1HJCA

Crystal structure of runx-1/aml1/cbfalpha runt domain bound to a dna fragment from the csf-1r promoter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title Structural Analyses of DNA Recognition by the Aml1/Runx-1 Runt Domain and its Allosteric Control by Cbfbeta
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hjcA00
3Q05A 4IBSA 3VD1A 2ADYA 3EXJA 1EANA 2J1WA 4AGNA 5ECGA 4XR8C 2ATAA 4MZRA 3WTUA 1GZHA 3KZ8A 4L0ZA 5AOIA 4LO9A 1HJBC 4IBZA 2AHIA 2BIPA 1HJCA 4IBUA 1H9DA 1CO1A 3IGLA 1LJMA 2J1YA 5G4NA 3WTSA 2J6WA 2XWRA 1IO4C 5AOKA 3WTVA 1GZHC 4IBTA 4AGLA 3WU1A 5ABAA 4L0YA 5AOMA 4AGOA 2GEQA 2J20A 2BIQA 2PCXA 2FEJA 5AOLA 3D09A 2WGXA 4IJTA 3TS8A 5G4MA 3Q01A 4QO1B 2VUKA 3WTWA 4G82A 2AC0A 4IBYA 2MEJB 4LOEA 2BINA 2XWCA 2X0UA 5BUAA 3WTYA 1KZYA 4MZIA 2BIMA 1E50A 3US0A 2IOMA 3QYMA 3WTTA 4GUQA 3D05A 2H1LM 4IBQA 4AGMA 4G83A 3VD2A 3US1A 4AGPA 5G4OA 1HU8A 3VD0A 4LOFA 4IBWA 5KBDA 3Q06A 1TUPA 3IGKA 1CMOA 3D0AA 2P52A 1EAOA 2RMNA 2IOOA 1UOLA 5AB9A 3D07A 5A7BA 3QYNA 5LAPA 4AGQA 3WTXA 5LGYA 2OCJA 2BIOA 4IBVA 1T4WA 3ZMEA 4L18A 3KMDA 1TSRA 2X0VA 2J21A 1EAQA 4HJEA 2X0WA 2J1XA 3D08A 4KVPA 5AOJA 4A63A 3EXLA 3D06A 2J1ZA 2YBGA 1YCSA 4GUOA 2IOIA
chains in the Genus database with same CATH superfamily
3MOBL 4O5LL 2F53D 4G1MB 1MHHA 3ABMB 1NGPL 2YEQA 3TN0C 3IXAB 4F2MA 1VLXA 2JQMA 1WT5A 1YEIH 1RXLA 1INEL 2FYVA 5D1XC 3CN0A 3D4GA 3P11H 4IOIB 4M5TA 4UM9A 4W68A 3PNWB 4YQXL 3IRZA 3CHXA 5EZIH 3F12B 4XAKD 2HA1A 3O3UN 1GKEA 4J3WA 1G6RB 4U1NB 4AW7A 1KJ2A 2QFRA 5LXGH 4P4KB 4DAGL 4UTCA 4TQPA 1UT1A 2E7HA 3OKEA 5F71A 1P53A 3TV3L 1R17A 2WNXA 1CFSB 2Q20A 1O0VA 4NPYA 4JFFD 4PEEA 1WLHA 4MQXD 5T3ZD 4MJIB 1N8ZA 4XMTA 1JHTB 1LO2H 1MQ8A 2ZF9A 3ARED 3QRGH 1KWGA 4O02H 4QTFA 2OYMA 1OY3B 1TFPA 4GRWB 4ZT1A 4EDWH 2YQ3A 1RJYB 5DJXB 1DQLH 3WUWB 3CXDH 4IMKA 4XI5C 4AEFA 5TK2A 4Z76A 3W5NA 3MGTB 4UDUA 2YMOA 5D7JC 5DJ2A 4K2UL 3AG4B 3HR5A 3H54A 2X0UA 4LHUA 1YECH 5BRZB 2BIMA 3G3LA 4QAMB 2X2UA 4YSDA 9CGTA 1N2RB 4JFSA 5I76B 4W93A 5CCKL 5HTSA 1A1NA 3CHOA 1IE5A 2QPSA 4OQ1A 5FM5O 4UB0H 1Y0LA 2P5WE 3K8KA 5E6IA 3VXUD 2CDGB 1O9WA 5CJOH 5DEFB 2HT2C 2N4IA 4I18A 5K1JA 4X8GA 2X05A 3RVVD 4Y1AD 3EJZD 3GRWH 4HWEH 2G5BB 1P7QD 4I1PA 3S3CB 1UXMA 2PO6C 3FRPG 4RDQF 1XGYH 3Q6GL 5A40E 3C60C 3MKKA 2HRPH 1ETA1 5I73C 1SXSA 2VXQL 3L3IA 2CBTA 1ZV5A 2OTWA 4DUVA 2DTSA 3B2PA 1S2EA 2PWGA 3O9WC 1M6OB 1G1YA 3Q2CA 4GRMB 4LESA 4U1SB 3PF2A 4YDIL 2FSDA 3BRGC 4G71B 4D9LL 2OMZA 1CFBA 5JOEA 2X0VA 1BXXA 4QMEA 4A2LA 1R3HB 3UC2A 5ESQA 4CU8A 4Y5VA 2R59A 5SWSE 4FTVB 1KIUB 1E30A 3GK8H 4P5KB 3TT1H 3MRDA 5I1KH 4XNUL 1NCGA 5AW4B 1SBSL 2FX8L 1PD6A 2ZOTA 2GUYA 5KVDH 3Q48A 5A6LA 1FFPB 3ULVL 3F84A 3BIAX 4ZNEA 1CDYA 2QSTA 1VFMA 1KPUA 1GZHA 2DJMA 2AQSA 5L0QC 1H5BC 4PPTA 1PYWB 2WQUA 2AEOA 3BSZL 3LRGA 4LU5H 5ERWB 5INCA 5LUMA 3BVNB 3JXAA 1UWGH 1ZT1B 1CICA 4WSGA 4AYMC 5LGHL 3UPCA 3H56A 1UCBL 4NJAL 4ZMQA 4MA1B 4QYOB 2CIKB 4UM8A 4JQIA 3KDMB 1ZHBA 3T3ME 4OD3L 4CSTA 4H8PA 3QFDB 2NYKA 4HH9A 5A3IC 4KV5E 5AVSB 4KFZC 4P23A 5J1AA 1CLOH 2CRIA 4AYEC 1A9BA 4C8XA 1EEYA 1LO0L 3QXVA 2P5EE 4Y1TA 3FXIC 3A4EA 1E27B 3RP1A 4H1LB 4XCCH 3EOBB 1W72H 35C8H 4NT6A 5DC2A 5EFIB 4QCIA 3ME0A 5FV1L 1NC2A 3DARA 3BVUA 2VUKA 4LOVA 4ZXBD 5EIIA 2J73A 2AQNA 2C9AA 3GXFA 4M9PA 4R4BB 1QLEL 2I60H 2NCMA 4PJCA 3Q6FA 3B3IA 2OYLA 3DPBB 3VACA 3QJVB 1J18A 2NNRA 1I85C 2YPVH 4HEME 4AE1A 2XTJB 1MZYA 3J27A 3HN8A 3QIWD 4X8JB 2ITDB 3HCVB 4NM4H 3QUXB 4LSTL 1ROWA 3C09C 4R5TA 5DJZA 2DQGL 1S8DB 25C8L 1FI8C 2WIIB 1K4CB 2QQLL 4P46D 5BPPA 4UOQA 5DJ6B 4S0SD 8PAZA 2DB8A 3VFTB 4TUKH 3ZE1F 3BT2L 2X6MA 3RKDD 2HH0L 4XWOD 3KYKL 3SOTA 3HLKA 1KXVC 1OKEA 4HSAC 3LJ3A 1Z9LA 3D07A 1P6AB 2AEPL 3OMNB 3P77B 1PZSA 5ELIA 5C2UB 3MOBH 3KWWA 2IJ0C 3SDAB 5IW3A 1WYJA 1EMTL 2Y5TA 4PRHD 2BJML 3ZN6A 5A2CA 1WEJL 3MRHA 5DJ8B 2CRMA 1FL5B 3KLLA 4GUCA 1J1XL 3S5LG 1G9MH 2AVFA 1INEH 3QP3A 4OR1A 3EIFA 5I1LB 1Z3GL 4BFIB 1AGFB 3SGKA 2HSIA 2DQUH 4YQXH 5EC2B 3ILDA 3LH2L 3QNYB 3Q05A 4N4YB 3HG1A 1WGVA 1QTPA 1BZQK 1U8IA 3N50A 5IFAH 3P69A 4DAGH 3H9ZA 3JYCA 3AS1A 4XXCA 2ZIDA 4J3VA 3RUGF 5GIRA 3DX3A 5BS0A 3MJWA 4P2RE 5MENB 1QPXA 5EUOB 1T66D 3RVWC 2HJFB 2CGZA 2O5YH 3U46A 4N2LA 2NY5H 3LKOB 3BUTA 4F58H 1W16A 4RLDA 2QFPA 1Q90A 2AK1L 1NTDA 1NA8A 2XHNA 2E8YA 2Y7SA 5DC9B 3NJHA 5K69A 1IO4C 3E80A 3IE4A 4FQHA 1JZ8A 3AACA 3BD4A 3MYJA 1I1RA 4U0RB 5AB0A 3NPZB 5C09E 2NSQA 4MCNA 4PW9A 2BCKB 1QWUA 3D69B 4R90H 5JHDD 4JRYB 4XODA 4GS7B 2X9ZA 5DRWB 3ZBMA 3CFEB 2ZKHH 3UPRB 2NW2B 3QQDB 5CINH 1NBYB 5CCKH 1KT2A 2P80D 3PJSB 4NRZA 5CJQL 1CLYL 2HT3D 3REVB 3H4HA 3O3EB 4JN1L 4NQCD 2XWBA 3KPSD 1NL0H 1CIDA 5MEQA 1T6BX 1U8JA 3IDMA 3DX8B 2JLLA 2XWCA 5GGSB 1NFDE 2WTOA 2Y3NA 4MZIA 3HG0A 1P4BL 5CN1A 3MLRL 1XCXA 1SNRA 3RNKA 4HZLA 4PGDA 4WFFD 3MV9D 4ODXB 1QSED 4L3CB 1HXYA 2N1KA 3JTBA 3NRQA 3TWYA 2Q8AH 4GQ9L 4CU7A 1MCIA 2HX8A 3FCSA 3ZT7A 3G6JA 1EZVX 2VXQH 3LN4A 1NGQL 1F86A 5GGVL 1VF5C 1DLHB 1QTSA 5HDBB 2WHVA 5FC9A 1SJMA 2KLSA 4YDIH 1FZOB 2WXNA 3CC5B 3APMA 4HSQA 4XWGL 4J5VA 1HU8A 4MHHI 4ALAH 4DH2A 4DVBB 3V4VH 5CILL 5IT2L 1P84J 4YHNA 1JWUB 2VSMB 4ZUUA 4N0YH 1NAML 2X4OB 1WAAA 4DFIA 3BXNB 1DJIA 2H0FA 4MNGB 2Z93B 3MV7B 3MCLL 4K71C 4RBPK 4XO4A 4AZ8A 5JNYA 2AITA 2A73B 1KJ3L 3F65A 4WFGD 4AMKL 2FWOB 2XJLA 4XNZB 2ORBH 1OF0A 4L0PB 5LKNA 1IC1A 4UILH 5B8CC 1BOGA 2X4PA 3OHXA 1KIRA 2LAGB 2VQTA 3T6QC 2NUTA 2CKBL 5LBSA 3V4LA 3C6SB 3IU4L 1UJ3C 4WFED 5HHOA 4MXVE 4LCUA 3S5ZA 3DYOA 4HPYL 5GSVB 1WFTA 4ZUSB 2H9GA 5TDPB 3MRRA 1TCMA 4AEIL 3OWEA 4X4MA 4Z7WA 3KLAB 4OCSL 1G9NH 3CLFH 4ONFL 2HMIC 4IGBB 4QRUB 5G2NA 4OD3H 1PMYA 1JK9B 5CZXC 2DZEA 3F8UB 5JA8B 4YPJA 2FQDA 3LKQB 5B4MD 4UV4H 1RUKL 3IN0A 5I66B 1M56B 1LO0H 3T0EA 1H6TA 4AVJA 4F7PB 1RSFA 5K9JL 4YPGA 4XCFL 3PWUB 4WWNA 2YO3A 2FB4H 4KQ0A 4L48A 3HC3L 1EZSA 3IWVA 1GL4B 3IDNA 4XMWA 5IG7B 3ZHLA 4C56E 3T1FB 4GKZB 5AW1B 4FNRA 3S36H 3UZVB 3QE5A 2OPCA 3PWPB 5FS5A 1P5UA 1P9MA 1PAZA 3GSOA 4PJGA 1BD2A 1N67A 3HAEA 3LMJL 2E27L 3QH3B 3QQ4B 4B6ZA 3BIKB 4I8DA 4IS6A 5HGBB 3CFTA 1N7ML 2NTSP 1DJSA 1AY1H 2PLTA 4NGHH 3OZLA 1MWAB 2ZWYA 3D52A 2F53A 2EDFA 2QGDA 3PQYB 3W39A 2YD9A 2QQLH 3D39E 2HB0A 4F3FB 2DPKA 4LCWE 1B3JA 3SKNB 3A24A 2NZ1A 1DDTA 4A6YA 3CH1B 1I8IB 3IFNH 3W9DB 4OCNC 1FG9C 5HP5A 3GMLB 1KG0B 2E7CA 2EACA 4KJPD 3BD5A 4MXWH 4MTMA 1FYHB 4NUQA 2V5RA 4Z0XA 4EDXA 1RZ8B 3HPJA 3TBVA 2EP6A 4MA8H 5DD3H 1H6EA 4KTEL 3RA7H 4MYWB 3ESNA 2BJMH 1CZ8L 5DQJA 3P9WB 3ZQWA 1A1MB 4QGTA 3S8WA 4NUGL 3CH8A 1J1XH 2WC7A 4K8RD 4MS8C 4JFFA 2C4FU 1ZLVH 4K0OA 3OJMB 2GIMA 3QR2A 1DJWA 4N2AA 3N5AA 3DNKA 2VN4A 1IGFL 4BDVA 4HKBB 1F00I 5FHAH 3AREA 3VGHA 1ZSHA 5I18H 4HLZH 4F33B 4BZ1H 2AEIT 2WCGA 1Z9MA 3PJLA 5ESVB 1EDHA 2GT9A 3OKMB 2FQGA 3P0VL 3PHOA 1OO2A 4QO1A 4Y8AA 2DH2A 4YZFF 5DHMC 2ZXAA 5C0DA 4HIEB 3ZKQD 1AANA 4UNTA 3FO2A 3WIIH 4F15C 4R7NA 5KVEE 4N90E 3UBXB 1YZZA 1NDGA 3G5ZA 3NDYE 4MD0A 2X4RB 1XZ0B 5M95B 2Q7YB 4JFDB 3V4PL 1Q9KB 3X1GA 5JOFB 1FH2A 4UIMB 4OI9A 2AK1H 2OYPA 4TMPA 3VXUA 1U8MB 3OGCA 4JY5L 1U42A 1UXWB 3VI4F 2ICEC 3KCWA 1P7QA 2M8XA 2YBRA 1CGXA 1LEGA 4TTDC 5C6TL 4BHUI 4JQXC 1XCTB 3VG9C 4JRXB 3L3GB 4OAWB 4YEEA 5KS9A 1QWHA 4NQQA 5L2KD 5KYUA 2VC2L 4FDWA 4JEGB 3DUUB 1KXQA 2A9NL 1EX0A 3C9NB 2HJKA 4ZAKC 2E6QA 2FIRT 1CLYH 3QS2A 2F5AH 5KN5A 3MJ8A 3O8XC 3OB0H 2V9QA 2AANA 4JN1H 1SJEB 4UU9A 4HK0A 1Q1JL 3QQ9D 4RDQG 4BCXA 4F37F 5TK4A 1A7RL 3IS0X 3P9MB 1B6DA 2ZX7A 3DJ9A 3PABB 2HJLB 3OQ3B 4RAVA 3X17A 1FNLA 2XJKA 1T5KA 4XN7A 4CGUB 2P46B 3UACA 1RH8A 4E9SA 2F8IA 1BPLB 4OT1H 1WA2X 1AHWA 3CXHJ 1NGQH 2A3TA 5GGVH 2JF1A 1XIWC 5EA0H 3MZGB 4OF8A 4RIRA 4OLVH 1UGNA 2EEAA 4XWGH 3TT3H 1JGLL 4E5XA 3K2UL 5F88A 3MFFA 5CILH 2MH4A 3ZT5A 1D5RA 2Q6WB 3PHQA 4NLHA 5C71A 1XGTB 4K9EH 5GZNC 4HWBL 4DZBB 4N5EC 1I8LC 3ZYIA 3MCLH 1GIGL 1II4E 2OI9C 1EERB 2AXFA 4FQXB 1YG9A 4PRIE 3P02A 5EOCL 4AENA 2QQQA 1E4XL 3TVMC 1BVKB 3SKOB 3ZE1E 1KMGA 4YSQA 5GRVL 4D9RE 1IT9L 4K5PA 3EJPA 1RFDL 5D1ZI 1L9QA 2V5TA 1UOKA 4KNUA 2O5ZL 4EIGB 5F7HA 2Z0BA 5F7WC 1NIFA 2CKBH 2DLGA 4Z3EA 2OL3B 5E8OA 2I7OA 1T5WB 2Y69B 2DQMA 3GXPA 5EUOF 3UTSD 4GAYA 5EU4B 2WVTA 3FUKA 3IEAA 4HPYH 5J89A 2VDQL 4NNPH 4AEIH 1CFNB 5FPIA 2DQIL 4GINA 3E1F1 1JZ2A 4OCSH 4L37B 5DHVB 4ONFH 4OLWL 4BWUA 4NKQB 1U3NA 3HS0B 1J86A 1JNJA 5C0GB 3WL9A 1PPIA 5CP3H 1YEGH 2VXTH 4ZNEE 3CK0L 3TX4A 2IH3A 1S7XA 4MCYB 4J6IA 4WU7B 3RFZC 1PGRB 2BFVH 3FONB 3RIFF 1YJDC 2YUVA 1P4UA 3QIWA 4IJ3B 5T3XD 4XNAA 1WAPA 5I8EB 1B4TA 2B1AL 3HC3H 4E9WA 2W80C 1MG2C 4Z7NE 4MZRA 3DVFA 4P46A 1NCCL 2JQAA 2IH1A 1L9MA 4OD2B 3G6AA 3NJLA 3L1FA 4MA7L 4F57H 1XB6A 5IMLA 2X70B 4F2FA 5TE4L 2MRYA 4Y8DC 4Y4KB 5FW8A 4XVSL 4FG6C 3LMJH 4EUPH 3OL2A 2J6EH 2QJDA 2V4LA 1NUDA 5EU5A 1N7MH 4OB5H 3UH8A 4Q97A 3SIKA 4UI2A 2LFGA 2FNBA 1L9SA 3CCHA 1ZLDA 5CBAB 3STZA 2AGJL 2YEZA 4LHJB 5HDBF 2YGNA 4PRHA 2DBJA 4NEHB 3O4OC 1MF2H 3EJJX 2AXGA 4A38A 4K3JL 1R5VB 4Q8BA 3VFWB 1ED3A 1UD6A 2PF6A 3LZPA 3MV01 3ZDXE 2IQAA 4RGNE 3HE6D 2V8MA 2CGYA 3HFFA 2R4SL 2ZF8A 1M53A 5DK2A 1JYWA 4YL9A 1BFOB 4N2GA 1LDPH 4FMKA 3LNEA 4OZFB 2VDOB 3BZ4A 4URTB 1OP5H 1LWRA 4B3EA 1NIBA 4S1DC 3LDBC 3LIZA 4O2CB 2J2ZB 3TTSA 1DVFD 2WP3O 3NCJL 4AT6A 3DBSA 1LYQA 1AQKH 3NJIA 4L4VB 3L7EB 5KSUB 2HG5B 3KJ4C 2M26A 4FFYA 5B8CB 2CR0A 2YK1H 3H0TA 5FKPB 3FB6A 1Z9NA 1HSAB 3LZFL 4FOMA 2KT6A 4AC2A 3HUJB 4ODTL 1CG9B 1UJ3B 4FMVA 1YMMB 3CIAA 3BKCL 5CZKA 3GTTA 4NQDB 1RZIA 2DQTL 3P0VH 4ERSL 3K6NA 4YHZH 5D71L 5E6UB 3BO8A 3DX7B 1J9RA 3LD8B 3BWAB 3I6LE 1HINL 2BHYA 3DK2A 1JCVA 5D7LD 5I8OL 1HEZA 5F0LB 2JH2A 1WFUA 5FOBA 5JHDA 3GSNB 4NN5C 1T7VA 5EC1A 2BK8A 4AQOA 2K6YA 4POUB 4OY9A 1QW8A 5HI3D 1Q9OA 3TF4A 5EU7E 1KCUH 2P80A 2HRLA 4H26B 4HA1A 3VGDA 2H32H 4NQCA 4B0MM 3BPCA 2ZUVA 3KPSA 4FQCL 1RPUA 1H8SA 4MJIE 3T08A 1FF5A 4ZQTA 5D7IB 4J3TA 4GRWE 5HBBA 4PLJD 3V5DB 2B9BA 5LN8A 3RY5A 1TO4A 3MV9A 2TSAA 1QSEA 2F19L 2PWHA 3BH8A 2WNWA 1EEZB 1FQ9C 1UOVA 3PDOA 5IB5B 1CGWA 3H3KA 1AQ8A 1CT8A 1BM3L 3VB9A 1U3YA 1MJ7L 5BRZE 4XR8C 1PG7X 3VMNA 3Q8AA 1A64A 3M7OA 3O4LB 3NH7L 4PRNB 1HDMB 1CU4L 3IGFA 3QA3A 1EAPB 5GGUB 4NKDA 3GSRA 1IJ9A 1YQ2A 1QWNA 3UC0L 4KJWD 1OTTD 1SEQL 4RWYH 5FO9A 3LZOA 4BFEA 3I84A 1NDMA 3NCEB 4NQED 2IAMB 3KPNA 1H9DA 1DVZA 4G7YL 4NO2A 1KTDA 4LRIA 5T5NF 5AD0B 1F4YL 5FYJH 4UT6L 2FJGA 4WO0A 4EXPX 2P8LB 1M7XA 5EF2A 5F1SA 1WT5C 4RNRB 1SOKA 2BVUA 4J3OC 5JDSB 4PJ7E 3BH9A 3WY4A 4N25A 4CC1A 5EZOL 4PLKD 5A2LH 3OAYK 4FL4B 2GEQA 2BCMA 1C7TA 1CGSL 2QMKA 2WN3A 2PCXA 1F97A 3BPNB 5TGBA 2IANB 5EBWB 3Q8FA 3VXNA 4D3CH 4DPRA 2G3MA 4P59L 4HULB 3QCTH 4NS0A 3O2WL 1NCUA 3QWOA 1EGJL 1V27A 1MW2A 4UNUA 4DIXA 4WI5A 1L3WA 2H41A 3R8QA 4GRLB 1E4XH 2D03L 4BINA 2GI7A 5H35A 4LSVH 3F5WA 2DBLH 3G6JE 3F01A 4XE5B 5C0IB 4F7CA 3WNMA 2PW2A 3HBZA 4M6OH 1MVUB 1T4KB 1EZVY 1I8KB 1SF3A 2K8MA 4JM4L 1BM7A 1HOCA 1KZQA 1TQSA 2W38A 4W9DC 3THML 1W91A 3EHBC 4L8BB 4QDGA 5DD0H 1N0LA 4DVRL 4F15B 5B39A 2XG5B 4XNMA 1ECYA 4IMKC 2BP3A 3GMMB 4FLSA 4WW2C 3UAEA 5TE6L 1T5XB 3PIQA 1HHJA 2R29A 3KGRA 3EFFB 5AYUL 4RMRA 3QJZA 3U6RA 4PGEB 1KJVB 1BSIA 5EZPA 5F9OL 1I3GL 4HV8A 4S10A 2Y7MA 3AADB 3P4LA 2F58L 2WTPA 2GIYA 2VR3A 2DN7A 3NYKA 4PRAA 2IFFH 1AQDB 1CVRA 4JHAH 2D3VA 4OZIB 3ECQA 15C8L 3KNBB 1OSYA 5E6IC 1X4YA 3PGDB 4ODSH 1ITBB 4I18C 3SGDH 1BBJA 4G5ZH 5I19L 1KOAA 3BE1H 4QRFA 3FUEA 1KBKA 4HBCL 3X11A 1BFVH 1NCCH 2EC9T 2FRGP 2ENSA 1FZJB 5I75B 3QZWA 1C5CH 1FP5A 4MA7H 3OMIB 5AB1A 4LARH 1VEMA 2VR6A 3NP4A 4BRJA 4XVSH 5FYLE 2HLFC 3BQVA 4PCTA 1H3PH 3GYRA 1IGJB 2ADJB 3RWHA 3TNNB 2YUXA 4X4ZA 1U58A 4J8RB 1QO3B 3PL6B 1FNSH 1ZHLA 1HL5A 1F02I 2AGJH 2R0WL 2WNGA 4UTBL 2KZWA 3GJFH 3DYMA 2Q3ZA 5AW5B 2V9UA 2EKJA 2XTJE 3GT6A 5F89B 4Y5VC 4ZX3A 4M00A 1K5NB 5D72L 2WPGA 2CXGA 1HXMA 1NGWB 2AQ1A 3AWEA 2N0MA 2VXUL 5DJYA 5DS8B 1VPOL 4Q74A 4YDJB 2AQ3A 4ZW6A 3RE0A 2XPZA 1L6ZA 3T2OA 2ADIA 2RR3A 3K74B 3MLZL 2R4SH 1ET8A 3CFKB 4GMSL 5I1EL 1IGTA 2DWXA 4LCYA 4LVNB 5I16A 2YARA 1GZHC 3F7RA 2BSRA 2HN7B 4K23L 5EBLA 1X5AA 3UX9B 4GKSA 3QCVH 3TP4A 3ECBB 1CICC 4IDJH 5J57B 3EADA 4ADGA 1R3JA 2IXQA 4L9DA 1E5AA 3D09A 5DQ9A 3LZFH 3VE0A 2CLZA 4ODTH 4APQD 4FG2A 2OA9A 4P23C 1SOQA 2QV2A 3QFJD 4WO4A 4ZUTB 2DQTH 1BZEA 3TJEH 4G43B 4IM8A 2MHAB 2VLRB 3O6KH 3FQRA 4YX2H 3CSYA 2Y2TA 1T83A 2ZZUT 2TRYA 4JM2D 3K0WA 4IDLA 4RSVA 4BE5A 3A67H 5I8OH 3QDMD 4KKAD 4TQEL 1T0NB 2YOAA 4NXSA 5L2KA 3DDFA 3WIFB 3MREB 5DHEA 3TC9A 2X38A 1OK8A 4B5EA 5E6YA 5MENE 4NZRL 1WBZA 1DDHB 3ZIYA 5BVPL 2AQQA 4A7GA 3VFUA 1CXKA 3BMWA 4CDGC 4NQUA 3CUPA 1BQ5A 2F7PA 1DZ0A 2A0LC 2FATH 1JVKA 3ARBC 2GJJA 5TH2B 1ZWIB 5JDJA 1JZ3A 2HVKA 5B1JA 4PJFA 2F19H 2CO7A 43CAB 3RX7A 1EFXB 1ZPUA 2QGEA 3GZOA 3DO7B 2OTPA 4XXWA 2JV6A 4LLMB 1DHKA 1BM3H 3GZKA 4PV9B 1FFOB 2CLRA 3MLYL 1EVUA 4JRYE 4FFVC 4N2CA 4PWIA 1BLNB 1F2QA 1KDJA 4PBXA 1DJHA 4TQHA 5E2VH 2LU7A 4QGYA 1S7SA 5G5DB 5K1NA 1GGBL 1PX8A 4RQQB 1ZLWK 3UBGA 2HKFL 1DJYA 4WK4B 3VVWA 4RETB 3WFBH 4P9HL 3H9HA 2O6DA 1ZKAA 1OK0A 5ICXA 3QT2A 1AGBB 4Q7DA 3S2AA 2K4WA 3IK2A 1MCRA 4L8CA 2WV3A 5BOPA 1KXQE 4PS8A 2V17L 5GRWA 4HUUA 5JHLL 1RD6A 4QJ3B 3SGKC 4PBDA 4JPSA 3LDBB 4X50A 3UTSA 3IDIA 5HDBE 2NDGA 32C2B 4F7MB 5MERA 1JWMB 3L3HA 3HUJF 4WU5B 4NCDA 4PB9H 4RH4A 4XXCC 3MJGX 2E9JA 1BPVA 1FHNA 4YE4H 2C3XA 5ACZA 1IARB 1PIGA 3LKNA 5IQ9B 2D03H 4KAQL 4ZTOL 3JTSB 1NGZB 1IEAA 1TMCB 1O9VA 4MNGE 3RILA 3MV7E 2BM3A 2YPLD 3L2MA 1P2CB 4XPTL 2R0ZL 1FIGH 3O2VL 4OI8A 1MFNA 4YFLI 1AD9A 2Z92A 4DKEH 1OIOA 1YA5A 2PPEA 4ODUA 4DVRH 4HJ0D 3QQ3B 4LL1A 4CNIA 5B1BB 4M56A 5AAWA 3KE0A 4FXGA 4GG6A 1HHHB 3IXTB 4YDVA 4KMTH 4BFFA 2W94A 1RK0A 4TTGA 2WMPB 4H0LC 1MFEH 4X6EB 4KZ0A 3UO8B 4OV5A 1EH9A 5D7IF 1XCQA 1I3VA 1WA1X 4PTTB 5I30L 3UROR 4AQAB 2J5WA 4IIQA 2DI7A 5DO8A 4ZFGH 3ULVD 3WYRA 2LV4A 3AXIA 5CSZA 5DJDB 15C8H 4LVOB 4HF5L 3X1FA 4OCYH 1OALA 3P1VA 4X6BB 3UYRL 5I19H 3KS0J 1VKXA 1XMEB 5DD6A 4E9VA 3NCBB 4HBCH 5EO1B 4GQPH 3ZKMC 3L16A 4DN4L 2G0KA 3DV6A 4YHPA 4QRAA 1QZ1A 4FZEH 3FQUA 2D2CC 5DZLA 5HI4C 1U8OB 2EIDA 3FULA 4Y1SA 3RDTB 3F7PC 4FYQA 3VQLA 5IBLD 1XH0A 1YO4A 5FK9A 2ENJA 3ISYA 4FYRA 4KO6A 5I74C 4UTBH 5KANI 1UWXK 5GRJH 4F20A 3C5SB 3HG4A 4Y88A 4PH8A 4F2MB 1WC7B 1OAYH 3N1PC 2V3FA 4ZFFA 3KYMB 3EGDA 4GW1A 2X2IA 2IOIA 1PG7W 3LQAL 2WQAA 3PQYE 3KPQA 3GRBA 3D0LA 2VXUH 2R39A 4K5LA 2C1PA 3R06A 5I5JA 2YJLA 4DEPB 4U3SA 3ML9A 1P7KB 4JZNB 3MLZH 3OHXC 3N43F 3SDXB 4WWPA 3RWCB 3QYCA 4GMSH 5I1EH 1U93B 1ZXKA 4Y9FA 3C5JA 4K23H 4MNHA 1BVOA 1PZBA 5D6CA 1AGEA 4BZYA 1A6AB 4CC4A 5D7LA 3S4SA 4X98A 4ZNCD 4PY7A 3WMQA 4JHUA 4ELKB 5JW3L 3T0DA 2QZQA 1VZIA 4JHWH 3RTQD 4RA3A 3FUDA 4H8WC 5E2UL 3D85A 2R4RH 2K7PA 5ALCH 1M7IB 1D7FA 3DXAB 1YDPA 2FBRA 4G6AC 1JP5A 4XCYB 4X7TA 1BZ7B 4WW2B 4MX7B 5FO8B 3QORD 4JFZL 1ZS8B 2EDLA 3DRTB 3I75B 5EO0A 3WEXB 5AL0A 3T0EC 5CEXB 5AOZA 1TLMA 4OH2A 5CFAA 1HQ4B 1G5GA 2G60H 3FTYA 2Y0SA 3HMWL 4KDVA 5ID0A 4YBQD 1T21A 2ZP8A 4TQEH 4DFHA 1HH6A 3BP7A 4OLZH 5I9QB 5IM7A 1SYVB 1ZT4A 5JXEC 4OZIF 3A6CL 2OK0H 4KX8A 3QIBB 4AE0A 2V5YA 2PCPB 2XA3A 5BVPH 1P5UC 1P9MC 2C9SA 4NWUL 1HYRC 1ZLSH 4N2BA 4O02A 3ARVA 2UWEA 1ONQB 1T1ZB 3NZUA 3BAXA 3RIKA 5IJVA 5HHMB 3JBG7 4NQEA 4WLCA 4FJYA 3FCBA 2KDGA 1E67A 4H25B 1E42A 1TJIH 1S7WB 1ZT7B 1P5VA 5DMJB 5E5MB 1S9WB 2GUOB 1EEQA 4JRXE 2ZG1A 4OFQA 1XSKA 1BYNA 3PWJB 5FYKH 5JLZB 3ABLB 1LO5A 5HGHA 1EWHA 1S5IL 1C5BH 5LAPA 2ICWI 5BQ7A 1BMWA 2HKFH 3AMLA 4WTXA 3GRWA 1NEPA 3GHPA 3D48R 3SKMA 4M7JL 5K9OA 4NHUB 4D0CB 1TTAA 2HX7A 1UH4A 3FZUD 1NJ9A 3U2IA 4MRCA 3IKKA 2VXSH 3HI6L 4WZ9A 2V17H 4P9MH 4CUCA 1QYGH 4MQXC 1TG8A 4OTXL 1A7QL 3AREC 3EGXA 3MXVL 2NR6D 4LXFA 2NPLX 2XIDA 4PJDA 1AYRA 5GGRA 1RZPA 5E5UB 3AQXA 4HJTA 4FTDA 2KMWA 3I02A 3AAZB 2MCG1 1J5IA 1AAJA 3GLAA 2R1XA 1IM9D 1MCLA 3HRZA 1PX4A 1JDDA 1PCSA 2OSLA 3I50L 3KPRB 3QNXA 3GXUB 2BNRB 3UBXG 1HJBC 3D34A 3OAZK 2C4FT 4YDZA 4XPTH 5FGSA 3EJCA 3O2VH 3HKZA 1KNOA 2C7UA 5C08D 3OZ9L 3CQPA 4HUVB 4UQ3B 2ZE0A 3Q43A 5TDOA 5FIEA 3MYZA 4XHQA 5K9KB 2BWDA 3V6OA 4BXVA 2CJSA 3RVVC 1E3ZA 4MMZB 4U1HB 3FJTA 2B5IC 1L0QA 5F1IB 1F90L 2YRZA 3KS0H 3PJNA 4U1KA 2KC0A 2VDRH 2WZ0A 4GXUN 4QXWA 4B41A 1CLZL 4TF4A 1QW9A 1ZV2A 4OFIA 2FLRT 1L5GA 4QOKB 2KZ1B 4L1DA 5IKCB 2VDKH 1OP3H 3S3JA 4ZMTA 4NN7C 3ARBB 4HXBL 5ESAA 3ZGHA 1U8KB 2MQCA 3ABGA 3ZMRA 4TUOB 4BUHA 3T77A 3TEXA 1DE4A 1IKFH 3BP6A 2XY1A 1KGCE 4XVUD 3ZR6A 1KENL 3U30C 2VZSA 1CGUA 1D3CA 3UYRH 2NY4D 1K4DA 3EZJB 4YSPA 5GGQL 3CZGA 1B90A 5JQ6L 1HHGB 1W72A 5JOPD 5T5FL 2CWRA 1BXUA 4LSPL 3OAUL 5D5MB 3IJSB 3G9AB 5F93C 3SGJA 5LG1A 1N6VA 4J6RH 2QKIA 2K4AA 2WBJD 1AHWC 1QSVA 4K55A 4IYKA 4M62H 3WXWL 5EB9A 5ICYB 3QJFB 3KL3A 2JXMB 4FQ2L 4Q9RL 2J44A 2HPOA 3TBWB 4NC1E 4B9JA 3Q5YA 1Z0MA 4J39A 1O6SB 4NQVB 3FTGB 3KWWB 1TUPA 3V52L 2YPVA 3APNA 3UCQA 3N40F 3RFRA 3PUUA 3U0TA 5IVOA 4H20H 3QC6X 4U1LA 1IEHA 1QFWM 2XT1B 1KF9B 2W95A 4KMQA 5LCVA 1MNNA 3ABKB 3EH4B 3MRMA 1UZ8B 2BOCB 2ZXQA 3M1BB 2JTDA 3CX5K 4BH8A 2WB1A 3J7HA 1LE9B 2YD5A 3QFJA 1EHKB 5T1LD 2WLIA 1R3KA 2IDCA 3EYVA 2HVJB 3ZO0A 4TN9A 4U6VL 4JE4B 1M42A 1O7DE 4Z7UB 5D2LA 1ES0A 3GNML 4JM2A 4MLIA 3ETBJ 3O41A 1A1OA 3TOPA 3MLPA 2OQJA 5JW3H 3QDMA 3BVWA 1V8HA 1LMIA 1OHZA 5CBEB 3SO5A 2ARJQ 2R2BA 4FCAA 5TF1L 3U0WH 1FV1A 3FYIB 3LRSA 5IQMA 4Z5RB 1TVBB 5EBMA 4HD9A 2WXOA 2VIRB 4G6JH 1MLBB 4S1RH 3H3PH 3PLYA 4FZ8H 3AS0A 1V3LA 3IS1X 2LHAA 4D2NA 1YMME 3EG9B 4NXKA 3WO4C 2Z31D 1H8NA 5F8RC 2DYPB 1W8NA 1FLRL 2QVKA 3IGAA 3QIWC 2V2WB 3HMWH 1NMCC 2BSTB 1A9EB 2OW6A 5AQ0A 4AKOA 4HH8A 5HXMA 1FAIH 3A6CH 4BEIA 3LSOA 4P46C 4WTWA 3W81A 3BYTA 4JJ5A 5JZ7D 2ZPKL 3WE6B 1JPST 4IEFB 3RBSA 3MLXH 5F7YC 2HKAA 5AW8B 4Z3IA 3FHAA 3RKDC 3EYUH 4XWOC 1U92A 4OJCA 3TPUB 1VADA 4GSUA 5I1GH 1WS7A 3UJTL 3VQ2C 4LCIH 4G6FD 1Q9WB 5PAZA 2RIKA 1OGAD 2XN2A 3AU1B 1DJZA 1V3JA 3QPXH 4NC0B 5D7IE 1J9TA 3OPUA 5DGRA 1E90A 5IVNA 1F6LL 3G5VA 1PLCA 4NO5A 3NOIA 2NQDA 4OUUB 2P7TB 3VXOA 4WGWB 1P7BA 4JFED 4JN2A 1AS8A 3STLB 4J3OF 3VQMA 2EUZA 3NZHL 1S5IH 3WIHH 1BQHA 3FMGH 3G6DH 4PREB 4XO3A 4OZFG 3O4LE 3QZLA 1Q0YH 1D9KB 3BMVA 5CCGE 2DYSB 2MCPL 2J43A 4AYBA 3ULUH 1UXSA 1MHCB 1WCQA 3SCMB 3SDXF 3VWJB 3ABZA 2YC1B 2BP8A 5HYSA 1T66C 3HI6H 3KBFA 4M8RA 2YPLA 2VXQA 3FO9A 1RK1B 5E8PA 4OTXH 5LNGA 1BCIA 1RIUL 1IM3A 4Y19D 4LCUB 5KSBB 3NJMA 2JMRA 4POZD 1NEZA 3QHFH 1BX2B 1IFGA 4S1SL 3QR0A 3VFMA 3OKKB 2EEFA 1KTBA 4HIJA 2F1BA 3NSDA 2R2CA 4JY6A 4WW2F 1TQVA 4IQHA 3A6BL 3I50H 5K39B 4XN4A 4V33A 3T1WA 3NIGB 2EKSB 2DMHA 1MFCH 2VSKB 4GUOA 5FYJD 1ET7A 2CBPA 2IGFH 1JZ5A 1ZSDA 5H2BA 5M94B 4YHKH 2EO1A 3ARGD 2HT3C 2XN9D 3FSOA 3QQNA 2UZPA 3P4MA 5AVRB 2E3VA 5K59F 4PRPD 1H15A 1S5HB 1IAKB 3GMNA 3OZKA 1T20B 4C4KT 3RWFB 2PTTB 2W9LA 3QUMB 3TESA 4IRSA 4Z77A 2ZNXA 1XGRB 1Y18A 1CLZH 2VZUA 4XO5A 2D4FA 4WWKB 1R3LA 1B4JH 4X9IA 4DGYL 2JB6B 3KH3A 4X7SH 3KHQA 4HXBH 1UA7A 1XR8A 1B0RA 1VA9A 2OJZH 4PJXA 4AK1A 4MCZB 2FJFA 4AUUA 3HC2A 5FWRA 5K1VA 3S3DB 3U7YH 3QARA 3OXRA 4GG6E 4XC3H 4OZIE 1N64H 1PQZA 3GBML 2H26A 5JQ6H 1OE1A 1XB8A 2DEYX 3LIUA 4LSPH 4NOFA 3DSNB 3MAWA 4LRIC 1E4KA 5I28A 1A7OH 5CHNA 2DTML 2R7EB 4D8PA 5DCCA 3IF1A 4Y5YB 3GMOB 2XV6B 3SOBL 3TXAA 4G8IA 5F3BA 1MKFA 2CHDA 4KX7A 5E23A 2IWEA 2P8MA 3U4BH 5E08L 1U36A 1XR9B 2ZUQC 2OMWA 3WY1A 4YDLC 1BIIB 4HKJA 2XX1A 3N1FC 2F8OA 3MRBB 2OW7A 5B38B 3IFOA 1K2DB 2YXWA 2R1YA 1MFAL 3RTQA 4JL2A 2B59B 1FNHA 4XVOA 2XKNB 4R26L 1DUZA 2F68X 5BOJA 2UY6A 2CGRL 5EEVA 4DW2L 4PVLA 4WY7L 5BVJA 5CN3A 3Q8CA 5B4MC 3MTRA 1OGTA 3N2JA 3QORA 1EXGA 4W6XB 1MI5D 3J2PA 3COOA 2NX5B 4U6VH 4ODWA 1K6QH 3GNMH 4M7KH 4PG9B 3DVNB 5A1AA 3QUZD 3RL2B 1NDGB 2LLLA 4HEPA 1N68A 5SWQB 4Z7OE 1TJMA 2BIOA 1YEKH 4YO0A 2CH8A 2CPCA 1ZTXH 5D2NB 1MHEB 5HVFB 4DPAX 5I15L 1OQOA 2DQJL 4HJEA 2G2RB 1IRAY 2X1WL 5DUMH 3KH4A 1G7IA 2P45B 1NAKL 3OSVA 5CWSA 3V55A 1J8SA 3MCKA 4AG4H 2Q87A 4NC1C 4Q89A 2R2EB 1RJZA 4Y1AB 4XOCA 4BZ1A 3ROOB 3SY0B 1PD0A 2BY0A 5ISZD 1OOWA 2J4WL 4OZ4B 2FEEL 4O2FB 4NSKA 2X4NA 5J11C 3FOLB 4EKJA 5ITFA 5M7QA 1IAMA 3N9GL 1MDTA 1IGIL 1U91A 4PMEA 4BFRA 3VXMB 4Q2ZB 1BHGA 3SO3C 5CGMA 1TQUA 4XPAL 3FFDB 3WEBA 4YSRA 4CADA 5D5MF 2Y25A 2ZWNA 3TFKD 4KJPC 4J3SA 2YPKB 1KGUA 5DMKB 1O7DC 4TULH 3UJTH 2J57A 2YRLA 2PCFA 3OR6B 3UOAB 4AIXA 1QKZH 1VFBA 3RZCB 4IU2A 2VE6B 1H6UA 2VQUA 1A7BA 4AQEA 4K8RC 2AEQL 3D7PA 3P3YA 3KPLA 2OSWA 5I1DA 2WBKA 1A47A 2IALB 1OLZA 4R7VA 4BH7A 5IHZB 3VRIA 2FEEI 1BXAA 2VDLL 2W81C 1KIQA 3BN9D 4JGUA 3LN5A 1QRNB 3OKLA 1U3ZA 3LPOA 1MCQA 1OM9A 5KZCD 5K9QG 5C1MB 4U7MA 2MCPH 2GABA 2IG2L 5GPRA 1EZUA 3A22A 4X6DB 3VU1A 4Z7UF 2VH5L 4L23A 4ZUWB 4JR9L 2H1LM 3NJVA 5HYEA 1CJYA 2Z91B 3QW9A 2OX5A 4JX0A 4EBQL 5C08A 4GAYB 1ILSA 3MXWL 1ZLEA 4WO4C 5CP7A 1OCCB 3MRGA 3DX9B 2L04A 2XWEA 3HLAA 4N0UA 4S1SH 3S4SG 3Q06A 5E95B 2C4XA 1T83C 5J3HD 5AVQB 4XNYH 3ZKXC 1E40A 4BQCA 1UOLA 4JKPH 3DJZA 4ZXBB 4BQ8A 3VJ6A 2DWEB 3DROA 2OP4H 4LBAA 3WFHA 5AVTB 2EVIA 4Y2DD 4WCYL 5EU6D 1KTKE 4U1JA 3B56A 1XSJA 2ZQKA 4ZD3L 1A6WL 1HILA 2R69H 2Y3AA 3QEQD 4ACPA 3FUIA 4XMLL 3RBGA 2R2HA 5AYQA 5FA3A 2OZ4L 2DS4A 1SJHB 4QPEA 2CKBA 4F80A 4JHBA 4KUCF 1ZANL 2KDYA 3QQ9C 5I17A 1EO8L 3ES6A 4FNQA 1MNUL 1HKLH 3LNGA 4KTGA 1PS3A 3INUL 2OMUA 2JB5L 5B1JC 2ATKB 3JSSA 2OBGA 4AL8L 4XOAA 2C9QA 3WKMH 4XXWC 3T0WA 1F41A 1A21A 5E4EB 3OLEA 4XNBA 3FF7A 3ULSB 4XPGL 3QWNA 4KNQA 5EU5B 3IBOA 5KVDE 5IJDC 1JGVL 5CP3A 1FIEA 1LE5B 4GI9A 4OZHA 3GKWL 2YRBA 3TJPA 1BXVA 4LGRB 4ZW3A 1OGSA 4FABL 2O6CA 3ZJAA 3IGLA 3CSFA 3N1GC 1NMBH 4KHXL 1WD9A 4LCVA 5DD5H 2ZXEB 5GS3A 1S9VB 1FDLL 2DTMH 1GZPB 3DVGA 3K2MC 1MEXL 4CVWA 2VR7A 4GUPA 3QG7H 5KJRH 1UA3A 2IEPA 1DVYA 3KAAA 1DO5A 3P4OA 4PRDB 3VGAC 3V0VB 2DIEA 3LHPL 5T1LA 4EUPA 1B0WA 4HJGA 2J6EA 5EWIH 5JO5B 2R27A 2BC4A 3OJ2C 2E9WA 5SWZD 5DK0A 1CFQB 2MKLC 4WEMB 2BY2A 3FB6B 2LU5A 5KSBF 4L4TD 2Y4SA 3E3QC 4B60A 4GY4A 4IU3B 2NNAA 2L4OA 2YQBA 3QJXA 1U8NA 4KJQD 4NRXA 4MAYB 3CVDA 5DRNB 4NZFA 5L4MA 2ZWZA 2Y1ZA 3S35L 4XP1H 4RISL 2YGVA 1XF3A 3NIGF 2K3TA 3LHAA 2YFNA 3TBTB 2Z31A 2QR0B 1MHPH 4HD5A 5I24A 1PFCA 3RWGB 3OG6B 2XZAL 5AAWC 4FXGC 5JHDB 1ZEAL 1P69B 2NDFA 4HCRH 2WZ6A 4M4RB 1TXKA 3FAWA 2EECA 1R3IL 2GITA 2WSDA 3FPYA 3FPXA 1JPFB 4Y16D 5B1AB 3ARFB 3EJYD 1F6AA 1FL3A 2CK2A 1IILE 3ZHNA 7TAAA 2YGQA 4WI7A 2GTWB 2KH2B 4AEHL 5DGQA 1LEIA 3DIDA 5C6WH 3OF6D 4WDIA 4IIQC 4KHTL 5IOKA 4UZGA 1WVZA 1LK2B 1NM9A 3DXAE 2JCWA 2LGNA 2IDUA 3FTXA 2J4WH 3QUKB 3QHTC 3QS3A 2I69A 3CZNA 1OGAA 5GGSY 3U6XS 1U8PB 3QDME 2FR4B 3JWOH 4XBGB 2WVVA 1GRWA 5CEZL 1A6PA 4FJ6A 3UDWA 1KBBA 4AK2A 1TNNA 4QY8A 1R33A 5TQ0L 5K59E 3MVSA 4LPWA 4R4FL 1SOXA 3BYYA 4JFEA 4R4ND 2ZXCA 4R2GD 4RFEB 1I9JL 2H32A 1BGXH 1QUNA 5GZOD 2I9TA 3DUSA 4PIRF 5E8NA 5DJCB 3CE1A 3M45A 1ZRUA 5AVZB 4GSRA 2GCYA 2MNWA 3BKMH 3INOA 3NIDE 4YAQA 4GXVL 1DVFC 5AZ2L 2YWYA 3UZQA 4QHNB 3KXFD 2N1TE 4JFOA 5F0MB 2BP0A 3QHZL 2AHIA 4UQ2A 5D1QB 4NX0A 1A6UL 2K1MA 4NQXA 1I8AA 3M1OA 4XP9H 4EEEA 3D3VA 4FI8A 1C08A 1HIML 4CMMB 1KCVL 3FCUB 2Q86B 1KC5H 1YEHL 3C8KA 2VDLH 3HZYA 4M8QB 4DT2A 1QD0A 5AW9B 1MRDH 1L9OA 1I7UA 1KB5H 1IC7H 3BW9A 1S7RB 4BSJA 1BZDA 1AR1D 3V4UL 4CC4C 1JTPA 1KPRA 1EDQA 2W9DH 2BIQA 3LZNA 1B6UA 1YYLL 4U3HA 1OD9A 1GAFL 2FTAA 4LEXH 3ATEA 3VFPB 1VHPA 1T1WB 1LLAA 5HI3C 1FNGB 2O5NA 2ZX9A 4OJFH 1ZLWH 3WN5A 4S2SB 1COBA 2XNAA 3MXWH 4DGIL 1B88A 1FUNA 3ARGA 2XN9A 5B39B 3QJQB 1G5AA 5DT1L 1T80A 5FYKD 4P2OD 5IW1B 2RQ8A 4HFUL 4PRPA 5HHXH 1HHJB 1OAQL 3MN8A 2R8SH 1XBRA 5D93B 2TAAA 5A2KH 4X9HA 3G5YA 4PLJC 1CR9H 2EIZA 4RFNB 3RJDA 3UP6A 3RPIB 2HXAA 2W60B 3FT9A 3EYSH 1NINA 4F2EA 4PGCB 3HKFA 4PY8J 4M43L 1NANI 3LVEA 3HW7A 3KPRE 4ZD3H 5KS9F 5AVWB 2BNRE 4NIYE 4TLTA 1HOEA 5LB1A 4XMLH 8FABB 3TGXA 1EVTC 3SJVB 4UDTB 1VACA 2EICA 1RPKA 1ZIBA 1TTBA 1U3HD 1WBYA 2DWDB 1EO8H 3FUMA 5KVEL 2PTVA 1MNUH 3PRZA 2Y7QA 2CD0A 4NYLB 3FK3A 4FEMA 1GGCL 3V0EA 4KJWC 1OTTC 4ABWA 3OPZL 2NY3D 3GHEL 1IX2A 2QLYA 2VRQA 5GS1B 4NZDA 2C9XA 1EV2E 1KLUB 3ECWA 5EMYA 3ETTA 5L8LB 4PJEB 2GTQA 2J72A 5DFAA 4QOKE 3KPOB 4LCCB 3IAGC 5IP4A 1JGVH 4OJAA 2MQGA 3DRQA 3ERXA 4PLKC 3EYOB 4YC2C 5FYJU 3K80A 2BVPB 4PJIB 1MLCA 4NJ9L 43C9A 5BV7H 3BRFA 3PGCB 4FABH 4CW1A 5KYWA 4PJAA 1R46A 4HXAH 5IR1A 4I88A 4HJUA 1S3KH 4R7DA 3QAZC 4XZUB 1N4XH 4HDIA 2YSTA 3MROB 1XH3A 1FDLH 1JDCA 4K94H 2R56H 2GJZB 5TPWH 1J05B 2BVOA 4X2UA 2J56A 4Y4HD 5D5ME 1WS8A 2BSED 3MLTB 1A4KB 1OP9A 2CUMA 1FO0H 1BQHG 4X6DF 1FCGA 1MI5A 3ILPA 4PJXE 3RVXC 3NSCA 1IV8A 4G7VH 4JFYB 4PV8A 1ZE3H 3QUZA 4WI9A 1NC4D 3FB7B 1AI1L 3GJFA 3SBRA 4LLQA 4W9IC 3SDCD 3NCCB 3QPQD 3DX6A 4PJ9B 5HYSG 2X6CA 3HRZC 1TZ8A 1PLBA 1KEGL 1WUZA 4OCLC 4EI5B 4EQ2A 3T9WA 1IFRA 1TZAA 3NFSH 3QZMA 3MOAH 1UWXH 1UQSB 4LF3B 4RISH 2G2NA 2XQYG 3X1EA 3NK3A 3RPKA 4MMXA 3RTLA 5LVEA 2XZAH 3H42L 3L5XH 4LQFL 5FLUA 3V6OC 3F00A 4NQSB 4DKFL 5L2KB 5AKSA 1MJ8H 3GZPA 4Z7UE 4MKTA 2P1YA 2IMMA 3W82A 1X6NA 4K9JA 4MXQD 4PJ5D 1OB1B 3BGFC 5GRZA 3HI1A 3WLBA 3CZJA 4LLYB 3VRLF 7PCYA 5J5EA 5D9SA 4ZSOB 4N0RA 3T4AB 2WAQA 4JFXA 3VFUB 3VXRB 1K85A 1RIVL 1SXZA 2Y07L 4KRNA 4W9GC 4TSCL 4Y0GA 5CLXA 2H0PA 5ACMA 4TLUA 1J8HB 1NQBA 2YQ2A 3QNZB 4ZOAA 4K7PX 4FQQA 4MD4A 3F3HA 3DUHA 4KK5D 5E8EA 4OIIH 1Z5YD 3BQUB 4KTYA 4H7VA 1YNTA 2AAAA 2ZUTA 5CD3A 2Z35A 1UURA 1NCNA 5F7NC 4GW5B 4HJ1A 3SGJC 3NQKA 4X6FB 5K93A 4S11A 5L2JA 2X4QB 1DEEA 3K72B 3V0IA 5TQ0H 1NLBL 3WI9A 3BUIA 1PG7H 1CGYA 1I9JH 2PW1A 1WCBA 1XGQB 5I0VA 2UV3A 2WLKA 2PYFA 1NCDL 3F7VA 1TQBB 3KLDA 4EOWL 4NKMB 3CTTA 1DANU 1TF4A 1B2WH 3L8QA 2FHCA 2EDRA 4C55A 2B4CH 5ICXB 4ZMPA 4Q0XH 2IPTH 3LKRA 3AY4A 3QHZH 3IGUA 4XN9A 4XT1C 2DQDL 1FPTL 1RUPH 3VGAB 1EANA 5B7FA 4MBRA 2VISA 4Z78A 1D5XB 1HAUA 1L0YA 3BUYA 4LEOA 1YEHH 4APQC 1DSFH 2WINA 3I6GB 2NLJA 1VGKB 4MJ4A 5F3FA 2Q76A 3KR3L 2D7PA 3TN0D 5LNEA 1OAKL 3FT3B 1BJ1J 4UCFA 4JM2C 3EOTL 4FLHA 1QHPA 4KKAC 4APXB 4LMQE 3GMQA 4ZOEA 3BP4A 4PGBB 1S7UB 4CVXB 1GAFH 4BCZA 1N19A 1FGNL 1AE6H 4Y2DA 5A6IA 4MJ5B 5EU6A 3U1QA 1QBLL 4HYTB 3K91A 2BMKA 1G9MC 1H3GA 2L7QA 3QEQA 1OB0A 3FT2A 4QD2E 5DMGD 1PJ9A 5IHUH 2ZUUA 3VFNA 2V2TA 1OAQH 1J88A 5HJGA 5KSBE 2Y6TE 2BRRL 3BOVA 1OCWH 3KEHA 4ENZA 4M3KB 1TQCC 1KEMH 4M7ZB 5ANMB 4LP4A 4I9WD 4L3ED 3B9KD 3LAFA 4MWFA 4PRBA 3RURA 4M43H 4RGOL 4G8GD 1AP2B 3JWNE 2MQ0A 2R1WA 5ABDE 5LLIC 5I0XA 2E9BA 3HZMB 1BG1A 3CFJA 4TL5A 1IKNA 1KELL 3RGHA 2CSPA 4G9FD 1ZGLB 1J1PH 1UG9A 3MPCA 1G6RL 2NY5C 5DD6B 5DVMA 3OAZH 3P4NA 3LCYA 4JQVA 4N0UE 3BDBA 3QEUA 2X4SA 3TEUA 3OPZH 4A66A 1A5FL 2AV1A 3GHEH 3M8OL 5ETUB 1AIZA 5CCHE 1AC0A 1KBVA 3A4DA 4NZTL 3DV6B 3UTTD 3WENA 5FHBH 5TTRA 1F8TH 3MRFA 4HUXA 3HE6B 1U4EA 3E7JA 3A6OA 2RJMA 2W9EL 4QRRB 4I3RH 1I9IL 5F6IB 3AB0C 3G5XB 4Y4FB 1KN2L 1JGUH 5C0CB 1B0GB 2IBGA 2JJTA 4NKOA 1F5WA 4HIXL 1O7SA 4OLEA 1UWEH 1DVFB 4Y2NA 4ENEC 4ISVB 1SXCA 5SWZA 3V95A 2IADB 1ZVNA 2MFNA 4F8NA 1GGIH 3MV11 5D7EA 5E4OA 2ZSWA 4Q4IA 4L4TA 4M8UA 2CM6A 3GTVA 3R06B 3X2QB 4L5FE 1HVXA 4X6CB 4N2KA 2IDQA 2L0DA 1TVHB 4GIAA 1CCZA 4DQOL 1KBGL 3IN2A 3DIFB 3UZEA 3VG0H 3MBXL 2B0SH 4U1GC 5E7BA 1BZ8A 2QTEA 4HJSA 4N20A 5JPNA 4KQ3H 1SMDA 3EXJA 1U33A 4RAUA 1W0VB 1R9FA 2YAQA 3EAKA 3ETSA 3CBRA 4PY7B 4CVUA 4OZHE 3K81A 1LK3H 3MJ7B 3Q3GA 1MCWM 3JWDH 4W1TA 4UTBA 1AI1H 4I5BB 4PUBL 1AMYA 2D31B 3JWNG 1F4XL 2ZICA 4Y16A 3A0OA 1JNNL 5L8KB 3TA3A 1Q94A 2IF7A 4KZEL 4AM0A 2GK0B 5KN5B 3OX8B 2X53A 3OKDA 4NUJB 3D25B 3WLWC 4AUYA 3GZQA 3OF6A 4P57A 1B3IA 3RGVD 2JK5A 2ZTBA 4WFHD 2ED7A 4U1IB 5ICZB 2IV9A 3ULVC 5DZ9A 2J88L 5HJ3A 4LDOB 1FN4A 3VO0A 1QA9B 4LQFH 2MTAA 3V7AE 3L6FA 2NX5E 1E28B 2XV2A 3IDYC 4JVUA 3MACL 4BWTA 5FF6A 1CF8H 4IRSC 1AZRA 4DP1X 5JA9A 3BGMA 3CDZA 2VLMD 1JGDA 1GC1L 3OR7A 5FGBA 2BNUB 2PYED 5HDQL 5C7XL 1RIVH 2HLAB 3LVTA 5J7CC 4J1UA 3MRNB 5HPOA 3SZKC 2YGPA 2AC0A 3B6SB 1P7HL 4GP8B 3DHJA 1AKJD 5GZOA 3EO1B 3VI3A 1XAUA 2YAOA 3LQZB 4PJEF 3OKOB 1KXTA 4P4RA 3W38A 1Y1DA 5F96H 1OSPL 3KXFA 1PFOA 1RZKH 1VSCA 5F1NA 4JPWH 1ORSB 4GB9A 5DYOA 5I8CB 2YS4A 1A2YB 2ZSVB 2XPGB 1E4KC 4PP2B 5HDWA 5LBSL 3UJIL 1I7RB 3X14A 2BY3A 1JL8A 4A68A 3VXME 1UYWL 4ZYKA 1A8ZA 1G7LB 1DN0A 5KEZA 1NOAA 3B2VL 4L8SB 4OFKA 4KK9D 1NCDH 1A6ZB 1BQLH 1D7CA 4JDTL 5EN3A 5E9DB 1WHOA 1HESA 3P54A 4XH2A 1BJ1H 1JHKL 2AJSL 5D8JH 3U4EA 4RSYA 1OGAE 2Q5BA 3B2UD 4UNVA 5B38G 2A83A 2H6PA 4YNYB 4PJ8D 5HGAB 3W11D 2JWYA 5FYLL 3RTQC 5MEOA 3SN6N 1X9QA 4JO3L 2Z4QB 5DUBB 5GRYA 4U33A 1M57B 4XHJD 5JORA 1ZPLA 3GSWA 5FWQA 4EUPG 1EA9C 1U6AL 4QHLB 2WQ8A 1XHHA 2R23A 3KR3H 3QORC 4P2OA 5KVFH 3DMMB 3V7AG 3KBEA 5IQNA 4UINL 3RX5A 2W07A 1XT5A 1M7DA 2BNQD 1KLGA 1REIA 1QRNE 2R0KL 2ZP0T 2CDEA 2DQEH 4YBQC 2WUBL 2DKUA 4PB0L 3BAYA 3GXDA 3SQOH 3UCRA 3U1SH 3KLQA 5C0BD 3TLRA 1SDDB 3MJ6A 1PEZA 1YPZB 4RWHA 4W70A 4NCC2 4XBEL 3PP3K 2BS8A 3D3VE 1MIEL 1OAZH 1TIUA 2BW5A 2JKLA 3MKGA 3O3BA 3ZDWA 1PEWA 2EE6A 1G7QA 4KOCA 2BRRH 3BKJL 5IWLC 3EUUA 4BELD 1DVXA 2LTQB 4U1MB 4QWWC 3RVWD 3LH8A 4X0KB 4A6YL 3RNQA 4LSRL 2NRDA 4G59C 1CC3A 3V0WL 4E36A 1BVLB 1EUUA 4A7VA 2NTFA 4XCNA 3FQTA 1HHKA 1TZHA 4HG4K 3ZU8A 5C0FA 1KELH 4ZMVA 5FXCH 4G6MH 1UT2A 4FLQA 4ZFOB 3UTPD 5KYYA 1G6RH 3UTQB 3QO0B 4R0LB 4ZS7L 3I6KA 3IFPA 4PRPE 4L9LA 4NZTH 3AQZA 3BVXA 3T0AA 3VRLE 4JG1L 1QLFA 4ATTA 5FYKU 4BQ9A 1NIDA 4D0DB 1KZYA 2M2DA 3FZUC 5H94A 2OLDA 1SJVA 1X9RA 2EVFA 1GMIA 3HMXL 4Y4HA 2BSEA 3O6ML 2V7NA 1KN2H 4F8TA 2WW8A 1YEJH 2QQNL 4KTDL 1PZ2A 4G80B 5BOZG 4KXZH 2KKQA 2NR6C 2ZX8A 2EXWC 3TYFA 1NGXB 4HIXH 5IB4A 4BWWA 3ZPDA 5LGJB 2DQHL 4FNLH 3FN9A 5G4OA 2IDTA 1KYFA 4M29A 1NC4A 2CIIB 1UKQA 4H5SB 3SDCA 4E42B 4HOWA 2R9HC 1FLTX 4GOSA 2PR4L 1I53A 1G9HA 1MW1A 2VL5B 3HI5L 3HVNA 3OVUB 3TH2T 4APQB 1WH0A 3AC0A 3GJEB 4DQOH 5DZOA 1S7TA 2XWTB 5AEAA 1WTLA 4UUJA 4AV0A 3PWNA 4N2EA 4CBPA 1INQB 1NCWL 3CLWA 3D51A 2VAAB 5AL8A 5IB1A 3ZQXA 3P9LB 3BWUC 4PGJA 3B1TA 3APCA 3LV3B 1A1OB 3FU3A 3N42B 1XGUA 4GSDL 1CD1A 2GC7C 3U7AA 1G4MA 2ZCHL 2Z9TA 5HPMA 2H8PA 4K9EC 4PJ5A 3MRJB 1F4XH 4XNXL 1NKOA 3KW8A 4KZEH 5CO1A 7FABL 4BBWA 3GC3A 1I4FA 3II1A 3DTUB 4HS8L 4P3DB 2VSDA 2F8XC 4TNVK 4RMTA 2DJSA 4A2GA 1PNDA 2J88H 4DPBX 1DEDA 4DK3A 2V8LA 1G0XA 2Q1EA 4D9QE 1JPSL 4XVUC 5J12B 3T8XA 2G9HB 1IZKA 2CK0H 2NT1A 4HIHB 4DZ8B 2A6KB 2NY4C 1T1XB 2AJUL 4JAMB 4KKBD 4M1GL 2XXFA 3DHMA 2AJ3B 4IHBA 3NJXA 4H2AA 3ESUF 1GC1H 1S7VB 2DLIA 2J5LC 3ISWA 5CLYA 2XN1A 3VNZA 4N1CA 2OXGA 1I3RB 1ZCRA 2WJ7A 4ZO6A 2FZ3A 1YUHB 3WAKA 4UF7C 4WI8A 1SOSA 4H0GA 1NIAA 3HZKB 4H13C 3CN1A 1FFNB 1WDAA 1JWSB 5I71C 1ETZA 2X4UB 5AZEL 3MO1B 3MQIA 4YXKL 5T1MB 3WJLA 3ZUCA 4JO5A 2NUPB 1ET5A 3HG5A 3NTCH 3PPSA 1MFDH 4WW1B 5EIQA 5BXFB 1TETH 3EKCA 1QR4A 5FECA 3F7YB 3R4RA 3RY6A 1PZ5A 5IEHB 4RVBA 5EORL 3MLUH 1GVIA 4PJHA 3S3BB 1UYWH 4H40A 4HAFA 3FU6A 3NZSA 2F54B 1TJXA 2K3HA 4X6CF 4C59B 5BRQA 5DVNA 4NO0D 4KRMB 1AXTH 4H1LH 2D73A 4LK4A 4YSSA 1F6FB 3ESPA 5HSFA 4K7PY 1FVDB 4GQRA 5FYLH 1RZ7L 1R19A 2X2YA 2CHNA 3QUYD 2PXYB 4JO3H 3FTUA 2EQDA 1DCLA 2BVQA 3AT9A 1A22B 1K8IA 3EDFA 2RQEA 2W65A 2AMUA 5KBNC 5D1QE 2Y5QA 1TQWA 4GPVA 1EZLA 2A6IA 2P5ED 1U6AH 4HALA 3QWRD 1JNHA 1ADQL 5GGRY 1DQQA 4OGAD 5CJ8A 5D96C 1HCFX 3CMGA 4M03A 3WKQA 4JZOB 3WIHA 3QI9B 2Z31C 1MWAL 4YHML 1PKQA 4ELMB 4WEBL 4X80L 4L8DB 2EJ1A 3UGEA 4MS8D 4XNQA 1DFBL 1YNKH 4L3EA 4ONOA 3B9KA 3PV7A 4JDZB 3MGOB 4XBEH 2ITCA 4MSWB 3PCYA 3S96A 5JZ7C 2V7HA 1DBJH 1GYWA 2Y7NA 4G9FA 3D87B 5FB8A 3GMNB 1X5LA 4G8FB 3IDYB 3VSTA 1KJMA 4P5RA 3QXAB 4DP2X 4GKNB 3IJYB 5IEKB 3EBHA 5DTFA 2HWZL 4HQQH 2AJYL 4OZGE 5AG9A 3PS6A 4LSRH 5CIPB 2YKKA 4Y2OB 3SDYL 2IV8A 3F58H 4LOUD 1CDIA 3KVPA 2IVFC 3FT4A 4PJBA 5F0JB 3MFGB 2ERJC 1HTYA 3UDWC 3U48A 1YYML 5KG9B 4FG4A 3IJEA 2QHLA 3B4NA 3QULA 1HH9B 3JVGA 3LIZL 3IVKB 3I9AA 4ZS7H 2AJVH 2H26B 3SJVE 5EUKA 3VCLB 2HFGL 2CCLA 1ODUA 3H7LA 3W9EB 2G30A 4DN3L 2YD7A 3IRPX 2H45A 4IBTA 3U79A 1GTFA 2C1OB 3IF1B 2DV6A 2W0PA 1BWMA 2A77L 3E2HB 1DBBH 2EYRA 4DEWA 3HB3B 1QLEB 1DZBA 3HMXH 4IBLT 3HA0A 1JERA 4MCMA 4KRPB 3FQYA 4FQ1H 3NVQA 3HC0B 3LPFA 3ROLB 2R83A 2VDML 4ZFQA 4PJEE 2A4ZA 3MR9B 3NCWA 3QXDA 1JZJA 1ODAA 3HTLX 4OM0H 4POZC 4YFEA 5IQ7L 5A6MA 4V1DB 5F0PB 3PXJA 4FXKB 4P2RD 1QX1A 5EBGA 4PJIE 3GSXB 5BMFH 3M88A 3TZVD 5T5FA 1FBIH 1PZCA 3HI5H 3DTXB 4ELDA 1ORQB 4DCQB 2XWJA 4MD5B 2XFXA 3KWXA 5BO1L 3T2LA 4OI7A 3RGVA 5L9DL 1QFUL 2VWEC 3WN5C 3ARGC 1YPZF 1UACL 3KYOA 3AWFA 3QJHA 1CE6A 2NCEA 4GSDH 5HGDA 5C09D 1D6EA 4HUWB 3UTZA 3V5HB 1V05A 2JKNA 5AYTA 1U4FA 1AD0B 1T89A 5EPMA 5HYIA 2H3NA 1IGYA 2YAEA 3MC0A 4XRCB 4FADA 1I1FA 4OM1L 2JCCB 4HS8H 3CZFA 5DC4B 2PYEA 2V2XB 2XWZA 3L5WB 4J4PD 1JXKA 5C0AB 2NY0B 3C5ZD 4F8LA 3WOVA 4FHKA 4LSUH 1U8HB 4PTUB 3SPIA 4JUSA 3HE7D 3F64A 3WDHA 5EEWA 3DGGB 1AKJA 2OMXB 1M9WA 1U9KA 4I4WA 4LFHG 4TQ8A 4YR6A 3RVTD 3UBFA 3UJJH 4EN2A 3SBPA 2VTFA 4M1GH 3BP5B 4TUJA 4XP4L 2DJ4A 1TEGA 3LRKA 2VGLM 4NWTL 4HMEA 4XAWL 3SY6A 1AACA 3I9PA 1NIEA 4BKSC 2CA4A 2XYCA 3GI9H 3TIDA 5B3NA 1GYAA 2WXHA 4FAAB 1QSFB 2WLLA 1AGDB 3AROA 1MJUH 4NENB 1D5ZB 3B2DC 1DSWA 1TQTA 4G3YH 3HR6A 2CR6A 1XO8A 2VDPB 1VFBB 2QADB 5AZEH 1J8HE 3VA2C 3WHXA 3O0LA 2CBMA 2HKHH 3TIEA 4PJ8A 3WTSA 4QR7A 4HIIA 4WENB 3Q5OA 5LGKA 3L95A 1M7UA 5EORH 3CFUA 4FG6D 3KWUA 1S7QA 4QHMB 3PE9A 4DPCX 4ZDHB 2ESVB 3E8VA 3OKLB 1SJXA 4PCSA 3GS4A 4JBSA 5JW5B 2WP3T 2WZPD 3ILEA 5DR5H 4WKZB 4OLUH 2R29L 3U0PB 1SDYA 3GMRA 4OF0A 1JRHH 2BNQA 2FO4B 3L2LA 3SYPA 1IM9B 2MOQA 3P73B 3QUZC 3HHRB 4PG2A 1X5YA 1E9PA 4GAJL 1MFVA 1RZ7H 3FU5A 1E9QA 3FN0H 3N42F 4M48H 4B50A 2XQ0A 4UT9H 1Z9SB 4MQ7B 3WKNA 4EKXA 4NNXA 4W4NA 4CKQA 2Q2EB 1AGCB 2XV3A 3SGEH 1I1AD 4O00A 3AG2B 5IOPA 1YEDB 4EVNA 1H19A 2W59A 1CFVH 2VT0A 1IEBA 3NP3A 3PWVA 5GJSL 1ZJBA 1INDL 1MWAH 1NAMB 4JFPB 3P2DA 3EJQA 4NP4L 4MMXC 4C56D 4EIBA 4X80H 1AR2A 2XZQL 1G7MA 3L4WA 4HFWA 3I2CL 3DROB 1MPAL 3NPSB 3LNDA 3VXTA 5I2IB 1CFMA 1VENA 2AAVA 4YIQA 4XE0A 2GC4C 4BIKA 1CFTA 2FX7L 3E6HB 5GGTH 1FG2A 3FQNA 4QRPA 5FA3B 4JG0H 3QAQA 1E5BA 4JB9L 4FE9A 4N0FA 2NW3B 2G75B 1T22B 5FYKE 1Z0NA 3QDJA 2E7DA 3TFKC 4I1NB 4TRPH 2ZWKA 1NKRA 1ZOXA 3GSQB 1NH6A 4GFTB 3D39D 3V9EA 1LEKA 5IB2A 5IV2B 4K8RL 3PWLB 5KTEL 4LCWD 4KO7A 3FRPA 1TZIA 2BHUA 3F6JA 3L3KB 2WBJB 2VQ4A 2FX9L 3SDYH 1A4CA 1PY4A 2DWYA 5ANME 1H0DA 3BESR 3KGTA 1IC4H 3SDDD 4OCXL 4Z7VB 4JKMA 5EEYA 1YYMH 4NRYA 5GRUH 4DGWC 1S9XA 2IIJA 2H0EA 2R69A 4ZUVB 3L3JB 1AG0A 1A6TA 2WKOA 1A6VL 5ECGA 3BN9C 1JK8B 1FGVL 5I26A 1OAUL 4YSUA 2VXVL 4ZQKA 4DN3H 2EH8H 3I3BA 3L3OA 3Q9PA 3B1UA 3IM1A 2OAAA 1JVLA 2A77H 4I0PB 1R5IB 3IDXL 5EZJB 3AY4C 3VYOA 4K7FB 1HJCA 5IF0A 5DEGB 2DMBA 3TCLB 1JV5A 2HFEB 4KROD 3VD7A 2AZAA 2OMVB 4WV1B 2XWRA 3D6GA 3LEXA 3IDGB 3MRCA 4HC1H 4Q6IB 4QRRE 3GSUA 5C0CE 2VLLB 4PS7A 2N56A 1F3RB 2UZXA 4N90D 1NCIA 1NWOA 5J3HC 1ZJAA 2ZONA 4M6ML 4JFVA 3NZ8B 3BIBX 3PHAA 4MZ2A 2SEBB 3RX9A 4NRXB 4P5TA 3GXIA 5LWYH 4Z3TA 3BZEB 1VFAB 3FFCA 1SYSB 5CU9A 4ELMF 1W0WA 4M93C 4UM9D 2ZUYA 4Y2DC 5IMOB 1JYXA 1HHIB 1E7VA 4X6CE 3QIUB 5AUMB 3FOMB 3K4ZA 1NFIA 1AZVA 2YIHA 2ZJSL 3FO1A 3L9RB 4N9OB 1UACH 2VO5A 1DBAH 1MFBH 4M6NL 1USZA 4AJYV 3GIVA 4OIAA 2WLZA 1JPGB 4WJKB 3ULVF 4Z8FL 3HNSH 5KSAB 1DQTA 3O11A 2X1XR 3O6FD 4TSAH 1F58H 1G7HA 3DJSA 2Z3FA 5A2BA 4YL4A 6FABH 1F3JA 5EF0A 4QNPF 5FA4B 3VMPA 4YS4A 3CSPA 1UCTA 4AI7A 3EHBD 5HGGS 3KLKA 1IKNC 5GISL 2D7QA 5B1CA 4WUUB 2B77A 2X44D 1BAFH 4P2YA 4JQVC 5J13C 2UZYB 3L1OH 5E2WL 3N1QC 4NLAA 3WDIA 1OP4A 2ARJB 3R19A 4NZ8A 4HCRA 3VFRB 2VDNL 3IETB 1CL7L 3V4PB 4LLVA 3CLEL 1EAQA 4XAWH 5IMKB 2P24B 5KYXB 2ZXBA 1YN7B 4ECNA 4MDJB 1U8LA 3GO1H 3CZKA 4B3VA 2OL3H 2WQXA 4GMTH 2HCZX 3MBEA 2QPUA 1RULH 3AQYA 1PJWA 1T3FA 1VFOA 2JJTC 5EOQL 5PCYA 4NO0A 1QBML 2CUIA 2X7LA 4WHTB 3S7GA 4KJYB 4QRTB 5BZXA 4PRID 5HHPB 3TO4D 4EQ3A 5DHVH 1HI6A 3AQDA 4J3UA 1JNLH 3DHUA 4WRLA 1KWKA 2VC2B 3O6LH 4D9RD 3MA7A 1F18A 3REWA 5DI8A 4W9LC 3NMEA 1FC2D 5IW6A 4BUQA 5IJBC 2AJZB 4Y19B 4KJQC 4HT1H 3UZEC 2XBZA 2GSGB 2WIMA 3CAFA 5F7EL 3QWRA 4KDTA 5A2JH 4JO4H 3S88L 5D1ZB 4ETQA 5TFSH 3AXLA 5JPNC 6PAZA 1M71B 2VSCA 3BKYH 3CVIL 5CKGA 4WGVB 3MLSL 5F9AC 2VABB 1CL7I 3IU3A 3NAAH 2K70A 4HCIA 2IDFA 3VNYA 1NGYA 3DOSA 4NOBA 4KI5E 2WXPA 5F3HB 5KBMA 2XIBA 3EH5B 4GAJH 5E9DE 3JV6A 3CPLA 3MNWB 4N8VA 3CDYA 4Y16C 3EJYC 1XF4A 1ACZA 3TA3C 5GJTL 1KCBA 2EEBA 5C0EA 5IHLB 1T03L 4ZPTA 4G1EA 4HEMA 1HFUA 2HYMA 2GEEA 5GJSH 1INDH 2XU9A 5AW3B 4NP4H 3CFBA 5C0JB 5EDXA 4LOEA 2XZQH 4ATWA 5DHXB 2C3GA 5E6RB 3VFSB 4RX4D 1LMKA 3SD5A 5ENWA 1TYJA 3US0A 4G7SB 4P2AA 4ORGB 2E9IA 2CJUH 2DICA 3A4AA 3MRQA 3LXUX 5FGBC 4IRJB 4LDLB 2AK4D 5SX4I 1AJ7L 1KDIA 1WBXB 3K6OA 5FUCC 1DCEA 3L7FA 5H37H 3CFDA 5BZWA 5GS0L 4OZFH 2VDOH 3UL4A 4R2GC 4X5XA 3IMBA 3CSTA 2W88A 2VDQB 2HG0A 1JYNA 5GZOC 2N7AA 1HT6A 3CZSA 1MH5A 2LE9A 1UVQA 4X4XB 3GXMA 1VGEH 5CEYB 2F74B 1NC2D 2ZAIA 4LIQE 2Z6FA 3ULUE 2TRHA 3KPPA 1IAOB 4MB1A 4I9WE 4EN3D 4RGND 3Q7JA 5DRXA 1ZVSA 2HX9A 2XG4A 4OCXH 4XMXA 5ALBH 3UAAA 1E6OL 3OXSA 2CMRH 3S37X 3GUTB 1C12A 3OAWA 1UD4A 2OZ4A 1MG3C 2A6JA 4LLDA 4CU6A 1EUTA 1L0PA 2GFBB 4MNQE 2ZX5A 4XCEA 3VXQA 5KUMA 4NN6C 5I1IL 2X9WA 3P0YH 4Z0BL 3GSNH 1AR1C 2W0KA 2YEVB 4FCHA 3TZVA 3POHA 1YEIL 1KPVA 2NY2D 3DI2B 5E1GA 4OFVA 2IPKA 1J7VR 3UAFA 2XQBH 3N41B 4EI6B 1DQJA 5AKRA 1U0QA 3OJVC 4PJBE 3DOHA 5EZIL 3EO0A 3I6LD 3ELAT 1L7TH 5LXGL 2FEDD 4P2OC 4P5MB 5F70A 5F7AA 1KTRL 5C09A 3GIZL 5F9WB 2WZAA 3IE9A 4P4KD 3TNMA 3VD4A 4M6MH 3MI6A 4HG4J 5KBPA 1B9KA 2WM0A 1AO7B 1IL1B 2EDTA 4N9GB 4J4PA 4EXKA 3ET9F 3MJ9L 3QRGL 5EU3B 3WEOA 3C5ZA 4O02L 3ASOB 4MJID 1W15A 4EDWL 1D5BA 4U6XB 5ISZB 2Q3XA 1DQLL 2FIKB 2ZJSH 2ZUXA 3CXDL 3HE7A 5C8JB 1DVTA 2OR7A 1FO0A 1NFDA 4M6NH 4P3CH 5IQOA 2EYSA 4HHAB 3CFCH 5LAXA 2ZG2A 3HRPA 4AJVA 5HYJA 2EXYD 3Q2NA 5I1JH 4UAOC 4IJTA 2KL6A 4F7KA 1UTDA 1YECL 2NY3C 4UT7L 2XI9A 1BYPA 3V6ZB 2HFFA 2DLTA 1HQRA 3QZPA 3ARDB 5BRZD 4JVPA 4JMXA 1SQ2N 2PETA 1SQMA 4IRZH 3HHSB 1WSST 1MUJB 4QAWA 1NSNH 4BKLB 2EDYA 2JELH 1RV6X 5CJOL 4Z7QB 1WUNT 4MD4B 2H0JA 3GRWL 4WJ5B 3EF7A 4HWEL 4U2YA 1QG3A 2D3NA 1UB6A 4I7ZC 4Z7VF 1U95B 4TNFA 1QEWB 3GGWB 2DH3A 2VZOA 4LKCB 2UYLB 1XGYL 4L9LC 2L7JA 4BCYA 2AV7B 2HRPL 3KEDA 3X3FH 1S78D 4BSVB 1ROCA 1XF2B 1T7XA 1QLRA 1Q72H 5CKAA 2WB7A 4Y4HC 2YAPA 1FYTB 2OJEA 1TYRA 5I6LA 3QYNA 2WZPA 3MUGA 2P28B 4Q9BA 5EOQH 3V0FA 3VWKB 1QBMH 4HWZA 3AGWA 5INDB 4RAHA 1R0AH 5KYWB 2W5PA 1ZA6A 4CVZB 3GS7A 2VN6A 2HUEA 5IB3A 3GK8L 3TT1L 2F5BL 1JTTA 3L5JA 1QTYT 3CZUB 3MNDA 3SDCC 3QPQC 1G1CA 3GKZA 3JTTB 1SVBA 5KVDL 2Z7WA 2OR8A 5DMIH 4YXHH 2RGSA 3U9UA 3EYFB 2DM2A 3POCA 1R75A 1I1AA 2GHWB 3DECA 3HZVB 3NJNA 4PD4K 4R3SB 5MI0C 1SLWA 1BBDL 2XKUA 3MLSH 4Z95H 1PDKB 4UOJA 1UWGL 4DO6A 4C56A 1QVOA 3RGBA 2F54E 3M17B 4PU2A 5JPMA 4Q6KA 2E6JA 4JZJA 2OMTB 3EUDA 3ZZQA 1E9OA 5EU6B 4NCC1 4MXQC 2RFXA 1J8KA 4LDEB 2E47A 3CQQA 3BEWB 3CVBA 1KIPB 4KKNA 5GJTH 1CLOL 2X88A 4GG8B 1I7ZA 1I7TB 1RIHL 3BAKA 5E99H 1UD3A 5DURB 1OZTG 1DP0A 4JDVB 3D2UB 1NCBL 4G2AA 1F45A 4FC3E 4G42A 2B3RA 1W72L 2Z8VC 4RZCA 3BX7C 2CZNA 4AGLA 3D39A 3UG5A 3MV8B 9PCYA 4BFNA 4KDWA 4KK5C 4LCWA 1D5MA 4QHUB 3D4YA 2FO1A 2EDBA 4ELME 2X4TB 1BOYA 4XN8A 5FYLD 1SVZA 4NAJA 3W5MA 3SDDA 5J6GA 3Q01A 2AZUA 1H3TA 2F8VA 3TA4D 3AT8A 2DYRB 4Y5XB 2DDQH 1N5YL 4NM4L 2XTJD 4E0RA 4HGWB 2B9AA 4X99B 1XFPA 3IMRA 3PP3H 4NC2B 5C9JA 4KI5C 1YNLH 4UTAH 2UY7A 3AM8A 3WJLC 3ZKND 4DETA 2NMSA 1NBVL 2GSIB 2YUWA 4M1CD 4N6RA 3F6LA 5EH1A 1OT1A 3PV6A 4TUKL 4I2XB 2C34A 5E00A 3IKCA 3RY6C 4GEIA 3US1A 3HPLB 4HKXA 1E6OH 4QRPE 3ZKSD 4W9KC 1Z3RA 3UYPA 1JHLH 4YDKL 5DWUH 1JZIA 5DEJA 3US9A 1P1ZA 2YLHA 5IFHH 1A7PH 3VDBA 3V5KA 2HZHA 3QDJE 3K6IA 5IFJA 4OJEH 5I1IH 5FO7B 1MAML 2IWGA 4Z0BH 3SDAD 5IMMB 4PYHA 1V54B 3S9DB 3WTXA 1G9ML 3QG6A 2E9GA 2CBQA 4OJYA 4LLWB 3KPMA 1T4WA 4KXDA 2DQUL 1V3MA 3NACH 5MEPA 1YJDH 2GBUA 2L7EA 3H7BA 4YLCA 5IJKA 2Y06L 2GVYA 2B14A 5J9PB 1KULA 5TDNB 5IFAL 1RZJH 5DMGC 4YSAA 1FL6B 1S9YB 2KLRA 3GIZH 1M3IA 3UABA 1M05A 1M9SA 1G7JB 1XGZA 2OXHA 3O6FA 2WWOA 3LEVL 4A37A 2K6ZA 5IREA 1T04B 5HHVH 4V1DE 1I1YB 3GSVA 4HZAA 5MEND 1RPQA 3B9KC 4I48B 2O5YL 3MJ9H 4YGVA 3ZK0A 3C08H 1T1YB 2NY5L 3NFPA 4F58L 4A2MA 4AKQA 3LRLA 1FN4B 4HKZB 4TPRH 1IBDA 4ZTPH 3FT1A 2XZZA 3QZOA 3LZQA 4ODVL 1R5WA 5F7UA 3JV5A 4R90L 2EC9U 2VZ1A 2WXIA 4UT7H 4QI3A 3WJMB 3FB8A 2FYYB 3TO2B 5IBUG 2ZKHL 4JRYD 3FU7B 5CINL 4FLRA 3FFCE 4YHYB 4AXWB 4R97B 2OSYA 3ISRA 5ANHA 4ZFZB 4B9CA 1ESOA 1NL0L 2JCCE 2CLVA 1RHHA 3TBBA 5C0AE 2JKTM 2XBDA 1DJXA 2MOGA 3JVGC 3X12B 1RZGB 3EFOB 5F44A 3EOAA 5FFOA 3TO4A 2Y9RT 4PRIA 4TSBL 4K7PH 4AOFA 5DZAA 2G3ZA 2Y5EA 2Q8AL 4LBEA 5I6XC 4WI0B 5E1AB 1GMEA 1FA4A 1N59A 3D30A 4E9QA 2EDEA 3O45B 5I1AA 1GJWA 1YY8A 1QQDA 4XPFL 2XBTA 1OL0A 2ATPA 1HCVA 2A6DA 2J55A 2GI0A 1AXSA 2YXFA 4ALAL 3V4VL 3TJHD 4QTHB 4N0YL 4AV4A 1ZK5A 2ILLA 3N41F 4NERA 4C54A 4PBWD 1QSFE 1UHVA 4ZW8A 2F5BH 4JLRA 5HYQB 1AXIB 3MV7D 5FCSH 1UFGA 4YXLH 1MJJA 2ORBL 4AQ1A 1CIUA 2CUHA 2BS9A 3LKPA 4UILL 3PGFH 3W0WB 5I1CL 1CTNA 4N6QA 3UEQA 4FERA 2VLJA 2DLHA 1V10A 1N5AA 1BBDH 4RGMB 1DUYA 3OB8A 3LS5H 4HJJH 4K3DH 3RGVC 3KMDA 4W9FC 2MNJB 1W8OA 2OMYA 3OG4B 1DL7H 1TNMA 2ESVE 1KBPA 4E9TA 4LRNL 2K45A 4O58H 2KHAA 1AIFB 2WTRB 2CDFA 1UKSA 1G9NL 3CLFL 4IHOA 5IVXB 4RX4A 4MKMA 4BQBA 3SYQA 2VOTA 3DURA 2GKIA 4IGBD 4TV3A 3K71A 3OJDA 2AFNA 2BSDA 3BSGA 4UV4L 1BP3B 2EDKA 4WSKA 3GMPA 2PN5A 2AK4A 1XZWA 4ZPVA 1RIHH 2YKLH 3QEHA 1P6FA 2DQFA 4U49A 1U3HB 2OZNA 4WHDA 1N6UA 5CZVH 1X9LA 5F7DA 3V6FB 4JPIB 2ICES 3AWGA 1NCBH 1EXUB 2FB4L 5BZDA 4E41B 1JUFB 2YHGA 3L4UA 2PPDA 3SE6A 3DGCR 2Q9OA 5HDLA 3S36L 2ZOKB 4OKVA 3BPLC 4BRVA 4J3OH 3BVVA 1D7DA 4Z7QF 2B1OA 4EN3A 3TH4T 3VI4B 1HHKB 1FNFA 3VFOB 1JF1A 2OM5A 1YNTF 3O3DA 1G7PA 4PYGA 3VDAA 5KSVB 1DSYA 3BZFB 1YHPA 4FULA 5HVHC 3AS2A 1SEBB 5EO9B 4DNLA 2QELA 3NA9H 4W6WB