5ESVA 4U7MA 3STLA 2B2XL 4TVPL 1D9KD 4FFZH 1CT8B 3MRPA 5HGGS 2VDNH 2KZ1B 3BW9B 5KANG 2DWEA 3RQ3A 4CAGA 5C9JA 4QHLB 3BPNB 1IT9L 2YA2A 2CDGB 2X4NB 4JZOB 3HCVA 4X9BA 5F3HB 1NCAH 1XIWC 2IPKB 1ZHLB 3PF2A 5I71C 4F3FA 3QQ4A 4LVNC 5DEFB 3TYGL 5JLZA 3WDJA 3ZDYF 5HHNB 3P0VL 1KELL 4OM1H 1F3JB 1NJ9B 2A83B 4G6KH 4JFDE 3H9HA 5CKGA 1T6VN 1JF1B 3QFJD 1FYTB 5E08H 5AUMA 5F7HA 1BWWA 2MQ0A 1RJLA 3U1SL 3MV7A 2KQMA 2E9JA 4M6MH 4F37K 5HDOA 1ZK9A 4M7KH 4D2NA 5FDWA 2P42B 2CR6A 4P2RA 2BJML 3DXAA 4YO0A 1CD8A 5JDSA 4LNRA 3QHTC 1MWAH 1N6QL 4HIIB 3U82B 1V3KA 3Q5OA 4IRZL 3SJVB 1Z3GL 4OM0H 1KCVL 3CDFA 2V9RA 1JGUL 1CK0L 4DVBA 2YBRA 5KSUB 1A7OL 3DETD 4GXUM 2JB5L 4D0DA 1FNSH 1PLGH 1ORQB 1T4KA 2GJ6E 5CJ5A 2PXYA 4LCWB 4YUEH 5KS9F 4PJIB 4Y1AD 3OB0K 1KCSL 3D39A 4HIJA 1T0PB 1J8KA 3TJHC 4LLUB 5EC1A 3VXTA 3UTPE 3DTXB 5A16A 4F2MB 1EEUA 4OF6A 2R23B 4M7JH 5CINL 35C8L 3C9NB 1JGEA 2P1YA 2WBKA 4CRPA 5C0RL 2VXVH 1JGDB 2OTUB 5C07A 1NDMB 1J1XL 3T2PA 1HHKA 4KI1A 2J8UF 1I7ZA 5LKNA 3WFBL 2R0ZL 4AL8H 4MD0B 1QSEA 4NP4L 3HZYA 5ALCH 4ETQA 3C5ZB 1PKQA 1OD7A 1P53A 3UP1A 4HLJA 4DEPB 1N64L 1IGJA 1JWSA 3W2DL 1OAXL 3GMPB 1CLZH 1J8HD 3RWHA 4UT6L 3OKDB 5SWZA 5C0FA 4PJXE 4JJHA 4AYFA 1EVUA 5E8PB 4GSDL 4ORGB 1XF4A 4PJAE 1UQSB 3UJIL 4J4PA 1LQSR 3EOBB 4V2BA 4TUKL 5E0QA 5ETUA 1EJOL 1Z5LA 3QO1A 5CUSL 3QCTH 5HHOE 1BM3H 4HGMA 2OCFD 3C5JB 5TH2B 4NC2B 4N0FB 4X5LA 3ARPA 4Z9KB 1NGWA 1QRNB 5IT2H 5DQJB 1ZXQA 1NMCC 1UJ3C 3R1GH 2XG5A 1QRNA 1YEKH 3PWLA 3A67L 2VQ1B 4P46A 4G8FA 3HMWH 5FHAL 1RZKH 3P4NB 3MRLA 3KR3H 3OKMB 2GTZB 1OSPH 2M26A 4GW1B 4FQ1H 3VDAA 4BQBA 4MHHG 5EU3A 1H5BB 1BZ7A 4IRSA 3N1QC 3O2DA 4P9HH 1CICB 3TBYB 1MLCB 5E00B 3K3QA 4U6YA 4K3GA 3GIVA 3ILQD 1SQ2N 2GW5A 4M4RA 1EFXD 3IDJA 5E2TL 5KZCB 3ETBF 5E9DD 4IIQC 3T0DA 1HNFA 1FL6B 5GQBA 1BOYA 3H8NA 1OB1A 4F8TA 1MREL 4CN6A 4JDZB 4NN5B 1R3LA 1YJDL 3B6SB 4NRZB 1FN4B 4PJEA 4MA7H 1SJVA 4G9DA 5DMYA 4HMCA 5GS2H 1KCVH 4CW1B 4KFZC 3UBXA 1KIPA 3MLTB 3LEVH 4PTTB 4AIOA 4WI3A 5IR1B 1RZFL 1IQDB 4F37F 4LVNB 5IFAH 3WNLA 4OCRL 3EDDA 1F02I 1TFHA 5D7IB 4K3JH 1U8QA 2VH5L 1JTTA 4EXKA 5HHQA 1G9MC 5IMMA 2BSTB 2V9TA 2NY7L 4N1CA 2DMKA 1FG2A 3PHOB 2OXHA 5IW1A 1IEBB 5JHDD 1VSCA 4KK6C 4KRPD 2JIXA 5HYQB 1HWHB 5HDLA 3AXLA 4MXQD 4JFHE 7CGTA 1GHFL 1IC5L 1I3VA 2OJEB 2AK1L 3TBTB 5DHYA 3HA0A 3GI8L 4HS6A 1GGIL 4GRMA 4K8RH 4J1UB 2NY0B 4M5ZL 3L9RB 4DKEH 1JF6A 2UWEF 1C7SA 3SN6N 1INQA 4JFXA 5T5NF 5I16A 1LO0H 4AEIH 1IGML 2OR7A 2VLRE 4KKBC 4U0QB 3C87A 3V5DB 3CVIL 3UX9B 1HOCB 5HGAB 5KN5A 1NBQA 1E4XI 4JO2L 1T66D 2H8PA 4TSCL 3JSSA 3T2QA 1HI6A 1A1NA 2OTPA 2X1OA 2CH8A 4YXLH 3N1GC 5B3JF 3HFMH 2HJLB 4PJCB 1F97A 4HKBA 4HFUH 3QDJD 2CIIA 2NX5E 1QBLL 1IRAY 1INDH 3QG7L 3HZMB 4PV9A 4ACPA 3OG6B 1UGNA 4LAQH 1T04B 2Z8SA 4I5BB 5JW4N 3EGSB 2HRPL 5CP7A 5D71L 4IRSD 3RIAK 4WHTB 2JK5A 3V6BR 2EE2A 3ARGA 3PWNA 4HH9B 3STLB 4PJEE 1D7FA 3E2HC 5A2JH 1U8KB 4ONFL 1FL5B 1FZOA 5HYJD 3HS0A 5D7JD 5D1ZA 4MGXA 2ZKHL 4MCYB 1P6FA 3HZMA 1RI8A 4MJID 5DRZB 3OHXB 2RGSA 2EDKA 4S2SB 4BELD 3JTSB 4HUWB 3I85A 3TF7C 3RZCB 4Y0GA 4HLZH 1EHLH 4OGYH 3ZKQD 1RAMA 1TIUA 5C8JA 1KXTB 3UZEA 1A9EB 1UYWH 3QQ9C 3O3AA 1D9KC 1F3DH 5TDOB 5LGJA 5HGAA 2IH3B 4P4KC 3ZDYE 2HH0L 4JKWA 3O6FD 5GZNC 4J3UA 4JFZL 3ZTNL 2AS5M 4JFFB 1QVOB 1OAZH 4N9GB 1G7PA 3R8QA 2BJMH 1YDPA 4FQIL 1MY5A 5C0CE 5C9KA 5FA4B 4PLJD 5FGBA 3TNMB 3PXJA 3CLEH 1R0AH 5FOBA 4OFYA 1LDPH 3C8KB 1A3RL 2C7UA 1YC7A 5CEZH 1F4WH 4HIHA 2L4OA 1QQDA 4YHKH 3RUGA 4NQUA 5DK0B 1JUFB 3PXHA 3TA3A 3IJYA 2NY4D 1V7ML 2E5EA 3SDAC 3OV6A 4PD4J 3WHXA 2BXYA 2R2CA 5DVMA 2XTLA 5ITBH 3UTTE 3L7FB 3NGBB 4QO1A 1YNKH 1KN4L 4OCXL 1T2XA 3V7AE 4LFHG 3AREC 4P2YA 5DXWA 5EOCJ 5DI8B 4NQDB 2YMXL 4F9LC 2GJ6A 4R7DA 4UOW0 1NGQH 1S9WB 1NCCL 3I3BA 3CCHB 1PX4A 2LVEA 1OSZA 5EG6C 4CKVX 2WWMC 4NBXB 3M1BB 4YHPA 5F1NB 1BIHA 5CIPA 1U93B 3FRPG 1AXTH 4QRQA 4UT9L 5LQBL 1TCRB 4ELMF 1G84A 3BGFB 1FL6A 1TNMA 3D85A 2GJ6B 2P8MA 4GLRI 1W72B 1A3RH 3BUYA 2D7QA 3T0EB 5HI3C 4M6NL 1T1XB 3HB3C 2MHAA 3GSXB 3BZEA 4TUJB 1DUZA 4XNYH 5FO8A 4YBLC 4JM2C 1NLBL 4ZO7A 5D7SL 2AV1B 1JIBA 3MFGB 4EDWL 2Y6SC 1XIWA 3OJMB 1MAKA 4LLWA 5FGRA 3OQ3B 2ZCKL 2YUXA 4S1RH 1IAMA 4DVRL 1AGDB 2XWBA 3GSQA 3IXTA 4MSWA 5CIPH 3BAEL 1JRHI 4QTHB 4KK6D 4MNGE 3GMMB 5CJBA 1FNGB 1Q9OA 3WS3A 3VD9A 1OP9A 1ZOXA 4XMKL 3KPQA 3PDDA 4NUJB 5D1QA 2P7TA 3C5JA 3BDXA 2X41A 3FO2A 4MA8H 1GGYA 4R96B 5BV7H 2A2QT 4EI5D 2VXQH 5FM5O 4JG1L 2XICA 3SKMB 3EOYG 1OSPL 2Q6WA 1QHPA 1EO7A 5FO7A 3RIAF 3DX6A 1UT9A 3PJSA 1YEDA 5DK2A 1I1AB 1OT2A 1RJZA 2YD4A 1ACZA 1FVCA 3L3GB 1L7IL 5GHWH 3WS3B 2IAMA 1R5IB 1JN6B 3BDBA 2E9IA 1AD9B 1QFUH 1FL3B 3EJZC 3KPPB 4JE4B 4O2FA 1H3WM 5IESL 2YD3A 4HBCL 3OAZH 4S1QL 2DLEA 5EU3B 1FIGH 1M7DB 2BRRH 4QRRB 3RWHB 4F9LA 3MA7B 4C58B 4PRHB 2FBJL 4DQOH 3S88H 5IUSA 1UG9A 1LE5B 2XIDA 4KTYA 4Y2DA 4CN1A 4JPKL 1JYVA 2L7JA 1MUJB 2DQEL 3WFHB 4G43A 4O58L 5DDHB 1GOFA 3MRGA 1D5BB 3BZDA 3QUMA 4JAMA 3WYRA 4MQ7B 2Y06L 3VDBA 4ZTOH 1CTOA 2DQJH 1I8IA 2I9LA 2F9BT 2F53A 2NX5D 2V17H 2ZSWA 3MACL 1NSNL 3AY4C 4JPWH 1NBZA 4WJ5B 3PQYE 4NYLB 5IFAL 5CGTA 3ET9F 4WTZG 1ZGLA 1I1FB 1RZFH 2DM2A 1KC5L 4X4ME 4OLUL 3MUY1 3P4MA 3FB5A 1VFAA 5BV7L 2R4SH 2V2WB 3T1FA 3VFPB 3ZO0A 4O9HL 3M17B 3QWOA 4NHUA 1U8PB 3ZE1F 2ESVD 4KRPB 4Q7DA 4WO4D 4PGEA 2XTJE 3ULVC 2E6QA 3TO4C 2R1YA 2ZSVB 5EO0A 5B4MD 1RMFH 1MNUL 4JLRA 4PY8I 2CLVB 3V79C 5E2WH 3MR9B 1G9NL 4F7TB 2EDOA 5LCVL 2AP2A 4H8WL 3OJVC 1QLFB 1A6PA 2IALB 5FM4A 2D3VA 3FMGL 5EU7E 2OXGA 1BPVA 1TQCB 1CD0A 2HLAA 2X4QA 2UWEE 4CMHB 5BRZE 2CGRH 3B4NA 3IETA 3OKNB 4R4FH 4L4TA 4U05A 4B53A 3KXFE 5I8KL 4LQ1A 1NMCB 2C5DC 3F7VB 3MBED 3KPLB 3VXOB 1MCWW 3IYLW 4G3YL 2FNBA 4GAJH 1JF5A 1NAMA 3WFHA 2FO4A 2DDQL 3BXNA 5J11B 1IC7L 3P73B 2FGWH 1DLFL 4M7LL 3D18B 3O11A 2X7LB 3VFRB 3OXSA 4HV8A 5C7XH 3GNMH 4HKXA 1LO2H 4X7TA 1IEAB 1DVFC 4XP1L 2VISA 4MQTB 1YNLH 3W11C 1WGOA 1Q9LB 2PTTB 3CFBA 2NY4B 3NIFF 4RWYH 4WO4B 1VADB 3V4PL 1BAFL 4DAGH 1AGCA 4PGCB 2GI7A 3C5ZC 3F5WA 4QYOB 2QEJA 3ARBC 3BVNA 1CL7I 1PQZA 1FL5A 4NT6B 5EUOE 2FLBT 1ZT4B 1MCPH 1NKRA 1UM5H 3L6FB 4PJCE 1HQ4B 5HVWA 1MI5D 4WFFD 1E6OL 2UYLA 3TH2T 1J1PL 3O3BA 1SY6H 1F8TL 3QULB 3NPSB 1GAFL 2RIKA 4NHCL 2OP4L 3I2CH 4OF8A 2BZDA 5IBTH 4OT1L 3ZHLA 2VLLA 1KJ2B 1F6AB 1IAOA 2R0KL 1IZJA 4XP9L 1RZ7L 2YKLL 4LCWE 3RL1B 5ICYA 2UVFA 3IFNH 1PG7X 4KJPD 4WI4A 4AG4L 3KPSE 3LH2H 3JUYA 1KTDB 4BYHA 4POUB 3DIFB 1L6ZA 3CVHH 4QTIH 5D93B 3Q6FB 5ILTL 2BVQB 4ZUWB 4M7ZC 5I18H 1CLYH 5E4EB 3FT2A 3BAEH 4PP2B 1FNEB 4DUWA 2JELH 2EDEA 3BH9B 5B39A 2B20A 5HYJB 3DHJA 4BKLA 3UC0L 1GVIA 2VJXA 4PJ5A 2F19H 4XP6L 2DJ4A 3TJEL 1KJVB 1TPXC 1OAQH 6CGTA 2ERJC 1S7XB 3KJ4B 1OAUL 3EYSL 2EE6A 5JOPD 1U6AH 4K7PL 4O51B 3QUZA 4Y88A 5C0CB 5CFHA 3C08L 1WV7T 1CDBA 2IQ9L 2ZP0T 4JCMA 1IGJB 4OZGA 1YMHA 4Q6IA 4HK3J 1U93A 4NC1E 1IKNC 3K46A 4RRPG 2NXZB 1D3CA 4PR5B 4QCIA 4TRPL 3B9EA 5L9DH 4WW1B 5IW3A 3NZ8A 4JY4A 4BZ2H 4XNXH 5ICYB 1YPZE 4Z0BL 5MERA 2YR3A 4NKMA 3FRUA 4OM0L 3R0MA 5EFIA 2PXYC 4UMGA 2WM0A 1TMCB 2OMNA 4OF5A 5GGVL 4C83A 2CQVA 1HK6A 4PJ7B 4QHUA 4XB8A 1MUJA 2ZUSA 4NQDE 5DD1L 4H0IA 5CZVL 1KB5L 5J0BA 1K6QH 1YN6A 4OZ4B 2NY1B 1BIIB 2CKBA 3MUGA 4WY7L 1RULH 5CILL 4TVPE 4NCC2 2DL9A 5ALBH 1NCUA 2G2RA 3C8KA 1MHEA 3MNZA 3QBTB 2BOCA 3DUUB 1T6WA 2WBJA 3W11D 3GSVB 4F7PB 2I24N 1LWRA 2YD6A 4K9EL 4TUJA 2Y72A 3OHXA 2XTJC 4EKXA 3DJ9A 5F96H 4TYUA 3LHPL 4PJ9C 4R0LA 4PJ8B 4NQEE 4J23A 2J2ZA 3EYUL 1MCJA 2W0FB 4HFWA 3ZDZE 4IRJB 4JFOA 3T08A 5K9KA 4FFZL 2AEPL 4MSWB 1IAIH 4PR5A 4NKDA 2VO5A 3BP7B 1UKSA 1AQDB 4U3HA 4ZODA 5BZWA 4NUGH 1T0MB 4YHML 2YN3A 3DUHA 12E8H 2JJTA 3RL2A 2IF7A 4F7CA 2V6HA 2DRUA 4KQ3H 3O4OB 3DVGA 2ZOLA 3O4OC 3IDNB 4EI5C 3TA3D 1Z9LA 3JV6B 4JFFD 5E2JA 2Z8WC 5D7KE 4YHNA 3KPLA 4JM2A 2EIZA 3BD5A 3JTTA 4HUUA 4PG2A 2DQCH 5DRWA 1U8MB 5BRZA 3KG5A 1FSKC 3SKOA 2V17L 2W65B 1NCNA 5FYLE 5C0IB 1YYMH 5EU5B 1BBDH 4K9EH 3OR6A 3VJ6A 2XN9A 1ZSDA 2Q3ZA 2IPUK 5KJRH 4TN9A 4XPFL 5ACZB 1D5MA 1MCIA 4UOW1 1VFUA 2J6EA 4NO0B 3LS5L 4FQJL 3R8BB 4N8CH 5IQ9B 1A6VH 3ULSB 4KVNH 2CR3A 3E3QC 1FO0H 3FB7B 1TETH 2ADIB 2XA8H 3K2MC 2XZQH 3JWOH 4PGZA 4UU9B 2ZJSL 5C0JA 4HMDA 1R5VB 2MQ3A 1TVHA 4NNXA 1FG2B 5MEOB 3RGHA 2WQ8A 1QOKA 5FO9B 5IFHL 4YHLH 4HSQA 5HHVL 3WL9B 1A1MB 2UYLB 3K8MA 4H5SB 5BOZG 5DEZA 5F7FA 1LP9E 1N5YH 1J10A 3L95B 2ADIA 1IM9A 1WFUA 4OLVH 5H94A 5LXGL 4MLIA 3N85H 4ZAKC 5ERWA 1MF2L 3DI3B 3DRQA 3BIKA 4JN1H 4N0RA 5IB5B 1J5OH 3T3MF 4JGJA 3BJ91 3KWWA 5EC2A 4TSBH 4HIIA 4KJQC 4PJEB 3GKZA 5DJ0B 3RBSA 1GGUA 1O7SA 3UAJD 2PTVA 4NCC1 1XR8B 3ARFA 2ZUTA 3MFFB 1UZ8B 2QHRL 3BZ4B 1TITA 5JR1L 5DJCA 3MSPA 2VC2H 2FZ3B 1W8OA 4FQLH 1AI1H 2VYRE 3OF6D 5BXFA 2OSLA 2ZCLH 2H3NA 5IEKB 5HI4C 4ODSH 1QO3A 2DQIH 2EXWC 4HKXB 2HLFC 4X7TB 5C07D 4HUNB 1F3JA 1NJ9A 1Q38A 3OZ9H 3EGSA 4CBPA 3TIEA 5GJSL 4FFWC 1II4E 1E28A 2BSSA 1TVBA 3BEVB 1BQLL 2G75A 5F96L 2CXKA 5F9AC 5GISH 4B7LA 2P5WD 4KKCC 5IROC 4OQTA 1B4JL 2V2TA 3BP5B 5CEYB 1CGSL 2HMIC 4GG6E 3TIDB 4C59B 2OX5A 4MCYA 4K8RD 2IH1B 4XVTH 2BVYA 3PWVB 3WSQL 5M95B 4NSKB 1U95B 3CPLB 3VRJA 2AABH 2D9QB 2W0FA 4K55A 2VLJD 4FQXA 1XGTB 3QH3A 2NMSA 1DZBA 4KJYB 3MV9D 4LCUA 5GRYA 3P11H 3LKRA 2EH8H 3WLBB 3B9AA 1JVKA 4P3CH 4ZG1A 2FEDD 4X6FA 1GGIH 2BY3A 3DX7A 3RVVD 3U7WL 4L8BB 1S7UB 4HS3B 4LOUD 1UQSA 1A3LH 4YNYB 4LPUA 2VLKD 4MNHB 1TTUA 5J06A 2IADA 1A0QH 1PW3A 4R97B 4AEIL 1ZLVK 2VZ1A 1BX2B 5HY9B 4HZAA 1GPOL 2HA1A 2CO6B 5IB4A 4NO2B 5EUOB 4DKFH 4N0FA 2IBZX 5E5UB 3UYRH 3QUXA 3CMGA 4G8EA 5CZXC 5K9JH 1HH9A 4OF3A 5JXEC 4BSJA 5E8EA 5HPMA 5L2KB 4N8CL 2J8UA 3QXDA 2IFFL 3TM6A 1AH1A 2EKSB 5DLMH 4E41B 4O5LH 1D6VH 1LEKB 1UCTA 3OL2A 4J12A 4IOIB 4NPYB 1CBVL 4CMMB 4H88H 1I9JH 5DUMH 4HIJB 1RY7B 1ETZB 2FECL 2P5WA 3D69A 4NUGL 4K94L 4JVUA 5E56A 3BMWA 1HHIB 2IMNA 3W2DH 1DUYA 4Z5RA 1RUAH 3BPLB 1I1CA 1MCQA 1NL0L 3HE7D 4Y4HB 3JWDL 4ODHL 2YZ1A 1REIA 4XVTL 3BP6A 5I30H 2C3GA 4FFWD 1C08B 2BSRB 5ISZD 2G5BB 3MLZH 5LWYL 1JGEB 2EH7L 4U6VL 3MJ7A 2IAMD 2BNRB 4N8PA 4U31A 5HPMB 1OARL 1F3DJ 3L3DB 1FIEA 1HZHH 1ZHKB 4AENB 4CVZA 3RTQC 2GK2A 1GL4B 3WIHA 4OTXL 4MQ7A 4JDZA 4PJIA 1HEZB 3LEXA 5I66B 1DBAH 4I0PA 3RZCD 2BY0A 1HXMA 1BVZA 4P57B 5I1KL 4B7IA 1S9XA 1U91A 4MA3A 5DFVD 3NZHL 1X5KA 1N6VA 3QR2A 3T65A 2EDTA 3WIFA 5TF1H 1MELA 2VISB 1T0MA 4HAFA 3TWCL 1P7QD 3LRGA 1QKZL 3RWJA 3VCLA 4G8GB 3R06B 3NFSH 2EE9A 3MLXH 4OD1H 1W72H 4Q58C 2KL6A 4YDVA 3LZFL 4KDVA 5HGHA 4JN2B 3CSPA 4GW1A 1S78C 4PRHE 4ZXBD 4EN3D 1IGTB 3O8XA 2BCKA 4KH2A 4R0LB 2YN5A 2VLMD 2P5ED 4M93B 5FV2A 5GISL 1WBXB 1BVKB 3WS6C 1X4ZA 2C1PB 2W38A 2VQ1A 4ZFFA 1BJMA 3QDJB 5C0FB 1CXIA 4YGVA 3DWTA 3WIHH 2R1WA 3T09A 4L5FL 1OW0C 3BSZL 5IB5A 2R29H 1ZLSH 2R0ZH 5F7DB 4AL8L 2R2HA 5I76B 5C0AD 4X8JA 5KVEL 1PEWA 4L4TB 5CIPB 3NTCH 1RVFL 3L95A 1K9TA 3EFDL 4DN3H 2XZCL 3KJ6L 5A40E 2H26B 1BOGB 2PW2A 5JIHA 1CR9H 2CDEB 4XP6H 4MB3A 4X5WB 1PGRB 1A6AA 5C6TH 1MHCA 3J7HA 1PFCA 5IBLC 4Y5XC 1MAJA 4L3ED 2CIKB 2A1WH 2X4SA 1G0YR 3GRWH 3VFTB 2AI0L 4R97C 3QJFA 1Y6MR 5IV2A 3IDXH 3X13B 2DBLH 4W70A 3AU1A 5T1LA 3CLFH 5KG9B 4I3SL 3UTQA 3ARVA 4OLZH 1N2RA 4QRUA 5GRZA 3LKPA 5C0NC 1FLRH 2V2WA 1TZIA 4G80A 1HH6A 5E8OA 5CJXC 1KTLA 3MJ9L 5EU5A 4S0TD 1AQKL 2HKHL 5DHYB 3RWIB 3V0WL 1ZGLB 4XX1E 2JJSA 4RFEA 3BYTA 5JXAH 2X4QB 1A6TA 1U8MA 5BRZB 4O51A 1I3RA 4MJIE 3CVHB 4MMZC 2DQTL 2NLJA 1Y6NR 1V7MH 5F7EL 3OTTA 2CDFA 4O4YL 5F7LB 1TZHB 5MEQB 3HE6B 3BZFA 1NL0H 1GC1H 4YHLL 2BC4B 3BWAB 4A6YA 1UWGL 3MV8A 3BKYL 4AEHH 4BFBD 1CI5A 2HG5A 3RGVA 3KNBB 2LABA 4KK5C 5D1XA 4FQ2L 4S1SH 4L5FH 1DN0A 4YHYB 1ZA6A 3BGFC 4P2QB 1OW0A 4FQIH 3ARDB 4CW1A 1LK2A 3V8OA 4JKPL 5IW6A 4MCZA 1AXIB 1U8OA 2ITCB 1MF2H 4JN1L 2YPLA 1EFXB 4PJHF 3P0YL 1X7QB 1ZSDB 4N0UB 3S7GA 4IRJD 2YXMA 2IGFL 1U8LA 4HWBA 5D8JL 1G7PB 3DX8B 4YPGA 3MV7B 1FIGL 2BRRL 4RNRB 3BWUC 1UJTA 3W0WD 4LDEB 5EBLA 3FQXB 2LQRA 4XCFH 4JM4L 1J05B 3FO0H 2AJXH 4ZNEA 2BOCB 2APBA 4P2OD 2IANE 3EOTH 1BX2A 5HY9A 3W39A 3GSNL 4NO5B 2CIIB 2GK0A 3BOVA 3MLUL 1RIUH 4XBPA 3IB4A 3NFPB 4UV7H 4F3FB 5C0BE 2P46B 3GZKA 3EOAA 3AMLA 4FG6C 4KK9C 4OIAA 1BQLH 4M62L 4ZXBC 4MWFB 3S6CA 4S2SA 2AKRB 2XPGA 5TQ0H 1S9KC 5DT1H 3CXHK 4HK0A 3RU8L 2VLKB 5T1DL 5KSVB 2PTTA 2QQKH 3X3FH 4J3WA 4U49A 4LDOB 3FQNA 1YZZA 4XCCH 4U1HA 4WW1A 4G8IB 1CDYA 2UZYB 4HC1A 4U3CA 5TQ2L 1G9EA 2IGFH 3P77B 5D96B 4ZUSB 3ZLQC 5HGBA 3T0WA 3TIDA 2N7AA 1YNTB 4I2XB 4Y2OA 2I07B 4XBPB 3BN9C 5D6DC 4DN4H 2F54D 5D7LB 2ZCKH 1T03L 2EO1A 1RIUL 3FQXA 3U46A 5DRXB 3BE1H 2WWMD 3SHSA 1ZLWK 1TJIL 2BSTA 4FFVC 3O9WB 5J12B 5IHBA 5I8OL 5IVXE 3LEXB 3WHXB 5I66A 5EFIB 5IB3A 3IF1B 1IEHA 5FCSH 4EI5B 4LOUC 5C07B 3E1F1 3VD3A 4QRPA 9CGTA 4HT1H 5EU6D 3HC3L 4KMLB 3KS0H 3MTRA 1P7QB 4KC3B 4QCIB 3DPBA 5BMFL 2P5EE 1J5OL 1RZGB 5I1DA 1SYVB 2QSVA 4I8DA 3MLUH 4MJ6B 4LLMA 1SEBA 4UV7L 2H2SD 2HT2D 2J4WH 4YHPB 5JHLL 4OKVA 3ZT6A 1J1PH 4N9GA 1A6WL 1J7VR 1K2DB 1T21A 3ZL4H 1JNLH 4NGHL 2GFBA 5CEZD 4PJ7E 3F7RA 5EZOL 4HGWA 4TUOB 3CDCA 4Z7NF 3C08H 3LRHA 3QEHA 2LFGA 2YXFA 4JRXA 3IDIB 2CIKA 3LV3B 3U0TA 5F8QC 1CICA 3WD5L 1JPFA 3O4LD 3PWPD 3MJ9A 2FDBP 4R7NB 1BEYH 4OZHF 1OAZL 2PW2B 3TH4T 3OR7B 1MREH 1YPZF 3H9SD 3OKLA 5DYOA 4AJ0A 5D72L 3UBXB 1F58L 5FKPA 1NC2A 3AGVA 1J0IA 3BKCL 4JREB 5DDHA 5IJKC 3O9WA 2QLVB 5FEBA 3IU4H 4O00A 1OY3B 1I8KA 1S5HA 2H41A 2VXUL 4WFHD 4NQDD 1K5NB 3MCLL 3ARZA 3UROR 4NN7B 5FIEA 3ZE0F 5EOCH 3MX0A 2QQLL 3SE4C 3BH8A 3O2VH 4E41D 3IFNL 2Z35B 1B9ZA 2X4UB 4HWEH 4RMSA 5EA0L 5TF0A 4ZUTA 3SY0A 2EH8L 3C60A 4BFIA 4X4MA 4XCYB 1MQKH 3PWJB 2HMID 3RIFF 3LZFH 5AYQA 2PYFA 5SX5K 5FO7B 4FZ8H 4XAWH 2JELL 5HYFA 4M43H 3QDMA 3RDTB 1O5DT 1YEHL 5SWSE 5IMLB 4HCRA 1KB5A 3GMMA 3FZUC 1XEDA 4MVBD 3KJ4C 5T1DH 3S37X 1QSFE 2DI8A 2B5IB 4NN5C 2G5RA 1W0YT 4YE4H 3QAZB 5IIEA 1HEZA 3C6LB 4LSUH 3MZGB 1IGTA 1JPGB 2JIXD 3RTQA 3ILPA 2XQBH 1UACL 3O6FB 1FNHA 1CE6A 1NLDL 1QSEE 1MCEA 3GM0A 3GUTA 4M7ZB 3ZTJH 4WGVB 1ZT7A 5EPMA 3RWJB 4NKOB 1DLHB 1WICA 3OXSB 3GNML 5ANME 3QDJE 3B8YA 4Y5VB 5CSBA 5E1HB 1QKZH 4OI9A 2I5YL 3KPNA 1MJJB 5I6XC 3QWOB 3M17A 2HRLA 3KLDA 2DJUA 4IDLA 4PP1C 4U1JB 1FBIL 5KAQF 4XXCA 1XGPA 4OZFH 4X7SH 2YBRB 3VWJD 4POZC 5I8OH 1TCMA 4Z76A 3S97C 5IT2L 4CDGC 5LBSH 1C8PA 4KRLB 1NCDL 4QY8B 3DBXA 5GS0C 5CGMA 4OBSA 1HOCA 2C4XA 2BNQE 2XRAL 3MCLH 4HKJA 3G5XA 2EXYD 2VSDA 3SDDB 3EFFB 1E4XL 4UT7L 4XMPL 3SDCD 3HPLA 3MRCB 5JTWA 1A7PL 3GHBL 4JDVB 4Y4KB 4H5SA 2XN9D 4KZEH 3D2UB 3GMLA 3RWDA 4IMKC 3G9AB 1WF5A 1G6VK 4Z5RB 1D5IH 4PRIB 4X7SL 4I0PC 2H1PL 5FUZL 4U7KA 5JHLH 5I1KH 2HTLC 3SGJC 1IARB 4WW2C 1AO7D 2Q87A 4NJAH 3B5TA 4LHQB 3MXWH 4N0CD 3JXAA 3TZVB 4MXQC 1NAKH 1FO0B 3MRQA 4OZHE 5LAXA 4HULB 5BQ7A 5I2IB 1FV1A 2K9UA 2Z92A 2GSIA 3QYCA 5EZIL 1MHPL 1ZAGA 3D25B 3VRIB 5C0CD 4QXTB 3V9FA 2P8PA 1I1FA 3O8XC 4I18C 1FBIH 1RU9H 2XN9B 3ROLB 1Q1JL 3RNQA 2APWA 1EAPA 1FNEA 2E6PA 3I6GA 1CLYL 1EGJH 3HNTH 2BDNL 1KIPB 3MLTA 6FABL 3RUGF 3PHQB 1CGTA 4G8GD 2YRPA 1T83A 8CGTA 2ZCLL 2A6DA 4XCFL 1CFBA 5AWNL 3B9KD 4YXHH 5H2BB 3RZCA 4TTDC 4K3HA 1H3GA 3OGOE 1AFVL 5B22A 5FECB 5KOMC 5KOVC 1GOHA 4P2OB 3MRIA 3EIFA 1S7QB 1YNKL 2BOBA 3W0WB 2W9DH 3NCJL 5JORB 1EEYA 5AG8A 5L7XL 1L9NA 1CT8A 3MRPB 5ITFB 1H8OA 3WUWG 2Q7NA 3ARFC 2WINB 4HH9A 3ARGB 3PWNB 4X6CE 2X4TA 5M7QA 2EIEA 3GMPA 3IFLH 3U79A 4ISVB 4KRPC 1N7ML 1NAML 4OQTL 5KSVA 2K3TA 5F89B 4JANB 4L9DA 4Q6IC 1PG7W 4L3AA 3HPJA 3D25A 5C0BB 3VGGA 4JQIL 1NC4A 2IANA 3DVNA 3TN0D 1TJGL 5E9DB 4MXWH 3CX5K 1KIRB 1F4YH 1N8ZA 5H2BA 5K59E 4HXAL 3OKYA 1MRDL 3RKDC 1BIIA 2VLKE 1SY6A 4HS8H 4JFPA 3KPSD 4P5MB 1EAPB 2NY5H 5CHNA 1MCHA 1Q0YL 4JFEA 4I18A 4GH7B 3VFMA 1DE4B 4KHXL 1KLFA 1MFCH 1ZANH 4PRPD 4RWHA 1HSAB 5FYKE 4UTAH 2ESVB 4KI5C 4U1MA 3QO0A 1R5WA 1BD2B 5BMFH 2R2BA 1XF5A 2AAVA 3HZYB 1AKJA 1S9YB 4L3CB 4DW2L 1ZVSA 3RJQB 3WN5C 4ODWA 4JHWH 3QDAA 4KQ3L 4A6YB 3CMOH 4OCWH 2ID5A 4PB0L 4FTVE 3WXWH 2G9HB 3IGAA 5CJOH 5IVXB 1XGUB 3SDXA 3NN8A 2VLJA 3ZHKA 4HH8A 4RAHA 5GGRB 1ROWA 2NY3B 4BQCA 1K8DB 1N8ZB 2A6KB 4OFIA 1FZKA 4JRXD 5HHMD 5SV3A 1YEIH 4MB5A 3EYOB 3QXUA 5EO1A 1QHOA 4O02H 2H32H 1BEYL 3K1DA 5JMOC 1T89A 1JBJA 4PPTA 4ZPTB 5KSUA 1G1YA 1S7TA 3PG2A 3RUGB 2VTFA 4JQIH 4D0BA 5IMKB 4N8VG 4G6FD 1FJ1B 4LAQL 4BSVA 1F4WL 3IU4L 5FUCE 1JWMB 3F12B 1Q9KB 5EUKA 4ODXA 3DO3A 3L3OB 3PP4H 5CBAB 2C4FU 5E8NB 1G7MB 4JY5L 4HWNA 4LCYB 1AHWA 4RRPA 4UI2A 3ZT7A 5L2JA 1IC7H 5I15L 4P23B 4IRSB 2RBLA 4DOHE 1CWVA 2WANA 2WQRA 4Z7VA 2W9DL 1RZ8A 3NCJH 2HT4D 5L2JB 2AEQL 2ILLA 4GUPA 4LAJH 3OKMA 1JFQH 1F2QA 3EO0A 1LO2L 4C56D 5AZEL 3SDAA 5HHVH 5GJSH 5EZOH 3TCLA 1WAAE 3LKQB 1A8JH 3G04B 1F3RB 4YZFE 2D2OA 5IFHH 4YXKL 2VLME 5EBWB 5F71A 4P57A 4D0CB 4ZDHB 4LSTH 3V6OE 3AREA 1BAFH 4U1SB 4KGJA 3GI9H 1BQHG 2D7MA 2PW1A 1LO4L 2R0WL 3QPQC 3MJ7B 1RVFH 4YR6B 3PL6B 1M05A 3D2UD 1A9BB 3HI5L 3SDCC 1X4XA 1EO8H 5K59F 5D2NA 5JW5A 5JW4M 2FWOA 4NP4H 1QBBA 4XHQA 4HBCH 4GRLC 4Z95H 4EN3B 1FO0A 3MRQB 5LAXB 4M3KB 3CDGA 2H3NB 4OGXH 2DN7A 5CZXD 2X9WA 4OLYH 2VH5H 2EICA 3PHOA 3P9WB 1CG9A 1LO0L 3BXNB 4NO0D 5F9OH 1PSKH 1UKTA 1K3ZA 5HVHB 2MTPA 3RVUD 3OKOA 1PG7L 1MCOL 4HDIB 5KVFH 1D9KB 1ORSB 2ESVA 2BNUB 3U30C 5HVFB 3HRPA 3HZKB 3H3PH 3NZHH 1FNFA 4P2QE 2NY3D 1NFDF 3CSYB 3TT3H 1WTGT 1KG0B 1MFDL 3V6ZA 4E0RA 2A0LC 4OAWA 3GI9L 4PG9A 1EHXA 4R4NC 1X5XA 2GFBB 3J8F7 5E2VH 4H25A 3WKML 1B0GB 2AV7A 1IGIL 4U1IB 1CL7H 3WXVH 4H88L 1KENH 4WNQA 1UWEL 4FQ1L 3UJTL 3MBEC 1EAJA 2EXYC 4JO2H 2ICEA 5FYJL 5JNYA 4KTDL 4PJHB 2W60B 3PIQA 1E6JH 1KBGL 4L3EE 4JPKH 5CMAA 3ORJA 3C60C 3QZWB 5C71A 1E0OB 5A1AA 3OGCB 1AP2A 3REVA 3UTZB 8FABB 4ZOEA 1YJDH 3ME0A 5DEGA 1U8QB 2PO6C 1MPAL 1GGCH 1Z9OA 2D4FA 3MUHL 3ARUA 3GKWH 4QRPD 1Z0NA 4GRWH 3TESA 5DRWB 1AGBA 1F11B 4Z95L 3VH8G 1CQYA 1U92B 1OWRM 4P4RB 4OF0A 4ZD3H 4IMLB 3U7AA 3JV5A 5D7LA 3DV4A 3TT3L 2IFFH 4LKXB 4F57L 3RVXC 3FQWA 3BP5A 1OAYL 3TN0C 3LDBB 4PLOB 1J11A 2F54A 5ICXA 4OZHB 1CGYA 1C12A 3HCVB 2F8OA 1TVBB 3BEVA 4QHNA 1OF2B 4GG8B 4CJ0A 2WAHA 3MCKA 3DYPA 4W81A 1MRFL 2IWGA 3S36L 3MUZ1 2N4IA 1WITA 5IK3A 1A14L 4WENB 5LGJB 2D03H 3MLXL 4OD1L 3CH1B 4RSVA 1DBBL 2VXTH 2DYPA 4GBXA 2IQ9H 5D7LE 3EYUH 4BQ8A 5C92A 5T3XD 5IB2A 1I1AA 1MCFA 5ESQA 1C12B 2Y36L 1V05A 1IAIM 2D0FA 3CFJA 5J9PA 5J1TC 1KFAL 4YDJB 4WUKH 1C16B 4XCNB 2Q76A 4L4TD 2NY2C 4HWBL 5I8KH 4F8QA 3EOAB 4M02A 4P9ML 1Q9WA 4Y4FA 1IGCL 1QLEH 1AIFA 3IETB 2BY2A 1X5HA 3VH8B 2XG4A 3B9KB 4U6HA 4UT6H 3W0WE 3S37L 4NHCH 2VZOA 2P5EB 2XZCH 3KJ6H 1QEWA 2AJXL 3VWJC 5E6IA 3V5KA 5DTFA 4IMKA 3S34L 1NCCH 4ODUA 5FOJA 5FGCB 5GGTL 4DKAA 4PV9B 5FA3B 1D5IL 1H0DA 1ORQA 1T4KB 4A6YL 4AG4H 1NCWL 4PJ9A 4MAUL 2FH6A 4GAFB 4N8VB 4X4XA 3U9PH 3E0GA 2A6IB 4HUXA 1KJMB 5EIVA 5I8CA 3S4SB 3ES6B 3HG1D 4XTRC 2I60H 1NFDE 1S9VA 4MS8C 1U8PA 1UXSB 3MYJB 1U36A 1LEKA 4M6AA 4C54A 4RMRA 1NGQL 1MFBH 2CGRL 2YEZA 3GK8L 1BECA 4OZGB 3ULUL 3HFML 4G6AD 5JW4Q 4LCCA 3D0LB 4YFLF 4DW2H 3I3EA 1JGDA 1QA9B 2ZZUT 5FB8B 4ZFZB 1OP3H 2AJUL 1FYTA 3MRHA 2NW2A 2DIJA 3MR9A 5TDNB 1NQBA 4K7PH 4NBZB 2FBOJ 3LRSA 4LPYA 3U36A 5A16B 4ELKA 5DTFB 2AJZB 3WKMH 4X6EA 2LAAA 3LD8C 1ZKAA 4ODBD 4J6RL 4UBDC 3S37H 1GIGH 3HAEA 3L5WA 3UTTA 2FATH 3MRJB 5JOEA 4FXKA 3O6FA 5CLWA 3STZB 5BS0A 4HF5H 5GGRY 2BVTA 4KTDH 3T0BA 4AEHL 1BD2E 1QR4A 3HMXH 2K7PA 4MAUH 5TF1L 4WUKL 3RDTD 3ULVH 3O3EA 1VFAB 3TWCH 5BJTB 2CD0A 1MHHA 3FHAA 4MYWB 2C7UB 4KTEH 5F1IB 1EMTL 5EDXA 3QI9A 4PRNA 3QJFB 2YOCA 3TZVC 4FTVB 4UIKL 5CINH 4MA1B 3G6AA 5JXAL 4YIQB 3VXMB 3GMRB 5IWLC 3BRFA 4X6CA 1WAAF 3MJ9H 5IBUG 2OL3L 4TNVK 5FYJE 2O5ZH 1FRGH 1FVEB 4XCYA 5D1QB 3RWFB 4FQHB 5F21B 1X9QA 1FORL 4ZYKB 1IM3A 4N5EC 4AM0A 3NFPA 2QL1A 2WNGA 3MODH 4JPIA 2NY1D 3AFLA 1R3IL 2CKBB 4KDTA 4M3JA 1L0QA 5I1IH 1A6ZA 4WW2F 1AQDA 1BFVL 5BZWB 3LD8B 4LLAA 1SJXA 3IS0X 4QT5A 3H3KA 1G6RB 5FFLA 4LSTL 4OZIF 2MHAB 2JLLA 5IG7B 5C0DB 3RU8H 1IKFH 1DEDA 4WRLA 1HILA 4XPGL 3BQUA 3MRLB 4JGMA 2Q8BH 2VKXA 2VDNL 1X7QA 4FG6D 1MIML 1UCBH 4JFED 4ZFGH 1F13A 3F12A 5EUKB 2H2PC 5IB1B 5MP6L 3RNKB 3GFUA 4BZ1H 1P4BH 2ICEB 5I1HL 5EIIB 1AY1H 3MRFB 1LEIA 3EOTL 1ZS8A 2NXYC 5C2UB 5EOCL 3TJEH 1KB5H 2VDOH 1SM3L 1T5WB 4PRDA 4WFED 4JHZA 1CGXA 1AHWC 5DJDB 1GGBL 1QFWM 3LPGA 1U8JB 3IFPA 5TFSL 5EZIH 3G5ZA 5DJ2B 3U0PB 5A43C 2A6DB 1A0QL 5A3IC 3DO7A 1SVCP 1T03H 3VXMA 3CZJA 1P7KB 2MKWA 4XMKH 3HZKA 2H6PB 4UDUB 3OAUH 5SWSD 1KCRL 4JFHD 5E5RB 3S96B 3DRTA 4NQCA 5IWLA 1EHNA 4PJ7F 3MRNB 3OPZL 3OF6A 2QQNL 1CFNA 4H8WH 4FQ2H 5D7LD 1KSRA 2XKUA 3SDYL 4LL9A 1KNOB 3ARQA 3VW3L 2X05A 3BPNC 5DURD 1ES0B 3LQAC 2XN9E 2I26N 5HGDA 4Z0BH 3RWEB 3OR6B 3VJ6B 3WV0A 1T2QL 4HWZA 4ZUUA 3KPNB 3N0PB 4HJ0C 1JK8B 4QRRD 1E27B 2V5SA 3TBTA 3CDGB 4WWID 3T8XB 3HAEB 4R9HA 4KROB 4C56B 2ADJA 5F3BA 1DLHA 2L0DA 4NQCE 2NY5C 1CZ8H 4NRXA 4GO6B 3WDHA 5HGBB 1Y0LB 2BP3A 3BHBA 3S3JA 2JF1A 2C1OA 3DV6A 1S7WA 1G7JB 5L2KA 1N0XH 3E8UH 5LXGH 4A6YH 3DLQR 3MBXH 3P9LB 3ULUE 5E94B 3QUXB 3ULUC 3TEUA 4NFCA 4HKZB 1DQDH 1ZGLP 4L1HA 4HUWA 3JTSA 3BD4A 1W0WB 1A7QL 2VRAA 1M71A 4KKAC 5CLTA 3LSOA 3OXRB 1LDPL 3CZFB 2ORBH 3CLEL 2HFGL 1E4XH 1AQKH 2FHCA 3E6HB 1D5XB 2DWDB 1CG9B 3OPZH 3V6OA 3K7UA 1B3JA 4AK1A 2B2XH 1MRDH 3VXRE 5ITBL 4LLYA 4PV8B 4XCEB 2PO6B 1FO0L 4M8QB 2DQFA 3P4OB 2WINA 1FFQA 1IEAA 4CU6A 1SBSH 1E4KC 3C60B 4BFIB 1P7HL 1A9EA 5TQ2H 1T04A 2AEPH 1YN7B 5D6DA 5HHNA 4MQXC 4QHNB 1DBBH 2VXTL 1QO3B 1G0DA 3BKYH 4J3VA 2V5RA 3BSZH 2I25N 2VDMH 2FL5A 1IVLA 3O2WL 4P5KB 4ONOA 3U2SB 1C16A 4LPWA 5CSGA 3D3VB 3BX7C 1A02N 1KJ2H 2FLRT 3MXVL 1MCSA 5E08L 3ULVD 4PJCF 3V5HB 3OKEA 2ZG2A 1BJ1H 1OD9A 4ODTL 5DJXA 4HG4K 1BD2D 5I73B 4UAOC 3UPRA 3WLWD 3S8WA 4FTVA 4RCAA 3TIEB 1N4XH 2C3HA 1RJCA 4OBRA 4UOJA 2JJWA 3GBML 1YYML 5D7KD 3SCMB 4M8VA 4M7LH 3VGAB 4KPHL 2LV4A 1GC1C 1A7RH 4R26L 4WUUD 3QCUH 2FIKA 2ED9A 4PFEA 1I7RA 2QR0A 2WP3T 4LLMB 1OAUH 2FIKB 1KIUA 1IEBA 4XC1L 2FX9L 4U7SA 43CAB 4OZFG 4NQVA 2Y4SA 3QUYB 1S78D 2YPLE 1T1YA 4EN3C 4PREA 2FHBA 3LS4L 3ARDD 4PRPE 1MJ8H 3M1BA 1P5VA 1ONQB 4FN0A 1A5FL 3O81A 5BW7C 4Z7UF 4MAYA 1CFTA 3Q1SL 2NR6D 3U48A 2I9LB 5IHLB 4JKLA 43CAA 2J8UE 1YECH 4S1QH 4HGKC 3MRKB 1U0QA 3NN8B 4LIQE 1YY9D 4GLRH 5T33L 4F33B 4LFHD 4KKLD 5KSAC 2OI9B 3FTGB 2CDEA 1QSFA 3GBMH 3V4PH 2DTMH 4XHJD 4AIZA 1LE9B 1U41A 3QFJA 5E9DA 3O4LE 3PWPE 1U3HC 2APXA 2VXUH 3R4DA 1JTOA 3DX7B 5T1MA 4PJXF 1RSFA 1YQVL 4P23C 4RBPK 1R5IA 4JPWL 3GGWA 2OLDA 3QEQB 1RHHA 4FOMA 3K4AA 4YHYC 2DBLL 4R2GC 1BVLA 3DMMA 1UVQB 2OK0H 2ATKA 4PJ8A 1U8NA 3I6KA 1G7IA 4O9HH 3O3UN 4QYOA 2X09A 3NABL 4G8FB 4EIZC 1QRNE 4OLUH 4DJMA 5MENB 2HT2C 3C8HA 4R6UA 2H2PD 4Y2DB 4W6WB 4MDJA 3RL2B 4QOKA 2HVJB 3MJ6A 3TZVD 4DCQA 1FHGA 1MLCA 5E00A 5DURB 1CU4L 4PRHD 5I9QB 1RZ8B 3D87B 1OTSC 4M7LT 4U6XB 3RVWC 3LKOB 2IAMB 1YN6B 4OZ4A 5EWIH 5GRJH 3RWCB 5JW5B 5E2WL 3HHRB 1FVEA 3ZE2F 4PGDB 4UB0H 1PD6A 2VR5A 4X4YB 3U7WH 3WN5B 5J1SC 4XPGH 4QXTA 43C9A 2RCSH 4Q0XL 1C1EL 2IBZY 4M9OA 4AZ8A 1TLKA 1FNGA 1Q9OB 2IEPA 1CDHA 3BPCA 4ZO6A 5DHVB 1ZLWH 4EQ2A 1MY7A 1YEGL 1B90A 5C0GA 4Y16A 4R26H 3EKCA 1CXLA 4NBYB 4RMUA 2HT3C 4K2UL 5IHUH 5J8OA 5GJTL 2FX7L 2NPLX 3WFCL 3GRWL 3SO3B 5F72S 3LAFA 2A1WL 4ORGA 1MIEL 5C0JB 5J13C 3AB0B 2WBJC 3CH8A 5IF0A 4RGNB 3A6OA 1OQOA 2DQDL 2VNCA 4BH7B 3N1MC 3SBWA 4GXVL 4PUBH 3S5LG 2VDRH 4IDJH 4PGEB 1YJDC 1NCBH 1QNZH 2HWZH 1FLRL 4KK8D 3T3PE 2FBJH 3GJFA 4R0LC 1HHJA 1YEJH 1ZWIA 3FHQA 1RUKL 2W59A 1OGAD 2BFVL 3K2UH 4OLWL 2HTLD 1V3JA 1EFXA 3IRZA 3VFSA 1MCPL 1WWBX 3B9DA 4Q9QH 2X9YA 5F7NC 3VXSB 3DIFA 4NGHH 1ZA6B 3WS6A 4Z77A 1R0AL 4F58H 1P1ZA 4N5UA 4IJ3B 3B3IB 5LG1A 3BN3B 4GKNB 2VLRB 5HJ3B 2M1KA 4L8BA 3CFCL 1AY1L 3UZQA 1C5DB 1MAML 3QXWA 4KJQD 1AJ7H 3L1OH 1CGSH 1CQKA 2VLLB 4I4WB 4MS8D 1CLZL 3GB7A 4RFNC 1YQVH 4S1SL 1WZMA 1YEEH 4MNQE 3U46B 3LCYA 1MRCL 4BK4A 3NCBB 1OTTD 3JBG7 3NA4A 5FM8A 1R3HA 32C2A 1L7TL 4HUVB 4X7EC 1B6DA 3KAAA 2C3WA 2I9TB 2F53E 5I75C 1SJEB 12E8L 1PQZB 4QHKI 3CVHL 1OLLA 4KK5D 3ULUF 1FPTH 1B4RA 2ICES 2R0LH 4I0CC 4CU8A 2DQCL 3BPLC 4U1JA 4NWUL 1INEH 3P77A 1BFOB 1NGZB 1KPVA 2O5YL 3Q3GA 1MCWM 3EUUA 4KU1A 3V0WH 1RJLB 5GXBB 1A3LL 2ENSA 3CFBB 5EOQL 3NTCL 5E4IA 3NCCB 1L0YA 4H0HB 4X5XA 3GJEA 4KY1L 3MMEA 3BGAA 3LY6A 5T5NG 3SE8L 2E7BA 3QIBD 3L5JA 4O4YH 4I3RL 1PG7H 4HKBB 3MRDA 5DO2C 2DQFB 3P4OA 3MCKB 1NUFA 5DR5L 3ZE2E 3EO0B 1C5CL 2KUTA 1G0XA 5HHXH 1NC4B 3MNWA 1YY8A 2X5PA 2PCPA 3QXTA 1F4HA 4Y2DD 3OBAA 1U3ZA 1CR9L 1C1EH 4XVSH 2BVPA 5JO5A 4C55A 2HN7B 3QQNA 3UDWA 3WDIA 2EZ0C 4JY4B 1EVTC 1AGBB 1BVLB 2VKWA 5D7JB 4UDTB 4XP1H 3P9LA 4PY7B 3SDDC 1IJ9A 1FCCA 4Q9BA 1I4FA 5L88L 1DQLH 1AGEB 1NFDB 3Q3GB 4XP5L 4Z78B 1MHHB 1ONQA 5I74B 3LKNB 2OQJA 1INEL 5ADPH 1UM4H 3UPAA 1N59A 3IJHB 1OAKH 4IRZH 5CD3B 3JV4A 5LVEA 1WVZA 4IHOA 4ZOAA 4GRMB 5GS1C 5BS0E 2BRQA 1J87A 1FFPA 5C2BH 3MQIA 2DQJL 4G8GA 4R7DB 1YPZA 3X17A 3FQWB 2H2SC 4Y8DC 1MPAH 5CEXA 2LTQB 3TP4A 1ZV5A 2A6IA 4HUXB 2ARJA 3D3VE 5IM7A 5AZEH 1JWSB 4LASL 3FTGA 1W0VB 5F6HI 2VR4A 5L6YH 1SYVA 4WU7A 2PR4L 2FYYB 3T3PF 5IROA 1OCWL 3KYNB 4J4PC 4PRIA 4CMMA 4MD0A 4DQOL 1IBGH 5C08B 4G5ZL 4L4VD 4NZJA 2EKSA 2I60L 2MNUA 4OGZA 4BKLB 3QWQB 3MRRA 1WIUA 4HX1A 4E41A 5AYUH 4PD4K 2YUWA 4KK9D 2YEZB 4DKEL 5IB3B 5C2BL 2P5EA 1IC4H 3QHZH 4L3CA 5IR1A 2W9EL 3MYJA 1F6LL 2Y06H 3O45A 5DVKA 1JGLH 4XPTL 2VXSH 3VXSA 2LAGB 1IT9H 2FECI 1LVEA 2DL2A 5E99H 3U0TB 1CBVH 5J7CC 2B5IC 2GSIB 1CFSA 3DTXA 1S7RB 1WZLA 1RMFL 3FOLA 4JFEE 4BZYA 4K7PX 5KSBF 1DQLL 1OARH 1NFKA 1IGMH 3TBWA 1K3IA 1YDPB 3BESR 1B4JH 1KV3A 3VXME 4XGZA 3IDNA 5JZ7C 1K4CB 4KJWD 1WIOA 3WXVL 5A2FA 2L7UA 2OI9C 2EDFA 4PB9L 4PRPB 1CICD 2Z91A 5F1SA 5C0ND 4ALAL 2JCCB 2J6EL 1QEWB 4HIEB 2IH3A 5IF0B 3BP4A 1NBVL 1KFAH 2O61A 4NN6C