1HIML

Structural evidence for induced fit as a mechanism for antibody-antigen recognition
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
219
structure length
214
Chain Sequence
b'EVQLVESGGDLVKPGGSLKLSCAASGFSFSSYGMSWVRQTPDKRLEWVATISNGGGYTYYPDSVKGRFTISRDNAKNTLYLQMSSLKSEDSAMYYCARRERYDENGFAYWGQGTLVTVSAAKTTAPSVYPLAPVGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A-KAPPA 17/9 FAB (LIGHT CHAIN)
publication title Structural evidence for induced fit as a mechanism for antibody-antigen recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 39
structure length 214
sequence length 219
chains with identical sequence M
ec nomenclature
pdb deposition date 1992-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1himL01
2Z9TA 5JLZB 3E2HB 2QEJA 2ZG2A 1UWEH 4OCXH 2ICWJ 1PY4A 1GVIA 4BFBD 4X99B 5HHNB 5GGRY 1CDJA 3AS3A 4QGYA 2R2EA 4L4VB 2UUDK 3F7YA 5LAXB 5FYKL 2B0SH 3MLYH 1JPTH 1NAML 1QSZA 1U3HB 3BH9B 4HWEL 1FFOB 5C0NC 3GSXB 5DD0H 3H9ZA 3QRGH 4M7LT 4KKNA 3DETD 5SWSA 2VXSL 3BW9B 3H7LA 2AEQH 1KPVA 2AJUH 4HKXA 2DQCH 3OTTA 3AUVA 5ICXA 1FNGA 3P9MB 4XVSH 1NCCH 2VZ1A 4MJID 4I4WB 4PLJC 5F7HA 1YY9C 1QKZL 1FL5A 3HE6D 5C09B 2VDKL 4FTVA 1X4ZA 1AR2A 5I1CH 3MLUH 5H2BA 4I18C 2R56L 4JFEA 1FRGH 2R9HC 3IDGB 3MJ8A 5MENE 4LCWA 3MCKB 3T2PA 1A3LH 5FYLE 1XGRA 3I6LE 3MRKA 3FB6A 2R2EB 4FQXD 4G3YH 2YD9A 2WBJA 5F9JA 1CE6B 4O2CB 3JTSA 4HKJB 1FFPA 1YN6A 3MQIA 5E2WL 2QBWA 5F7NC 3QDME 1OTSD 4Y1AE 1HE7A 2EYSA 4JRYA 1OWWA 1MJUH 5SWSB 5E8DL 1U8OB 2P5EE 4PD4K 4L8SC 2MNUA 2ITCA 3I3BA 5IB4A 2C3XA 1BWWA 1U92B 2WANA 4PJIA 4HKXB 1HQRA 3IDNB 4GQ9L 3FCTA 1EJOL 1PG7W 1TETH 3WJLC 1LP9B 5F7UA 4QRRD 2ADIB 3MXWH 4WWKD 4Z7UA 1Y0LA 3WFCL 1F4XL 2VIRB 1FL5B 5SX4H 2HRLA 4MMXC 5JQHC 5JIHA 5L7XL 3F5WA 5A3IC 5F44A 5A2IH 4HULB 1TPXC 5E5MB 3BZDA 3FO9B 4ZQKA 4KFZC 4M7LL 2ARWA 3D2UD 3S9DB 3UBXB 3KPSE 1KTDA 1TCRA 3AREC 3ARGA 1IKFH 3T0BA 3VFPA 3VGGA 4PRPE 3HC4L 3EKCA 4MCZA 1GRWA 2R1WB 5F7KC 3VFOB 5F9JB 1W0WA 3JTSB 4ZUTB 5ICZA 1NCDL 3BOVA 4NBXB 8CGTA 1T7ZA 3I2CH 5AD0A 5JNYA 3GSNH 5FM8A 3HG1D 4YEFA 2NY0C 2ED7A 4W6YB 3TBWA 3N06B 3NGBB 5IB4B 3PWPD 2VSDA 3V5KA 4KKCC 4PJIB 2PTTA 3CVHA 2OP4H 4ODWA 1HQRB 1MJ8H 3HNTH 4G43A 4MB4A 1BVZA 1CD1A 2BHZA 2XZZA 3FRUA 3MLTB 3MV11 5IFHL 3GSQA 1WLHA 5IGXL 1Y0LB 4NO3B 3WSQL 1KUMA 4EVNA 5EZLB 2OS7A 1ACZA 3ARFD 3NZHL 3SE8L 3MGOA 5CIPH 1JHTB 4N0UA 4G6KH 2YRZA 1D9KD 1N6VA 3GMQA 4QRPE 3CXDL 4X6EB 2GAZB 2E7LC 1MJ7L 3DVNB 4NUJA 5D7LA 5C0RH 1KTDB 1TCRB 4P2CG 5GXBB 3ARGB 2LU4A 2WAHA 2Z31B 4KJQD 3RGVD 5J4MA 2XRAH 1F4YH 1T5WB 5KSVA 2XQYG 1VPOL 4XXCA 4QXTA 3NBNA 1I7ZA 1E4XL 3WNPA 4PG9A 2BNQE 5IVZA 2A6DA 4U3HA 1B3JA 4RWYH 3GMRB 3ZKXB 1JRHL 4PV8A 4J8RA 1IKNA 3QUMH 1IGMH 5D1ZD 1A5FL 2PTTB 2VXTH 7FABL 5IM7A 1F90H 1QQDB 5FB8B 3KXFD 2G75A 5KJRL 2P8LA 4G43B 2DTSA 1C08B 1T7VA 3P0GB 3LEVH 3D0VA 4CADB 4Z77A 5GHWH 3FRUB 1V5JA 2Q8AL 1DVFC 1S7QA 4WW2C 5IBTH 4HLZG 3TA3C 2NX5A 1UVQA 2YD2A 3HUJE 2X4SB 1NBYA 3EYFA 3GRWL 4N0UB 4PUBL 1YMME 4I48B 3WJJA 4JFZL 1EUTA 4UV7L 1NSNL 3T3ME 4GUPA 4D0BA 5DEGB 4QNPE 2XICA 4AQOA 3LKQA 1G9NC 4V2BA 4DFHA 1RULH 1EFXD 4DUWA 1FDLL 1XGQA 3AAZA 1DP0A 1OAZH 1CXLA 4LVEA 1BBDL 5KVGL 2PKDA 4QXTB 3M8OL 5BJTA 2UWEE 4ODTH 4X6DA 43CAA 3R06B 5DEFB 1B0RB 1I7ZB 1YJDC 5KN5B 3IJYA 5HVFB 3BFOA 4OGYH 1DEEB 5GGUA 1CLZH 1QOKA 1RJLA 1UJ3B 3EJJX 5A16A 1AQKL 4JY6B 1WCBA 1E6OL 1FO0H 1RZJH 1U3YA 2P8LB 4OLXH 4HCRL 1R5IA 4TRPH 4Z77B 4DVBA 2J8UF 1CXHA 5FGRA 1GZQA 2DQEL 4A2LA 4MJIB 1RIVL 3X3FH 2FD6L 5BOZG 1LO5A 1JJUA 1JGDA 1FNEB 2YZ8A 4QRQA 1SY6H 4EI6B 1NBYB 3D18B 5GS0C 3ARSA 4ZS6D 1FHGA 1CXFA 5JIKA 5KSAA 3RGHA 4GUPB 5DSCB 2X4NB 1RUMH 1T20A 2H8PA 2UZIL 1EAJA 1OB1B 4FQXB 1MY7A 2GUOA 4POYA 2VERN 4PRAA 3DJ9A 5D8JH 1T1YA 3RY4A 3CFDB 3E8UL 1Y6KR 5BVPL 5IEHA 4P2RD 4YXHH 3WHE0 5CD5C 2UYLB 3S37L 3IJYB 2EDLA 4Z0XA 5GGUB 3KLAA 1SEBB 3ARBA 2IALA 3PL6D 5A16B 3WLBB 3MRBA 4O2FA 2NY3B 3IU3B 1Q1JH 4PRHE 3RWIA 3IDUA 3LKSA 2MOVA 3JWNC 4MJ4A 4DVBB 5EBGA 4QRRB 3P2TA 3T0AA 1GZQB 2NY7H 5MEQB 3OAZK 1CFTA 1JGDB 5F88B 3O4OB 1RZJC 4UB0L 1U3ZA 1RPQA 3ZO0A 1J1OL 3C6LA 3VG9C 2IC2A 4PBVC 4ELKB 5ECJE 5KVFH 1DR9A 1XCQA 1KJMA 4L1HA 3EDFA 4AM0A 2D7PA 1UG9A 5E94B 4UILL 5FYJL 2B2XH 2WUBH 1T1YB 4FQIH 3NMEA 1QFPA 3B5TA 5C08D 2F19L 3BPNC 1C5CL 5IEHB 1I85A 3ULUD 1NC4D 1A7QH 1UM4L 4Z0XB 4HF5H 2DIJA 4UIMA 3DIFB 2PTVA 3HC3H 1DLFH 4JPVL 5AZEH 3WXVL 1I9RL 1DBKH 2FX8L 1HSAA 2XZAL 4S1QH 3RWIB 3LKSB 4ZFOL 3WEXB 4Z7VE 4L8CB 4WHYH 3VA2C 3PWVB 4R7NA 1ZVSA 2BHUA 1D5BB 4LRNL 4OKVA 2WV3A 1TZIA 1MWAL 3KPLA 3SCMD 2AJVH 3UTZA 3MROA 3MRCA 4F7MA 5EOCL 4G6AD 2DQHL 1S7VB 3ARFB 4ELMB 4YGAB 1FH5H 1F13A 4LOUC 2XTLA 3C60D 5KSBB 5BMFL 2AXJA 4UUJA 4LSSH 1D9KB 2L4OA 3VXRD 3JWOH 4HV8B 1QPXA 2AJSH 2V17L 2UVFA 3RKPA 2VN4A 3VFMA 1BZQK 4X9FA 2WBJC 4KQ3L 4LPCA 3MRGA 3MFGB 3RGVB 3R4DA 3SHSA 3TCXA 3SDCA 3MYZA 1LO0H 1RZ7H 3X13B 3SQBA 1HDMA 3CVHH 5LGJA 2VLME 3VFSA 3IFPA 2C1PB 4CMMA 4QRSB 4J6RL 2BY0A 4XRCA 1U8PA 1JNLL 4NQSA 4UIMB 4PREA 2Z92B 1Z0NA 1BECA 1PKOA 3LEXA 3VFVA 4CMHB 5D1ZB 1XF4B 2HJFB 3KGRA 3QAZB 1H8OA 3EOBA 1AKJB 1OTTC 4R7NB 1RMFL 1VGKA 1LO2H 3EW3B 3QXDA 1CTOA 4ZO6A 1MVUA 3LEYL 4JQIL 2XYCA 3MRCB 4K3JH 4F7MB 3GRWA 1MCLA 3ILPA 1MVFA 1EAPA 2BXZA 3KJ6H 3P0VL 4CRPA 3OKOB 5ALCH 4KI5E 4NKOB 1GGIL 4UDUA 1I8MB 3ARGC 3KVQA 3VFMB 1OAXL 4QCIB 3LKNA 3HI6H 1EFXB 4PP1C 4D9QD 3TH3T 3WKNA 4X9BA 5D6CB 3JWOC 1PFCA 4M02A 4PB9L 1EVUA 3G5VA 4U1IA 1HDMB 1S8DA 1G7QB 5C0CD 4CMMB 1ETZA 2GFBA 3ZKXC 1JI1A 1R3HA 2OZ4H 4JLRB 1XT5A 3O6KL 1A14L 4NQSB 5GGTH 5ID0A 2UZYB 1KB9J 3D0LB 2NY6C 3B2VL 3RDTC 4YFLI 3QDJA 2HWZH 3HNVH 3ZTNL 1CF8H 5TE7H 3ARDD 4GRLD 3RIAF 4XP9L 1WTLA 3WO3B 3EOBB 5C0BD 1J8HE 1TJIL 2FJFA 3O3UN 5JTWA 3QXDB 2F5BL 1J05B 3SGJA 4H20L 2UY6A 2F54A 3MZTA 1OTUD 3GI8L 1EAPB 5GGSY 5FYKH 2HVKB 1EH9A 4G8EB 1NAMH 3FRPA 4HWEH 1X5HA 1HHGA 2BVPB 4UDUB 3MV7D 2IBGA 3OL2A 4JFYA 2G2RA 1C1EL 4DEPB 5JXED 3LKNB 4B5EA 2YMXL 4QOKD 5AUMA 3W9DA 2VXSH 4DKAA 4RAVA 2MCPL 4JFFE 2YK1H 3KYMA 1HCVA 4K7PH 3G5VB 1NUNB 1AQDA 1KLGA 2OXHA 3PF2A 5C3LD 1S8DB 3OAYH 4P2RB 4BUGA 3QPXL 2C4XA 1R3HB 4GAJL 5AAMA 4IMLB 5ADPL 4XGZA 4JFDE 1QKZH 1IKNC 4RGMB 3PL6B 4MXVE 5DLML 5D93B 4PJHE 4GAFB 2I60L 2BRQA 5J11B 2R56H 4ZODA 3SO3C 2EC8A 3SQOL 1J11A 4GKZB 3TBSB 2R29H 2W65B 3B9VA 4AIZA 1ZVYA 1YEGL 4R97B 1JUFB 2FR4A 3QQ9D 2QADC 3WJJC 5E2WH 4NFDA 4L3EB 1IGIL 2BY1A 2G2RB 5GRXG 4BSWA 1KIPA 3BDBA 5B8CA 3MNZA 5I1EH 2CO6B 2BRRH 5E8DH 4I9WE 3W9DB 4JFHE 1E4KA 4L1DA 3KYMB 5EU7E 4GQ9H 1EJOH 5C08B 3K0WA 4Q9RL 2FB4H 4F37K 4DTGL 4X98A 3C5JA 5BZDA 3QNYA 3CFIC 5DTFB 1NUDA 4QKXB 3WFCH 5TDNA 1F4XH 2DI9A 2NY3C 4P3DA 4R96A 4XNYL 4UZGA 5HSFA 3AS1A 4GW4A 3AB0B 4DAGL 4TNVF 1KCVL 4M7LH 1INEL 4E5XA 5F96L 2UV3A 1G9MC 1F11B 1ADQL 3SO5A 1GIGL 1NFKA 3HC4H 1OP3K 3SCMB 1N26A 5DJZB 4AIZB 3V6ZA 5IQ7L 4KZDH 3EGSA 1JPGA 3UTTD 3LKRA 2FR4B 2VLRD 4QYOB 5I66A 4ZO9A 4YWGL 1HOCA 3C60B 5KSAC 5IWLA 2ESVE 2HFEA 4EI5A 4D0CA 3VXRB 4NQEA 1OPGL 2PXYD 5EBWB 3CMOH 1RUAL 5D2LA 3MNZB 5DR5L 5B8CB 4LBEB 4UV4L 3IKCA 4Y2OA 1RK1A 4JZJB 2D0GA 4R90L 4NC1C 3QIWA 4PGDA 1QA9A 2IH3A 4IBLT 2FH8A 2R2CA 2LE9A 4X98B 4G8GE 5HDOA 3RX8A 1HXMB 2V7HA 1MHPL 3QNYB 3ZKSD 3ARBC 5IFHH 5IGXH 5DJ8A 3WSQH 3RA7L 4I5BB 4R96B 2H32H 1LMKA 4PJ8D 5J6GB 2HKHH 3SE8H 1NGYA 4IHOA 2DTML 4GW4B 2RAMA 3CXDH 1ORQA 1MQKL 5DRXA 2FLRT 1NFIA 5I73B 2D2OA 4E5XB 1ZT4B 4Y5VA 1YEKH 4LRIA 3MPCA 3T77A 2ZUUA 3EGSB 4GS7C 3KG5A 3UPRA 4Z7NF 3DRTB 2NXZC 3C6LC 1VPOH 3SKJL 1KIQA 2E7HA 2BOCA 4IRSD 4Q9QL 4BFGA 4HC1L 3KPRD 1KN4L 3UTPE 5EO1B 1E4XH 5CEZD 3AM8A 5IG7A 1JRHH 3SGKA 5TQ0L 3NIFE 3EHBC 2FIRT 4CVXA 1A5FH 5IBLD 1I85C 2BVOA 5KJRH 2X9WA 4MNQE 2WM0A 2FJHA 3BEVA 1X5ZA 3WBDA 3HLAA 1GZPA 1DL7L 5DJAB 1QRNA 4KKBC 1X5AA 3DHMA 3JZ7A 2CDEB 2E9JA 2AQ3A 3VFWA 1FIGL 4XPHL 2EXYC 3RI5K 5D2LF 1HQ4A 5EZJA 1NGYB 4IHOB 5F21B 3GRWH 2QSQA 4U1JB 4ZO8A 3ARDB 4UV7H 5DRXB 3L6FA 4MSWA 1NSNH 1NFIB 5T3ZD 3ZT6A 1HEZA 3BWAB 4JN1L 2DM7A 4MLSA 5DRZA 5EO9A 3ULVD 4NZTL 1FDLH 4XBEL 4Y4HD 3UPRB 4F3FA 4IOIB 3R0NA 1G7IA 1BBDH 2VZOA 1N4XL 1LDPL 2BOCB 2BNUA 1ZWIB 4XT1C 1F6FB 3MV7B 3O3EB 5FGCB 3U0TB 3QEQE 3EO0B 2GTWA 4ZAKD 2AK4E 4QOKB 1P7KA 4NQCA 3SDCC 4YBQC 3ECBA 4GG6A 1YN7B 2F53A 4OUUB 4ZFZA 1VFAB 4HCRH 3M45A 3KDMA 3V52H 1GZPB 1HH6B 1N0XL 3VW3L 2DQEH 1QFOA 3DO3A 5EU4B 1OQXA 1RIVH 4G8IA 2FD6H 4JY4A 2P8PA 2UZXB 4EDXA 1RUKL 2NLJA 1MCWW 2X89A 3BKML 1NH6A 4OZGF 3UBXG 4K8RL 5AG8A 4CJ0A 1Z9MA 5KTEL 3UROR 3L6FB 4MSWB 3V8OA 5JMOC 3UTSD 1P4LB 1G7HA 3X14A 2P5WA 2UZIH 3UTQB 3O2DA 5I8CB 5DRZB 4LLWA 4PV9A 4U31A 4P5KA 4F3FB 1ZA6A 3Q0HA 3UZEA 3E8UH 2IAMA 3MRNA 1L4IA 1Z5LA 2BNUB 5BVPH 1DDHA 1AXTL 4OF0A 4WHCA 3S37H 1NKRA 2EYRB 2H3NA 3MV01 4AH2B 1SHMA 1ZA3B 4GG8B 3OJDB 2ATKA 3BH8B 2EIZA 4GG6B 3W11C 3K4ZA 3H9YA 1KPUA 2NR6C 4P4KD 4JKPL 4Y5YA 4ZFZB 1LK2B 3WFHB 4RIRB 4XVTL 4D0DA 4HLZH 1KXQE 3KDMB 2MFNA 1A4JA 1T7YA 3FQUB 2X70A 4W4OA 4JY4B 2P8PB 4UB0H 1AY1L 2VMFA 5T3XE 3G9VA 5TFSL 1YEDB 4NO0A 1J1OH 5E99L 1H3UA 2HJKB 3H9SE 4MJ5A 3ROOB 3T08A 4WUUD 3SGJC 1DANT 5IHLB 4L3CB 3F7VA 4D8PB 5E8NA 2Y07L 5IESL 5E8PA 4UILH 5FYJH 1NANI 3N85H 5D70L 4GBXD 5KSUA 3UTTB 2IAMB 2VLRB 3MRNB 4D2NA 2F19H 4N5ED 3L95A 5D71L 5EZOL 4PJCA 4XNUL 1UM4H 5HYJE 3O8XA 2ITDB 3K8MA 1WBXB 2F5AL 5E4IA 5EG6C 3QUYD 4JPVH 1HH9B 3WXVH 1I9RH 4JAMA 1OARL 2FX8H 3DURA 4JDZA 4LHQB 2XZAH 4Y5YB 5BXFA 3S96B 3GJEA 4HEPG 1A4JB 3TC9A 1UB6A 1SYSA 2VDNL 4LRNH 4I0CC 2RFXB 5I8OL 3MV8D 3HMXL 1MWAH 3FQNB 2DF3A 5GGRB 3RRQA 4CW1A 3FL7A 5EOCH 2DQHH 4PJ8B 4LLYB 1YNTA 5HHOB 3FOMA 5KW9H 1FZJB 1MFCL 2DYPA 1QNZL 3IU4L 4YNYA 2V17H 5GISL 3MFFA 3V6OA 4YIQB 3BJLA 3U0PB 3QJHA 4KQ3H 1S9KC 4JO4H 2X4UB 2ILLA 4M62H 4NGHL 3TYFA 1U58A 1KIRB 3A6BH 1N8ZB 5CJ5A 2QQNL 4PJCB 5B8CC 2JB5L 3KPRB 4E42B 2G9HA 4J6RH 1UGNA 3UZVB 5E8EB 1JNLH 3AROA 1E4KC 2ZNWA 4XNMB 1XIWD 2OX5A 4HJ0D 2XXCB 1C7TA 2ZUTA 2XZCL 5K59E 3BP4A 4XBGA 2AV1B 1UXWB 1I1FA 3ARUA 3GJEB 4LVNB 1NGXA 1A1OB 4HUNB 3PP4L 4WWID 5JW4N 1SYSB 1HI6B 4NQDE 4XPAL 1YMHA 2H26B 1Q94B 5ANMA 4JQIH 1MCQA 4MA3B 4XAWL 3P0VH 1OAYL 3ARPA 2HJLA 1GGIH 3CNKA 4X6CB 1QLEL 1UXSA 4YNYB 3OV6A 4HUVA 1PLGL 1CFBA 3ARZA 1OAXH 3LDBB 4J1UA 2VOTA 3MXVL 3OR6A 5GQBA 3RVVC 4M6NL 2FNBA 4JM2A 4Y4HB 4FQ1L 3TYFB 1U58B 2EE6A 4PB9H 1HK6A 4EI5C 1QLRB 5ESQB 3BQUC 3BZFA 1ND0A 3VXMA 3ZL4L 1YEIL 1CLOL 5E1HB 4PRID 3UAJC 4TVPE 4KK9D 3O6KH 3ARVA 1JWSA 1A14H 1KN2L 1EXUA 1CFQA 2WQ8A 3L3HA 5D1XA 2K9UA 4ZAKB 4GXUN 3QIWC 5D2NA 1C16A 3B2VH 2EE2A 3EOAA 1H9VA 1K8DA 2GJ6D 3BP4B 4P9HL 5E08L 2CSPA 1LHZA 4XP9H 4LLMB 1NGXB 4HJJH 5IHUL 4WJ5A 2NNAA 1TJIH 4OI7A 3C87A 2EXWD 2F5BH 4YR6B 1KACB 3VWJA 4J3TA 1FZKA 1Z9LA 2OSLA 4Q9CA 1HILA 3BPLB 4XCYA 5D7IA 1FVCB 4IOFC 4HUVB 1CDUA 4U1KB 4Y5VC 1C1EH 4LRIC 4UOW1 4J1UB 1O7SA 3OKLA 1Z9SA 1T0PB 2OR7A 4NBZB 5TDPA 1I7TA 4O58H 4H8WL 2GY7B 2NY2C 5LVEA 3NVQA 4MWFA 2QLVB 3O4LA 5D5ME 3QPXH 2Y36L 4MD0B 4QRTB 3SGKC 3NIGF 4GAJH 5ADPH 4LMQI 4R7DB 1INQB 4TSAL 1EXUB 1T1XA 1BFOA 4OD1H 3FT2B 2CKBA 4ZSOE 1C16B 3O2VL 5KVEL 2DIBA 3TT3L 4DK6A 1BVLA 4Y8DC 2A83B 4NWUH 3GUTA 4QHUA 2I60H 1J7VR 4P4KB 5TQ2L 3FB5A 5I6XC 3ZDZF 2WWMD 2HRPH 4WJ5B 5JR1L 4KXZH 4QHMA 2IAND 3SQOH 2GEEA 4OZFA 2FO4B 4KY1L 4HK0A 4HWBA 1FZKB 2X5PA 4R0LA 4ZNEA 1QZ1A 5HD8C 4FFZH 4C55A 3O2DH 3SKOB 1YEGH 3TVMA 4BZ2L 2JIXD 2XN9D 3MBED 5CMAB 4HQQL 2HLFC 3K2UH 2Q7YA 1AD9A 1IGIH 4NO5A 2YA2A 3VWKA 4WUUB 3G6JE 1QEWB 5HGGS 4MHHI 3D39A 1Q9WB 1NCWL 1I7TB 4HIXL 4Q9RH 5J13C 3CFCL 1A1NA 2IQAB 4DTGH 4HBCL 2LFGA 2R8SL 3GSUB 4PRDA 2FWOB 4K23L 1ZXQA 2VO5A 4RMUA 4JFOB 1T21A 1AO7A 5EBMA 5K9KB 3QUYB 1QBLL 1OF2B 5T1LD 1IGCL 4QHUB 3V0VB 4PJXE 5FO9A 3GMPA 4P4RB 1NCBL 1ZHKA 4DAGH 5DJ2A 2NY5L 4QHMB 5IW6A 1KCVH 2Z8RA 3IF1A 1INEH 4HK0B 5GRZA 5F96H 3MV8B 1ADQH 3SDXE 3ZDXE 1GIGH 4QRUA 4CNIA 3VXOA 4L4TE 1Q9LA 5IQ7H 4X5XA 1IILE 3DECA 1GSMA 5GPRA 4HH9A 5MI0B 2BZDA 1AD9B 1KG0A 3Q1SL 5E1AB 1U2CA 4YAQA 5C6PB 4KMQA 1OPGH 2Y7QB 5FK9A 1RUAH 5DR5H 5DJXB 3MACL 3D39B 3GB7B 1U8MB 3IFOA 4UV4H 4PJGE 1VSCA 3BAEL 4QT5A 4R90H 5L2JA 5KS9F 2UUDH 2IAMC 4DKFL 3I50L 1CT8A 1RHHA 2DQFB 4IMKA 3ZE0E 3TIEB 1JNHB 2APBA 4PRDB 1IM9A 2FHFA 4HUWB 1MHPH 1F3JA 1KOAA 3RA7H 1U8HB 1XIWB 1U95A 5L8JB 3DV6A 3GI9L 3NCEB 4Y5YC 5J1SC 1KJVB 2DTMH 3GMPB 1ZHKB 5I71C 3W5NA 1ZHNA 3BGFC 1LP9F 3TBVB 5DJ0B 1GGCL 1GYAA 3N0PB 1G7JB 4W4OC 3T1WA 3DLQR 3I6GB 3OGCB 1BX2B 4M9PA 4QRUB 1RZ8A 3RZWA 2CLZB 4HWUA 3VXOB 4MNHA 3H9HA 1TNMA 2XXMB 3C08L 5GGVY 3IT8D 3IXTB 1MNUL 3QDMD 4XVUC 3SKJH 4RMTA 4X4ME 3QFJD 5DWUL 4HC1H 1KN4H 2BFVL 1PW3A 1FV1A 1KV3A 2P5ED 2QSCL 3LPFA 3O6LL 1OLLA 1S7SB 1BHGA 5H35B 1ORSA 5TQ0H 4M61B 1VDGA 4KTYA 5MERB 1HHJA 1C12B 4OQ1A 3SOBL 3VDAA 4RSVA 1A9BB 3DNKA 3V6BR 4YXLL 4DGIH 5HDBE 1KGCE 4RNRA 2JCCB 4QEGA 5DEZA 3O8XC 4DFIA 2CR3A 1RK0A 1LE9B 1DL7H 4JHZA 3SDAD 3BUYA 4PRIB 1FIGH 1U95B 4XPHH 5IHZB 5GS1C 2Y5TA 4OCLC 4LVNC 2GJ6B 4LIQL 5HDLA 2DIAA 2FH6A 3QT2A 4XMLH 5I76A 1ZHNB 3KPSD 1UM6L 3HC0A 4PTUB 1J1PL 5CILL 4KROC 2X1XR 5FA4A 5ITBL 2VXQL 1OP9A 4NZTH 1TTUA 3H9HB 4XBEH 2MTPA 2RBLA 1CIUA 4B0MM 4C83A 1N4XH 1LDPH 3KNBA 4AEHL 2I27N 3V6OC 4YXKH 3MJ6A 2YXFA 1N3NA 4G7VL 2BVYA 2CK2A 5T1MB 3S3SA 3EOTH 1HHJB 1JGEA 2VL5A 3KPQA 5CSBA 5GIRA 4PJ7F 4TTGA 4TULL 1ZSDB 1GCFA 2OXGA 3BPOB 1N0XH 3HE6A 3FB7B 3ELAT 4NQXB 1MFAL 5HYQA 1RUKH 4LNRA 4KHTL 1YDPB 5FA3B 3BKMH 4JY5L 4K8RH 1XGTA 4QRPD 5FECA 1MPAL 2X1WL 5KTEH 4LSQL 1QSFE 1H5BB 1DQTA 2IANB 3OQ3B 3QCTH 4M7KL 1EHLL 1UADC 3IFNL 1S7XA 1WFNA 1SVCP 5DRWB 4NHUA 2ATPB 5DC0A 2VR5A 2XWJA 3MYJB 1FFNB 4C83B 5HPMB 3MBEB 2XN9B 1E27B 3KNBB 1EUUA 2YC1A 2IJ0C 5ACZB 2X4OA 1AXTH 2HT4D 1P84K 1N3NB 1UWXH 1EHXA 1TJHL 4FQHA 3L3GB 4KV5F 3O3DB 2K7QA 5HY9B 5C0AE 4JM2C 3FO1B 2DI8A 4IS6A 3C5ZD 4WFGD 5E6IA 2A38A 2YUVA 1X5IA 3O41A 1P2CA 2Y6SD 4JKPH 1ZKAA 1IC5L 4W4NA 4XVTH 4ZFFA 4BQ8A 1UENA 3D25A 4HZLB 4YFLF 4PY8I 3P77A 4JR9L 5D1XC 3BP5B 3OJMB 1S9YA 5D2NC 4LNRB 1AY1H 5T1LB 5FECB 5TFSH 4LKXB 3H0TA 5E99H 5MENA 3HTLX 3L3DA 1VCAA 1JF6A 3R0MA 3VWJC 3QDGE 3SY0A 3D69B 2Y07H 5IESH 2VDQL 3TBTA 2XWJB 2VLKD 5D70H 1IT9H 1I3UA 3BKYL 4Y1AA 5JXAL 4ODVL 1NBZB 5D71H 5EC2B 2NY1C 5EZOH 1T89A 3ULUL 4XNUH 4FQHB 1LEIB 1QYGL 3MCG1 4XXDB 3VGBA 3ET9F 5CZXC 3MO1B 2F5AH 1B4RA 5IW1B 4P48A 1KTLA 1T0MB 4XWOC 3UPCA 2V5SA 3WIFA 3O41B 1M71A 2ZOLB 4X7FC 5T33L 1KB5L 2HT2D 3AMKA 4TN9A 1R24B 4R9HA 3G5ZA 2OI9C 1LEKB 2VDNH 1T5XA 5IHBA 5I8OH 3BUTA 3HMXH 3VXPA 5C70A 3FB8A 3TN0A 2ADGA 5IIEA 4FXLA 3IAGC 1IGYA 3GSWB 5GGSB 1A1MA 4Z0BL 2XKSA 3DVGA 4LASL 2VLJD 1ZMYA 3WS3A 4PGZA 4UBDD 4KPHL 1QNZH 1A6UL 2BVQA 3IU4H 4LLUA 4R0LC 5GISH 4PRPA 4U0RB 1U8IB 3TVMC 2NW2A 4YUEH 4NGHH 3U7AA 4WEMB 3QDMB 1YPZF 2YN5A 3VWKC 3IGAB 5HVHB 5DFVC 3DGGB 4JO1H 2P5EB 32C2A 4KAQH 2A77L 3DX7A 4NZRL 5KG9A 3M07A 4FTVE 5HGBA 1PG7X 5DFWH 1VEPA 4K94C 3GMLA 4JFEE 1M71B 2XZCH 2Q3ZA 2A74A 4JDVB 5SV3A 3PP4H 1H15A 3QUKA 1A7PL 4XPAH 4ZDHB 1H3TA 2YXMA 4EEEA 4KMLB 4U05A 3TN0B 3TF7C 4QLRA 1AD0B 4XAWH 1ES0B 5I1GL 3T1FB 1OAYH 4A6YA 4LNVA 1XH3A 2DAVA 1FL3B 1FNFA 3KPSB 4JRYE 2HTKD 1QLEH 2VR9A 3V5DB 4CU8A 1PLGH 4PRPB 1T6VN 4XPGL 4NRZB 4X9GA 1I7RB 4RGOL 1XCTA 1ZOXA 3MXVH 5DQDL 4PS4L 5HTSA 2NW2B 3W82A 2VKWA 4M6NH 4FQ1H 4ELMF 4KJPC 5DMGD 5KSBF 3OKDB 1EA9C 2BNQA 4Z7UE 3ZL4H 3ROLB 3MOQA 1YEIH 4JREC 1CLOH 1P5UA 1FVEB 1IGFL 2VABA 1UA6L 3DX7B 5I18L 1MCCA 1KN2H 3LPWA 2NYYC 4PLNC 4POUB 4P9HH 4IMKC 5E08H 3DUSA 4GJTB 4FG6D 2A74B 5IHUH 1RZFL 1T1WA 4DJMA 4ODXA 4FFVD 5B22A 4BQ9A 2B7DT 2DQDL 4YBHA 3P9LA 3LV3A 3HUJA 3AXLA 4NQVA 3F6LA 5E9DA 4OIBA 4A6YB 1MCHA 1JGUH 4QRPB 3EZ8A 1A64A 1YEEL 5FUCE 7CGTA 2A6JA 5MEPB 1MI5D 1FFQA 4OD3L 2CO7B 1EEQA 1Q9OA 4NFBA 3REWB 1NMAL 3QR2A 3VFNA 1FG2B 4PJ5D 2V2WA 3Q6FB 4J4PD 2E3VA 2V2TB 1TVDA 5F1IA 1J8KA 2XTJD 1CR9L 5JZ7C 4NQUA 3O11A 4H8WH 4QHLB 3O3AB 3W0WD 1KXTB 2UWEA 2VLMD 2BNQB 2D7OA 4YC2C 3QHZL 1F5WA 2GTZA 1H3VA 2Y36H 3ZZ1A 4F37F 4TSAH 5DJDA 3TT1L 3WN5A 4NPYB 4K7FB 3MNVB 3U30B 1DLHA 3O2VH 2X42A 3LSOA 3TT3H 4N0FA 3T0ED 1ULVA 4OF5A 5HYEA 1BD2E 5J9PA 4N9OB 5TQ2H 2DQJL 3RVUC 1A3RL 2GITA 2FL5B 5D7LE 3BPOC 1T1WB 5JR1H 4BSVA 2I25N 4KY1H 4KTDL 2FLBT 4P9HC 1RUQL 1J0HA 4KK6C 3TBYB 4NQVB 1CGWA 2J8UE 3OAUL 5BVJA 4PY7A 4YE4L 3DO7A 1YMMB 1F3RB 4KVCH 4HQQH 3CFKB 3CUPA 4S0SD 3FTGA 1MH5A 1WFTA 1J10A 5I75B 4EQ2A 3RX5A 3ARWA 3VFNB 5FYKU 3G04B 5I9QB 2ICEA 1B0WA 1B2WL 4JHAL 3MRFB 3S5LB 4HIXH 3FFCE 4Q0XL 4F7TA 1UZ6F 2VLKB 4XX1E 2GK0A 3GSVB 5J6HA 3CFCH 4KJWC 4HUUA 4BK5A 4HBCH 5DVLA 1MHHB 4K23H 1VHPA 2EH8L 2NX5E 3T65A 1H8NA 3WE6B 3WN5B 4H1LA 4OF6A 4RAUA 4OQTA 1FNHA 3LN5A 5HHVH 1QBLH 5KZCD 1YYLH 1IGCH 1T2JA 5CP7A 1JWUA 1YECL 1NCBH 5ALBL 2NY5H 3HE6C 4XH2B 4CDHA 4E41D 4LPUA 5GSVB 5FYKE 2AXFA 4YHYC 1JK8A 4E9LA 3ETBF 2J6EA 3OB0H 4HIEB 1H3GA 3H8NA 3HFMH 5BVJB 2WZPD 1E6JL 3OKKA 5DJCB 4HDIB 2VLJB 3ARTA 4LVHC 3QQ4B 3Q1SH 1S5IL 4OGZA 3LMJL 3JTTB 3MACH 5TE4L 5BV7B 2ICEB 1OY3B 4X4YB 4JFFD 4XNXL 4PTTB 2XPGB 4YDVA 3BAEH 5IEKB 4PGBB 4DKFH 3C8DA 3I50H 5GSRA 2GK0B 4JPKL 4ONHB 5DVOA 4PR5A 4N8VG 4YDJB 5E56A 1J1XL 5F97E 3V4VL 2W07A 1L6XA 4JFDD 2KBGA 3PGCA 5D7SH 3H6JA 2P42B 1UWGL 4RAUB 5E6IC 5DZNA 1F3DH 4PJEB 4PRHB 3GI9H 4Y7MA 4Z7VA 3TEUA 1EO8H 1XGPB 1JWUB 5CP7B 5FDWA 1CVRA 3RI5F 3HPJA 5ACMA 1CZ8L 1GGCH 1A7BA 1U8NB 5IR1A 1HSBB 3ULUF 1A4KB 4YHNB 4L29A 4TUOB 1JK8B 4ODSH 1R3LA 4AEIL 1AGFB 3RWDA 1QSEE 1BJMA 2J88L 4MNGA 3OG4B 2XNAA 3OPZL 5KANI 4L8DB 3C08H 3OKKB 4WTZA 3AS0A 4C56E 1MNUH 4XCCL 3VDCA 3B83A 1FORL 1UH3A 4WI2A 3OKMA 3RWHA 1QHOA 1HINL 5I15L 3K1DA 4JFQA 5DWUH 2BFVH 5CEZL 3ALPA 3PWUB 4MD4A 2QSCH 3LAFA 3O6LH 4JFHD 5IMLB 4KDWA 2FZ3A 4YDVB 5F6HI 5CEYA 3SOBH 4O5LL 3VGAB 2CDFA 2C3HA 2A73B 3CFBA 4YXLH 2VTFA 4R4ND 2RHEA 3RNQA 3QA3B 4X5WB 2EDDA 5I2IA 3TO2A 3LKOA 2EO1A 5DK3A 4YHPB 4GRLA 5FUOL 1I4FA 4GH7B 3S34L 4NQTA 4K3DL 4Y4FD 4Z7VB 4UIKL 4M93B 4LIQH 2A2QT 3HPJB 1G6RL 3PXHA 3PDOB 1LK3H 1R5VB 5T3ZL 4AG4L 5IR1B 1AHWB 1J1PH 1L0XA 4OZ4B 4S1DC 5DFTA 5CILH 4GKSA 5FO7A 4XP5L 3ULVL 1AP2A 4ZUSA 5ITBH 4K71C 2VXQH 4ONGL 3RWDB 5TGBA 4AEHH 3OKMB 3KPMA 4UTAH 3CCHB 4NYLB 43C9B 4E0RA 3C2AL 3MLXL 5JOPE 4PJ5B 2VXUL 3U4BL 4HAFA 3QIBD 1NFDF 4FQLL 4WNQB 2YKLH 4MA8H 4WU5B 1OP3H 2CDFB 4WO4D 3CFBB 3DXAD 1AR1D 3TFKC 5EUKA 4TULH 5DT1L 3PHOA 1AGBB 5FKAA 4M00A 2R1XB 3TO2B 1MFAH 5CFHA 5C2BL 3L9RA 4KHTH 3ES6B 5D9SB 2F15A 3G5XA 4JY5H 3LN9A 3MA7A 3T0EB 1MPAH 5IT2L 2A1WL 1J8HA 3VRLE 4LSQH 4EUPA 3MJ7A 4G9FD 2FDBP 5GRWA 4YEEA 5FO7B 1H3WM 1AP2B 3AU1B 4ORZC 4M7KH 3WHXA 1EHLH 2D7MA 1JPST 3QO1B 4GAYB 4TVSa 3HZYA 4KH2A 3BDYL 4XPTL 1CGSL 1PX3A 2Y5EA 1R3KA 2HYMA 4AIXA 1CGXA 5KVMC 2Q86A 4R8WH 1V3LA 4PGCA 1TJHH 5DUPL 3PNWA 5ISZD 4F80A 2YBRB 1A6VL 2AJZA 1FYTE 1QG3A 4LDOB 3VCLA 1KPRB 1T66C 1DZBA 1IC5H 3BD5A 1T3FA 3ZKNC 5EUKB 3BZEA 4RQQB 2X41A 2X6MA 1NEZB 1RURH 1S7UA 1K3IA 4JR9H 1EJ6A 3BN3B 5CGYD 2E9IA 5T1DL 4V1DD 4NKDB 4PJHA 3G5XB 1B6UA 1AXIB 2NZ9C 2MWCA 3O3BA 4G9DA 1DEDA 5LGHL 3G9AB 2HLAA 3U46A 1J8HB 2AI0H 3FQXA 5C0FB 4EUPB 1FNSL 2E7CA 1ZS8A 1LGVA 3RJQB 3FQTA 3JV5A 5IF0A 4HS6A 3WHXB 2OMBA 2Q6WA 2ADJA 4Y4KA 2BNRD 3BPCA 1ZLSL 2VDQH 3EDEA 2PXYA 3BKYH 5JXAH 4ODVH 5FF6A 2OJEA 3PDGA 5I75C 1TJGL 3ULUH 4PGCB 4R3SB 4I0KA 3PNWB 5HBBA 3V5HA 1QYGH 5JO5B 5C07E 3TNMB 4JFFB 2SEBB 3QDJE 3RY5A 5LWYL 1KJ2L 3F7QA 4YK4C 4XTRD 5T33H 1KB5H 3RBGA 3BZEB 3N1GC 2LABA 1NANH 4PY8J 3CZFB 1H3PL 1JPSL 4JFDB 3GHEL 2F54E 3WN5C 1ZHLB 3IJHB 2H45A 4OLUL 5D7KD 1OM3L 3MRPB 1DBJL 1OSZA 4GW5A 4LASH 1S3KL 3U46B 1A8JH 3MODL 2OK0L 1SJXA 1L9MA 4NN6B 1IQDA 4HJGA 3IJSB 1A6UH 4LPXA 4MGXA 3I85A 3WHE1 5D1QD 3CD4A 2ADJB 2FIKA 4IRSA 5CGMA 4HG4K 2LV4A 4K2UL 1SYVB 3MRJA 2EE9A 2ESVA 4C58B 5JUEL 2ZG1A 4JN2A 5DDHB 3TLRA 2OJEB 4P2OB 3EFFA 4RGNC 2EDJA 3AC0A 4KKLD 2NXYB 4K3HA 5CZKA 1JNNL 4AT6B 3QSKB 1UYWL 8FABA 2A77H 4NZRH 4AZ8A 4N8PA 5FM5M 2ERJB 4I0PD 3IDMA 3IB4A 3KLHC 3HAEB 2EDFA 5DVMA 4CN1A 1B4JL 1DCLA 4JRXE 4F58H 2IGFL 3CX5K 3OX8B 4D3CL 1VKXA 3STZA 2OTUA 4CBPA 2ARJQ 2EDQA 1A7PH 3T4AB 5JDSA 1OGAE 5JPMB 2WINA 2O93L 4WEUD 3CDGA 2QR0A 5AWNL 1HHIA 4LLDB 1P6AB 2X4TB 3H9SD 5I1GH 5EPMA 4I77L 4MDJA 1OSZB 2WBWB 5EA0L 4Y4FB 5C0EB 1U8JA 5JPNA 4BA8A 5IKCB 4HJGB 5IVNA 3WXWL 4JJ5B 3O2WL 2V9QA 5FYJE 4M1CD 4RGOH 1ZT7A 1MUJA 5DQDH 4PS4H 4QY8A 1P84J 3IAQA 3LKPB 1A6TB 4JB9L 1KLFA 1JV5B 4Z7NE 5JIIA 4AIOA 4LARL 1JF1A 3QEGL 4F33B 1IGFH 1UA6H 3IDMB 3W9EB 3VFTA 5BRZA 3VGAC 2KZWA 2D7QA 4CVUA 3X12A 4WGWB 4MNQA 2XWBA 3OXSA 2PYEE 4G8GB 4ZXBA 3REVA 2QQQA 2A6IA 4HZAA 4N90E 2DMCA 4F2MA 4LF3A 4OB5L 2B5IC 1JPFA 2DQDH 1HHIB 2IMMA 5IJVB 5CSZA 3WIIL 3RZCA 1T0NB 5EPMB 5E03A 1U8JB 2P48B 4K9EC 4NQEE 3BZ4B 2PO6D 5JPNB 4OD3H 5D2LE 5T1KD 4FZEL 5J7CC 1QO3A 1MCIA 1T22A 1NMAH 4G9FB 5CJQL 1BM3L 2WIMA 3RWFA 2CIIA 1NMCB 1ZT7B 1LD9B 1MUJB 1CR9H 1C5DB 1TZHA 4S1RL 1HCFX 2BOBB 3HZKA 3QI9A 3DYMA 2DMKA 4U33A 2WSKA 5D6DA 1AI1L 2QQLL 3QHZH 4X6CF 4Y16D 1JP5A 1M6OA 3QEQA 4Y19D 4MB5A 5EULV 4X6BA 5ISZB 2AK4A 4DKDC 3H3PL 3RTQA 3MV9E 2FATL 1NC2A 3ULVF 3VFTB 3FHQA 4PJAA 4O02L 1JZ4A 4YBLC 4NCDA 1N0LA 2H1PL 1WZLA 2QKIB 2DQJH 1D5IH 2A6IB 3GSRA 4P3WA 2O61A 5HJ3B 3WYRA 3TO4D 5DUML 4GRLC 4WRLA 3TJHC 3VXSE 1RUQH 4YDLB 1K5NB 5CSZB 3OAUH 3G6AB 3LB6D 5GS2H 4YE4H 5CS7A 1I9IL 3EO9L 4P5TD 3B9KA 3BGMA 4L9DA 3E6HB 4OZGE 4Z7WA 5GRUH 1XR9B 3MRLA 4KKAD 2YD1A 1OTUC 5H94B 3RWFB 5F93C 2CIIB 2FYYA 4HK3J 2J12B 1DJSA 1RZKL 3CLEL 1PGRB 1A6ZA 3D3VD 3PGFL 1TZHB 2BNRB 4HIIB 4KI5C 4U1GB 4Q0XH 3HZKB 4N8CL 5DA0B 2HMID 5CD3B 1E4JA 5CEXA 5E70A 1IEAA 4K7PY 2VZSA 4HHAB 3QEQB 4G8FB 2AK4B 2A6KB 2EH8H 1IGJA 4HBQA 3QWRD 3U4AA 5KANG 3HB3D 4RAHA 3GMNB 3KYOB 1YECH 2ICWI 1UZ8A 1FJ1B 3GMOB 3RVTC 4JQXA 1D6EA 1PG7H 2O61B 5GZNC 5J57B 4WY7L 3A6CL 4TPRH 1U91A 3PQYD 3WO4C 5JHDE 1NGPL 4CAGA 1Q72L 1ZHBA 4U1NB 2HVJA 2GYSA 1E6JH 3JBG7 5ILTL 1PX4A 3A6OA 3LZFL 4Y5XB 4XMPL 1S5IH 1YEHL 3FT3A 3LMJH 4LSUL 4MCYB 5TE4H 5D1QB 4IRJD 4TSBH 2VE6A 4WHTA 3RNKB 2VZ3A 4P2QA 4ZUWA 2OQJB 5J8OA 1BOGB 4UQ3B 4JPKH 4ZTOL 2C5DC 1QFWI 1J1XH 5HYJA 2AKRA 3V4VH 1IGJB 2LTQC 1Z9OA 2DM2A 5DQJB 4Z7WF 3VXUA 3MREB 1UWGH 2ICCA 4I0PB 4WU7A 4LLAA 1NBVH 5C0ND 2W0FA 3B4NA 4PB0L 2GY5A 4ZPTA 4Z9KB 1KELL 1CZ8H 1BFSA 3BWUC 2P5WE 3MRDB 3S3JA 2QQKH 4WI8A 1IJ9A 4NZJA 1MLCB 4AEIH 3GJFA 2J88H 5LG1A 2FEEI 1I1CA 3OPZH 5IOPA 4DWHA 3TWCH 3H9SB 2RJMA 5CWSA 3TZVA 4GT7A 1I1AD 1FORH 2AW2A 5I8EB 5CCKH 3FN3A 1HINH 4LFHD 1ZEAL 2E27L 5I15H 4PLJD 4KC3B 2D03L 3FT3B 3U9UA 5I74C 1YY9D 4DZBA 5CEZH 1X7QB 2XWTB 1XGUA 4KMTL 3FQWB 1S7WB 4Y4KC 3ZHDA 4PRNA 2IBZX 4WHTB 1K8IA 5E0QA 4Z76A 4DUVA 2FGZA 4ZUWB 1BOYA 2PXYC 4O5LH 3CSYB 5B4MC 4KQ4L 3U6RB 5FOBA 3G5YB 5AYQA 5HYJB 2AKRB 4M1GH 2FSEA 1F4WL 3NN8B 5ENWA 4NKQB 3BHBA 4U2ZA 2ERJC 5EU7C 2XKUA 2EE3A 5FUOH 3S34H 1QBML 3D9AL 4K3DH 4PJDF 5ETUA 1N5YL 3JWDC 4UIKH 4MLIA 1G6RH 4NQDA 1S9VB 5EBLA 2P1YA 1AC0A 1I1YB 2X4PA 5T3ZH 4FQ2L 2GJJA 4NKMA 1V7NL 1D5MB 4XP5H 3ULVH 4XP1L 4ONGH 3B2UC 3MLWH 2DKSA 3GJFB 4I3GA 3QXUA 5F71A 4M8QA 3TZVB 3S5LG 1PKQE 1RZGB 1OAKH 5JOEA 1ZGLB 2PO6B 1WZ1L 3U9UB 1VADA 4GFTB 5T1KB 4AY0A 3S4SG 4HX1B 3MLXH 2Z8WC 1M7DA 5HHXL 5DRNA 4IRSC 3W39A 3U4BH 4PRNB 5ESAA 1R3IL 4Z76B 3EYQC 2VQ1B 3QH3A 4FQLH 2C1OB 4PRBA 3O45A 4M6ML 1FLTX 3O6FA 3THML 4F9PA 1BZ7A 3ARED 2B1HL 5DT1H 4M03A 4Y16B 3GBNL 4QTIH 4Y19B 1K4DA 3DBXA 5EZIL 3WUWB 5IBLC 4OCNC 1IEHA 5C2BH 2XY2A 4DW2L 2MQ0A 1QBAA 4BZ1L 4LCCB 3RWEA 4JFXB 5ETUB 3ME0A 3KJ4B 4LP4A 2ZOKA 3FT4A 5HHMD 2A1WH 2NY0D 3OJ2C 4NQDB 5HYSA 2JCCF 2C3VA 4DOHE 1RU9L 1N2RA 3F58L 4KKCD 5SWZE 4KDTA 2JIXA 4N0CD 2IWGA 1GGYA 4FP8L 3VRIA 3BDYH 4XPTH 4N0RA 1CGSH 2EICA 1EK3A 4GQPH 4EXKA 4P5TB 4MAUL 3ULVC 1IAOA 1TIUA 3P3YA 5DUPH 1NMCC 4F7CB 1IM3B 5DRNB 1A6VH 4LLQB 1OAUL 1EMTL 3DUUA 4PRBB 1FE8L 2BSRA 1UFUA 3O6FB 3BT2L 1KGCD 1P1ZA 4MQXC 1IRAY 5D5MA 2D3VA 4DN3L 1H0DA 2DWDB 5I16B 5BS0D 5ANME 1A9EA 2WWKT 4ZSOA 1EEZA 5T1DH 1BIHA 5GS3A 1ZAGA 3RWEB 4HAGA 1LE5B 3BP6A 5L2KA 4U6XB 5LGHH 4ZXBC 4G80B 1JGVL 1RFDL 4P23A 1BBJA 3B9AA 1FNSH 2C3VB 2XFXB 1MCPL 1PQZB 1AJ7L 1X5GA 4M9OA 3ZDZE 5C6WH 1VGEL 1W8NA 4GKNB 3PQYB 3U7YL 3HR5A 1TDQA 4I1NB 3RZCC 2H6PA 1NL0L 4RFNC 3VXME 3G6JA 3SKNA 4AENA 4N9GA 1TJGH 1DVFD 4OV6F 3TA3D 4X7SH 2XKNB 1JZ7A 1QTYT 5D2NE 4X8JA 1GOGA 4Z78A 4IRJB 1PDKA 5LWYH 2X7LB 3EO1A 3QI9C 2G5BB 4FXKB 1KJ2H 4KK5C 5D6DC 2DWEA 4S0TD 2FX9L 3QQ3A 2BHYA 3C5SA 5IVXB 1H3PH 2D31A 1F2XK 4GSDH 3RTQC 4U6TA 5K9OB 5HVWA 1KCSL 3C9NA 2AV7A 4OLUH 4WFEE 1OM3H 1P7QA 3ZKQD 5JQ6H 2ZUWA 4MA1C 1S3KH 2OK0H 3MODH 3VE0A 5CJBA 3N1FC 4OI8A 3BO8A 4OD2A 4C59B 2CGRL 3QISA 4HIJB 4L4TA 3HR5B 4F7EA 2V5MA 1GC1H 1UJTA 1X5JA 4HKBA 1IGTA 4ZUUA 3LRSA 1LWRA 2D9QB 4K2UH 2ZSVA 4UNUA 3B9KC 2H6PB 5JUEH 2BC4B 4U2YA 4AENB 3HRZA 4ZPVA 2CD0A 3V6FB 2QL1A 4NOBA 1I1RA 5C0AD 4ZOBA 1JNNH 1KCKA 4GBXC 1UYWH 4F8TA 4PJGA 4QF1A 5FO8B 5CINL 4X8JB 1MJJA 5GS0D 1ZK9A 1R5WA 1S78C 4I18B 1FC2D 4N5UA 3S8WA 1BPVA 5CSGA 1B4JH 2DWEB 1BF2A 1EBPA 5CJOL 3FONA 5HYFA 2IGFH 2W91A 5IK3B 4L4VD 4NDMB 5KS9E 5JA8B 2R0LL 2WK2A 4IRZL 5F70A 4HGWA 4NT6B 5AWNH 5IV2B 1IC1A 3DTXA 1A2YA 3RL1A 3VH8A 4PJXB 1VFMA 4OCWL 4I77H 1QHPA 1XF5B 4IIQA 1O7VA 4HFWB 5CD5D 4JQXC 5H37H 3WXWH 3ZSSA 3X3GL 3SDXB 3WDHA 4L8SB 3MOBL 2JB6B 4L4TB 2APXA 4HKBB 4K07A 2YPVL 4XC3H 3B6SA 4X4MA 2OTWB 1XMWA 4FFWC 1OP5K 4JB9H 3BXNA 4ISVA 1S7RB 5EUOB 4WTXA 4M7JL 2IPUK 4ZPVB 3T09A 1GC1C 5C09D 3QEGH 3MRHB 4QF1B 4PIRF 4HXAL 1CFVL 1NEZG 3LRHA 4FFYL 2DQGL 3WLWC 5BQ7A 2A0LD 3QFDA 1TPXB 4JVPA 1IZKA 2APWA 1IQWL 3AREB 4ODUA 3DROB 4KGLA 4OB5H 1MCKA 1WBYA 3VFRA 3LN4A 5B3JF 1E28A 3MRRA 1LO4L 3VH8B 1XR8A 3WIIH 4UQ2B 2EDTA 4IIQB 5HHMB 4KZEL 3KYKL 1TENA 4XWGL 5SWSD 1BAFH 3MLVL 1RUPL 3ARRA 1LEGA 4FZEH 4M6OH 5CJQH 3TNNA 2FJGB 1BM3H 3WNLA 3P4NA 2ARJA 1J0ZA 1QR1A 1FYHB 3HZMA 3PUCA 4PJFA 3GSNA 4S1RH 4WFHD 1P4IL 2J3SA 3TZVC 3BP7B 3D5OF 1TQBB 5D96C 3KYNA 4ISVB 2HG5A 4HWNA 1B0GA 5C9JB 5E2JA 1CS6A 2QQLH 3VGFA 2YPLA 4FTVD 3K80A 3KPOA 5DHVH 5FGBA 4X83A 1V05A 2H9GB 1EGJL 2NY4B 4JFED 2FATH 1H8SA 1ONQA 3L5HA 5BQ7B 2B4CH 4LCWD 5FHAL 4O02H 4R2GC 5FEBA 2AXHA 3IDIB 3QUZA 2H1PH 5F7FA 3IETA 2WBJD 3EYVB 1IBGL 4I8DA 3U9PL 2L0DA 5CIPA 2WIIB 2H2PD 3DMMA 4F9LA 1G7MA 5DUMH 1C7SA 3PWLA 4EQ3A 3VFRB 4PJ7E 3LN4B 3P40A 3H3KA 3STLB 2VDML 2YHGA 4Z5RB 4I2XB 2EXWC 5TJWK 1I9IH 3EO9H 4JRYD 4DGVL 1QSFA 2VWEE 3PABA 5FCSH 3TNNB 1K9TA 2DKMA 3CLEH 3FQRA 3PGFH 2GSIA 4MX7A 1OOAA 1F97A 5FGSA 4N8CH 5I30L 1JBJA 1OTTD 4QTHA 4U3CA 3PWNB 1KLUA 2HG5B 4LAJH 3QUMA 3HAEG 3RBSA 1DVFB 4LEXL 4WW2B 3TA3B 4FZ8L 1I8KB 5JW5B 3OB8A 3RKDD 3CX5J 3VFGH 1ED3B 1W72A 3O6FC 4KV5E 4F9PC 5SX5K 3ARGD 3L5IA 3IETB 4U7MA 1JNJA 4PP1D 4S1SL 1QVOA 4WW1A 2B4CC 3A6CH 4BSJA 4IDLA 3QHFL 4OGXL 4LHUA 1WAAF 2QTEA 4OLZL 4DQOH 1Q72H 3LQAL 1OAQL 2C9AA 3BIKA 2AXGA 2G60H 1HHHA 5ILTH 4F15C 1QSFB 3OZ9L 4KVNL 1C8PA 3LZFH 4XMPH 4U6HB 1WT5A 3BE1L 1YEHH 3QDGA 4LSUH 4P3CL 3MRIB 4KDTC 2DQTL 2J8HA 3KPTA 2NY6D 2CK0H 2FBJL 4LCIH 5L88L 4ODHH 4KJYA 3BIAX 4P5MA 4OCYL 4H25A 4IJ3B 1F6AB 1NUGA 3L7EB 4R4FL 2AJXL 3T3MF 3QUMB 5C0AB 3QXWA 1D6VL 1FO0A 3MSPA 4M43L 1D5ZB 2BCKB 3RL2B 3L1OL 2OM5A 4U49A 3WS6A 1KEGL 5D7LD 4PB0H 2X9YA 5DD1L 1SY6A 1HN1A 1QVOB 4Z95L 2R0ZL 1U8LB 5K93A 1QFWL 4EOWL 4O4YL 1IZJA 4KRNA 4LHUB 1CGUA 1IAII 2ZKHL 3WKML 4P23C 1F45A 2WMPA 1WTGT 5M95B 1ZEAH 2E27H 2D03H 4U1SB 3QDGB 1SBSL 2BSED 4KMTH 4LCUA 2GQHA 1RJZA 2AJ3A 2HN7A 2YUZA 4YO0A 4ZUVA 5GRVK 4QRRE 4WENB 4KJYB 4IOSD 4H25B 5CJ8A 4KQ4H 3WIHL 2FEEL 5TF1L 2IBBA 3RWGA 4CL7A 2NX5D 5ID1A 1F4WH 1CGTA 1YPZE 1FO0B 4LQ1A 2WWKO 5C0DA 3WFBL 4RX4A 2QADD 4P57A 4NCC1 1QBMH 3D9AH 3BD3A 3VG9B 2NCMA 4W81A 4PBXA 1XEDA 4N68A 5E24E 5FYKD 2DDQL 4BQCA 4FQ2H 3F7YB 3BN9C 3PP3K 4XP1H 5C1MB 2V2XA 4WUKH 4BFIA 3NA9L 5AYUL 3L3IA 4PJEF 5DHYA 3HG1E 1GJIA 3BPNB 4P59H 1PD6A 1X5KA 4NNXA 2DD8L 4J4PA 4M5ZH 4YQXH 1WZ1H 5TE6L 3PWPE 1QRKA 3ARXA 2CJUL 3UXFA 1KENL 2NY3D 1DUZA 3QEUA 2OYPA 1KPVB 3UZQA 3OBAA 5HHXH 3JUZA 2AJ3B 1CICA 4YO0B 4ZUVB 1G0DA 4ZTPH 2I9TA 5ICXB 4M6MH 4F7PA 1FNGB 3NACL 1GHFL 2YWZA 3THMH 3EFDL 3WNOA 2MHAA 3GBNH 4FTVB 2E8YA 2MKLC 5KSBE 3CAFA 5C0DB 1CDGA 2X09A 5H2BB 4DW2H 2VC2L 4BZ1H 4JFEB 4P57B 3EJYC 3MJ8B 5KSAD 1U6AL 2VB5A 4LCWB 3SDAC 1UC6A 1XGRB 2OCFD 1BQHA 3MRKB 1IAKA 1SM3L 1HIMH 3FB6B 5F1NA 1T1ZA 2KQMA 2WBJB 5SX4I 3S37X 3F58H 3EUUA 1FFPB 1YN6B 1HKFA 4BFIB 1YEJL 1G0YR 5F8QC 4FP8H 4XNQA 4IIQC 2EYSB 4FRWA 4JRYB 3Q5OA 3ARBD 3QWOA 2OR9L 4LAQH 2ITCB 1DUZB 1DQLL 5E4EC 3KXFE 5BCAA 1CICB 3RDTA 3FCTB 4XBPA 4OI9A 4MA7L 1EMTH 1FE8H 1TQBC 3Q3GA 2OL3A 3BT2H 3QNXA 4Z7UB 3RJDA 1OGTA 2M26A 4DN3H 3SKUD 2Z4QA 2PETA 3F5WB 4FXGA 4OTXL 2NY4C 4KUZL 5EOTA 5J0BA 4LIQE 3C6LD 3OWEA 4RFOL 4MAYA 1BD2A 5GGVL 4ZQKB 4RWHA 1WEJL 1BQHB 4I3RL 1JGVH 1IAKB 4LVOC 1RFDH 3VFPB 1GPOL 2OBGA 4MCZB 2CR6A 3EHBD 2R15A 1MCPH 1W0WB 1AJ7H 1WFUA 1VGEH 2J8UA 3C09C 5ICZB 1MHEA 3U7YH 4C4KO 1JZ6A 2ZZUT 5EO0A 5BO1L 3T4YA 3OSKA 4XNQB 1CN4A 1HKLL 5AD0B 5JNYB 4U6YA 1SBBA 5A2JH 1YUHA 3T2OA 5KVDL 4IM8A 1SMOA 5C0IA 1KC5H 1F2QA 3TBWB 3V5KB 1YC8A 4Q58C 2EXYD 3CVHB 4NJ9L 4ZOAA 2NY6B 4ODWB 3FFCA 3RDTB 1I8IA 1JI2A 4XBPB 2APTA 5DF0A 5FV2A 4BZYA 1AKJD 2OZ4A 1TMCB 1CD1B 5GGTA 4D9LL 1BJ1J 1GL4B 3P73A 3T8XA 1W72H 2FX9H 3EYOA 3GSQB 3PXJA 4OJFL 5FGBC 4EVNB 1UZ6E 5C0GA 4HLJA 3ORJA 3MGOB 5E9DE 3PV6A 3N50A 1KCSH 1BD2B 3GMQB 3BEWA 3U36A 3QUZC 1F02I 4NUJB 1GXEA 5D7LB 5C92A 2JTDA 3NPSC 4CKVX 4R6UA 3DMMC 2FECI 4F9LC 1NAMA 1WIOA 2CLRA 2WBKA 5KSVB 3SDCD 4EBQL 4YBQD 1BEYL 2J8UB 3H42L 3QCUL 1IAIM 5EO0B 5J3HC 1RI8A 3GK8H 2QV2A 1WITA 3HPLA 4PG9B 1ZLUH 5CGTA 1DQML 2A6DB 5IVZB 4PV8B 4J8RB 5C3TA 5FOJA 1KT2A 2ZPKL 5IM7B 5D7JA 5CINH 2PYFA 3FFCB 2EIEA 2G75B 3EYSL 2KDGA 5HXMA 4Q6IC 4U1MA 3D0VB 3WUWG 4IJ3C 3ZT7A 3GHBL 4NM4L 2CDGA 3KPPA 3P73B 5DD6A 3SO3B 3T8XB 5CJOH 2ZSWA 3BJ91 3G08A 3DSFL 1S7QB 3QZWG 1VESA 2WP3O 1S9WA 2NX5B 1UVQB 2R0LH 5C0GB 3NCYS 4IRZH 1RHFA 3VI3F 3JV0A 1K4CA 1CWVA 3EYFB 4ETYA 2HT2C 3IVKA 2CUIA 2BXYA 1Y18A 2QADB 1DQQA 4OCRL 2P7TA 4D0BB 3LKQB 4ZFGL 2IPKA 4ZYKA 1E4WL 4RGNE 3WFEL 1XGQB 3AAZB 1NAMB 4XZUA 1AFVL 4WFFD 4EZMA 1DBML 3OXRA 5D72L 1QSEA 4RMSA 5DK2A 3MOBH 2VDOL 1R0AH 3W11D 2NR6D 1MIEH 4OF3A 5BJTB 4C56A 43CAB 2DLFL 4X6DB 3ULUE 3N9GH 3UJIL 1EFQA 2ZCLL 25C8L 5DC9B 3PJSA 1WT5C 4M7JH 1RJLB 3FAXA 2CPCA 3QIBA 4XNZC 4W6WB 4PYHA 3UYRL 3QDJD 1UACH 4F8QA 1CFVH 1WCBB 4FFYH 4HS8L 2DQGH 1FLRL 4U1MB 1CDCA 1R5IB 2YS4A 1EPFA 2CDGB 5DD6B 1I7UA 1CFSA 4YHZL 1FSKC 3QHTC 2F54D 1LO5B 2CMRL 2IH1A 4CVZA 4QRQB 1YNLL 4BM7A 3IVKB 3WS6C 1GGBL 1Y18B 4LPWA 4UT9H 1LO4H 3WFZA 4L3ED 1DQQB 2IPUG 3SE9L 5KSAB 4NRXA 3B43A 5C0JA 1T20B 2H8PB 2IPKB 3KS0H 4KZEH 3KYKH 4HGMA 3MLVH 1RUPH 2GUOB 3B9DA 3OXRB 4PRAB 1QSEB 2DJUA 3UBXI 4EXPX 2W0KA 4L9LA 1P4IH 2BY3A 3QWQB 2DM4A 3JV4A 3PJSB 3KLAB 3ARBB 1X4YA 2IALB 3MRBB 4O2FB 4CVWA 4M8VA 5E6YA 4N1EA 1MHCA 5EB9A 4UAOC 3UJTL 3QDHA 1KFAL 3IXAA 3QULA 2X4QA 1NFDE 4Q97A 1QUNA 5LQBL 2H32A 1CFTB 1UEYA 2IH1B 1EBAA 1IBGH 1S7TA 3U9PH 4B7IA 4MQTB 5JHLL 4AEFA 4MNGE 4GS7B 4W68A 1FZOA 2NXZB 3C6LB 4LEOA 2VDMH 1W0VA 4FFVC 3U0WL 4DGVH 1AGCA 5C8JA 4ENEC 2XACC 1XCQB 1KJMB 4AM0B 1ZTXL 1I3RA 4LFHG 2XG4A 2R2HA 4KTEL 4L9LB 2AGJL 5DS8A 1CIDA 1I3GL 5C0CE 1XZ0A 1HXYA 3MJ9L 5I30H 4J4PC 2FCBA 2FGWL 4PJBF 2XTJC 2OL3H 1QLFA 4LSVL 4LEXH 1S9XA 1EZVY 1CICC 4FZ8H 1FYTA 1HSAB 2FRGP 4QHKI 2APVA 5C0BE 1WZKA 1XF2A 3IXAB 1ZVSB 4OKVB 1TZIB 5E2TL 4PGEA 3KPLB 3FN9A 3UTZB 5F89A 3MROB 4S1SH 3DRQA 4LU5L 1CD0A 1P6FA 4Q9BA 3RVVD 3C8KA 3QHFH 3MV7E 4ETQA 4OLZH 4UUJB 4EI5D 1OAQH 1W0VB 1WISA 5DQ9A 5C8JB 4UMGA 1AGCB 1T2XA 2NMSA 3OZ9H 4KVNH 3MRGB 3BE1H 1BLNA 3SEPA 3LD8C 1X44A 4P3CH 5DGRA 1F4HA 2GSGA 4YFDB 3RAJH 2DQTH 5EN2A 3SDCB 3GEWB 2FBJH 5L88H 5FUCC 4DCQA 2Z0BA 5LGJB 3QG6A 4OCYH 4X9IA 3VFSB 3IFPB 4H26A 2DBJA 3M17A 4R4FH 2J4WL 4XRCB 1U8PB 2AJXH 3CJJA 4PREB 1QLFB 3L3KA 2LVEA 5C07A 3PHSA 1S9XB 2P45B 3KPNA 3LEXB 3VFVB 4MDIA 1D6VH 4M43H 4HCRA 3UPAA 3L1OH 4D94A 5DJ6A 1KEGH 1A47A 1INDL 1VGKB 4IOFD 1T04A 2Z91A 1MVUB 4U1LA 3DRQB 4Z95H 3J8F7 2R0ZH 3ILPB 4LMQE 1YC7A 4EOWH 5F6IC 4MAYC 1X5XA 2NY2D 3LY6A 2ZKHH 2ZWLT 5DQ9B 3HI1A 4PJ9A 3WKMH 1GOHA 1VFUA 1T6WA 2IG2L 4YJZL 4ESKA 1SBSH 4OFIA 2IFGA 3RIFK 5L8KB 5EN2B 4POZC 1XF1A 5GJTL 4U1IB 3HAEH 5EH1A 1NCUA 2PW1A 1QRND 3NZ8A 1ETZB 2GFBB 3M17B 1IAIL 5I1LA 5TF1H 5ID0B 3CZJA 3L3KB 5C07B 4X9HA 4KRPC 4YHIA 5HD8D 3T0DA 3KPNB 4OZIF 2VDKH 2VH5L 3QDJB 3L7FA 5DJ6B 2ZNXA 4OBRA 2FEDD 4JRXA 1DQDL 1Z3GL 1GH7A 1HHKA 3PHQA 1SJHA 5EU5A 2FJFB 2Z93A 4EDWL 2IEPA 1T04B 3ZYJA 2DDQH 2VITA 1OGAA 2YWYA 5FUZL 2F54B 3LH2L 1WICA 3BX7C 3UTTE 2VLLA 1LO3L 5B39A 4APQA 1MAJA 1SJVA 2P49B 2RCSL 1HHGB 1Q0YL 3NA9H 5DYOA 5AYUH 3LQZA 1X9QA 4HMCA 3HI1B 4JFYB 1Z6JT 1XF3A 5CBAA 3TCLA 2DD8H 5TE6H 1YYML 5AUMB 4NQCD 4FABL 2CJUH 1KENH 1RJYA 4RAVB 1IARB 6CGTA 2F53D 1AQDB 1KLGB 2D4DA 3CFEA 3NACH 1GHFH 3RIAK 3NZ8B 3EFDH 2R1YA 5I1LB 5F3BA 3PDDA 5EU6A 1YY8A 2E6QA 2B8OT 4XGZB 1JTTA 4QWWC 4YHIB 2X89D 5IB3A 5L7XH 4I3SL 5MHSE 5D7JC 4P49A 1QR4A 4ZFOA 3AGVA 4BH8A 2VC2H 3HMWL 3QXVA 4JRXB 1U6AH 2JJSA 3PHQB 2PYEA 1MWAA 2H2SC 4RRPG 4EN3A 3BKJL 1WSST 5E8OA 1MRCL 1BJ8A 4HUMB 1K85A 1OGAB 3KLDA 1VEMA 1U2HA 2GW5A 4WI5A 3NFNA 5B39B 4NRYA 2IAMD 5H8DA 1YEJH 1NCDH 3LQZB 5CEZE 3I6KA 4BSWB 5FDYA 3BQUA 5CBAB 1KIPB 4OV5A 2VUYA 15C8L 2VAAA 2OR9H 2RB8A 1DQLH 4JZNA 1MRDL 1CBVL 1KBGL 4XI5D 1CXEA 5J56B 2PNDA 3C5JB 1FVDA 5BZDB 2IFFL 3QIBC 1X5YA 5TDNB 3QWRA 5IB3B 4P3DB 5IB1A 3TESA 4ZFOB 5DMKA 3MV9A 1CE1L 3NZHH 4NO0D 5HHOD 4XVUD 4X6CE 4WI6A 4X6FA 1IKFL 3J7HA 1U93A 2PYEB 5T3ZE 1MJ7H 4LHUG 4OZHA 1WEJH 4I3RH 1UB5A 5DMJB 3ULVE 4JRWA 4J12A 1MFDL 4P46A 1GPOH 3IRPX 4GMTL 2X4RA 3OKEA 2I24N 4NHCL 3V6ZB 3VXSA 4V2CB 1JPGB 3LKRB 5I66B 3DX8A 1Q8MA 1HOCB 1LVEA 2HFEB 4EI5B 1MRFL 4D0CB 1TLKA 1HKLH 4NQEB 3ILQC 4OZGA 3BQUB 1KCLA 5DZLA 3D85A 5D2LB 5KVDH 3O8XD 3CSPA 4OV5B 4TYUA 2OP4L 4HUXA 3IKCB 1RK1B 3O9WA 4YHKL 4JZNB 3QIWB 5F7LB 7FABH 4NJ9H 3FO0L 4PGDB 4L9LC 1QA9B 2IH3B 5BRZE 1UEMA 3MLZL 4P9ML 5IFAL 4FQQA 1AE6L 2V7HB 5C2UB 1G9NL 4MJ2A 5DJ8B 2Q8AH 4KROD 4OJFH 2ZG3A 4AL8L 3NCMA 2RGSA 5IQ9A 5DMKB 1MY5A 5DD5L 3TP4A 4PUBH 4OM1L 1FN4A 3UTSE 4JFZH 1ORQB 1U3JA 2DYPD 4M3JA 1YJDL 3FKUS 4UT7L 1MOEA 4Y5VB 4P46B 3T77B 3HA0A 4Z7QF 3WNNA 5JHDA 1PZUB 4EBQH 2Z35A 1BEYH 5F9WC 5KVGH 3H42H 1KIQB 3QCUH 2GJZA 3DX8B 3TYGL 2NY2B 2VDRL 1I1AA 3M8OH 2VUOA 2EEBA 3DX6A 3RVWC 2DICA 4OZGB 4OM0L 4RCAA 1DQMH 5IG7B 3IAPA 4G6FD 4HUXB 2V7NA 1AQKH 4JM4L 4OZHF 4CVXB 1VACA 2ZPKH 5GS0L 2FECL 1E6OH 3KR3L 4PJAE 2BVOB 1I9EA 1CVSC 5I6XB 4FQQB 2FJHB 3GHBH 3BEVB 2VISA 4NM4H 3HLAB 3MOAL 1QRNB 1UKQA 2CLVA 3GSOA 4PG2A 3VFWB 2R69L 5I1DA 1HQ4B 5EZJB 4XTRC 2R0WL 2H41A 4MQ7A 5ERWA 4NIKB 3MRQA 4OCRH 2EYTA 2G5RA 5I17A 4Z7WE 1X6NA 5IMOA 4ZFGH 1HEZB 3I02A 3WFEH 5EO9B 3V7AG 4NNYA 4CJ1A 5L0QC 1A7NL 4JM2D 1AFVH 3FZUD 5IVXF 1DBMH 5JHDB 5D72H 1G7IB 3U4EA 2VDOH 1OWRM 3VFUA 4HMEA 4X7CC 3O0RL 2Q87A 3UJIH 5J13B 2ZCLH 25C8H 6FABL 4D9RE 2GTWB 4NN5C 5D1XD 2M1KA 2N4IA 4LPTA 1P7KB 4NQCB 2F74A 3ECBB 3UYRH 4TRPL 2ZP0T 1QFHA 3ZMRA 1CQKA 2F53B 4HS8H 1FLRH 3H7BA 3MR9A 2VISB 2GCYA 4WHYG 3MV8E 3VWJD 4XPFL 2EDRA 4G8IB 4YHZH 4EDXB 2NLJB 2VAJA 5I1DB 2DLTA 3FJTA 1J0IA 4MQ7B 3T0VA 2C4FU 1RUML 3MUHL 1GGBH 3HRPA 3C2SA 3MRQB 3SE9H 2EYTB 2NY1D 2YPKA 1G7HB 1ADQA 4JCLA 3X14B 5IMOB 1BWMA 4DUXA 4U1HA 2P5WB 3I02B 4XCFL 4PLOB 3UTOA 1FGNL 4PJDE 4LLWB 4PV9B 5CLTA 5CZXD 3SBWA 4P5KB 1P5VA 1ZA6B 2CRIA 1N59A 2DL9A 4YXHL 4P2QE 5HGAA 3VFUB 1Z5LB 3O4LD 1DDHB 1C5CH 4PJ9C 3QIUA 1PKQA 5AEAA 3ALWA 3QO0A 1BMGA 2H3NB 2R23A 1RJCA 1UKTA 2WW8A 2ATKB 3ZDXF 3VXUE 2W60A 2EIZB 3NA4A 1KPUB 5GS1A 2ZJSL 1JHKL 4JKMA 4D0DB 3H7BB 1MLBA 3MGTA 5I71B 2X70B 3BGFB 5BS0A 5EUOF 5LQBH 2YR3A 4YDKL 3L3OA 3TVMD 2MJWA 5JHLH 2BMKA 4KU1A 4J3UA 4NO0B 4Y88A 4OGAC 5BMFH 4KHXL 4MJ5B 4JGUA 3VWKD 3EOYG 3WDIA 5C6TL 1FPTL 5DFVD 3SJVA 3U0WH 1OSPL 4NSKA 4GO6B 2Y06L 3D39D 3F7VB 4LSPL 5E8NB 4JE4B 1ZTXH 5E8PB 5SWZA 4R26L 4ONOA 4APQC 1BVKA 2LAGB 3UP1A 5HGAB 5KSUB 4HC1A 4OKDA 4AYFA 2JCCE 4Q6YA 3L95B 4KTEH 3OR7A 2AGJH 3MJ9H 1PKQB 1TVBA 4WVRA 1EEYA 1JCKA 2DL2A 2FGWH 4XX1G 3HE7A 3O8XB 3OKNA 2R23B 1CTNA 5IROA 3RY6A 1AO7D 4LSVH 5E7FA 2GJ6E 4HKZA 4JAMB 3W5MA 3QPQC 5CBEA 3DURB 4JDZB 5GS1B 5BXFB 4Y2DA 5ABDE 2PCPA 4MZ2A 3MGTB 5EIIA 4ACPA 1UB6B 1RMFH 4XMKL 3OG6B 5E2TH 2DS4A 1OP5H 3UDWA 4P99A 3DSNA 1FH5L 1L6ZA 3LEYH 4KROB 4CW1B 5DURB 1FZMA 3MNWA 3JWOL 3QUXA 1YNTB 2JJSC 1G6VK 4KJPD 3FOMB 4EN3C 4DZ8A 2DYPB 3MFFB 2V5RA 2GIYA 4NSKB 1UH4A 1CDBA 4OAWA 2EDKA 1NLDL 3QJHB 4DOHB 5EFIA 5F3HA 5EC1A 3LB6C 3CVHL 2NYYD 3HHRB 1L0QA 1MAML 1NAKL 1J86A 1IM9D 3EJZC 2G9HB 1CG9A 3HE7B 2J4WH 3GM0A 4L5FL 1YQ2A 3RVXC 2M8XA 4G6FB 3INUL 3NAAL 3L5XL 4QGTA 5CBEB 2DRUA 4QHKJ 3ZTNH 1TITA 4XBGB 1LO2L 3UC0L 1NEUA 1I1FB 1WIPA 5HHNA 5EIIB 3LIZL 1INDH 1ERNA 1DE4A 1YMHB 5LAXA 1OD7A 3KJ6L 4H20H 5ANMB 4XPBL 4PLKD 1U3HA 1FZMB 1II4E 1V7ML 4J23A 5JZ7D 4WW2F 2XN9E 3SDDA 3GI8H 3MA9L 1VA9A 2HJLB 1EIBA 1UXSB 1A21A 2CUMA 4Q7DA 4P46C 2LAAA 4OAWB 2IG2H 5EFIB 5F3HB 4Y89A 2YMXH 3VMNA 3OR6B 4XHJD 4YPGA 1J0KA 4JM2B 2MCPH 2HAZA 3HCVA 3V4UL 5GJTH 4HGKC 1P4BL 4OLYL 3GFUA 3BZFB 1ND0B 3RVUD 3VXMB 3P4MA 2W9DL 1IAIH 1JWSB 3I3DA 3L3HB 1CFQB 5D1XB 1OW0A 2KPNA 3O9WC 1KYOK 5MEOA 4KK6D 5D2NB 3IDGA 3OHXA 3EOAB 5DLMH 3BSZL 3RUGF 2VH5H 3MCKA 1OD9A 1K8DB 2OJZL 3PV7A 4MXQC 3V79C 4GRWF 5CZVL 5L2KE 2EDYA 1DQDH 1Z3GH 2NNAB 3IS1X 1PEZA 1DE4B 1IC7L 5KS9A 4EDWH 2ED8A 1CE6A 4O2CA 5T5NG 3VWJB 4HKJA 5FUZH 3LH2H 5TDOA 3SDDB 4NM8L 2OSLB 1LO3H 1HILB 3PE9A 2RCSH 4XCYB 5A43C 1Q0YH 2Q76A 5D7IB 1U8OA 4KJWD 3GIVA 2NY1B 5HPOA 1TQCC 4KXZI 2QSTA 1U92A 2YK1L 4K7PL 5SX5H 3OKLB 1YYMH 3IDNA 4FABH 4YPGB 5TDPB 1OCWL 1LP9A 5GZOC 1M7IA 3HCVB 1CU4L 1I1AC 5AAWA 2ADIA 4PGJA 4MS8C 4MWFB 3HI5L 3O4LB 3ZE1E 2WQRA 2VIRA 1NKOA 3P4MB 2MQCA 2XZQL 2CRMA 2OI9B 5E5RB 1G9ML 4DVRL 1T1XB 1BFOB 3U83A 2CKBB 4H0IA 3I9GL 5MEOB 4I3SH 5E5MA 3OHXB 4XNYH 3FO9A 5TH2A 1BVLB 3GUTB 2NQCA 1CI5A 3UBXA 3FB5B 3HMWH 2R29L 3HMXA 4PG2C 3E0GA 4OZFB 1ROWA 3BKJH 5KS9B 2R1WA 1MRCH 2YRPA 3VFOA 1JIBA 4R0LB 3Q6GL 4ZUTA 3S36X 5TDOB 4CN4A 3TVMB 2E6JA 3QFJE 4ZOCA 4YWGH 2BX5A 5I1EL 2Q76B 2Q7YB 2BRRL 3RFZC 1VEOA 4NO5B 3VWKB 3GIVB 2Y1VA 2F8XC 4OFDA 5B3JE 3F6IA 15C8H 1J9CT 2FB4L 1JN6A 4OLVL 5E6ID 3ZDYE 1M7IB 3TIDA 1MRDH 2MPAL 1CBVH 3MLTA 1KBGH 4JCMA 4NO3A 1A1NB 1MCRA 5EZLA 3MC0A 1HYSC 1TZGL 2IFFH 4HK3N 2DOCA 3F8UB 1JHTA 1BQLL 1T21B 1AO7B 5EBMB 4X6EA 5TH2B 3T2NL 2GAZA 1CE1H 1URLA 4JPWL 3ZKMC 1JTOA 5MEND 5HGDA 3DVNA 5FO9B 5FYLD 1WBZA 3I6LD 2Z31A 5DJ2B 1KJ3L 5IW6B 1MQKH 2D0FA 5B3NA 5HI4D 4KZDL 1T5WA 3IF1B 1KTKE 3CH1A 1MFDH 4CNIB 1WCQA 4GMTH 1Q9LB 4NHCH 4PJ7A 4X5XB 4GW1A 5IFJA 4Y1AD 2J5LB 3CGTA 3CMOL 4HH9B 4KDVA 4Q9QH 3AVEA 1KEML 1NGWA 3HZVA 1KG0B 3GMRA 1MRFH 4KGJA 4YAQB 3FO2A 2HFGL 5FK9B 4YGVA 1ZVHA 3GZKA 3OF6A 4JREB 4N0CC 3IFOB 3SBWC 1QQDA 1S5HA 5FB8A 4XVJL 4QT5B 1JN6B 5L2JB 1C08A 4YHKH 3TIDB 4CADA 1CT8B 4XAKE 1RHHB 3FO0H 2P44B 3PP3H 4BJLA 3MLZH 2NTFA 3QIUC 4P9MH 3JUYA 5IFAH 2RQ8A 1AE6H 2R4RL 5F72S 1IM9B 4KK8C 1F3JB 1G9NH 2HT3C 3EYUL 2HKHL 2X4SA 4S1DD 4XB8A 3TN0D 4AL8H 4I48A 1UWXK 2V9RA 1BREA 3DV6B 1JL8A 4PJIF 5DD5H 5HGDB 5DEGA 1IEBA 1EEUA 1WBZB 4OM1H 2VSCA 1YEKL 3CXHJ 1YJDH 3FRPG 4UT7H 4PRPD 4Z7UF 4U4BA 5J12C 3CH1B 5LJYH 1RZ8B 2PTUA 4JN1H 4WDIA 2ED9A 4MNHB 4PJ7B 1WWCA 2YSSA 3R06A 4GW1B 4PJFE 5DEFA 4GRWH 1B0RA 2Q8BL 5IFJB 1NGWB 1WGOA 3TYGH 5KN5A 2VDRH 3HZVB 1DEEA 3FO2B 4YHML 1UJ3A 2EDEA 3TFKD 1FV1B 4YC2B 4YGVB 4OM0H 3SE4C 1WAAE 2YPLE 1PSKL 1S5HB 4JY6A 1ORSB 4WFGE 4UINL 4JM4H 2HTLC 4WI4A 2PW2A 5GS0H 4UNVA 2W9LA 2HP4A 3KR3H 2NTFB 4MJIA 1FNEA 1SMAA 4RNRB 1X4XA 3HE7C 5J1AA 1RK0B 3MOAH 3VW3H 3IYLW 3BUYB 4EI6A 3D18A 5IROC 3RY6C 3WL9A 1CFNA 2P8MA 1KNOA 2R69H 5F1OB 2Y5TB 4Y2DC 5DSCA 1B6DA 2R0WH 2X4NA 1IEBB 5I76B 5B39G 2MKWA 1OB1A 3CPLA 4FQXA 3HC0B 3UDWC 5AZ2L 4R4BA 5FA4B 2DJ4A 3CFDA 4WDIB 1MCBA 2L7UA 1A7NH 2VLKE 5K9QI 2YSSB 1XFPA 3QUXC 4H0HB 2UYLA 4OFYD 1T66D 2BNQD 2F8OA 3S36L 3SE3A 1SEBA 3O0RH 3ZKND 3WLBA 6FABH 4C57C 3IU3A 3W2DL 1P53A 4XP4L 3AS2A 2HH0L 2PW2B 2NZ9D 3MTRA 1JGEB 2VL5B 3QG7L 3V52L 4QRRA 3S88L 3KPQB 5MEQA 4WWKA 3F7PC 3SGDI 5GIRB 5F88A 1Q9KA 5J1AB 3HE6B 5I8KL 4XPFH 3WL9B 4YHYB 5HYQB 1YPZA 1CFNB 2P8MB 3E2HC 5E9DD 1KNOB 1YMMD 2VLJE 1XGTB 4ELKA 3GDBA 3D2UA 2XY1A 4FNLL 3CPLB 4LVHB 5E94A 4R4BB 4K8RC 1U3HC 4XCFH 1FGNH 1S7XB 3ISWA 3K8KA 1DBBL 3SDDC 2AJYL 1QP1A 2EC9U 3ZLQC 4AEEA 4LSRL 4NHUB 2Z8VC 3KLSA 3HG1A 1DBAL 2YC1B 5EU3A 1WWAX 4FQJL 2X4OB 3DIFA 3CC5A 3PWPA 2E7BA 4PJEE 4KUCD 3WEXA 4IS6B 5B38A 4L8CA 5E6IB 3PWVA 1P2CB 1N64L 1OARH 2EZ0C 3KYAA 4LDLB 1D5BA 2ZJSH 4WWKB 4O00A 1JHKH 3D1MC 4ZFFB 4X6DF 3N1PC 1Q9KB 3S7GA 4CGTA 3D25B 3P77B 4B7LA 1OW0C 1S7VA 3ARFA 4ELMA 1S9YB 4HFUL 1YPZB 1NJ9A 4YDKH 2A0LC 1OQOA 5KSBA 4G7YL 5DXWA 4RFEA 2W9EL 1D9KA 2AK1L 4HV8A 4UTBL 3H0TB 3RWJA 5MENB 3D2UB 4KHXH 3L3DB 5C6TH 4RGND 1FPTH 1MFCH 3RGVA 1K3ZA 1OSPH 4J3SA 4TTDC 2Y06H 2N7BA 5EORL 3N85L 3SY0B 4LSPH 3X13A 1W2KT 3TBTB 4R26H 3VMOA 4NFCA 3KLHD 2C1PA 3HG1B 2X1QA 4QRSA 2BVEA 4Y1AB 5EU3B 2ZCHL 3RHWK 1U0QA 2QQNH 1B9ZA 1JZ3A 2Z92A 3KWWA 3CC5B 2JB5H 3PWPB 5D1ZA 2APFA 1XF4A 2HJFA 3KXFA 1KTLB 5JDJA 5B38B 1ZGLP 3K7UA 4PRHD 3WIFB 1AKJA 4TNWK 1RV6X 2EEDA 1YEFL 2P43B 3G5ZB 1MFEL 1NUFA 1T5XB 2OR8A 3QDAA 4XMKH 3VXPB 3OKOA 3FB8B 1NJ9B 3E3QC 1RD6A 2ADGB 5IIEB 4DN4L 4K71B 5KW9L 4NKOA 4RFEB 4A2MA 2JLLA 1I8MA 1IGYB 1D3CA 1A1MB 1B90A 3DVGB 3RWJB 1MI5E 3ZTJG 4RBPK 4QCIA 1CLYL 4X5LA 1EFXA 3WS3B 4JO4L 1SQ2N 4M62L 2H2PC 2BVQB 4LLUB 4PJ5E 4ZOEA 1U36A 2XTJE 5D6CA 2O5XL 5F8RC 1NLDH 3A6BL 3W0WE 4ZD3L 3OAZH 1G7QA 2J5LC 3JSSA 5EOCJ 3MLSL 1MAMH 4JLRA 3RIFF 5T5NF 1NAKH 3NGBC 3KWWB 4RISL 5JW4Q 3D0LA 3NTCL