1HJBA

Crystal structure of runx-1/aml1/cbfalpha runt domain and c/ebpbeta bzip homodimer bound to a dna fragment from the csf-1r promoter
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
66
structure length
66
Chain Sequence
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CCAAT/ENHANCER BINDING PROTEIN BETA
publication title Structural Analyses of DNA Recognition by the Aml1/Runx-1 Runt Domain and its Allosteric Control by Cbfbeta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 30
structure length 66
sequence length 66
chains with identical sequence B, D, E
ec nomenclature
pdb deposition date 2001-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1hjbA00
3KQGA 1HUCA 3MGNA 4M3LA 1SLQA 2YO2A 3IR9A 3OAKA 1S9KD 3HE5A 1H88A 2R5BA 2Z5HA 5AVRB 3NFQA 5APQA 5AW2B 1GK6A 2JJLA 1FOSE 2R32A 1GZLA 3LIEA 3NMDA 1J2JB 1FAVA 3M0AA 5AVYB 3V4QA 3LIDA 1S9KE 3UIAA 3SWFA 4GT1A 2XU6A 2XZRA 3A3YB 2R5DA 3V5BA 2E43A 3HE4A 1A02F 1NWQA 3NTNA 2VRSA 3HE5B 1GD2E 3L36A 3P8MC 5AVZB 5AW5B 3A7OA 3TK1A 3TNUA 3L37A 3TYYA 3KDPB 5AVSB 2P67A 2E42A 1OWAA 2BASA 4HYTB 3M9BA 2WT7A 2N9BA 4KHXA 3P7KA 3VN0A 4EOTA 4LC1A 2Q7CA 1HJBA 4AUWA 5AW8B 4B86A 2XV5A 2QM7A 5AW6B 3O8ZA 3M9HA 1HWTC 1CSBA 5AW0B 3HE4B 3VMYA 2YO3A 2H7HA 5APUA 4RESB 1CI6B 1JUNA 1H8AA 4AYCA 3NXSA 1YYCA 3VMZA 3VMXA 3TNUB 5AVWB 1FOSF 5AW7B 1G2CB 3A5TA 4C7NA 1CI6A 2WPQA 2ZFCA 5APYA 5AVXB 2WPSA 4GKGA 1A02J 2WT7B 2W27A 1IO4A 5APVA 1GTWA 1T2KD 2P7JA 3A2AA 1NAFA 3HTKA 4I2LC 3MD0A 2Q3IA 3T97A 4JYBA 5AVTB 5APSA 1HBWA 2WWWA 5AW1B 1DH3A 1SP4A 2WTYA 4JYCA 3VTPC 1MUUA 1MFZA 4C7NB 1KQLA 5AVVB 1JNMA 1CZQA 2QM8A 5AW3B 3VYIA 3L35A 4C46A 2ZXEB 3M06A 4XE5B 2R3CA 1X8YA 3M0DA 3I5CA 5APXA 1T2KC 5AVQB 2Z5IA 5APTA 1GU4A 1OXZA 3B8EB 2WPRA 2C9LY 2KP8A 2YNYA 2IPPA 2C9NY 3P32A 1GU5A 5APWA 2P2UA 3M91A 1MV8A 4AQRD 5AW4B 2Q5UA 1GK4A 4I6MC 5AVUB 5AW9B 3V4WA 5CMZA 4DZOA 1H89A 2W6AA
chains in the Genus database with same CATH superfamily
3E1IA 2E75B 1KILB 3NFQA 3LIEA 1N7SD 4EYYQ 1AQTA 4XFJA 2N9YB 1VQ4P 1KYOH 3CCMP 3SFDC 3H25A 1LTGC 1BSNA 3QWOC 2ZYGA 5AVSB 2JDIH 5KLIC 2POHA 4WY4C 1H0TB 2H7HA 1KMIZ 3MUDC 4IOIH 1VQ6P 1LWUC 3VMXA 2N1TC 3TNUB 1HGVA 1S5LE 2WPQA 4ZNCA 1YI2P 3KYQA 3CXHH 4PD4D 3AEAC 4HKZH 3T97A 2HPCA 4JYBA 3CL3D 2HODA 1DIPA 3JC22 1PPJE 3CWBG 1R8EA 4N6JA 2QIWA 3H1IJ 3PJSK 5KAIE 2YIUC 3IAOA 4LLHA 1KILA 2WITA 3V6IA 2C9LY 2WQYC 4PV1C 5GTIE 1ZOYC 5AW4B 3RK2D 2Q5UA 3H1IE 1YTZT 2YO2A 4WY4B 1SQXJ 1KILE 1PGQA 1NTZG 1AFOA 1NTZD 1UIIA 2KSEA 2WSCJ 3RL0C 2N1TB 2HG5D 3LIDA 1RE3A 3UIAA 3TDKA 1P84D 1GL2A 5CJ0A 1AVOA 4Y99C 2Q6QA 1BCCG 3P8MC 1SQXE 3TNUA 1JO5A 3BRVB 1ZR4A 1L0LJ 3MHVA 1JY3P 4HYTB 2QJYC 2P58A 3C8VA 3M9HA 2W83C 2IZ0A 4AYCA 3OW2O 2ZYDA 2JWDA 1E79H 1PPJD 5TISH 3H1KG 4OVNF 1L0LE 3H1KD 1GTWA 3AEFC 3CC2P 2D2CC 1DD4A 3CCJP 1OFCX 1SQXK 2IBZG 3HD7B 2IBZD 3H6PA 4PJ0H 4XE5B 3HUSA 2KYVA 3M0DA 3I55P 2YKOA 1QX8A 4UB6H 4Y99B 1RE4A 1W2EA 2E75D 1KILD 1PGJA 1LTSC 1L0LK 4PD4I 4I6MC 5AW9B 5AVUB 2R44A 2NZ2A 1D7MA 3GMAA 1J1EB 1SFCA 3E1RA 3LW5H 3V2PA 1FZCA 1YIJP 5KJ7C 1FE6A 4N78D 3SFEC 2ZT9B 1NO4A 1DD3A 2O01J 1K9MQ 2WSFJ 3FGAD 4BRYA 3O8ZA 4IL6H 3A0BE 4QMAA 1JEKA 2I1JA 2OYHC 1CI6B 2KB7P 3NXSA 3HD7A 1P84I 5CCGA 3U1AA 4RKUJ 1S5LX 4I2LC 1M1JA 2G8YA 3H1LG 2WMMA 4BWNA 3G6EP 1TU3F 2BEZF 3M06A 3SWKA 3VP9A 3USSA 1Y47A 4WBAA 1VL2A 5KLVJ 1VQ9P 2YNYA 3H32B 1EC5A 1NKNA 3AE5C 1KORA 4L73A 1YTZI 2IYPA 1KYOE 2RMZA 3TF5A 3IN6A 3MTUE 2IBZI 5KLVE 1NU1K 3B4SA 2C0XA 2E76B 1S4XA 1N73A 5B5EE 1SFCD 1LNQA 3SWFA 2R5DA 3GF3A 3O6QB 4WVZA 1JY3N 1KN7A 2E5TA 1RF0A 4HJGH 2FFDC 4HH2A 1OWAA 4H13B 3PP5A 2BCCG 4W7ZA 2Q7CA 2M3EA 2E74D 1CSBA 5KLVK 1LTIC 3GG2A 2MJZA 4MN4C 3WU2H 1NU1G 1NU1D 3HD7D 3W68A 2WPSA 2IX7C 1A02J 4I1LA 2W27A 2FXMA 2KUBA 5CCGD 1IFPA 3L71J 1JCDA 5BU8B 1JOCA 3L74J 3CPWO 3FWLA 3OJAB 1KYOD 3L71E 1OX3A 4TLFA 3N7NA 1FDMA 1QLED 2AEJA 1L4AC 4DZOA 2IZ1A 3KQGA 3H1JJ 1ZN5A 3L74E 5H2FH 5DJUB 1GW4A 1Q81Q 2ZT9D 1JM0A 1OW7A 3AE6C 1IK7A 3H1JE 1OW8A 2M0BA 1N2DC 3A7OA 3TYYA 1S72P 2E42A 1VPCA 2HYNA 1U57A 3WUVA 2BEQD 3KXDA 3CCQP 3Q1MA 4H0LD 1NH4A 1RF1C 1M90Q 4PJ0E 1IJDB 3CC7P 1ZLLA 1G2CA 1URQB 1LTBC 3IFMA 1L4AB 3D71A 2CPBA 1KQLA 3L75G 4RO0A 3L75D 3TGUG 5CCHC 3TGUD 1BGYG 1BGYD 4DJGA 2OTKE 1T2KC 5AVQB 2IFNA 1SQBG 3CWBJ 3L74G 1SQBD 3L74D 1EZVG 2KOGA 4KT0J 3EWKA 2OYIC 1GU5A 2I1KA 2PAJA 2E76D 4GODA 4PD4E 1FJKA 2A06E 1YQ3C 3CWBE 5KAFE 5AVYB 1RF1B 1HTLC 1JB0J 2RKLA 1KTMA 3CMEP 4H13D 1KYOI 3P8CD 1S3JA 1NTZJ 3L36A 1QEXA 1DEBA 2H43A 4OGQB 3ZDMA 1URQA 3GLMA 1K05A 2CK3H 1BCCJ 1NTZE 5AVWB 2FYUG 2QSIA 2CPSA 2XKMA 4GKGA 3U1CA 1AQ5A 1P84E 1PV3A 2IFMA 4L74A 3CXHI 3R2PA 3AEBC 4WWIA 1X9VA 5E79H 1BCCE 1OVVA 1FZEA 1OVRA 4NPEA 5AVVB 3GHGB 3AE1C 2ZVOB 3H1KJ 3Q3DA 1Q82Q 2W6JH 1XTCC 3RK3B 2WZ7A 4IFMA 3FWNA 1SQPG 2WPRA 1NTZK 1SQPD 4LGDE 2A06G 1NYHA 2A06D 3CWBD 1DEEG 3MZWB 1X0TA 3H1KE 2R3SA 3AEGC 1SLQA 3E7KA 3OA7A 1AA0A 1VQNP 3TSIA 1OZHA 2QRXA 2IBZE 3B71A 1G1IA 1K04A 1BDDA 2OGUA 1JMBA 1FZCC 1ZXGA 1EZVI 1YJ9P 5KLIB 1OVUA 1Z56A 2WSEH 1PIXA 1FC2C 1LWUB 4B86A 1HWTC 3VMYA 2QJPC 2V4HA 1URQD 3D70A 1JUNA 1IFIA 1H0TA 2J5UA 1L4AD 5GTHH 2KS1B 3GHGA 1KC8Q 1YHQP 4C7RA 1BCCD 5APYA 5AVXB 4W80A 3PHLA 2YKPA 3EQ2A 2GUVA 3V2RA 1VQPP 1HBWA 1QGKB 3AEEC 3BATA 4N78E 2YIUB 2YMYA 1CZQA 2QM8A 3KZIE 5AW3B 3BCCG 4NPDA 3BCCD 3PH0A 1BSHA 1ZP0C 3CD6P 2ITAA 1LTAC 1VQ5P 2Z5IA 5H2FE 4PV1B 2M5AB 1OXZA 3H1LJ 1LT9C 1VF5C 1S2EA 1E5WA 3RGUA 2WPVB 2E43A 4H44C 2B87B 4YTPC 3RL0B 5APQA 3F5HA 1RHZB 2P1JA 4WY4A 3B5NC 3H1LE 1LP1B 3MUDA 1LWUA 2N1TA 1M7LA 1NTKG 4OGQD 1NTKD 2RH0A 2OQQA 2KXPB 2QJYB 5CCHD 2NPSC 3TK1A 4RJTA 1QVFO 2XDJA 1EDJA 2BASA 3M9BA 4K3AA 2QM7A 3II6A 1M1KQ 1KFMA 2I8DA 1ZRTE 3G4SP 1FOSF 2D2CB 2BCCJ 2O01N 1VF5B 1AV1A 1S1CX 4U3FG 1W5CE 3F89A 1JTHB 5AVTB 3RK3D 4UB8H 3S1KA 1SP4A 4R4MA 1NU1J 3PRJA 1JNMA 4N3YB 4C7NB 4JBZA 1QVGO 3KHUA 1NJIQ 2K1AA 2BCCE 2KI7B 1GMJA 5KTBA 2B87A 4IFFA 3U59A 5APTA 1GU4A 1LTJC 3L4FA 1KD1Q 2KLVA 2IPPA 2QG4A 3N4XA 1CW5A 2NPSB 4YXDC 1LP1A 1NU1E 2K37A 2QVAA 3H1LD 5CMZA 1T6AA 3MGNA 3OAKA 3FXDA 2Z5HA 1USEA 1GZLA 2IYOA 1EDIA 3Q2YA 1KB9I 4WY4D 1Q90D 2JWAA 3CLQA 3H1HG 4K35A 3SSUA 2VRSA 1VQLP 3H1HD 1OIPA 2N1TD 5AVZB 1ZRTD 3L37A 3KDPB 1N7SC 2OYHB 2N9BA 1L0NJ 1KB9H 5AW0B 3HE4B 2NRGA 1JTHA 1PL5A 3BVHA 3S9OA 2LXCB 1NTMG 4GIFA 1LTJB 1NTMD 4HB1A 1CI6A 4C7NA 3MP7B 2FKWB 1PP9G 1NAFA 1PP9D 2FYNC 1L0NE 2BCCD 5M1BA 3CXHE 2KLUA 1SQVK 4JYCA 4PV1D 5KAIH 1MFZA 2FXPA 3G71P 1M8OB 2FBWC 2L5GB 2H88C 1J1DC 3HTKB 1FZGA 1FZAA 1HJ0A 2WSEJ 3L73G 1WRGA 3RL0D 2HFED 3L75J 3L73D 4ZMDA 2QEXP 3TGUJ 5KJ7A 2Z4EA 1BGYJ 3H32A 2P10A 1L0NK 5L8RJ 1BE3G 1H88A 2C0WA 1SQBJ 5AVRB 1BE3D 4DCKA 3CCEP 2Y0DA 2DW3A 3L75E 1SQVG 3V4QA 1EQ7A 1SQVD 2OYHA 1S9KE 3TGUE 2FFDB 2XU6A 1BGYE 3RK2C 2JP3A 3HE4A 4DOJA 3NTNA 1VDFA 2B89A 2FYNB 3O6QA 1SQBE 5GTHE 2WSCH 1HGZA 4Y28J 1EZVE 2ZAEB 3MIWA 4R4LA 2D2CD 2W6BA 2XV5A 2IDBA 3AE4C 1J1DB 2KNCB 1L0NG 3PTZA 1L0ND 1YYCA 1GW3A 3CXHD 1EDKA 4IFDK 5CHXA 3Q5PA 2MKVA 1T3JA 3HTKA 5TISE 3WUUA 1ZMEC 3P8CE 3CC4P 1SQBK 2FYUJ 2QJKC 2WTYA 1MKMA 2K88A 1IFJA 1MUUA 1JMMA 2PRRA 5B66H 4YXWH 2AXTH 2KP8A 3P32A 2FYUE 2QE7H 3LW5J 5APWA 4UB6E 1QL2A 1G1JA 2FFDA 5KJ7D 2K9YA 3AE3C 1S9KD 1SQPJ 1PFIA 4EDFA 1DX7A 3NMDA 5C39A 1KILC 4GOFA 3VMAA 1EZVD 1NGMB 3JSVC 3CX5I 3FXEA 2KNCA 1YJNP 5AW5B 1SQPE 2FYUK 3JCUH 2J58A 2QJKB 3CCLP 4EOTA 4ZKUA 2XNXA 3A0BH 1HJBA 2YMKA 1YJWP 1HVVA 4TT3H 1RE3C 1GL2C 1YBKA 4IL6E 3VMZA 1HF9A 3CX5H 1SQQG 2O01H 4JF7A 2PGDA 2WSFH 5DJTB 3A0HH 1HH0A 2HPCB 3AEDC 2P7JA 1JCCA 3A2AA 1MZ9A 2WVRA 5AW1B 1SQPK 1FZBA 3VTPC 1L4AA 1IC2A 3L35A 4C46A 2JEEA 1FS0E 2FYUD 2QA4P 2YXQB 3C1LA 2R3CA 3ABVC 4L76A 2OYIB 2GUSA 2E5YA 2LKMA 2C9NY 3BCCJ 1IFDA 3V4WA 1JY2O 1H89A 3FX0A 4DT0A 5EFWB 5AW2B 3CCUP 3HUSC 4GOEA 2Q3EA 3M0DC 3CI9A 5B5EH 4EIJA 1GL2B 4I7ZC 1Q2NA 3L70G 3V2QA 3L70D 2KZJA 3BCCE 5CBOA 2V7QH 1M56D 1RE4C 3L72G 1KB9E 4GT1A 1RF1A 3A3YB 3L72D 4KJMA 3K5BA 2Y9YA 3GW6A 1JY2N 1VQMP 4D6TG 2OARA 4D6TD 3VN0A 3P7KA 1SFCC 1NTKJ 4AUWA 2G3AA 2YO3A 1WMKA 4RESB 3RBZA 1EXJA 3G9RA 3BRTB 1H8AA 5CCHA 2HLOA 5AW7B 3WU2E 1KFNA 1AJYA 3SWYA 3G3ZA 2WT7B 1AVYA 1NTKE 2OYIA 2Q3IA 2E74C 2WSSH 1DH3A 5K5GB 2UWJE 3HUSB 4JPZB 2ZXEB 1OMIA 3HD7C 4I7ZB 4U3FJ 2RN0A 1R5LA 3RL0g 1X8YA 1KV4A 4YPCA 1LT1A 5CCGC 1T3UA 2GM4A 4GDOA 1M1JC 1VQOP 4ZKPA 1GK4A 4Z1MH 4U3FE 1NTKK 2L91A 3CCSP 1SFCB 1KB9D 3RK3E 1GK6A 2YKQA 1FAVA 3M0AA 1UIXA 2ZXXA 1FDOA 1KQFB 1FZCB 2FY8A 1J1EC 1X22A 1N86A 1A02F 3V2NA 1GD2E 3BASA 1PPJG 2K3RA 2E74B 2Y9ZA 4BRYB 3IF4A 2QJPB 2A45G 1EDLA 2WT7A 1XTGB 4LC1A 2ZVNB 4BXLA 5AW8B 2ZT9C 3H1HJ 1N73C 1Y8AA 1YITP 1LGHB 4L75A 3D6ZA 4NPFX 1RF0C 1SS1A 1L2PA 1NHLA 4IL6X 3I56P 3H1IG 3H1ID 1M1JB 2PFXA 2KS1A 1T2KD 3H1HE 3Q5SA 5APSA 5B66E 2WWWA 2AXTE 4OH8B 1NTMJ 4H0LC 2Q9IA 1KZUB 2B88A 1USDA 1PP9J 1NAYA 3QH9A 1LT9B 2ZYAA 2M3BA 3CCRP 1SQXG 4U3FD 1SQXD 1YQ4C 1U7MA 1NTME 4H44B 2M5AA 2FXOA 4PD4H 1GL2D 1ZR2A 1SVFA 2W6AA 1PP9E 3WMM0 3B5NB 2LR2A 3IR9A 5KAFH 1N73B 3L73J 3JCUE 3W67A 2H8PD 1L0LG 1L0LD 2E76C 2XZRA 3V5BA 1BE3J 1NWQA 3M9QA 1OW6A 3CX5E 3HRNA 2PP6A 2AEFA 1NTMK 3L73E 1SQVJ 4H0LB 3A0HE 4KHXA 5AW6B 1X79B 5CJ4A 1IK9A 4H13C 2JKVA 1BE3E 2JR8A 2OTJP 1IFNA 1PGOA 4EI2A 3A5TA 1BDCA 1EXIA 1P84H 2JO1A 2KSJA 1SQVE 3AE2C 1IO4A 1NKZB 3CMAP 1LT9A 1JY3O 4CPGA 1FBMA 3VOPA 1VQ8P 2SPZA 2A45I 5E79E 2V7QJ 1S5LH 2XNDH 3VYIA 1ZW0A 1T8ZA 4JQ0D 3B5NA 5APXA 1MFTA 1RQVA 2KIKA 3AECC 2LXBA 2B9BA 1N8RQ 3AE7C 2A45H 2FYZA 2NPSA 1FJPA 1NOHA 2HR3A 4ASWA 2R5BA 1Q7YQ 2JJLA 3Q5RA 1LJ2A 1J2JB 3CX5D 5CBNA 5GTIH 2OTLP 1PZQA 4OWFA 2O1JA 5BU5A 1FU1A 2W8ZA 3HE5B 2KK7A 3C9IA 1N7SB 2P67A 1NVOA 3VP8A 1LTTC 2K9JB 1G2CB 1K73Q 1LTJA 3ITKA 1RQUA 3RBXA 4O9BA 1K8AQ 5KLVG 1WT6A 5KLVD 1URQC 1VF5D 3KZIH 1SQQJ 1JY2P 1N7LA 3D6YA 5KKZC 2O3JA 1GDTA 2OYOA 2YXRB 4H44D 2W90A 3EFGA 2M8RA 4XA4A 1IFMA 1RY3A 3GF7A 5BVZA 3B5ND 2H89C 1QL1A 1SQQE 3M91A 4AQRD 4WB4A 2O1KA 1HUCA 4M3LA 1PGPA 1VQKP 3HE5A 2ZJSE 2NPSD 1N7SA 1U7JA 1FOSE 2R32A 3RK2B 3PLNA 2Y0CA 1W2BO 2K9JA 4ASVA 3KPEA 1SQQK 3L70J 1FDIA 1M57D 1IZNB 3L72J 5KKZB 4U7JA 3AE9C 2E75C 5TJHA 5APUA 4OGQC 3L71G 3L71D 4A7PA 2GA1A 3S4RA 2ZFCA 4D6TJ 3L70E 5APVA 1R5SA 3L72E 2AXCA 1KQSO 3MD0A 1Y9BA 3R4YA 1RH5B 1VQ7P 2Q1KA 1ZV8A 4UB8E 3WUTA 3AE8C 4D6TE 1KQGB 1SQQD 1FZFA 3GHGC 3I5CA 2J59M 3T97B 3H1JG 2Y0EA 2HODB 3H1JD 3B8EB 2KZIA 3RK3C 1Q86Q 4W7YA 2P2UA 1MV8A 3EFFK 2AEMA 3CCVP
chains in the Genus database with same CATH topology
3KQGA 1NTKK 3MGNA 3E1IA 1ZN5A 1SFCB 3OAKA 2Z5HA 1KILB 3NFQA 1GK6A 2YKQA 1GZLA 3LIEA 1GW4A 1FAVA 1N7SD 3M0AA 1FZCB 4WY4D 1J1EC 3CLQA 1N86A 1A02F 3V2NA 2VRSA 1GD2E 3BASA 2N1TD 1LTGC 5AVZB 3A7OA 1N2DC 3L37A 3TYYA 3KDPB 5AVSB 2E42A 1VPCA 2HYNA 2A45G 1N7SC 2WT7A 2OYHB 1XTGB 2N9BA 2POHA 4LC1A 4WY4C 5AW8B 1N73C 5AW0B 3HE4B 2H7HA 1LGHB 1JTHA 1LWUC 3BVHA 1NH4A 3VMXA 1RF1C 2N1TC 3TNUB 4GIFA 1LTJB 1IJDB 1HGVA 4C7NA 1CI6A 2WPQA 1RF0C 1NHLA 1ZLLA 1G2CA 1M1JB 1URQB 2FKWB 1LTBC 3KYQA 3IFMA 1T2KD 1NAFA 3T97A 2HPCA 4JYBA 1L4AB 3CL3D 5APSA 2HODA 2WWWA 4OH8B 1SQVK 2CPBA 4JYCA 2Q9IA 1KZUB 4N6JA 1MFZA 1KQLA 5CCHC 2L5GB 1J1DC 3HTKB 1LT9B 1FZGA 1T2KC 5AVQB 4LLHA 2IFNA 2M3BA 1KILA 2WITA 1FZAA 2C9LY 1WRGA 2KOGA 3RL0D 2HFED 2OYIC 1GU5A 2I1KA 5KJ7A 2Z4EA 2PAJA 5AW4B 3H32A 3RK2D 2Q5UA 1GL2D 1ZR2A 1SVFA 2W6AA 1YTZT 1L0NK 3WMM0 3B5NB 2YO2A 3IR9A 1FJKA 4WY4B 2C0WA 1H88A 5AVRB 1N73B 1AFOA 2H8PD 5AVYB 3RL0C 1RF1B 2N1TB 2HG5D 1HTLC 3V4QA 1EQ7A 3LIDA 1RE3A 2OYHA 1S9KE 3UIAA 1GL2A 2FFDB 2XU6A 5CJ0A 2XZRA 3RK2C 3V5BA 3HE4A 3P8CD 4DOJA 1NWQA 3NTNA 4Y99C 1VDFA 3M9QA 3L36A 3P8MC 3HRNA 3TNUA 2PP6A 2WSCH 1DEBA 1HGZA 1NTMK 1JO5A 3BRVB 1ZR4A 1JY3P 4HYTB 2H43A 4KHXA 3MIWA 1URQA 2W6BA 2XV5A 5AW6B 3M9HA 1X79B 5CJ4A 1IK9A 1J1DB 4AYCA 1IFNA 1YYCA 5AVWB 1GW3A 3A5TA 2CPSA 2XKMA 4IFDK 4GKGA 2KSJA 5CHXA 3U1CA 1IO4A 1NKZB 1AQ5A 2IFMA 1GTWA 1T3JA 3HTKA 1LT9A 3P8CE 3R2PA 1JY3O 1FBMA 1X9VA 1SQBK 1SQXK 1FZEA 3HD7B 3VOPA 2WTYA 1IFJA 2A45I 1MUUA 3H6PA 5AVVB 3GHGB 1JMMA 3VYIA 1T8ZA 4XE5B 1XTCC 3HUSA 2KYVA 3M0DA 3RK3B 3B5NA 5APXA 2WZ7A 2YKOA 4IFMA 2WPRA 1NTZK 4Y99B 2KP8A 4LGDE 1RE4A 1W2EA 3P32A 1KILD 5APWA 1LTSC 1QL2A 1L0LK 1G1JA 2A45H 4I6MC 5AW9B 5AVUB 2FYZA 2FFDA 2NPSA 5KJ7D 1FJPA 1NOHA 1SLQA 1S9KD 3OA7A 3TSIA 2R5BA 1PFIA 1J1EB 2JJLA 1DX7A 3NMDA 1SFCA 1J2JB 3LW5H 1KILC 3V2PA 1G1IA 2O1JA 5BU5A 1FZCA 1FU1A 5KJ7C 1FZCC 3HE5B 3C9IA 1N7SB 4N78D 5AW5B 1Z56A 2FYUK 2J58A 2P67A 1NO4A 2WSEH 4EOTA 4ZKUA 1LWUB 2XNXA 1HJBA 4B86A 3O8ZA 1HWTC 1HVVA 3VMYA 3VP8A 1URQD 1LTTC 1RE3C 2I1JA 2OYHC 1CI6B 2KB7P 1JUNA 1IFIA 1GL2C 3NXSA 3VMZA 3HD7A 1L4AD 1G2CB 2O01H 4JF7A 3GHGA 4C7RA 5CCGA 5APYA 5AVXB 2WSFH 4W80A 1HH0A 3U1AA 1LTJA 2HPCB 2YKPA 2P7JA 1JCCA 3A2AA 3EQ2A 2GUVA 1MZ9A 4I2LC 4O9BA 1M1JA 3V2RA 1WT6A 1HBWA 1URQC 5AW1B 3BATA 1SQPK 4N78E 1FZBA 1JY2P 3VTPC 1N7LA 1L4AA 2YMYA 1CZQA 2QM8A 5AW3B 1GDTA 1IC2A 3L35A 4C46A 3M06A 3VP9A 2JEEA 3EFGA 2M8RA 2R3CA 4XA4A 4WBAA 1IFMA 1RY3A 5BVZA 2OYIB 2GUSA 1LTAC 2LKMA 2Z5IA 1OXZA 3B5ND 2YNYA 2C9NY 3H32B 1LT9C 1QL1A 1NKNA 3M91A 1YTZI 1IFDA 4AQRD 1E5WA 4WB4A 3V4WA 2O1KA 1JY2O 1H89A 2E43A 1HUCA 4M3LA 3MTUE 3HE5A 3RL0B 2NPSD 1N7SA 5APQA 5AW2B 1NU1K 3HUSC 1FOSE 2R32A 3M0DC 2P1JA 3CI9A 4WY4A 2C0XA 3RK2B 3B5NC 4EIJA 1GL2B 1N73A 3V2QA 1SFCD 3MUDA 3SWFA 1LWUA 1RE4C 4GT1A 1RF1A 2N1TA 3A3YB 1M7LA 2R5DA 1JY3N 1RF0A 2FFDC 5CCHD 2NPSC 3TK1A 1JY2N 3KPEA 1SQQK 4HH2A 2XDJA 1OWAA 3PP5A 2BASA 4W7ZA 2OARA 3M9BA 3VN0A 3P7KA 2Q7CA 1SFCC 4AUWA 2QM7A 3II6A 1CSBA 1KFMA 2YO3A 5APUA 4RESB 5KLVK 1LTIC 2MJZA 3BRTB 1H8AA 5CCHA 1FOSF 2HLOA 5AW7B 1KFNA 2ZFCA 3HD7D 2WPSA 3SWYA 2IX7C 3G3ZA 4I1LA 2WT7B 1A02J 2W27A 5APVA 2FXMA 5CCGD 2OYIA 3MD0A 2Q3IA 5AVTB 1JTHB 3RK3D 1JCDA 1DH3A 1SP4A 1ZV8A 1JNMA 4N3YB 4C7NB 3HUSB 5BU8B 1JOCA 2ZXEB 3HD7C 1FZFA 1X8YA 5KTBA 3GHGC 4IFFA 3I5CA 2J59M 5CCGC 3U59A 3OJAB 5APTA 1GU4A 2HODB 1LTJC 3B8EB 3L4FA 1T3UA 2KLVA 2IPPA 3RK3C 4W7YA 2GM4A 3N4XA 1CW5A 2NPSB 1M1JC 2P2UA 1MV8A 3N7NA 1FDMA 4ZKPA 1GK4A 5CMZA 1L4AC 4DZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQG A;  1HUC A;  3MGN A;  4M3L A;  1SLQ A;  2YO2 A;  3IR9 A;  3OAK A;  1S9K D;  3HE5 A;  1H88 A;  2R5B A;  2Z5H A;  5AVR B;  3NFQ A;  5APQ A;  5AW2 B;  1GK6 A;  2JJL A;  1FOS E;  2R32 A;  1GZL A;  3LIE A;  3NMD A;  1J2J B;  1FAV A;  3M0A A;  5AVY B;  3V4Q A;  3LID A;  1S9K E;  3UIA A;  3SWF A;  4GT1 A;  2XU6 A;  2XZR A;  3A3Y B;  2R5D A;  3V5B A;  2E43 A;  3HE4 A;  1A02 F;  1NWQ A;  3NTN A;  2VRS A;  3HE5 B;  1GD2 E;  3L36 A;  3P8M C;  5AVZ B;  5AW5 B;  3A7O A;  3TK1 A;  3TNU A;  3L37 A;  3TYY A;  3KDP B;  5AVS B;  2P67 A;  2E42 A;  1OWA A;  2BAS A;  4HYT B;  3M9B A;  2WT7 A;  2N9B A;  4KHX A;  3P7K A;  3VN0 A;  4EOT A;  4LC1 A;  2Q7C A;  1HJB A;  4AUW A;  5AW8 B;  4B86 A;  2XV5 A;  2QM7 A;  5AW6 B;  3O8Z A;  3M9H A;  1HWT C;  1CSB A;  5AW0 B;  3HE4 B;  3VMY A;  2YO3 A;  2H7H A;  5APU A;  4RES B;  1CI6 B;  1JUN A;  1H8A A;  4AYC A;  3NXS A;  1YYC A;  3VMZ A;  3VMX A;  3TNU B;  5AVW B;  1FOS F;  5AW7 B;  1G2C B;  3A5T A;  4C7N A;  1CI6 A;  2WPQ A;  2ZFC A;  5APY A;  5AVX B;  2WPS A;  4GKG A;  1A02 J;  2WT7 B;  2W27 A;  1IO4 A;  5APV A;  1GTW A;  1T2K D;  2P7J A;  3A2A A;  1NAF A;  3HTK A;  4I2L C;  3MD0 A;  2Q3I A;  3T97 A;  4JYB A;  5AVT B;  5APS A;  1HBW A;  2WWW A;  5AW1 B;  1DH3 A;  1SP4 A;  2WTY A;  4JYC A;  3VTP C;  1MUU A;  1MFZ A;  4C7N B;  1KQL A;  5AVV B;  1JNM A;  1CZQ A;  2QM8 A;  5AW3 B;  3VYI A;  3L35 A;  4C46 A;  2ZXE B;  3M06 A;  4XE5 B;  2R3C A;  1X8Y A;  3M0D A;  3I5C A;  5APX A;  1T2K C;  5AVQ B;  2Z5I A;  5APT A;  1GU4 A;  1OXZ A;  3B8E B;  2WPR A;  2C9L Y;  2KP8 A;  2YNY A;  2IPP A;  2C9N Y;  3P32 A;  1GU5 A;  5APW A;  2P2U A;  3M91 A;  1MV8 A;  4AQR D;  5AW4 B;  2Q5U A;  1GK4 A;  4I6M C;  5AVU B;  5AW9 B;  3V4W A;  5CMZ A;  4DZO A;  1H89 A;  2W6A A; 
#chains in the Genus database with same CATH topology
 3E1I A;  2E75 B;  1KIL B;  3NFQ A;  3LIE A;  1N7S D;  4EYY Q;  1AQT A;  4XFJ A;  2N9Y B;  1VQ4 P;  1KYO H;  3CCM P;  3SFD C;  3H25 A;  1LTG C;  1BSN A;  3QWO C;  2ZYG A;  5AVS B;  2JDI H;  5KLI C;  2POH A;  4WY4 C;  1H0T B;  2H7H A;  1KMI Z;  3MUD C;  4IOI H;  1VQ6 P;  1LWU C;  3VMX A;  2N1T C;  3TNU B;  1HGV A;  1S5L E;  2WPQ A;  4ZNC A;  1YI2 P;  3KYQ A;  3CXH H;  4PD4 D;  3AEA C;  4HKZ H;  3T97 A;  2HPC A;  4JYB A;  3CL3 D;  2HOD A;  1DIP A;  3JC2 2;  1PPJ E;  3CWB G;  1R8E A;  4N6J A;  2QIW A;  3H1I J;  3PJS K;  5KAI E;  2YIU C;  3IAO A;  4LLH A;  1KIL A;  2WIT A;  3V6I A;  2C9L Y;  2WQY C;  4PV1 C;  5GTI E;  1ZOY C;  5AW4 B;  3RK2 D;  2Q5U A;  3H1I E;  1YTZ T;  2YO2 A;  4WY4 B;  1SQX J;  1KIL E;  1PGQ A;  1NTZ G;  1AFO A;  1NTZ D;  1UII A;  2KSE A;  2WSC J;  3RL0 C;  2N1T B;  2HG5 D;  3LID A;  1RE3 A;  3UIA A;  3TDK A;  1P84 D;  1GL2 A;  5CJ0 A;  1AVO A;  4Y99 C;  2Q6Q A;  1BCC G;  3P8M C;  1SQX E;  3TNU A;  1JO5 A;  3BRV B;  1ZR4 A;  1L0L J;  3MHV A;  1JY3 P;  4HYT B;  2QJY C;  2P58 A;  3C8V A;  3M9H A;  2W83 C;  2IZ0 A;  4AYC A;  3OW2 O;  2ZYD A;  2JWD A;  1E79 H;  1PPJ D;  5TIS H;  3H1K G;  4OVN F;  1L0L E;  3H1K D;  1GTW A;  3AEF C;  3CC2 P;  2D2C C;  1DD4 A;  3CCJ P;  1OFC X;  1SQX K;  2IBZ G;  3HD7 B;  2IBZ D;  3H6P A;  4PJ0 H;  4XE5 B;  3HUS A;  2KYV A;  3M0D A;  3I55 P;  2YKO A;  1QX8 A;  4UB6 H;  4Y99 B;  1RE4 A;  1W2E A;  2E75 D;  1KIL D;  1PGJ A;  1LTS C;  1L0L K;  4PD4 I;  4I6M C;  5AW9 B;  5AVU B;  2R44 A;  2NZ2 A;  1D7M A;  3GMA A;  1J1E B;  1SFC A;  3E1R A;  3LW5 H;  3V2P A;  1FZC A;  1YIJ P;  5KJ7 C;  1FE6 A;  4N78 D;  3SFE C;  2ZT9 B;  1NO4 A;  1DD3 A;  2O01 J;  1K9M Q;  2WSF J;  3FGA D;  4BRY A;  3O8Z A;  4IL6 H;  3A0B E;  4QMA A;  1JEK A;  2I1J A;  2OYH C;  1CI6 B;  2KB7 P;  3NXS A;  3HD7 A;  1P84 I;  5CCG A;  3U1A A;  4RKU J;  1S5L X;  4I2L C;  1M1J A;  2G8Y A;  3H1L G;  2WMM A;  4BWN A;  3G6E P;  1TU3 F;  2BEZ F;  3M06 A;  3SWK A;  3VP9 A;  3USS A;  1Y47 A;  4WBA A;  1VL2 A;  5KLV J;  1VQ9 P;  2YNY A;  3H32 B;  1EC5 A;  1NKN A;  3AE5 C;  1KOR A;  4L73 A;  1YTZ I;  2IYP A;  1KYO E;  2RMZ A;  3TF5 A;  3IN6 A;  3MTU E;  2IBZ I;  5KLV E;  1NU1 K;  3B4S A;  2C0X A;  2E76 B;  1S4X A;  1N73 A;  5B5E E;  1SFC D;  1LNQ A;  3SWF A;  2R5D A;  3GF3 A;  3O6Q B;  4WVZ A;  1JY3 N;  1KN7 A;  2E5T A;  1RF0 A;  4HJG H;  2FFD C;  4HH2 A;  1OWA A;  4H13 B;  3PP5 A;  2BCC G;  4W7Z A;  2Q7C A;  2M3E A;  2E74 D;  1CSB A;  5KLV K;  1LTI C;  3GG2 A;  2MJZ A;  4MN4 C;  3WU2 H;  1NU1 G;  1NU1 D;  3HD7 D;  3W68 A;  2WPS A;  2IX7 C;  1A02 J;  4I1L A;  2W27 A;  2FXM A;  2KUB A;  5CCG D;  1IFP A;  3L71 J;  1JCD A;  5BU8 B;  1JOC A;  3L74 J;  3CPW O;  3FWL A;  3OJA B;  1KYO D;  3L71 E;  1OX3 A;  4TLF A;  3N7N A;  1FDM A;  1QLE D;  2AEJ A;  1L4A C;  4DZO A;  2IZ1 A;  3KQG A;  3H1J J;  1ZN5 A;  3L74 E;  5H2F H;  5DJU B;  1GW4 A;  1Q81 Q;  2ZT9 D;  1JM0 A;  1OW7 A;  3AE6 C;  1IK7 A;  3H1J E;  1OW8 A;  2M0B A;  1N2D C;  3A7O A;  3TYY A;  1S72 P;  2E42 A;  1VPC A;  2HYN A;  1U57 A;  3WUV A;  2BEQ D;  3KXD A;  3CCQ P;  3Q1M A;  4H0L D;  1NH4 A;  1RF1 C;  1M90 Q;  4PJ0 E;  1IJD B;  3CC7 P;  1ZLL A;  1G2C A;  1URQ B;  1LTB C;  3IFM A;  1L4A B;  3D71 A;  2CPB A;  1KQL A;  3L75 G;  4RO0 A;  3L75 D;  3TGU G;  5CCH C;  3TGU D;  1BGY G;  1BGY D;  4DJG A;  2OTK E;  1T2K C;  5AVQ B;  2IFN A;  1SQB G;  3CWB J;  3L74 G;  1SQB D;  3L74 D;  1EZV G;  2KOG A;  4KT0 J;  3EWK A;  2OYI C;  1GU5 A;  2I1K A;  2PAJ A;  2E76 D;  4GOD A;  4PD4 E;  1FJK A;  2A06 E;  1YQ3 C;  3CWB E;  5KAF E;  5AVY B;  1RF1 B;  1HTL C;  1JB0 J;  2RKL A;  1KTM A;  3CME P;  4H13 D;  1KYO I;  3P8C D;  1S3J A;  1NTZ J;  3L36 A;  1QEX A;  1DEB A;  2H43 A;  4OGQ B;  3ZDM A;  1URQ A;  3GLM A;  1K05 A;  2CK3 H;  1BCC J;  1NTZ E;  5AVW B;  2FYU G;  2QSI A;  2CPS A;  2XKM A;  4GKG A;  3U1C A;  1AQ5 A;  1P84 E;  1PV3 A;  2IFM A;  4L74 A;  3CXH I;  3R2P A;  3AEB C;  4WWI A;  1X9V A;  5E79 H;  1BCC E;  1OVV A;  1FZE A;  1OVR A;  4NPE A;  5AVV B;  3GHG B;  3AE1 C;  2ZVO B;  3H1K J;  3Q3D A;  1Q82 Q;  2W6J H;  1XTC C;  3RK3 B;  2WZ7 A;  4IFM A;  3FWN A;  1SQP G;  2WPR A;  1NTZ K;  1SQP D;  4LGD E;  2A06 G;  1NYH A;  2A06 D;  3CWB D;  1DEE G;  3MZW B;  1X0T A;  3H1K E;  2R3S A;  3AEG C;  1SLQ A;  3E7K A;  3OA7 A;  1AA0 A;  1VQN P;  3TSI A;  1OZH A;  2QRX A;  2IBZ E;  3B71 A;  1G1I A;  1K04 A;  1BDD A;  2OGU A;  1JMB A;  1FZC C;  1ZXG A;  1EZV I;  1YJ9 P;  5KLI B;  1OVU A;  1Z56 A;  2WSE H;  1PIX A;  1FC2 C;  1LWU B;  4B86 A;  1HWT C;  3VMY A;  2QJP C;  2V4H A;  1URQ D;  3D70 A;  1JUN A;  1IFI A;  1H0T A;  2J5U A;  1L4A D;  5GTH H;  2KS1 B;  3GHG A;  1KC8 Q;  1YHQ P;  4C7R A;  1BCC D;  5APY A;  5AVX B;  4W80 A;  3PHL A;  2YKP A;  3EQ2 A;  2GUV A;  3V2R A;  1VQP P;  1HBW A;  1QGK B;  3AEE C;  3BAT A;  4N78 E;  2YIU B;  2YMY A;  1CZQ A;  2QM8 A;  3KZI E;  5AW3 B;  3BCC G;  4NPD A;  3BCC D;  3PH0 A;  1BSH A;  1ZP0 C;  3CD6 P;  2ITA A;  1LTA C;  1VQ5 P;  2Z5I A;  5H2F E;  4PV1 B;  2M5A B;  1OXZ A;  3H1L J;  1LT9 C;  1VF5 C;  1S2E A;  1E5W A;  3RGU A;  2WPV B;  2E43 A;  4H44 C;  2B87 B;  4YTP C;  3RL0 B;  5APQ A;  3F5H A;  1RHZ B;  2P1J A;  4WY4 A;  3B5N C;  3H1L E;  1LP1 B;  3MUD A;  1LWU A;  2N1T A;  1M7L A;  1NTK G;  4OGQ D;  1NTK D;  2RH0 A;  2OQQ A;  2KXP B;  2QJY B;  5CCH D;  2NPS C;  3TK1 A;  4RJT A;  1QVF O;  2XDJ A;  1EDJ A;  2BAS A;  3M9B A;  4K3A A;  2QM7 A;  3II6 A;  1M1K Q;  1KFM A;  2I8D A;  1ZRT E;  3G4S P;  1FOS F;  2D2C B;  2BCC J;  2O01 N;  1VF5 B;  1AV1 A;  1S1C X;  4U3F G;  1W5C E;  3F89 A;  1JTH B;  5AVT B;  3RK3 D;  4UB8 H;  3S1K A;  1SP4 A;  4R4M A;  1NU1 J;  3PRJ A;  1JNM A;  4N3Y B;  4C7N B;  4JBZ A;  1QVG O;  3KHU A;  1NJI Q;  2K1A A;  2BCC E;  2KI7 B;  1GMJ A;  5KTB A;  2B87 A;  4IFF A;  3U59 A;  5APT A;  1GU4 A;  1LTJ C;  3L4F A;  1KD1 Q;  2KLV A;  2IPP A;  2QG4 A;  3N4X A;  1CW5 A;  2NPS B;  4YXD C;  1LP1 A;  1NU1 E;  2K37 A;  2QVA A;  3H1L D;  5CMZ A;  1T6A A;  3MGN A;  3OAK A;  3FXD A;  2Z5H A;  1USE A;  1GZL A;  2IYO A;  1EDI A;  3Q2Y A;  1KB9 I;  4WY4 D;  1Q90 D;  2JWA A;  3CLQ A;  3H1H G;  4K35 A;  3SSU A;  2VRS A;  1VQL P;  3H1H D;  1OIP A;  2N1T D;  5AVZ B;  1ZRT D;  3L37 A;  3KDP B;  1N7S C;  2OYH B;  2N9B A;  1L0N J;  1KB9 H;  5AW0 B;  3HE4 B;  2NRG A;  1JTH A;  1PL5 A;  3BVH A;  3S9O A;  2LXC B;  1NTM G;  4GIF A;  1LTJ B;  1NTM D;  4HB1 A;  1CI6 A;  4C7N A;  3MP7 B;  2FKW B;  1PP9 G;  1NAF A;  1PP9 D;  2FYN C;  1L0N E;  2BCC D;  5M1B A;  3CXH E;  2KLU A;  1SQV K;  4JYC A;  4PV1 D;  5KAI H;  1MFZ A;  2FXP A;  3G71 P;  1M8O B;  2FBW C;  2L5G B;  2H88 C;  1J1D C;  3HTK B;  1FZG A;  1FZA A;  1HJ0 A;  2WSE J;  3L73 G;  1WRG A;  3RL0 D;  2HFE D;  3L75 J;  3L73 D;  4ZMD A;  2QEX P;  3TGU J;  5KJ7 A;  2Z4E A;  1BGY J;  3H32 A;  2P10 A;  1L0N K;  5L8R J;  1BE3 G;  1H88 A;  2C0W A;  1SQB J;  5AVR B;  1BE3 D;  4DCK A;  3CCE P;  2Y0D A;  2DW3 A;  3L75 E;  1SQV G;  3V4Q A;  1EQ7 A;  1SQV D;  2OYH A;  1S9K E;  3TGU E;  2FFD B;  2XU6 A;  1BGY E;  3RK2 C;  2JP3 A;  3HE4 A;  4DOJ A;  3NTN A;  1VDF A;  2B89 A;  2FYN B;  3O6Q A;  1SQB E;  5GTH E;  2WSC H;  1HGZ A;  4Y28 J;  1EZV E;  2ZAE B;  3MIW A;  4R4L A;  2D2C D;  2W6B A;  2XV5 A;  2IDB A;  3AE4 C;  1J1D B;  2KNC B;  1L0N G;  3PTZ A;  1L0N D;  1YYC A;  1GW3 A;  3CXH D;  1EDK A;  4IFD K;  5CHX A;  3Q5P A;  2MKV A;  1T3J A;  3HTK A;  5TIS E;  3WUU A;  1ZME C;  3P8C E;  3CC4 P;  1SQB K;  2FYU J;  2QJK C;  2WTY A;  1MKM A;  2K88 A;  1IFJ A;  1MUU A;  1JMM A;  2PRR A;  5B66 H;  4YXW H;  2AXT H;  2KP8 A;  3P32 A;  2FYU E;  2QE7 H;  3LW5 J;  5APW A;  4UB6 E;  1QL2 A;  1G1J A;  2FFD A;  5KJ7 D;  2K9Y A;  3AE3 C;  1S9K D;  1SQP J;  1PFI A;  4EDF A;  1DX7 A;  3NMD A;  5C39 A;  1KIL C;  4GOF A;  3VMA A;  1EZV D;  1NGM B;  3JSV C;  3CX5 I;  3FXE A;  2KNC A;  1YJN P;  5AW5 B;  1SQP E;  2FYU K;  3JCU H;  2J58 A;  2QJK B;  3CCL P;  4EOT A;  4ZKU A;  2XNX A;  3A0B H;  1HJB A;  2YMK A;  1YJW P;  1HVV A;  4TT3 H;  1RE3 C;  1GL2 C;  1YBK A;  4IL6 E;  3VMZ A;  1HF9 A;  3CX5 H;  1SQQ G;  2O01 H;  4JF7 A;  2PGD A;  2WSF H;  5DJT B;  3A0H H;  1HH0 A;  2HPC B;  3AED C;  2P7J A;  1JCC A;  3A2A A;  1MZ9 A;  2WVR A;  5AW1 B;  1SQP K;  1FZB A;  3VTP C;  1L4A A;  1IC2 A;  3L35 A;  4C46 A;  2JEE A;  1FS0 E;  2FYU D;  2QA4 P;  2YXQ B;  3C1L A;  2R3C A;  3ABV C;  4L76 A;  2OYI B;  2GUS A;  2E5Y A;  2LKM A;  2C9N Y;  3BCC J;  1IFD A;  3V4W A;  1JY2 O;  1H89 A;  3FX0 A;  4DT0 A;  5EFW B;  5AW2 B;  3CCU P;  3HUS C;  4GOE A;  2Q3E A;  3M0D C;  3CI9 A;  5B5E H;  4EIJ A;  1GL2 B;  4I7Z C;  1Q2N A;  3L70 G;  3V2Q A;  3L70 D;  2KZJ A;  3BCC E;  5CBO A;  2V7Q H;  1M56 D;  1RE4 C;  3L72 G;  1KB9 E;  4GT1 A;  1RF1 A;  3A3Y B;  3L72 D;  4KJM A;  3K5B A;  2Y9Y A;  3GW6 A;  1JY2 N;  1VQM P;  4D6T G;  2OAR A;  4D6T D;  3VN0 A;  3P7K A;  1SFC C;  1NTK J;  4AUW A;  2G3A A;  2YO3 A;  1WMK A;  4RES B;  3RBZ A;  1EXJ A;  3G9R A;  3BRT B;  1H8A A;  5CCH A;  2HLO A;  5AW7 B;  3WU2 E;  1KFN A;  1AJY A;  3SWY A;  3G3Z A;  2WT7 B;  1AVY A;  1NTK E;  2OYI A;  2Q3I A;  2E74 C;  2WSS H;  1DH3 A;  5K5G B;  2UWJ E;  3HUS B;  4JPZ B;  2ZXE B;  1OMI A;  3HD7 C;  4I7Z B;  4U3F J;  2RN0 A;  1R5L A;  3RL0 g;  1X8Y A;  1KV4 A;  4YPC A;  1LT1 A;  5CCG C;  1T3U A;  2GM4 A;  4GDO A;  1M1J C;  1VQO P;  4ZKP A;  1GK4 A;  4Z1M H;  4U3F E;  1NTK K;  2L91 A;  3CCS P;  1SFC B;  1KB9 D;  3RK3 E;  1GK6 A;  2YKQ A;  1FAV A;  3M0A A;  1UIX A;  2ZXX A;  1FDO A;  1KQF B;  1FZC B;  2FY8 A;  1J1E C;  1X22 A;  1N86 A;  1A02 F;  3V2N A;  1GD2 E;  3BAS A;  1PPJ G;  2K3R A;  2E74 B;  2Y9Z A;  4BRY B;  3IF4 A;  2QJP B;  2A45 G;  1EDL A;  2WT7 A;  1XTG B;  4LC1 A;  2ZVN B;  4BXL A;  5AW8 B;  2ZT9 C;  3H1H J;  1N73 C;  1Y8A A;  1YIT P;  1LGH B;  4L75 A;  3D6Z A;  4NPF X;  1RF0 C;  1SS1 A;  1L2P A;  1NHL A;  4IL6 X;  3I56 P;  3H1I G;  3H1I D;  1M1J B;  2PFX A;  2KS1 A;  1T2K D;  3H1H E;  3Q5S A;  5APS A;  5B66 E;  2WWW A;  2AXT E;  4OH8 B;  1NTM J;  4H0L C;  2Q9I A;  1KZU B;  2B88 A;  1USD A;  1PP9 J;  1NAY A;  3QH9 A;  1LT9 B;  2ZYA A;  2M3B A;  3CCR P;  1SQX G;  4U3F D;  1SQX D;  1YQ4 C;  1U7M A;  1NTM E;  4H44 B;  2M5A A;  2FXO A;  4PD4 H;  1GL2 D;  1ZR2 A;  1SVF A;  2W6A A;  1PP9 E;  3WMM 0;  3B5N B;  2LR2 A;  3IR9 A;  5KAF H;  1N73 B;  3L73 J;  3JCU E;  3W67 A;  2H8P D;  1L0L G;  1L0L D;  2E76 C;  2XZR A;  3V5B A;  1BE3 J;  1NWQ A;  3M9Q A;  1OW6 A;  3CX5 E;  3HRN A;  2PP6 A;  2AEF A;  1NTM K;  3L73 E;  1SQV J;  4H0L B;  3A0H E;  4KHX A;  5AW6 B;  1X79 B;  5CJ4 A;  1IK9 A;  4H13 C;  2JKV A;  1BE3 E;  2JR8 A;  2OTJ P;  1IFN A;  1PGO A;  4EI2 A;  3A5T A;  1BDC A;  1EXI A;  1P84 H;  2JO1 A;  2KSJ A;  1SQV E;  3AE2 C;  1IO4 A;  1NKZ B;  3CMA P;  1LT9 A;  1JY3 O;  4CPG A;  1FBM A;  3VOP A;  1VQ8 P;  2SPZ A;  2A45 I;  5E79 E;  2V7Q J;  1S5L H;  2XND H;  3VYI A;  1ZW0 A;  1T8Z A;  4JQ0 D;  3B5N A;  5APX A;  1MFT A;  1RQV A;  2KIK A;  3AEC C;  2LXB A;  2B9B A;  1N8R Q;  3AE7 C;  2A45 H;  2FYZ A;  2NPS A;  1FJP A;  1NOH A;  2HR3 A;  4ASW A;  2R5B A;  1Q7Y Q;  2JJL A;  3Q5R A;  1LJ2 A;  1J2J B;  3CX5 D;  5CBN A;  5GTI H;  2OTL P;  1PZQ A;  4OWF A;  2O1J A;  5BU5 A;  1FU1 A;  2W8Z A;  3HE5 B;  2KK7 A;  3C9I A;  1N7S B;  2P67 A;  1NVO A;  3VP8 A;  1LTT C;  2K9J B;  1G2C B;  1K73 Q;  1LTJ A;  3ITK A;  1RQU A;  3RBX A;  4O9B A;  1K8A Q;  5KLV G;  1WT6 A;  5KLV D;  1URQ C;  1VF5 D;  3KZI H;  1SQQ J;  1JY2 P;  1N7L A;  3D6Y A;  5KKZ C;  2O3J A;  1GDT A;  2OYO A;  2YXR B;  4H44 D;  2W90 A;  3EFG A;  2M8R A;  4XA4 A;  1IFM A;  1RY3 A;  3GF7 A;  5BVZ A;  3B5N D;  2H89 C;  1QL1 A;  1SQQ E;  3M91 A;  4AQR D;  4WB4 A;  2O1K A;  1HUC A;  4M3L A;  1PGP A;  1VQK P;  3HE5 A;  2ZJS E;  2NPS D;  1N7S A;  1U7J A;  1FOS E;  2R32 A;  3RK2 B;  3PLN A;  2Y0C A;  1W2B O;  2K9J A;  4ASV A;  3KPE A;  1SQQ K;  3L70 J;  1FDI A;  1M57 D;  1IZN B;  3L72 J;  5KKZ B;  4U7J A;  3AE9 C;  2E75 C;  5TJH A;  5APU A;  4OGQ C;  3L71 G;  3L71 D;  4A7P A;  2GA1 A;  3S4R A;  2ZFC A;  4D6T J;  3L70 E;  5APV A;  1R5S A;  3L72 E;  2AXC A;  1KQS O;  3MD0 A;  1Y9B A;  3R4Y A;  1RH5 B;  1VQ7 P;  2Q1K A;  1ZV8 A;  4UB8 E;  3WUT A;  3AE8 C;  4D6T E;  1KQG B;  1SQQ D;  1FZF A;  3GHG C;  3I5C A;  2J59 M;  3T97 B;  3H1J G;  2Y0E A;  2HOD B;  3H1J D;  3B8E B;  2KZI A;  3RK3 C;  1Q86 Q;  4W7Y A;  2P2U A;  1MV8 A;  3EFF K;  2AEM A;  3CCV P; 
#chains in the Genus database with same CATH homology
 3KQG A;  1NTK K;  3MGN A;  3E1I A;  1ZN5 A;  1SFC B;  3OAK A;  2Z5H A;  1KIL B;  3NFQ A;  1GK6 A;  2YKQ A;  1GZL A;  3LIE A;  1GW4 A;  1FAV A;  1N7S D;  3M0A A;  1FZC B;  4WY4 D;  1J1E C;  3CLQ A;  1N86 A;  1A02 F;  3V2N A;  2VRS A;  1GD2 E;  3BAS A;  2N1T D;  1LTG C;  5AVZ B;  3A7O A;  1N2D C;  3L37 A;  3TYY A;  3KDP B;  5AVS B;  2E42 A;  1VPC A;  2HYN A;  2A45 G;  1N7S C;  2WT7 A;  2OYH B;  1XTG B;  2N9B A;  2POH A;  4LC1 A;  4WY4 C;  5AW8 B;  1N73 C;  5AW0 B;  3HE4 B;  2H7H A;  1LGH B;  1JTH A;  1LWU C;  3BVH A;  1NH4 A;  3VMX A;  1RF1 C;  2N1T C;  3TNU B;  4GIF A;  1LTJ B;  1IJD B;  1HGV A;  4C7N A;  1CI6 A;  2WPQ A;  1RF0 C;  1NHL A;  1ZLL A;  1G2C A;  1M1J B;  1URQ B;  2FKW B;  1LTB C;  3KYQ A;  3IFM A;  1T2K D;  1NAF A;  3T97 A;  2HPC A;  4JYB A;  1L4A B;  3CL3 D;  5APS A;  2HOD A;  2WWW A;  4OH8 B;  1SQV K;  2CPB A;  4JYC A;  2Q9I A;  1KZU B;  4N6J A;  1MFZ A;  1KQL A;  5CCH C;  2L5G B;  1J1D C;  3HTK B;  1LT9 B;  1FZG A;  1T2K C;  5AVQ B;  4LLH A;  2IFN A;  2M3B A;  1KIL A;  2WIT A;  1FZA A;  2C9L Y;  1WRG A;  2KOG A;  3RL0 D;  2HFE D;  2OYI C;  1GU5 A;  2I1K A;  5KJ7 A;  2Z4E A;  2PAJ A;  5AW4 B;  3H32 A;  3RK2 D;  2Q5U A;  1GL2 D;  1ZR2 A;  1SVF A;  2W6A A;  1YTZ T;  1L0N K;  3WMM 0;  3B5N B;  2YO2 A;  3IR9 A;  1FJK A;  4WY4 B;  2C0W A;  1H88 A;  5AVR B;  1N73 B;  1AFO A;  2H8P D;  5AVY B;  3RL0 C;  1RF1 B;  2N1T B;  2HG5 D;  1HTL C;  3V4Q A;  1EQ7 A;  3LID A;  1RE3 A;  2OYH A;  1S9K E;  3UIA A;  1GL2 A;  2FFD B;  2XU6 A;  5CJ0 A;  2XZR A;  3RK2 C;  3V5B A;  3HE4 A;  3P8C D;  4DOJ A;  1NWQ A;  3NTN A;  4Y99 C;  1VDF A;  3M9Q A;  3L36 A;  3P8M C;  3HRN A;  3TNU A;  2PP6 A;  2WSC H;  1DEB A;  1HGZ A;  1NTM K;  1JO5 A;  3BRV B;  1ZR4 A;  1JY3 P;  4HYT B;  2H43 A;  4KHX A;  3MIW A;  1URQ A;  2W6B A;  2XV5 A;  5AW6 B;  3M9H A;  1X79 B;  5CJ4 A;  1IK9 A;  1J1D B;  4AYC A;  1IFN A;  1YYC A;  5AVW B;  1GW3 A;  3A5T A;  2CPS A;  2XKM A;  4IFD K;  4GKG A;  2KSJ A;  5CHX A;  3U1C A;  1IO4 A;  1NKZ B;  1AQ5 A;  2IFM A;  1GTW A;  1T3J A;  3HTK A;  1LT9 A;  3P8C E;  3R2P A;  1JY3 O;  1FBM A;  1X9V A;  1SQB K;  1SQX K;  1FZE A;  3HD7 B;  3VOP A;  2WTY A;  1IFJ A;  2A45 I;  1MUU A;  3H6P A;  5AVV B;  3GHG B;  1JMM A;  3VYI A;  1T8Z A;  4XE5 B;  1XTC C;  3HUS A;  2KYV A;  3M0D A;  3RK3 B;  3B5N A;  5APX A;  2WZ7 A;  2YKO A;  4IFM A;  2WPR A;  1NTZ K;  4Y99 B;  2KP8 A;  4LGD E;  1RE4 A;  1W2E A;  3P32 A;  1KIL D;  5APW A;  1LTS C;  1QL2 A;  1L0L K;  1G1J A;  2A45 H;  4I6M C;  5AW9 B;  5AVU B;  2FYZ A;  2FFD A;  2NPS A;  5KJ7 D;  1FJP A;  1NOH A;  1SLQ A;  1S9K D;  3OA7 A;  3TSI A;  2R5B A;  1PFI A;  1J1E B;  2JJL A;  1DX7 A;  3NMD A;  1SFC A;  1J2J B;  3LW5 H;  1KIL C;  3V2P A;  1G1I A;  2O1J A;  5BU5 A;  1FZC A;  1FU1 A;  5KJ7 C;  1FZC C;  3HE5 B;  3C9I A;  1N7S B;  4N78 D;  5AW5 B;  1Z56 A;  2FYU K;  2J58 A;  2P67 A;  1NO4 A;  2WSE H;  4EOT A;  4ZKU A;  1LWU B;  2XNX A;  1HJB A;  4B86 A;  3O8Z A;  1HWT C;  1HVV A;  3VMY A;  3VP8 A;  1URQ D;  1LTT C;  1RE3 C;  2I1J A;  2OYH C;  1CI6 B;  2KB7 P;  1JUN A;  1IFI A;  1GL2 C;  3NXS A;  3VMZ A;  3HD7 A;  1L4A D;  1G2C B;  2O01 H;  4JF7 A;  3GHG A;  4C7R A;  5CCG A;  5APY A;  5AVX B;  2WSF H;  4W80 A;  1HH0 A;  3U1A A;  1LTJ A;  2HPC B;  2YKP A;  2P7J A;  1JCC A;  3A2A A;  3EQ2 A;  2GUV A;  1MZ9 A;  4I2L C;  4O9B A;  1M1J A;  3V2R A;  1WT6 A;  1HBW A;  1URQ C;  5AW1 B;  3BAT A;  1SQP K;  4N78 E;  1FZB A;  1JY2 P;  3VTP C;  1N7L A;  1L4A A;  2YMY A;  1CZQ A;  2QM8 A;  5AW3 B;  1GDT A;  1IC2 A;  3L35 A;  4C46 A;  3M06 A;  3VP9 A;  2JEE A;  3EFG A;  2M8R A;  2R3C A;  4XA4 A;  4WBA A;  1IFM A;  1RY3 A;  5BVZ A;  2OYI B;  2GUS A;  1LTA C;  2LKM A;  2Z5I A;  1OXZ A;  3B5N D;  2YNY A;  2C9N Y;  3H32 B;  1LT9 C;  1QL1 A;  1NKN A;  3M91 A;  1YTZ I;  1IFD A;  4AQR D;  1E5W A;  4WB4 A;  3V4W A;  2O1K A;  1JY2 O;  1H89 A;  2E43 A;  1HUC A;  4M3L A;  3MTU E;  3HE5 A;  3RL0 B;  2NPS D;  1N7S A;  5APQ A;  5AW2 B;  1NU1 K;  3HUS C;  1FOS E;  2R32 A;  3M0D C;  2P1J A;  3CI9 A;  4WY4 A;  2C0X A;  3RK2 B;  3B5N C;  4EIJ A;  1GL2 B;  1N73 A;  3V2Q A;  1SFC D;  3MUD A;  3SWF A;  1LWU A;  1RE4 C;  4GT1 A;  1RF1 A;  2N1T A;  3A3Y B;  1M7L A;  2R5D A;  1JY3 N;  1RF0 A;  2FFD C;  5CCH D;  2NPS C;  3TK1 A;  1JY2 N;  3KPE A;  1SQQ K;  4HH2 A;  2XDJ A;  1OWA A;  3PP5 A;  2BAS A;  4W7Z A;  2OAR A;  3M9B A;  3VN0 A;  3P7K A;  2Q7C A;  1SFC C;  4AUW A;  2QM7 A;  3II6 A;  1CSB A;  1KFM A;  2YO3 A;  5APU A;  4RES B;  5KLV K;  1LTI C;  2MJZ A;  3BRT B;  1H8A A;  5CCH A;  1FOS F;  2HLO A;  5AW7 B;  1KFN A;  2ZFC A;  3HD7 D;  2WPS A;  3SWY A;  2IX7 C;  3G3Z A;  4I1L A;  2WT7 B;  1A02 J;  2W27 A;  5APV A;  2FXM A;  5CCG D;  2OYI A;  3MD0 A;  2Q3I A;  5AVT B;  1JTH B;  3RK3 D;  1JCD A;  1DH3 A;  1SP4 A;  1ZV8 A;  1JNM A;  4N3Y B;  4C7N B;  3HUS B;  5BU8 B;  1JOC A;  2ZXE B;  3HD7 C;  1FZF A;  1X8Y A;  5KTB A;  3GHG C;  4IFF A;  3I5C A;  2J59 M;  5CCG C;  3U59 A;  3OJA B;  5APT A;  1GU4 A;  2HOD B;  1LTJ C;  3B8E B;  3L4F A;  1T3U A;  2KLV A;  2IPP A;  3RK3 C;  4W7Y A;  2GM4 A;  3N4X A;  1CW5 A;  2NPS B;  1M1J C;  2P2U A;  1MV8 A;  3N7N A;  1FDM A;  4ZKP A;  1GK4 A;  5CMZ A;  1L4A C;  4DZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...