1HJCA

Crystal structure of runx-1/aml1/cbfalpha runt domain bound to a dna fragment from the csf-1r promoter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
b'GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
publication title Structural Analyses of DNA Recognition by the Aml1/Runx-1 Runt Domain and its Allosteric Control by Cbfbeta
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 20
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hjcA00
1GZHA 4L18A 1HJBC 3WTUA 1CMOA 5AOJA 2X0UA 1T4WA 3VD0A 4IJTA 5LAPA 4AGLA 2GEQA 5G4OA 3IGLA 3Q01A 4GUOA 4LOEA 2BIOA 5ECGA 4IBYA 1EANA 4LO9A 1HJCA 2P52A 1LJMA 1CO1A 4G82A 5AOKA 1TSRA 4IBWA 2J1XA 2J20A 3WTWA 3Q06A 2BIQA 3ZMEA 2RMNA 2ADYA 1UOLA 4AGNA 3TS8A 3KZ8A 2XWCA 4IBSA 3D05A 3WTTA 4A63A 2OCJA 4MZIA 1TUPA 5A7BA 3Q05A 3EXJA 3WTYA 4AGQA 4AGOA 4QO1B 4IBTA 2FEJA 3KMDA 1EAQA 5KBDA 5AOMA 4AGMA 3EXLA 4HJEA 1H9DA 2IOOA 2X0VA 3US1A 4IBUA 2IOIA 2AC0A 4AGPA 4XR8C 3WTXA 3D09A 3QYNA 2YBGA 4GUQA 5G4MA 2VUKA 5AOLA 4KVPA 2XWRA 3D07A 4G83A 4L0YA 5BUAA 1KZYA 3US0A 2BIPA 2H1LM 2ATAA 3QYMA 2IOMA 4LOFA 2MEJB 3VD1A 5LGYA 5AB9A 1HU8A 4MZRA 1IO4C 4IBVA 4IBZA 2BIMA 2J6WA 2BINA 1YCSA 3VD2A 3D0AA 2J1ZA 3D08A 5ABAA 3D06A 2AHIA 1GZHC 1E50A 4IBQA 4L0ZA 2X0WA 2PCXA 2J1WA 3WU1A 2WGXA 5G4NA 3WTSA 1EAOA 5AOIA 2J1YA 3IGKA 3WTVA 2J21A
chains in the Genus database with same CATH superfamily
2A73B 4X4YB 3AB0B 4F9PC 1KJMA 1XIWC 4WGKA 2HT2C 2IANA 4N90D 4MD0B 3N40F 1KPRA 2HT3D 4RGMB 3B9DA 4M3JA 1AJ7L 1PY0A 3X13B 3DV6A 4M61B 4Y2DB 2HP4A 3RX5A 4AKQA 5ICXB 1AKJA 2ORBL 2X2HA 5I1LA 1M7XA 2V5YA 5BRZB 3FYEB 3VFPB 5ENWA 1CF1A 1AKPA 3P2DA 4D7PA 3DIVA 4L48A 3VH8B 4IBWA 4EQ2A 3HJ0A 5DD6B 2AJYH 4E68A 5DJCA 4U6YA 1ANUA 5EBLB 2X3CA 3LH2H 1X9QA 3VB9A 1X5JA 2IQAA 1BFVL 1NMBH 4RWYL 2C9PA 4YDJB 1FH2A 4A63A 1YMHA 12E8L 2BMKB 4MZIA 4NN6B 2N3JA 2WWOA 4OF5A 2IWEA 3NCYS 1ZHBA 4DNLA 2C9VA 4MHHG 1JGVH 4MAYA 3RKDC 5ICUA 4F9LA 3GB7A 4BJLA 3MGTB 2CGYA 1S3KL 4F93B 5HI5C 2YRBA 4X98B 1ZT1A 5C2BH 1YRKA 1D3CA 2ADJA 4M1DH 3BGAA 1AXTL 3PHAA 4IBUA 3L45A 4MAYC 4WK0B 3VFTB 1WWWX 1XXFC 1S4IA 4WV1B 3UJTH 3H7BA 3VI3F 3H9YA 4KKNA 1OOAA 4QXUH 1AQDA 4ABWA 1U91A 3HW7A 5HHNB 3FK3A 3U2SB 5FS5A 4DFIA 4AIZA 3T6WA 4BHUI 5IMLA 2L0DA 2JIXA 4M5YL 2EDDA 5KTEL 3IXTB 3E6FA 4KMQA 1XH3B 5C0CD 1G6VK 3N9GL 3RUGE 3CV5A 3PGDB 2A6IA 2FQGA 2P7TA 3AABA 1JZHA 3QBTB 4ZK8A 4OD1H 1OAZH 2GUYA 1OWRM 3ARFB 4MNQA 3ZR6A 1VJSA 3GGWA 4HUWA 4E9WA 1CGWA 4OGYL 2CMRH 1ULVA 4HIHA 5EC1B 3LN9A 2WNGA 2B15A 5DXWA 4Q58C 5CLXA 5D72L 1RZJC 1YNTB 5IHBA 3SKOA 4Z7UF 1I3RB 1YVLA 2F1EA 3IE4A 4NFDA 3DARA 3TWCH 3LTVA 3QJXA 1TFHA 1PQZA 3IETA 2J1YA 5KYWB 3EJZC 5I71C 3NIFF 1AGCA 4A6YH 2WUBH 4N20A 4OV5A 2WKLA 4TPRH 2WCPA 2VDPB 4X9GA 4X7TB 2IPUG 4GKLA 3QZMA 4XHQA 2BSDA 1DJWA 2VRKA 3C9NA 5E9DD 1CC3A 2BNRB 1RZFH 2PTTB 4P4KD 4IBYA 1UD6A 5J13B 6CGTA 2P8MA 1A9BA 5AZEL 5C0NC 4Q7DA 5CP3H 3PWLA 4XPHL 1EFQA 4XCFL 4PHZA 2ID5A 1MFNA 3LNIA 4O2CB 4ZRGA 4CAGA 5CEXA 4QOKB 3KYNA 1KTBA 3G5YB 2BFVH 4F7PB 4NN7C 3OKEA 3LB6C 4ZAKA 3N0AA 4WHDA 2VLKE 5EORH 2OR7A 3EO1B 2ZD0A 1E0OB 1W6LA 4UAOC 3U9PL 4YWGH 1UXMA 2YLHA 3L9YA 3FQTA 2YC1A 3LHPH 4ZMNA 1MCQA 4ZYKB 2H6OA 3LDBC 5JXAH 4HP5A 1ILSA 4ILDA 3WEBA 2WKGA 3G5XB 4HJ0C 4JFHD 1DVSA 3O9WC 3NGBB 5CFAA 1A6TA 1QFWI 5JUEL 3C09C 3DX8A 2W0PA 2FYYB 1N59A 2CHZA 2Y9RT 4JO2L 4ODWB 3V0AC 1NDGA 2IXQA 2I60H 4C83A 2IFGA 3DVGA 3CFBA 4QYOB 3VFGH 4B9GA 3BFQG 4GUQA 3L3HA 2EE9A 3VFUA 4OJAA 4J39A 4JRXD 1N8ZB 4KTDL 3UABA 5HYSA 1NCAL 4B5ZA 3ZT6A 2AABH 3U6RB 1JPTL 4NO3A 3MLWL 1KJVB 3KBEA 4WVRA 4W9GC 5D4HA 1TZIB 3HI5L 3FT2A 4JVUA 4LSQL 5LG6A 4GKOA 5ILTH 3DYOA 3CFJB 5CIPA 3UBXB 4IGBB 3TEWA 2OAAA 5FM8A 3P69A 4JM2B 1E4HA 4HHAB 3B83A 2I7OA 1X9UA 1HH9A 5E6ID 1CBVL 5EBMA 4QNPE 3SGEI 1QSFA 4OCMC 5JOFB 5GPRA 1F11A 2ISDA 3KLSA 3A5VA 3M86A 1GY1A 4QF1B 5DK0B 4H1LA 1ZLVH 4M48H 5A16A 1AS7A 3EH3B 3FQNB 4X6CA 3U46B 2AZAA 4M6ML 1RK7A 5IHUL 1HH6B 1SDDA 2XG4A 1TG8A 2F53D 2EECA 4DP6X 1MWAB 3BEVA 3L81A 4AJ0A 5IJDC 2F15A 4OD3L 1SRDA 5JMOC 3GSVA 4CJ1A 2XKNB 1U8CB 2XTJE 3MLPA 1SDYA 2CSPA 3CDYA 3L6FB 5DTFB 3WJLC 3QNZA 3DWTA 1QYGL 3QJVB 1T7WA 2CE6A 3S4SB 1K5WA 2Z4QB 3LKOB 2MNWA 4MMYB 1T1XA 3HHSA 3VXRA 2F1BA 1IUZA 3TNMB 1JZ3A 1JVKA 4ODTL 3RVVD 3K8KA 4YE4L 4LVOB 2AVGA 2R59A 2HMIC 2Q7YA 3KXFE 4K5MA 4NNXB 2OSWA 3RL1B 2J73A 2DKMA 4WWOA 2E4TA 4W9DC 1WBYB 5JLZA 2AXWA 4OZ4B 1DJYA 1RZKL 2HH0L 5C08B 2ICWJ 3B3IB 1P69B 2F5BH 4AEHH 1S7QA 2GY5A 1LK2A 1I7TA 3PWVB 2FNBA 2DYPB 4L4TA 5FCUL 4AGNA 3U4KA 4CN6A 1FH5L 4WIQA 2G5RA 4JFZL 1AP2A 3UC0L 4N1HB 2GEEA 2Q20A 4MB4A 1IFGA 1E4JA 3PV6A 3SDDD 1ZTMA 1TNNA 3EJQA 3SD5A 2EDKA 1UGNA 1UUSA 4XVJH 4JKKA 1NBCA 2OTPA 3RGVD 5KUKA 1G9NL 1GW0A 2Y5TB 5A2JH 4JGNA 1ZVYA 2XA8L 2FJGA 4HS8H 4APQA 32C2B 1P6AB 3AQXA 1G4MA 3IBEA 2VDLL 4A1RA 3H4FA 3ZZSA 4ZDHA 4IHOB 2UYLA 3L7FA 1YMME 4XO3A 4DOHB 4K55A 4LT7A 4PRBA 1W72B 2JV6A 3OKLA 1BGXL 3NA9L 3T5WA 4IRSC 1AZZC 3HNSH 4OUUA 1JNNL 4XX1G 3BW9B 1E7VA 1F1DA 3QAQA 1CTNA 2XN1A 2K8QA 7FABL 1MCOH 4R5VA 1DQJB 5E00A 5AUMA 2Y3NA 3DTXA 3CFTA 5GHWL 2G30A 4L3CB 2ADGA 4XMKH 1BFSA 3MRDB 1QSED 4YC2C 1OAKH 1IB5A 3QZWA 3AW5A 4G6FD 1AR1C 2XG5B 4YZFE 3P4OB 1J0ZA 2JTYA 3OC8A 3Q13A 1U6AH 2K4WA 1JE6A 2ATKB 2NOYA 1E5YA 1DN0B 3ARWA 3TP4A 1BZ9B 2WM0A 2Y1VA 2PO6B 1UFUA 4KDWA 2NXZB 3O0RL 3S3PA 5GS0H 1NUFA 1B0GA 1G7HA 4TNFA 3X14A 1XIWB 1JPFB 2A83A 2NYKA 2X87A 4OCXH 2X0WA 4BELD 4JY4B 4NI3A 1GZQB 3HIZA 1JD7A 1UM5L 3MGOA 4IKKA 3ARRA 4J3SA 1QLFA 1MNNA 4TULH 1LTXA 2BNQE 5GRXG 4DAGL 3NJIA 4A7GA 1I1FB 3NIGE 1U92B 5E8DL 2BH0A 3IXAB 5GS0C 1UVQB 4PRDA 1B6DA 4NB7A 5ISZE 1IV8A 1FZMA 1AGBB 4G42A 1RERA 2BS71 1HDMB 5JIQA 4DUWA 4PWEA 5I1DB 1PAMA 1CFNA 3WXVH 1ZTXE 3CVHB 4AQAB 1NCCL 3W56A 4XOCA 3X17A 5CEZE 2A77L 5KSAB 1MIEL 4IMKA 1SBBA 1LJMA 1CXLA 3HAEA 5DRZA 1PZ3A 3L17A 1JPGB 1PNCA 2X41A 3SPVA 4R4ND 4P07A 1M7DB 4O5LL 4E0RA 3NZUA 1Q9WA 3QZLA 1MRFL 5E23A 1MFDL 4OJYA 2BRRH 2C34A 3NK3A 2IAMD 3QXAA 3ZO9A 2GYSA 3C5SA 2H8PA 2X9XA 3EZJB 4XGZA 2XN9E 3NN8A 3U4EA 3K8LA 4XPBH 1V7ML 4ANWA 4NUJB 1DVFB 4HCIA 4PJAA 2OMVA 3SKUD 5KSBA 3CPUA 2X4NB 1RIUL 4WTXA 2PXYA 2V2WB 4JG0L 2D8KA 3LKNB 4R84A 3GXNA 3VNYA 3ILPA 5G55A 4RGNC 4NKIL 2AK1L 5JHDA 1GL4B 4FOMA 1F4WH 5CP7A 3JBG7 3UTSE 2AQPA 4B9PA 4YPGA 1KUMA 3LEYL 4WI4A 1INEH 1OVZA 1Q8MA 4KHXH 1QUNA 1Z3RA 2D4FA 4G59C 1C5CL 2IFFL 4PRHD 2Y1AA 1ZS8A 1WCBB 3O3BB 4CNIB 4ETQA 3IDNA 4DP0X 1LDPL 2ZXCA 1IQDB 4FFWD 3QZWG 4GI6A 4WUKH 1NBQA 4PEEA 3P30H 5IHHA 4PJ8D 5IVXF 3SGJC 5D7SL 2R4RL 1A21A 2HKHH 4FG4A 4OM0L 1J0KA 3KPQA 5L88H 4U49A 1MFCH 2GG1A 2OL3A 5DZNA 3QI9C 2AJ3B 2DRUA 2W0KA 2KZKA 3NZSA 1AS8A 1G7LA 1NC2A 5I71B 5E7BA 4PTUA 2JCCA 2BCKA 2V9RA 3D50A 4NLAA 3S3BB 3V5DA 4ZMYA 5F6HI 4NM8H 5G5DB 4HIJB 4JFQB 3T0VA 4J3OC 2XZCH 4Q56A 4WW1B 4S2SA 3UIZA 4F37K 1IEAA 3IJYB 1XL4A 2WVTA 4F2ME 5L2JB 1JFHA 1X9RA 1KBGH 3QQ4A 1CTOA 4LCVA 4JJOA 4JN2A 3WTVA 5BS0D 3V95A 3HPLA 4JQVA 2YD2A 4MA3B 1YUKB 2F19H 3DRTA 5EBWB 4A6YB 5C0DB 4U1JB 2WLZA 2VZ3A 3LPWA 4JG5A 1KBPA 3EYUL 4JDZA 2E86A 4P2YA 2FT8A 4NCC2 3VSQA 1NGWB 2XVKA 5DI8A 4NO2A 4OI9A 4QHNB 3EFFA 4MA7H 2R2HA 2VDOH 1IX2A 2GSIB 2Z31C 2W1NA 4TKWA 1BXUA 5IF0A 2DTSA 2LAAA 1QKZL 3NAAH 4A7TA 4NQSA 2Y7LA 5FUOL 3VWJA 4Z8FH 4F3FA 4HHGA 3RWHB 3M8OH 4X6FA 3VI3B 5FA3B 2CLVB 3B3BA 3WUWB 3O6KH 1NEPA 3KDPB 3LAFA 4UMGA 4ES8A 4I0PC 3LDBB 3CFKA 4WJKB 1ZA3B 4ZT1A 43CAB 2GUOA 3WHE1 1PYWB 5HBBA 1FA4A 3VW3H 3A4DA 4JPIA 4I87A 4RGOL 1RSFA 3C09B 1HT6A 1XF3B 3VFRA 3BN9D 5LWYH 2GIMA 4KK6C 1ZV5A 1RZ8A 1P4BL 5AWNL 1M7UA 4L3EA 4YFDB 2ZX6A 3WXWL 3JVGA 3S9DB 4ESKA 1RU9L 2RQEA 1PW3A 4X6BA 3RB5A 1M2VA 5D7LB 3V0WL 5C3LD 2B3RA 1REIA 2HN7B 3FFCD 4OCSH 4GW4B 3P4LA 4Y9FA 2QKIB 2IOIA 1DO5A 3ARED 5GZOC 3QAZC 4TVPH 5HVHB 1T22A 5D1ZC 5ESQA 2AMGA 3BUDA 1K5NB 4F7CB 3WUZA 4Q6IC 5JXEC 1IT9L 5F1NB 4KQ0A 1G7PA 2X4TB 4PJEF 1Y1DA 4KI5C 1S9VB 4Z7UB 1HCVA 4X6EA 3W81A 3ZHLA 1HZKA 4TTDC 2CDFB 2VZUA 4G8EA 4P2QE 5B1CA 1KNOA 4FNSA 4U6TA 4JAMA 5EIVA 4N28A 5I16B 5JW5A 1AHWA 5LXVA 3BP4B 4LOFA 2OCCB 1MCDA 3NIFB 5J56B 1CDBA 4S1QL 1Z9PA 2PYEE 4D8OA 1RHHB 4KJQC 4XCEA 1TFPA 2AFNA 4IBZA 2Y2YA 4MAUH 2BP0B 3O3DB 4HH8A 2R0KH 3NTCH 1M6OB 3HCVA 3L9RA 3NIDE 3VXPB 3VD4A 3HRZB 3WEMA 1R33A 2HKAA 1DANU 1I1AC 1M7IB 1UJ3C 3DMMA 3MRBB 5MEQB 3LXCA 2NY0C 4F5CE 1FZJB 3BAWA 4CW1B 2DWDA 3REWB 1IAKB 5BJTB 1A7NH 2R23B 2QGEA 1FBIH 3I9GH 5T5NG 1TXKA 2QELA 5GSVB 5BVPH 2VDKL 4G11A 5FHAH 5BO1L 5AAWC 1FNEB 5C1MB 4UM9A 1VGEH 3HZMA 4XC1H 1T5WB 4N0YH 5A3IC 4X8JB 4BK8A 3QXUA 1LDSA 1LK3L 4NO5B 1RUKL 1Z5LB 5JIDA 2YOCA 3KH4A 2EYSB 1DBJL 4HPYL 1FLRL 4AT6B 3V9EA 1SQ2N 2BC4B 1J8SA 1GAFL 3RNKA 1FFPB 2NY6C 4NQED 5H35B 4MA8H 5C0AB 5AKRA 4HEME 1LO4H 3PWUB 1ZHKA 3QQDB 5E0FA 5H2BA 3ZZ1A 5FIEA 5ID0A 3BVVA 3D85A 2GBVA 4G9DB 3I50L 1DBAL 2NYYD 5IBLC 5LGHH 1QBLL 3LKPA 3NSYA 1BJ8A 3ZHKA 1PSKL 3BVUA 3L5IA 2VGLM 4PRIA 4G8GA 1DVZA 2KMWA 3JZ7A 4J5VA 1CXKA 3HE6B 1OF2B 5I18H 2VC2L 1GA2A 1RZIA 5GGSA 3EF4A 3NPSC 4Z7VE 4ZNCD 4BZ2A 3KYOA 2ITEA 2QGCA 1GTFA 2DLFL 3QDJD 3QFJA 4I48B 2BHYA 5JO5A 1FE8H 5EF0A 3LIUA 3TC9A 4JLRB 1SJHB 5B1KA 4FQPA 5E8NA 3STLA 2X1OA 3F58L 1ZT7B 4IRSB 5DR5H 4BQ8A 3OMNB 4WNJA 4GSQA 4BCZA 5DJAB 4XPTH 2VXTH 3ILEA 2YARA 1BVNT 5KBLA 4UQ3B 4YHZH 3LNDA 1V5JA 2NT0A 1QFWL 1IC4L 1EBAA 3FN3A 1QRNE 1T66C 2RJMA 4U6XB 1A02N 5JHBA 3KYMB 5AW2B 5E08L 4FJZA 2WLIA 4KUZH 2EIEA 4MCYB 2FJUB 3BO8A 2EE6A 4A2HA 2V2TB 1HI6B 4GW5B 4LU5L 2XU9A 3IFNL 3G5VB 2QGBA 1Q9OB 2YEZB 3PWJB 4IBVA 3OV6A 2WSDA 2V8LA 2Y07H 2YUVA 3D33A 4IOIB 2WXJA 4H25B 4WSGA 4A55A 5HHVL 1MI5A 3TF4A 3ATBA 5DHVA 4Z7WA 4YHNB 2CBMA 4GQ9L 3KLAA 1O6TA 3C6SA 5AW3B 4QRPE 3LRSB 3HKZA 5DJ8B 2X4RB 4LF3B 4ES9A 1YYLL 2H32A 3MJ9L 3ISYA 4JM4L 1UACL 2BZDA 4O58L 3BYTA 1QUPA 35C8H 4FFZA 1ITCA 4IQHA 4P5MB 5D71L 2XWEA 5MP6H 1KIQB 3ZW3A 1MCIA 3OZ9L 5DK2A 2V9UA 3SJVB 4AIEA 1J5HA 1ECZA 5C3TA 2YQ2A 3QUXC 1HC1A 2CGZA 1AO7B 4LLQB 4JDVA 5IBUG 3OC5A 5B3JF 1EO5A 2D31A 4OFPA 4FTVE 3P0VL 3TYGH 1NCNA 2H0PA 2OMUA 4NQDE 1X4XA 2YXWA 4PJHA 5IMOB 1AGFA 4BA0A 2V3DA 3PQYE 4HALA 3IDGB 3SY6A 4XPGH 1KELH 1JUFB 4CSZA 4IRZH 2P5PA 5SWSB 4YLQT 5GZNC 5LLIC 1HEZA 3HZKB 1D5BA 1U8KA 5IMMB 3UO1H 3KZ8A 4XNDA 3DK2A 5F2FA 2VJ8A 1INDH 4HT1L 1SN0A 1UZ6F 4LKXB 3RA7H 4DVBA 2DQFB 2ZE0A 5T5FH 2Q8BL 1ZE3H 5AB2A 4L4VB 1W8EA 2BFGA 1EHLH 4BZ1H 3RWCB 4ZFZB 3FSZA 1RIVH 4X99B 3GO1L 3SDAC 5IVOA 5D2NC 5I30H 4RIRB 1Q0EA 1CF8L 3E80A 4WENB 1SHSA 4GAJH 3TJEH 4IKNA 4QEGA 2C9XA 3VTMA 3T04D 2YEQA 3SY0A 4JFDE 2J4WL 4IIQC 3I3BA 4X0KA 4GMTH 4JZJB 1ZE3C 2IG2H 4I8DA 4NWTH 1F3JB 2DLEA 1JAEA 4BFRA 5JW3H 1ORSA 1JP5A 1FGNL 4JY5H 4HA1A 4CSPA 3OLEA 4NUGH 5TDPB 1AHKA 2J6EA 2BDNH 2OR9L 3X2QB 2NY4C 4QI3A 4R26H 3Q6FA 3QQ9D 4Q8BA 3P9MA 3HMXH 1WAAF 2OULB 1QI4A 3IDXL 3QI9B 4BWWA 5EV7A 5ADPL 1MG3C 5GRVL 5LGYA 1E7UA 4ZPVB 4P3CL 4A67A 1MQKH 1KBBA 3MRCA 4JGJA 4URKA 2DLGA 4PJGA 4XBMA 5DZAA 1A25A 2DLTA 4XP9L 3WMQA 2R27A 3VCLB 5KYNA 5BQDA 1A9EA 4CC4A 4S1SH 1WH0A 4QOKD 5TE6L 1F02I 2GHZA 3WO4B 5FO8A 4DGWC 1X5GA 4OZHA 3IF1B 4B7LA 5HGHA 1VESA 3DURB 2WD0A 1ZIBA 2ZONA 3MLYH 5I5JA 4ALAL 4H8WC 3ARVA 5CD5C 2V9QA 3IDJA 4J3WA 4LCCA 4ZFOA 2V17H 3EHBC 3FUFA 3FH7A 3QORD 4KK9C 4I77H 3BSZA 4K7PY 3VXSD 4DZBB 2Z31B 5DQJA 3FCSB 4G5ZL 5FDWB 2AV7B 2WLHA 3EOBA 3O0LA 3DDGA 1IM3A 5CKGA 5IVZB 3R7QA 1A47A 3D25A 4UNTA 4U1SA 2KLSA 1R47A 1YN6B 3MV8A 2VLME 4PJ9A 5DD5L 3OXSB 4K8RD 3WN5A 4OLZL 4ZFFB 3GYRA 5JOPD 4FQIH 2BSSA 3UTTE 5DJDA 3PGFL 5JTWA 3MROA 3QGVA 1HJCA 1DQQA 4JRFA 1UM6L 4JQIL 3ZHDA 4ANUA 1C1EL 4L29A 1FRGH 1HHHB 2X70A 1QR1A 4DQAA 2KT6A 1AG0A 5FYLD 1S8DA 5HPMB 1OOWA 1BEYL 1T3FA 4UCFA 1H6EA 2K78A 4TNWF 4WTQA 3TASA 3UYPB 1K8DA 3QEGL 3GUTB 4DK5A 5EA0L 1MHPL 1X7QB 2OP4L 1KJ2L 3BAJA 5CCGE 5GGRY 1PTZA 1XSJA 3FQXB 1M05A 1QTPA 2YD4A 3EDDA 4PG2A 1I1CA 2Y6TE 3O4LB 5D9SA 3UEZA 1IGIL 5D1ZB 2ZWYA 5FX3A 1UC6A 4PWJA 5SWQB 2WZPD 4QT5B 5DJZB 5D5MA 2ZUWA 4X4ZA 2G3NA 1TEGA 1TIUA 4Q6IB 5TF0A 3ORJA 1WA0X 1I9IL 3IT8D 3MMEA 4ORGB 5AW1B 2YA1A 5TF1L 3SBPA 3VXMB 4K9EH 5IVXB 1CIDA 3DX9A 3GXUB 4EDWH 1AQ8A 3AY4A 2WTRB 1CFSA 2XPGB 3OL2A 4LRIA 2C26A 1NFDE 4LHQB 4OJDH 4RCAA 3RWDA 3MBXH 3O2DA 3MV7D 1AQKH 1SXZA 4L5FE 4N2IA 1YEKH 3V6BR 4OIFA 4E42B 3E7JA 3MNWA 1DVQA 1KBVA 4Y2DA 5D6CB 4PJ7E 3DXAE 5CJBA 4YGVB 1T5KA 2ZG1A 4DERA 2EUZA 3ULAB 3LZRA 2MH4A 2CHDA 4HC1A 4FL4C 3TBVB 1I1AB 5SWZD 2DQCL 1OE1A 2NR6C 3MACL 2NY0B 3Q8FA 1J5DA 2VISA 4L23A 4HFWB 5C08D 2BINA 1OEZW 4PRAB 1DUZB 3QXVA 5EBLA 2CKBL 3HUJF 1H8LA 4JR9L 1BZ7A 1L3NA 2XA3A 4KAQH 5E99L 5IUCA 1F1AA 4GNKB 4F1SA 1N0LA 4Q9CA 3FCGA 4XB3A 3VFWB 1KB5H 1NKOA 2R2BB 5E1QA 3FFOA 4WO4A 3F7LA 2UXTA 4X80H 1E4XI 3GC3A 4FQ2H 2DQUL 4R8WL 2NY6B 5LDSA 3I6GA 4Q0XL 3V4UH 4N8CH 3MJ8B 4QRRA 1O6SB 1DZBA 3RDTC 3CIQA 3P4NA 3NH7L 3DGGA 2MCPH 1AIFB 4NSKA 1Q0YL 4OZGA 2DEWX 4BK5C 4CKQA 1MNUH 2ZUYA 4F15C 1VGKB 4RZCA 1Q9LB 1TJXA 5J7CC 1EMTH 5HHNA 1N64H 4JQXA 3U2SA 3M1OA 1U8PB 1OAQL 2P44B 3KPNB 3K71B 3O11A 4YNYB 1A0QH 1KYDA 2O5NA 3N2JA 3ARDD 2R8SH 3F62A 1RJZA 5GRWA 3NJJA 1NCWL 4N3TA 1DN2A 2BSBA 3NPSB 4X4KA 3UYRH 5AEAA 4JBSA 1KPUB 4ELDA 2UV3A 4UIKL 5CJOH 2J88L 3MBED 1CL7L 4P46C 4P04A 1Z9MA 1A3QA 4PLOB 3ARFA 2E47A 3UX9B 3UG4A 1ZANH 3QE5A 1RURL 3FN9A 3EOYG 1FG2B 3PV7A 4PP2B 3W82A 4G7VH 4NIKB 4V11A 2OJZH 4PJEB 1F2QA 4NHCL 3SCMB 5A7BA 3OG4B 4WI6A 3FTZA 5F7EH 1FIGL 3FT3A 4H88L 3WNJA 1MAJA 4P0DA 3O8XA 4Y7MA 2VDML 2XC8A 4ZNEE 1I3RA 3RNQA 1QBML 1JCVA 2GJJA 2HT2D 1EX0A 5CZXC 3K80A 5L2KB 4LP4A 2D7MA 3WKML 3TBYB 4FG6C 4MDRA 1PZUB 1NGZA 4HUUB 3VGFA 1XCQB 1R5VA 4AE1A 2D7QA 3CMOL 3SPHA 2CD0A 2AJVL 4LEXH 3EGXB 5T3ZE 4IKJA 3Q0HA 1HL5A 2JB6A 1AQMA 3O2WL 5DSCA 4UQ2A 3HTLX 2NY2C 1SDAB 2WLMA 2VLLB 1R3JB 2VDRL 1VRSA 3B9VA 4ETYA 3WOVA 1AKJD 3OKKB 3BZFA 1JTTA 3IDIB 3O6FB 5I19H 4GUPA 1LE5B 1KIUB 1UB5B 3MA9L 1F4XH 5CZRA 3BZEA 4M3KB 3HEIB 3VH8G 4G7QB 3T0DA 1SEBA 1U8MB 1ZGLM 4RNRA 1F4YL 3DIDA 1IQWH 2MNUA 4XC3L 1IBZA 4WFED 3G5YA 3BAEL 3UTZB 4XBPB 5KS9A 3SHSA 3X3FH 1CU4L 3KPSE 1PLGH 1PG7H 3TZVA 3DROB 5HJBA 2R1YB 2VDQH 4QTHB 3BPNC 2XJLA 1CGVA 2APXA 2ROYA 4MAYD 3I84A 2Z7WA 4LDCA 5CBAB 5CM1A 4QXVA 2QMKA 3QUXB 3KCPB 2O6EA 4NZUH 1N7MH 3LQAL 2YGQA 2Q6WA 2X4PB 4KVNL 5F89B 5C6WH 4E9YA 4W68A 1J88A 3V5HB 3HJEA 4Q4IA 3QUZB 3MRRA 3OXRA 4DGIL 9PCYA 4AGLA 5I1EH 4J3TA 3MN8A 3QUMA 3T4AB 2XPZA 5GSRB 3HC2A 3SKMB 1N8ZA 2VIRA 2BVEA 2ITFA 4ZMVA 4XO4A 1FHGA 1Z0NA 5C7XL 3U6RA 25C8H 4EUPH 4PTTA 2PPEA 2HVKA 1KJVA 2AJUL 3NFPB 2IDUA 5T1DL 5ESAA 5KAQG 4MNQD 3SDAB 3VYPA 5J1AB 3G08A 3UBXA 3QEHB 4OQTL 2IJ0C 5J6GA 2WKOA 1PPIA 3GSNA 1MLBB 1FFOA 1NOFA 2K3TA 4KNQA 3BUQA 4JM2A 1E6OL 3FQUB 4HHAA 4IIQB 4NJAH 1S7RB 3CZLA 3TBTB 1CGTA 3PXLA 4Q9BA 4UMSA 4WSJA 3EJZD 2JKLA 4HX1B 5I1JH 4QF1A 4R2GB 1O7DE 1YLBB 2HZHA 3BZ4A 4LK4A 3VUAA 2FRGP 3CVIL 5I2IB 5GS1C 2JQMA 4YHOH 3IU3B 4DKFL 1UEMA 4AH2A 2XYCA 2XN2A 2W0FB 3L5XH 3QCTL 5KVEH 5F3FA 2OK0L 1OAXL 3MXWH 3TO4C 1CDHA 4K3EL 3FSWA 1OM3H 3ROLA 4HS3B 1A7BA 4XNUH 5DD3H 1FCGA 1JL8A 1S78C 3LH8A 3D07A 4JFEA 5C0ND 3P3RA 3W0WB 1LO2H 4X7DC 1SNRA 2AQSA 3UOAB 1T04B 4XXWC 3TT1L 3BZ5A 3QZPA 1D6EA 3GJFK 4U1HB 3CXDH 3H1ZA 4H0HB 4C4KT 5ALCH 1IJNA 1YY9C 3OB8A 5LVEA 3PWVA 1A7PH 1EXHA 3H42H 5EZJB 5FR3A 3QR1A 2J1ZA 3WV0A 1SYSA 5GGVL 3UADA 1VPOL 3H3BC 4LSRL 3MOAH 1T80A 3MLRL 5IESL 3O2DL 1W0VA 2VKWA 4HJ0D 4Q9QH 3O9WD 5L0QC 3LS5L 4YHYB 4Z3EA 2WTPA 1EV2E 4DUVA 4XAWH 5CF3A 5HP5A 3T0EA 2DS4A 4Z5RB 1WA1X 4Y4HA 5KBNC 1XR9A 5IJVB 3AUVA 2Q3XA 1FL6B 1U8HA 5EU4A 1KFAH 1HINH 2G0KA 2C8NA 1SXBA 5D7LD 2MQ0A 1F6FB 2L7EA 2NY7L 4HC1L 4I5BB 4QNPF 4N8VA 2PR4L 5E1AA 2H2SC 5CGYC 4UIMB 2W9EL 4GLRH 1MF2L 2KDGA 3IGAA 3VYOA 2A3TA 1MIML 2IQ9L 4DN3H 4TSCH 2Z0UA 3REVB 4KH9A 3L3IB 4FFVC 4G7SB 3BW9A 4Z3GA 2IAAC 2P52A 4UU9B 4UB0L 5KBKA 2XWZA 2WIMA 1QSZA 4L3CA 4PS4H 2IPUK 2WYZA 4OLUH 3V7MA 5B7FA 4HGWB 2ARJB 4KZEH 1J1OL 1UXSB 2OSXA 5TK2A 1MJ7L 3E8UL 5EN2B 1WAPA 2ATKA 1DN0A 1LEKB 3IE9A 3TEUA 2NNRA 5BPPA 4OJFL 1UZGA 2VL5B 3AU1B 1ACYL 3U25A 1NUDA 2AEQL 1QSFD 2IIJA 3R18A 5E9DE 4YX2H 1MFAL 1L9RA 3KGSA 5FGBC 4LCWA 1QHOA 4L9DA 4LPTA 4CJ0A 5HDQL 2XQBH 4K7PX 5KANG 2CGRL 3SN6N 1C5BL 2CO4A 4KXDA 3OLIA 4M7JH 5DUPL 2KH2B 3VX1A 3E6HA 4FL4B 4FQCH 3QUHA 2XWRA 3S4SG 4OGZA 3QJHB 2VDNH 2QL1A 1TVDA 4LSUH 4KDTA 4M8QB 4PRPD 4W6WB 1F6AA 2ARWA 4YO0A 2Q76B 3VXRD 3SQBA 3QQ3B 3WE6A 3WLBA 3CVHA 4YEFA 4BH8B 7PAZA 3AAZA 3NCJL 5C0AD 3K2MC 1TVHB 1EHNA 3US9A 1DQDL 3EF7A 2A2QT 1JHTB 3VDAA 3MCLH 4PGCB 1SVZA 2VLRA 1M7DA 1QO3B 2HKFL 5KJ4A 3TYFA 4XXDB 3FUJA 3W2DL 3LEVL 5H37A 1JI2A 4HFUH 4HWBL 2MPAH 4KVCL 1S7XA 1JFQL 1KB5B 2BVUA 2VDPL 4BD4A 4BUQA 1I7ZA 4DN4L 4S0TD 1E2WA 4IBQA 4O51A 4YSQA 3RDTB 2I07A 3CFIC 1B4JH 2BJML 3E3QE 3QHZH 3T0AA 1G9MH 5CN2A 4MX7A 3CJJA 1U2CA 4NUJA 2ILLA 4BFIB 1DVFA 1GGBL 4NZTL 1RUQH 2XTJC 2ED9A 2ENSA 5C0BD 1KTJA 3MFFA 2IGFL 1G9MC 4N3UA 3JV4B 2G5UA 3OX8A 1N3NA 4P46B 2LW3A 1SMOA 4LOEA 1E4WH 3NIGF 4WUUA 1AR1D 5HHOE 3ZDWA 3ECVA 4XVUC 4HJSA 4Z95L 5TDNA 5D1XA 4M4RA 3OGCB 4NZJA 3VJ6B 5JR1L 4FN0A 2ZXGA 5AZ2L 1YYMH 1PKQB 4XNMB 2N0KA 4OLYL 3A6CH 2F53E 5B39A 1RUAL 4NQUA 3RX9A 1NH6A 2NXYC 2QSQA 3GPEA 2D9CA 4N9GB 1A14L 2BERA 2IDCA 4QXGH 3SSGA 3T1WA 2AJ3A 43C9B 1FFNB 3QDGA 2FEJA 4Y16C 1U8JB 3S37L 1L9SA 3CZGA 5G5DA 4H0LC 4HIJA 4ADGA 1G4RA 5CEYB 5CU5A 5DQDH 2C3XA 1CVRA 3BAXA 4KRLB 1ADQA 2NY2B 3WJMB 4GEIA 3TA3C 4OFDA 1IAIL 3HUJB 2R29A 2VUYA 1YEGL 3SDYH 4QWWC 5FYLL 2H5UA 1KCRH 5F1KC 4ZXBC 4WTZA 1RY7B 1HEJC 4L0YA 3PDOA 4JRLA 5GGQL 2N56A 2UZIH 4HGMA 5DYOB 4GIPD 4M62L 2YK1H 5E2UH 2X4OB 2DQMA 3HB3B 1GGIH 2FQDA 3BHBA 3GBLA 3J07A 3SQOL 2JJVA 1B4RA 3ETSA 4WAFA 3R1GL 1QFOA 1QNZL 1O5PA 3BDBA 1BV8A 3O41A 3VI3A 4R6UA 4C58B 1ND0A 3CLFH 4N2KA 3ML8A 4HBCL 4Q9RH 1MWAL 4HWUA 1T4KB 3DRQA 3TT3L 3QUKB 4LCUB 1H6FA 2QPEB 5AZUA 1K6QH 3GJEB 4AQ1C 2G60L 4TXVB 1OCCB 2QTVA 4X8GA 4F7EB 5C9JB 4LLMA 3WU1A 1RJLA 2K3HA 4Z3IA 2WLYA 5H94B 3L3JA 4P23A 4AMWA 2DYSB 4Y5XC 4FA7B 2YD1A 2W07B 1AD0A 3QC6X 5F7UA 1E65A 2HN7A 1GZHA 1QD0A 1Y6MR 1ZTXH 5FW6A 4MA1C 3MJ7B 3GPSA 4RGND 3C6LA 5CEZH 2AXGA 3KPRE 4R4FH 4MCMA 5B22A 2P48B 2FBRA 1YEFL 1OD7A 1E4XL 3IPEA 3CBJB 4P23C 3KE0A 5DC2A 4TV3A 3LZNA 4MWFA 4YLCA 1QPPA 1E3FA 1K5NA 2L7QA 3N0PB 3B2PA 4FP8L 2RTTA 3QIBA 1BM3L 2C3VB 1SGKA 4ABQA 2M8XA 4OU3A 5JHDD 2EZ0C 2WXMA 4HW6A 4GG6E 4JJ5B 3ZPDA 2FE0A 3KWWB 3TJPA 4HG4K 1CVSC 1ODUA 2K6YA 4IU3B 1NL0H 4AM0Q 4E41B 1NAKL 2GJZB 2YUWA 4XMPH 4EUPB 1KN2L 1SOQA 2IH8A 3ZE2E 2ADYA 2E9GA 2DJSA 4JCWA 3JZYA 5DRWB 4LLWA 4WF7A 3GBDA 4IW4C 3LQZB 3NEXA 3AITA 3QHFH 5ALBL 2LV4A 5IR1B 5IWLC 4J3OD 5GS1B 5HHXH 1HXKA 1DDHA 4OCNC 2QADC 1M7IA 2JJSC 1A3LL 3MRBA 5T1LA 1TT6A 5KBDA 1HWHB 1PZDA 1QLRB 1W72L 3Q6GH 3L5WB 4LKCA 4YPJA 4N5EC 2B1AH 2GVYA 4DP4X 4WY7H 5C71A 4X5QA 2ZOOA 3BGFC 4JHBA 1NMAL 1UFGA 2XX0A 4JDEB 4PJFE 3PJSB 1F3RB 1Z5LA 2Z31D 3TPUB 2NY5H 5HYJD 4RX4D 2DWXA 3HFFA 3OPZH 3ZSTA 2AVFA 4MCZA 2EEXA 3FN0H 2O61B 1WISA 3FU9A 4PCTA 4ELME 1JGUH 1NIBA 2XIDA 3ULVF 4I0PD 3PWUA 2NY5C 1R3LA 2GIXA 3P11H 1LXMA 1B6UA 3TXAA 4CRPA 2UUDK 3NQKA 2Y6SC 4G6ML 2A0LD 5JIIA 4M4PA 1FYTE 5E2TL 1ZDQA 1DSYA 1WLHA 4DEWA 3WUWG 1CFTA 3D0AA 4KK6D 3OVUB 1WFUA 1I8IB 2G9HA 4TQ8A 1AGDA 4MJ2A 1XZWA 3UCQA 4DPCX 4GBXC 2GABA 2YPVA 1XTMA 1HQ4B 2ZKHH 1SJEB 3EO0B 5GZOD 4TUJB 5DJ6A 5G4NA 2LFGA 5D1ZD 3BT2H 1MRDH 4L3ED 4U3HA 3F5WB 2VZOA 3BWAB 3CVHL 1AYOA 2HB0A 1G94A 4L2LA 4KI5D 2AS5M 1MREL 3L1OL 3SYOA 4KUCF 4ZBJA 4TTDD 1BA9A 1BEXA 2Q9OA 3GSQB 3VFMB 4TVPD 5C2UB 1WFJA 4OFVA 3SGDH 2AJYL 2GEQA 5BRQA 4LVHC 2YEVB 4O9HL 1OTTC 1HHGB 1OWWA 3LH2L 4OVVA 4ZW7A 3ZQ9A 5FFOA 3IGLA 3ATEA 1EAJA 4FQXB 1WICA 2R15A 3QZNA 5D1ZI 3EJJX 4KJQD 3U0TA 1NMBL 4X9FA 1MAKA 1HOCA 2PP8A 4K23H 4KKBC 4LPUA 1W2KT 3GMQA 5TFSH 2VRAA 5F72S 1KYUA 1MEXH 5EU3A 5F6HJ 4MCYA 3RWJB 4KROC 5MEPA 1JGVL 2BM3A 3CNKA 2VLKB 2NUTB 3A22A 4JFPA 4HKBB 4PVBA 1I1AD 1UWYA 4QRUB 4XE0A 5BS0E 1Q9OA 2YEZA 4ERSH 2NY0D 2WQUA 2WIIB 1XR8A 3KPTA 4M1DL 4MB3A 3MX0A 2FGZA 3IJSB 1UXLA 2Y7OA 1SZNA 5BVJB 2H45A 3UJTL 3FRUB 5AL8A 4Y19E 3ZDXF 4QXUL 5A3ID 2EVHA 3LRSA 3QEQE 4KXCA 4HV8B 3EYQD 3BN3B 1AXSA 2D7TH 2EIZB 2FZ3B 3NCFB 4N0RA 4OF7A 4Z7QE 3NRFA 5KN5B 2PTVA 2OYMA 1FNHA 4NPYB 3QIUC 2QV4A 3B1TA 1DR9A 4GXUN 3V55A 5E0QA 1DJIA 4UM9D 2BY2A 3O4OB 4UBDC 1MUJA 3SE3C 4KY1H 3LS4L 3SJVA 4ICXA 3K72B 5F7BA 3AT8A 5J06A 4DP5X 5LGJB 1AC6A 3TH3T 2VDNB 2ITCA 2PABA 3I75B 5IBLD 5J6HA 4X5XA 3UZVB 3VM5A 2CMRL 5E03A 5KVFE 4MJJA 4DKAA 4HUVA 2YA2A 2F74A 3V0DA 1U3HB 2E4FA 2YQGA 1PLAA 3QP3A 4UT6A 1UJTA 3D85D 4GKSB 3QT2A 2HLFC 4WWID 3IDGA 2BK8A 1JUFA 4L9LA 5DMKA 1BP3B 3K2IA 3ZHNA 5AL0A 5IMMA 4PRID 4QPEA 1KN4L 3GHEH 4AQEB 3WY2A 3AS1A 3NA4A 2WUBL 2XFXA 3S36X 4A6YL 4AZ8B 2WZ0A 1XGTB 2ICWB 5EO1B 2PW1B 4GFXA 4I7ZC 4TPRL 4NAQA 4YSOA 2VXUH 4PVLA 5AW9B 1XWVA 2XTJB 3QFJD 4L8DB 4ANVA 1JV5B 3FUKA 1L0PA 1UB6A 4M6NH 4ZFZA 3MNZA 3CBKB 1BECA 4J2QA 5IHLB 4I18C 1T7YA 2FBJH 1Q94B 4OAWB 3KHOA 4TQIA 3WAKA 3KEHA 3KW8A 5L2KD 1RZFL 5F9JB 1AOHA 5DHYB 4JZNB 4Y2LA 1T66D 4PLKC 2J2ZB 4RFEA 3KXFB 1SY6H 4Q74A 1HHKA 3KHQA 5C92A 1RP8A 1TCMA 5FK9A 2IWFA 4RETB 2XICA 4LCYB 2ADFL 4ZMAT 3BH9A 1GVIA 1PY9A 3H9SE 1YPZA 5TDPA 2BFVL 5LCVA 3VFOA 3VRIA 1KULA 3MJ6A 4WO0A 1UASA 2F0CA 5FO7A 4EI5A 3UBHA 2IH1A 4J6IA 2J5LC 4MXQD 2Z92A 3G9VA 5EORL 3JWDL 5FGSA 4HK0A 5FF6A 3T2NH 2NTSP 3CHPA 4KRNA 3FQWA 4N68A 4YWGL 4JL2A 2CJUH 5IB5B 3OMIB 4N0FA 3LHPL 4N85A 4Y16B 2XHNA 5JXAL 1T2XA 5E4EC 4EI5C 3HE7C 4Z7OF 5J9PB 3HG1E 3PLYA 1WT5C 1A1MB 5JIMA 3WTTA 1RFDH 1MI5D 4W93A 2OZ4H 4B53A 2I9TB 2DJ4A 4KPHH 1LP9E 3RWFB 4S1DC 5CBEA 3PP3H 4JO5A 5TE7H 4NNYA 2WXPA 2I60L 1FVEB 2HX9A 1KF9B 1ECYA 4JCMA 3D1MC 4NQEE 3DURA 1O5DT 4HEPA 4HUXA 3SODB 4ZXBB 3VFGL 4PRNA 4NENA 3EBGA 1A7OH 2KQMA 4F7MA 3DX6A 4P59H 5D70H 5FV1L 1IBFA 1FN4B 2YAMA 1GGYA 1RJYB 1NGYA 3FMGH 4OF0A 5EFIA 1VKXA 2AABL 2JK5A 4HQQH 1Z5YD 4DZBA 4EZJA 1FV1B 2DDQH 4MQSB 4XP5L 4HS6B 5I8EB 4W81A 1NCDH 3ETBF 5A7EA 4KXZH 2D0HA 3M45A 2A6DA 3OXSA 1KIRB 4XWOC 1B4LA 5JPMC 3QDJE 5GZND 2YPLB 3OAWA 1BG9A 3VU2A 1EZUA 4F2FA 4N26A 4KDVA 3IRPX 1GHFH 2XQYG 2ZUVA 1F5WA 1G7MA 2PCPA 1KJ3H 1L4IA 3CN2A 1Q1JH 4FKEA 3T77A 5FOBB 1U3ZA 4ZSOE 4ZX3A 4NQVA 4CU7A 3GMOB 3F83A 3SDAD 1DJSA 4Y5XB 3UYPA 2BNQB 4P5RA 4HSQA 3NIGB 1X7QA 2N1TE 4MA1B 3IS1X 4OI7A 3BH8B 4HH9B 2JKIS 5ISZB 1NFIA 1YC7A 1MDAA 4XWGH 4H5SB 4HDIB 5DJ0A 5FUCE 2XUWA 3KDMA 2EUWA 2VM3A 4K94L 3QJQB 1RVFL 3QA3A 5F6IC 3MRQB 2X7LB 3S5LA 8FABA 1Q4NX 2NY4D 5IBTL 2JB5H 4ANXA 2F5BL 1C08B 4AEHL 4FADA 3SIKA 3TBBA 3V7AG 1CLOH 4LLAA 5AVXB 1NGPH 4B27A 3G6AB 2F18A 4DKTA 1KCVH 4CSTA 1J0JA 3DX2A 1MCRA 2HFEA 1TF4A 2AMUA 3JTBA 2BW5A 5B21A 1FUNA 1K72A 2OYLA 2B4CL 4GIOA 4XVJL 1GIGH 4IK6A 3WTWA 1I8LA 2QADB 3CFQA 1PZCA 2XDHA 2ED8A 3NDYE 2D3VA 5LDUA 3FONB 1KOAA 2XACC 1I7UA 2XN9B 5CD5D 2IF7A 4TLUA 1E8ZA 1DUZA 2JFCA 4NM4H 3EXJA 4HIIB 3EHBD 1TU2B 2VCOA 3OQRA 3UAFA 1MY7A 2GPZA 4KK9D 1KTDA 4Z76B 1C16B 1QQDA 4NRYA 2LU5A 3V4LA 1A2YA 3OF6A 1UKQA 3CSYA 3IAPA 4TUKH 4EI6A 4ZMXA 2H6PB 3HNSL 3U7YH 1NAMB 3RB7A 1I1YB 3PF2A 5AW0B 4PY7A 4APXA 4OBSA 2RGSA 3WIHA 4PV8B 4NC0B 1OAYH 4UV4L 1MCOL 3N3EA 4NQCD 3FQRB 4DPRA 3EJPA 4Z9KB 3UTSB 2ZYRA 3S8FB 4YL9A 1MFEH 2FVNA 2A9CA 3NK4A 5MHSD 5LN4A 1DE4A 4XMKL 4YQXH 1TJIH 2GC4C 3EH4B 5C0FB 1F2XK 5DURD 1FL5B 2VQ4A 1QFUH 3MV8D 2OMZB 1U6AL 2BVYA 1UWEL 2A74C 2Z4TA 1JWUB 2DV6A 4WSKA 3B2VL 4GRMA 5HDLA 2AQ2A 2NQDA 3VXUB 2OQJB 4KKRA 2W9DL 3G6JE 4JVPA 3QRFM 4FNTA 3OHXC 5GS0L 4YN3A 3FU6A 5HDRA 2J43A 4OCXL 4A7QA 5CN3A 5LO7A 5JHLA 4RISL 1QNIA 4PJIF 3U36A 4GQRA 3GZKA 5DZVA 2ZWKA 3D08A 5K33A 5TD4A 4F2MB 3CHRA 1MY5A 4LAQH 5JIKA 4O02A 2I5YH 5FLVA 5DVLA 4WNQB 3SCMA 3LN5A 2ERJC 4AG4H 4KZ0A 3DHPA 1G0DA 4K7FB 4Z18A 3VWKC 1UENA 4GO6B 3E1F1 1G6RH 1VFOA 3HNVL 3GS4A 1ZA6B 5FA4B 3WXVL 2YFNA 3IMTA 3MRHA 3N5AA 1P2CB 1D7CA 1CWVA 1K4DB 3GMLB 3TBYA 2EC9U 1N2RA 3TBSA 4YDNA 2N4IA 3U4AA 2W80C 3ARYA 4ADIA 1HXMA 4XXCC 4DETA 1FVCA 3BCDA 5D93B 1DQMH 2H2PC 4CADA 2OA9A 3EGXA 1ZJBA 2WVVB 2XWJA 2BRRL 4D0BA 2C1PA 1T89A 2NR6D 1JNHB 2VLLA 2QPUA 3LKRB 3GQFA 2YD7A 3P02A 1O0VA 5F1OB 4YAQA 4DSYA 2L7JA 4P5TC 4EKXA 5IEHB 5DMGD 2Q86B 4JZOB 3O6FA 5D4QA 2ENQA 3TCLB 1AD9A 1A3RL 2Z35B 1LQBC 1LNUB 1UQSB 1TOXA 4N6QA 3RIFK 1IBGH 3BGMB 3I3DA 4XPBL 3VXSE 3B9AA 1QHQA 1NIEA 4XOEA 4PGBB 1L5GB 3UIYA 5IG7A 4YDVB 3HFMH 2OCJA 5GS2H 1PG7W 4UV7H 3SDXE 1N6QH 1SYVA 1ZDSA 2AF2A 3GMNA 3QIUB 2N01B 4XBPA 3BLPX 4L8SC 3MJGX 4ZOAA 4JG1H 5DHDA 5JOPE 4QTHA 5INCA 1ETZA 1CB4A 3GTTA 3CSFA 3K0WA 3AGVA 4L5FH 2CK0H 2VT0A 1CQKA 3ARSA 1F4WL 3X1GA 3R7RA 1INEL 3EO9H 2X4PA 4KHXL 4QRRD 2MRYA 2CLZA 4P2QB 1AIZA 2X6CA 5B8CC 1CXHA 4A2FA 3KL5A 6PCYA 3I6KB 4WUKL 4L1SA 3P30L 2R1XB 2PYEB 4DTGH 5KYYB 2WB7A 1VHPA 3GDCA 2BVOB 5CXPA 2QR0A 5EN3A 3T4AA 1XGQB 5L88L 3BPLB 4RQQB 1ZLDA 1I8MB 4P46D 5DUMH 3NIDB 3FOMA 5I6PA 1GGUA 2VN5A 3FO0H 1HNYA 1C8PA 1S9YA 1NCOA 3QEUA 3TN0C 2YQBA 4NM8L 2F6AA 3WD5H 1MHEA 1R3IL 1DCLA 1NJ9A 1TKWB 5CWSB 4IRZA 4JO1H 2XZCL 1IGFH 1XF2B 4J12A 4MLSA 3NFPA 3CUPA 3VGAB 4BBWA 3VDBA 2HVJA 5DA4A 3KJ6H 1JPEA 1GC1C 3QEHA 3TVMC 3MV7E 1W16A 3MRLB 4P8QA 1QZNA 2XTLA 5AYTA 2DB8A 1S7RA 5IHZB 4FG6D 4HX1A 1M6UA 3O8XD 4PJXE 5DCCA 2AEPH 4YSTA 4N25A 4MA7L 1DLFL 4LDOB 3GLAA 4YDZA 2VXQA 3IU3A 5LN8A 4CKVX 2W0FA 3ERXA 2NY2D 4WKZA 5I6KA 1FO0H 3KYAA 4XN7A 2J5LB 3NAAL 5GGVY 1AZUA 3V4VH 2CK2A 4V33A 4Z8FL 5I6XB 3D39D 5CHNA 3M8OL 1ZEAH 4J6RH 1U58B 2NX5D 3V0GA 2BOBB 3EYFA 4LGSB 3GLZA 2VAAA 3HE7B 2P1YA 2ZOWA 4QRAA 4KRPC 3VW3L 1UWXK 2UWEE 4C56E 1OB1B 3PGCB 1UZ8B 2WCSA 4Z7VB 4ZS7H 3DIFA 4DWHA 5CNHA 3V6FA 4U1HA 3BUTA 3QS3A 2OLDA 2ZWSA 2YGVA 3F64A 2CDGB 4W9HC 4YL4A 5C6TH 5KBMA 3O3AB 3ULSA 3LMJL 4UTBH 3F7KA 4OCSL 4P57A 4WDIB 4A7UA 2BSTA 5FKPA 2R0WH 3DJSA 1AR2A 2GCYB 1WTLA 1KYOK 4ZPTB 1GS6X 3K6NA 3QUYC 1SN5A 1B3IA 4TVPL 8PAZA 2HA1A 1E5CA 3VXQA 3Q48A 5I17A 1G9HA 3C2AH 3BJ91 1QX1A 1U8QA 3C8HA 4NO0B 1X5MA 4ZUWB 4FDWA 1L0XA 1PBYA 5T3ZH 3U6XA 3WNPA 1FNGA 1QRNB 4NN5C 4NT6A 1FDLH 3C8KB 5DRXB 5T1JA 2FAUA 2CALA 1JV2B 2WYTA 2QDVA 2VLJA 5JPMB 1UT1A 3CZUB 1UD8A 4RFOH 4MD4A 2FX7H 3BE1H 1E28B 2RCSH 4FXTA 1G0XA 4L8BA 3L3DB 4X7CC 5IFJB 1GCFA 4MAUL 1JN6B 3VRLE 3NTCL 4U0QB 3NSXA 4PJ5A 1LEGB 5E56A 2GTZA 5E6SB 3REVA 5CJXA 4NWUH 1IL1B 5ITFA 2C4FU 1ORQB 1WF5A 3BPCA 1R24B 1XH1A 3QZOA 3SYAA 3TL5A 3ZYIA 1B2WH 1FC1A 4PJCE 4NQXB 1K4CA 1FBIL 3I9GL 4QRPB 4RAUA 3CU7A 3O3EB 2JQZA 5BVPL 4HGWA 4HOXA 4XZUA 1UXSA 1VGEL 3QJOA 4XC1L 2DEYX 4N0YL 5FHBH 5LQBH 1EH9A 2IANE 5A2LH 4OZFH 2IDSA 3S97C 1A6WH 2YAHA 2DICA 3VG9B 2VL5A 3AU1A 4M7LT 4TQEH 2OS7A 3ZT7A 1F56A 2ITDB 3HLAA 5J89A 3TO4D 2FH8A 4M7KH 3GT6A 4UQ9A 3L3GA 1A4AA 1CLZH 1GRWA 3IFOB 3CZFB 2LT9A 2VQ1B 2EJ1A 4N86A 2CHXA 1S78D 2YMXH 2VAJA 4NAMA 5AVTB 3QIWA 3MV9B 4Z7OB 1LO4L 4FTVB 4LLUB 3BZDA 4ODUB 2J71A 3RZCA 4NQDB 1DQVA 1NWPA 4WLCA 4M7ZC 3QH3B 5IJKA 2HTLC 1CJYA 3PQYB 1J87A 1S9XB 4W9JC 5ICYB 2ESVA 2Y7NA 3KNBB 3GUFA 1G7QB 3QIWC 4JFED 4AEIL 1GW6A 3OG6B 4YVUA 1RK0B 4M8QA 1YDPB 3WJJC 3BRFA 1BAFH 4P2OC 5CZVH 2CHWA 5I18L 2ZCLH 3D4GA 3HZ3A 2XSKA 2CO3A 1YY9D 3P2TA 3V10A 1J48A 1T20B 1TSHA 1OTUD 5K93A 1UD3A 5I8KH 1HVXA 4AYFB 3HC4H 1CXIA 2BIQA 2FO4A 3OD3A 3RTLA 2O5XL 3CXHK 1FE8L 3B9KC 2DI9A 4PHXA 3IJEB 1XQ4A 2GTQA 3IKKA 5FYJE 4DF9A 4MS8C 5DR5L 4WCYH 4XXDA 4OZIF 1P7KB 4XPTL 2VZTA 2PR9A 4JFDB 4XMXA 3B7UX 3BRGC 4HPOH 4XMUA 4OIBA 4YHZL 3BKYH 5I1AB 3L1FA 2V5SA 4IIZA 3NCYP 4M29A 1O7DC 4BFGA 2H2SD 4J23A 5CGYD 2AQ1A 4Y4HD 5SV3A 1QVOA 3TPKA 1G7JA 3K4DA 2MCAA 1XZ0A 2HJFB 2MHAA 3Q2WA 1I31A 4KUZL 5F71A 3STZB 3WIFB 4FFVD 4MLIA 2GY7B 1NZRA 4LPVA 1V7NH 4MNQE 3NZHL 3B2UD 3GRWA 4Y4FB 1ZSDB 3LJ3A 3QO1B 2Y07L 1PY4A 4QY8B 1P6FA 2R0ZH 3CC5A 5A2KH 2ICEA 2QQNH 3RIAK 1T6BX 4MJIB 1A7RH 1ZGLP 1RUPL 2ZXDA 4XT1C 1QFPA 1M71A 2FWOA 1ZAGA 2X53A 1CPUA 2DN7A 2HT4C 3FUDA 3I6SA 5E5MA 1Q9KB 3VWKB 2ZG3A 1JXDA 3TGXA 5IGXL 2JE8A 3POHA 4ONHA 3ZL2A 2VABA 5J12C 5MP6L 4GLRI 1Q38A 1S7TB 4HCRA 2I24N 4N9GA 2O5YH 2EACA 3FT1A 5D6DC 4GP4B 4JFXB 1XGRA 1WZ1H 2CBTA 2A9NH 4FI6A 1UEYA 4QHUA 3ROOA 4M7LH 1G6RB 2JXMA 4PH8A 3PP4H 4DH2A 4EDXA 2X1PA 1UWFA 5DO8A 5E6RB 4ZFGH 5CEYA 4PCYA 5BZWA 3AC0A 3E9UA 4G1MB 4LCWD 3TYGL 3UTTB 1NC4A 4AK2A 3HZYA 3WJMA 3DUSB 2IALB 4ISVB 3S7GA 3RWGA 2RA1A 5E6ZA 5FW7A 1USQA 4XPGL 1KELL 4EAEA 4Z77B 4IRZL 3RE0A 3WDHA 1RZ7H 2VR9A 3OJDA 4WI8A 3FB8A 1OP3K 4GQZA 1DTUA 3RX8A 3EBIA 3UO1L 2CWRA 1INDL 5DYOA 1IM9A 2W60A 3T65A 1FFTB 3RA7L 1DHKA 4N2EA 5T5FL 4WI2A 1MJJB 4Z78B 1EHLL 4BZ1L 4L8SB 4DESA 1RIVL 2RMNA 4U33A 1G87A 5J4MA 3C5JB 5DHXB 3II2A 5LBSA 4GAJL 3TJEL 4BFOA 4FS0A 2E6PA 2PWDA 4GMTL 1RK1B 2IG2L 4AGOA 3A4AA 3GLEA 4NWTL 4PJDA 3QUKA 2WXNA 2ODIA 4LCUA 2EYRB 5F7DB 5JW3L 3GJEA 4JY5L 4P9HH 4LE8A 1AFVH 4FXGB 1SJVA 4XX1E 5B8CB 4WEUD 1XXDC 2BDNL 2UY7B 2X0VA 2E46A 2FJFA 2XCMC 3NSCA 4P4KC 4MJ6B 3D3VA 3EFOB 2P47B 3LPPA 3Q3GB 1N67A 4R26L 1CDIA 3HMXL 2Q0ZX 5L4JA 2AEOA 3V0VB 1Z2KA 4ZTOH 2RIKA 3DXAB 1CR9H 4NZ8A 4DGVH 1LILA 1CYWA 1MQKL 3LN4B 4XVUD 2BNUB 2PWFA 5SV4A 1D5IH 1Y0LB 2ICWI 1UH2A 4ODBD 3LQMA 3WKPA 3IMSA 5AYQA 3U9UB 1U95A 3FFDB 1JPST 3WFHB 2XNAA 4S1SL 2ZP0T 1B9KA 1Q72H 2WAHA 3F00A 3K2UH 2JJTA 1QSFE 4WUUD 2NXYD 2V3FA 2PP9A 1ZD6A 3B7RL 3KWWA 4D0DB 4WZ9A 4IU3A 1WS7A 5D1XD 1PNDA 3MLYL 5FFGA 5FLUA 1T1YB 4X6CE 1SM3H 3UGXA 3VFNA 4F37F 3T9WA 4E41A 3CPLA 1WFOA 2V17L 4K5LA 1JZ5A 4LSDA 3FNKA 3HC3H 4Y16D 5EUOE 2JJTC 4QXTA 3UAJA 5KSVB 1BYPA 3LQZA 3SGEH 4AKOA 2QZ5A 2EKSA 2WV3A 3MLVH 3S48A 1IFHH 2WUCL 2WQ8A 4RDQF 3W2DH 3LEXA 3TTSA 1II4E 4HJUA 3AG3B 1RI8A 3TA3D 3VXRE 4GT7A 4AWJC 5BUPA 1OPGH 3C5ZA 1F3DJ 3E3QC 2EH8H 3ESUF 4QWWD 2J8OA 4MASA 4DCQB 1BJMA 4FQIL 5J57B 4ZXBD 1YMMD 4OLWL 2IBGA 3ME0B 2NLJA 3S34H 3ARBB 5AVUB 1NICA 2NDFA 2G75B 1KACB 4QHMA 2PTUA 1FRGL 1FO0B 2HX7A 4NUQA 2EDWA 1U30A 5EO9A 3V4VB 5LXGH 4YBLC 3PJSA 1I9EA 1ZRUA 2DMBA 3PABA 4L4TE 3OJ2C 4QJ4B 2HG0A 2X4SA 1HL9A 4H7VA 2AQ3A 1BDYA 4WJ5A 3QFDA 1U8LB 1UCTA 1I9RH 4PU2A 4BQBA 5IOPB 1YNLH 4LCIH 1BVLB 3M17A 4OCWH 2DI7A 2E7DA 1U8IB 3R8QA 4C4UA 1JYVA 5E6UB 3QUYB 4LSVL 4WWKA 1EFXB 1RIHH 2G5BA 2A4EA 2DWEB 4UOZA 1CZ8H 2COVD 2WQRA 3TURA 3IVKA 4WEMB 1XBDA 4M6OH 4AQ8A 3P4MB 4GG6F 4U1KB 3DO3A 1P7QA 4K9EL 1U42A 1WWCA 2O6CA 4EDWL 2QQLH 2Z8SA 2RFXB 2Q7AA 2BNQD 2D0GA 1P9MA 3MBXL 3ECWA 3WDJA 1XAUA 2P5EB 1YEKL 3EO0A 3VVVA 4J27A 4MDJA 2OSLA 4MFHA 4P23D 1J10A 4DHLA 3PWPA 1OGAA 4XB7A 3F5WA 4RMTA 3EFDH 3WFCH 1P9MC 3CN3A 1H8SA 2OTUA 2UX6A 2XOTA 3C6LD 3DJTA 2RALA 4XBGA 3BH4A 4LLVA 2EZ0D 3VI4F 3VMOA 5HY9B 2AXFB 1PDKA 3SE4A 2WOBA 4JPSA 3UROR 4IEFA 3EAKA 3NEEA 4Y5VB 4B50A 3PIQA 4Q89A 4XCYB 1JGEA 3RURA 1J0HA 1JPSH 1OCWH 5IB1A 3QIBD 2WSPA 3QRBA 4KAQL 4MNGB 1CICB 1YUHA 3RGVC 4MD5A 3S96B 4PJFF 1FORH 1KB5L 4UT9A 4IU2A 3KPSB 5C07A 2E6JA 3WMPA 4J8RB 1VIWA 2NNAA 3GM8A 4G43B 1UHVA 4R5TA 4EUPG 3RRQA 1IFRA 4X80L 4MB5A 3PHSA 4ELMF 2K8MA 3MHZA 4FQ2L 5F7YC 4B9ZA 1LL1A 4Q97A 1IC7H 3SKJH 3D06A 4MYPA 2WIIA 2BP8B 4WW2F 1TTBA 3V4UL 2XN9D 4N5ED 3HS0C 4N8CL 3SB3A 3MRNB 2AV1B 4OZFB 3L4XA 5A2FA 2MCPL 1MNUL 3S3JA 3KVQA 4M7ZB 2AITA 4Q6KA 3HG0A 2CDEB 1GXEA 4R9HA 1EMTL 3OWRA 4KK8D 1N64L 1QRKA 4YSRA 2EIZA 2FZ3A 2QQKL 5D1QA 1A0QL 2J56A 4XO8A 4F8PA 1A6VH 2R8SL 2Z3FA 4NGHH 4P2OB 5I15H 2WC7A 3Q2VA 3FCTB 1O9VA 3UYRL 3C5XA 1K8IA 3FYIB 2OYPA 3A67H 5C8JB 2GFBB 3O6LH 3UACA 5EZLB 2UZYA 1R5WB 3F7VA 4F20A 3B9KB 4HLJA 4J3UA 4C8XA 5LGJA 1MPAH 4MMXA 4F24A 5KUMA 1LO5B 2Y6SD 5EMYA 2OJZL 3RFZC 4UQIM 2EDEA 4QRTA 4EI0A 2V33A 5F7EL 1WA2X 3EG9A 2XZQH 1IEBB 2QVTA 3AWGA 3CDGA 2VM4A 3P77A 4GBXD 5AKTA 3NDZE 3W9DA 4PJAE 4F7TB 1Q90A 3QNXB 3ZMRA 5KSBE 2Y7QA 5PAZA 1TMCB 5KYUB 4HJIA 2XI9A 5IP4A 1F42A 2RD0A 3FT4B 3MUY1 2IEPA 5FO2A 2E9BA 5IUSA 1GOHA 4PR5B 2PW1A 1BQHB 4LEXL 1MN4A 3BVNB 4GP8B 3TJHC 2E0PA 4GQPH 4L8DA 4Y1SA 5JHDE 5KVMC 3J2PA 4ADJA 2FJHA 2I69A 5CMAA 3GFUA 2AJXH 2B59B 3LIZA 3DDFA 3RZWA 1MH5B 1FJ1A 1OTTD 4LL9A 3QWQB 4OCYH 5CZKA 4FULA 4I2XA 1ET8A 1U8OB 4AUJA 1F4XL 2J25A 2B5IB 1S5HB 3HR5B 3JUZA 1UOKA 2PW2B 1SF3A 4KKBD 5CD3B 3KPMB 1Z7JA 3ZTJH 4Z7QF 2JWYA 3U4BH 4YHPB 4KROD 1CIUA 2ZOLA 1UYWH 5E8EB 1IQWL 3WHXB 2NCEA 4Z3HA 1H5BA 2YRZA 4GUCA 3H3KA 2MQCA 3MLZH 4LBEA 2OMTA 4X4XB 1FYTA 2PPDA 4FG2A 2JCCE 4G3YL 1NBYA 3MRIA 3BVWA 3X3FL 4KU1A 4QLRA 1PLGL 1PG7L 2CJ3A 2IDQA 2V6HA 2X44D 2GTWB 1OAUH 4DFHA 4R3SA 1AY1H 2KLTA 4X7SH 4KQ4H 1HZHH 2FB4H 4QRBA 5I74C 1VFMA 4MMZC 1RZPA 3MYJA 4NZUL 1N7ML 1PLCA 5TH2B 3MLUH 5I66A 3SGDI 4UTAH 2O4EA 3UTQB 1NGQL 4OF3A 4R7NB 2OYKA 2IV8A 3PHQA 4XRCB 3M1BB 2V7HB 3MUGB 4ZX4A 5I8OH 4UUJA 1WS8A 2C9RA 4AC2A 1FVEA 4UBDD 5I1EL 5HHQB 2EEFA 1H8NA 4AUYA 1TQBC 3OAYK 5A2CA 2YAFA 1EZSA 2FT7A 1AZVA 1A6ZB 1LO0H 5DZPA 3WDIA 3HPJB 1DSFH 1J1PH 4B9FA 4FHKA 1IVLA 4YS4A 4PJ8C 5D7IF 4PP1D 25C8L 4GSUA 1FV1A 3BXNA 1OZTG 3IJHA 4P2QD 2HFTA 5CSZB 3U2JA 4HS6A 3GSUA 4XZ4A 3C8DA 4QHPA 1QTYT 4N2GA 1S7VB 3U48A 4Z7NF 3RL2B 5HXMA 4UANA 2D7OA 4ZUUB 3S37X 3FU7B 4XO5A 4C47A 4NJAL 2YPLA 2KYIA 1U8NB 4LGRB 4MXVE 5ACZA 2A5UA 3M7OA 1X5IA 2LTQC 2P42B 4MXWH 4N6RB 5C0IA 4L3EE 5I1JL 2O5ZH 4AL8H 2MMXA 2J8UA 1O7VA 5AVWB 2PPCA 1EGJH 5E9DB 4KUCD 4KI5E 4HMCA 1TCRA 4P4KB 4YHOL 4I1PA 1P5UA 3GMOA 5IMKA 3L5XL 4U31A 5DQ9B 5KVEL 2FHBA 5K69A 2V2XB 3MXWL 4YSEA 4HOMA 3KLHC 1KB3A 4AL8C 1OT1A 4XNUL 3JWOH 5DD3L 4HH9A 4RSVA 4R96A 4PLKD 2EVGA 2KBGA 1PD6A 5AW4B 4H5SA 1Z9SB 1LO2L 3TH2T 5LNDA 2H4EA 4GXVH 4QKTA 4U6HB 1O9WA 4GAGH 4YDIH 1LP9F 2EDMA 1U93A 5KVFH 1BD2A 4KO5A 3JWOC 1HYSC 4PG9B 4YUEH 5G4MA 4UOW1 2CCVA 2EYTA 2O6FA 4JM0A 3AS2A 3F05A 4N22A 3T0BA 1A7PL 1NEZA 4N24A 1H3TA 4PWIA 2PF6A 3MOAL 5JPNA 4EI5D 3HE7D 4WKXA 5CS7A 2DI8A 1BPVA 4YIQA 2WBJC 5HSFA 5GGTA 1IKFH 2BOCB 4XAWL 5DJYB 2G2RB 2JLLA 2GK0B 2QBWA 2ETWA 4HD5A 1ACZA 4S1DD 2DIAA 3CG8A 4KTYA 3K8MA 3N41F 1L3WA 2WQVA 3D2UA 1KFAL 1HINL 3CDZB 4Y4KC 4FHBD 3DBXA 1Z6JT 4GRLA 1HHJB 2V5TA 4XN1A 1KPVB 5IT2H 4CVWA 3TIDA 1IKNA 3FOLA 4EN3C 1UG9A 4LSTL 3OJMB 4BQ9A 4GRLC 4DN3L 5DHEA 4TSCL 2YOAA 1IGTA 1NAMA 3FL7A 1RJCA 3S0PA 3T6XA 3H9SA 1QRND 2C1OA 3I6LD 1FYHB 4XWOD 4ELKA 5FKAB 4PS4L 4C54A 3PAYA 1K9TA 1OGTB 5ICZA 1OPOA 2VJ0A 2JVUA 4OLUL 4PRIE 1U2YA 4G8GE 4WU7A 2Y69B 2AQQA 4KZEL 2F53B 2OMZA 4FD0A 1ZGLB 3FT0A 2YA0A 1JWUA 2YFOA 3OR7B 3QFJE 5E2WL 5F97E 3VXUA 5C97A 1THAA 2AJSH 4JREC 1K2DA 1SUJA 2AEIT 2YSSA 3IN0A 4XVTL 4FFYA 2GJ6A 4YX2L 1E5ZA 5L6YH 1SLXA 4MSWA 4QRPD 4HXBH 3MA7A 2WWKT 4OKDA 3VACA 2XRAH 4HIEA 5BMFH 3V0HA 3QJSB 3RWEB 3U79A 5J0BA 4YSPA 4KXZI 3OKYA 1BWWA 3ARGA 2XQBL 4RA3A 3V52H 2FR4B 1E9PA 1H3GA 2WNXA 2UXFA 4M7JL 1T5XA 4FQCL 4G7YH 4K7FA 4Y1AA 4XMLH 2IOOA 3N06B 3P73A 5DC4B 2XX1A 4GSRA 2VDNL 4LSUL 3FU3A 3L2NA 1G1CA 1WBXA 2R1WB 3ARUA 5K39A 1NFAA 2NYYC 1O75A 1P1ZB 5E70A 4QUOA 1X7SA 5F1IA 2ZNXA 1K4DA 4RLDA 3STBA 4YEEA 1C12B 3JV6A 3RGVB 3A6OA 5AG9A 4CC1A 1F0LA 1SN2A 2L04A 1GKEA 2UX7A 1CFQB 3H53A 4H2AA 2BCMA 1MI5E 2HLEB 3PQYD 5DEGB 3W9EB 4Z7WE 2E9WA 4WK4B 1I85C 3KJ4C 4HFUL 5JQ6H 2R69H 3LKRA 4H20H 4LEEA 2MPAL 4KNUA 4L37A 2P49B 3GMPB 3HS0B 1V8HA 2IWGA 4FKHA 5KAQF 2LVCA 3QG7H 5BZZA 1KWGA 4JZOA 1WUNT 1B4JL 2JMRA 2QSCH 1MHCA 3QHZL 4OFIA 4BSWA 3P1VA 1UQSA 1BX2A 2DJMA 1LD9A 3FHEA 1G9ML 3LIZL 2C3GA 2GJPA 2XXCB 3FRPA 3QCUH 5ID1A 2E56A 1AGEB 3G6JF 5F7KC 3V79C 1EEYA 1NLDH 3RVTC 2YD8A 3DOIA 3GMRA 2VL4A 4YR6B 1QSEB 4ZW8A 2AKRB 3IMBA 4JFDD 4G6FB 3T6QC 1I3VA 1D9KA 1XT5A 3U30B 3S2AA 3KPOB 4M6AA 4MNHB 1XTLA 4LDLB 5GRJH 4WGWB 3GMMB 5FUCC 1GGCH 5M94B 4J4PA 1E4WL 2E75C 4PJHE 2FHCA 3WNMA 4A39A 1Z3GL 5CILH 3RY6C 3KPLA 2IMNA 1JZFA 4NI6A 3RFZB 4GG6B 3DX7B 4MAZA 3BKML 4WWNA 2WZAA 3V4PH 4X8XA 2ZAGA 3X11B 1I53A 2I9LA 1KLFB 2HJLA 3A6CL 5T1KB 2WLLA 3SE9H 1PEWA 4HJTA 3R8BB 1ZWIA 4CGTA 4GW1A 1XGQA 4QXGL 5CGMA 4RQQA 1T7VA 5D55A 4G8FA 2P5WA 4AMXA 2EC9T 2X5PA 2QQQA 1MAMH 2APSA 1SXNA 2GSGB 4BZYA 2H41A 4DEPC 4XN2A 4UILH 4MKTA 2JJUA 5EUKA 1ONQB 1TKWA 2OMWA 5J11C 4N0UB 5DQDL 2X4UA 4LARH 1XF2A 3VWKD 1H0DA 3KPPB 3BD4A 3UZEA 5A43C 3MAWA 4JFYA 4D0CB 1CE1H 5B4MD 3P9LB 3LSOA 3ZKXC 3VDCA 4GXFA 5B3NA 4J2XA 2QDWA 2E8YA 5F21B 3SDYL 4JKNA 3ZKQD 1C5DB 2XIIA 3MRLA 4QR7A 4Y8AA 3ULUC 4MDIB 1KCRL 1FL3B 1YY8B 1LMKA 4OSUH 5IHZA 2WXQA 4PJFB 4NRXA 5KVGE 1MFVA 5SX5K 2Z64C 4LLYA 2UZIL 3UPRA 2IAMB 1KLUA 3O45B 5FV2A 4XP6H 3F7YA 5KG9B 4KO9A 5E2UL 4E9RA 1GGIL 4S0HA 4AW4A 2H2PD 2VLMD 3FTYA 2P80A 3ZOAA 4ELMB 1R3KB 1HN1A 3GSXB 5GGRA 2F8VA 2ZQKA 3W57A 1NKRA 2OPCA 1OM9A 4FQQA 3BI9X 1IVTA 4PJGE 5LBGA 3K6DA 3VO0A 2LU4A 4BUGA 4PUBH 2ZTBA 4R4BB 4K3JH 4P5TD 3PL6A 4HAFA 3QDMA 1S2EA 2GI0A 3EGDB 4NZRH 3U6XS 2WOYA 1U58A 3EYOA 3CLFL 5KJ7E 4W9LC 4Q9RL 3UBFA 4OZHE 4TLTA 3MOQA 4RWYH 5TTRA 3K6OA 1K6QL 4YSDA 1UZ8A 4D9QD 5EIIA 4MJ4A 1X5HA 3BP5B 4BH7B 2X88A 5HGBA 4XBEH 3O3AA 5MHSE 4CVUA 1TQBB 2GC7C 1ZTXL 1IBHA 2UXGA 4WDIA 1DQKA 5CEZL 1P7BA 2OW7A 4PRHB 3BP6B 2OZ4A 3MV8E 1GYWA 2FGWH 1QSVA 2IPKB 3GI8H 5DUBB 4NYLB 4PJ8B 1BVKB 1V3LA 3EH5B 4ZUVB 3JQOB 2YRPA 4YE0A 5T3XD 3PS6A 3IDUA 2BVQB 3MRKB 2PPAA 7PCYA 1SLUA 2BIHA 2W95A 5DRXA 2X10A 2FEDC 4FNUA 3MRPA 5T8IA 3N9GH 4B3EA 4PV9B 4QGTA 1UGKA 4JFFA 1E28A 2F7QA 4XMPL 4PJXF 2LTQB 4RWHA 3IKCA 2ALWA 4E5XA 3TEYA 4U1IA 5DMIL 3TN0D 5HVFB 3GS7A 3QHFL 4LEOA 3ESMA 4PAZA 5BS0B 4E9TA 2ED6A 2APBA 1JD9A 1VAHA 2K45A 2QPDB 3N6YA 1IL1A 5TPWL 3RWIB 1B0RB 1ORQA 1PVHA 2PCFA 1WFMA 2W9LA 3H0TB 1R24A 2IMMA 1KYOJ 2JI1A 1HQRA 2UZXB 2DMHA 1EJOH 1YYCA 2I7SA 5D5ME 3UZQB 1CGYA 1X5LA 3TVMD 1QLEH 4NQXA 3Q6GL 5GJSL 3OBAA 1CGUA 2MWCA 3N91A 5FECB 2VZ1A 1NAML 1NBZB 2B1AL 4BKLA 1YQVH 2VITB 3MO1B 1VZGA 1R3HB 4M5ZH 4WY7L 5CO1A 1DJZA 4AV4A 1V05A 4Z7QB 4LSSH 5B38B 1F41A 1WQVT 3BQUC 5IW6B 4IRJC 3IBOA 5GGSY 4QLWA 5EWIH 3N1MC 4UQEA 1MOEA 1BZ8A 3OKMA 2X89A 5D7JC 4AUUA 2VNCA 3OWEA 2AJZA 3QDAA 1TO5A 3FN0L 4HKJB 2ZP9A 5T1MB 1J8KA 2A6JB 2XKUA 2Y0SA 4IBLT 4UZUA 5ES4B 2VQ1A 1X5KA 1J0YA 3BVXA 2AERT 1IILE 4KRPD 4YHMH 3QH3A 5D96C 5F44A 4PREB 5DZLA 4PGEA 3PFQA 3GKWH 1S9XA 1VFBB 1HHIB 4QRQB 3KNBA 3K6SB 4OKVA 4F8OA 5B1JA 1YN7A 5I1HH 3D2TA 4OD2B 4Y4KB 4AM0A 2H47C 1KFGA 1BLIA 1PD0A 4G7RB 4HWEH 5GGUB 5I0DA 3MRGB 2Z8VC 4WFGE 1T20A 4PWFA 2ZKHL 3IAQA 1BWMA 3BEWA 4NZFA 1JHLH 4EN3B 3QUYD 1BOYA 2O30A 4HWZB 1MRDL 1INQB 3EUUA 3SBWA 3H3PH 4QRRE 3RTQB 2ICES 5ITBL 5EEYA 2NY1C 4R7DA 4E9SA 3BAKA 4OZGE 5EPMA 4XPFH 1SJMA 5FGCB 2OBGA 3KW7A 1X4ZA 2WP3T 1NMCC 1FAIL 2ROXA 3ASWA 1GSMA 1IAOA 2NTFB 1VEMA 4L0PB 5KBPA 2L8AA 5TJWK 5LUMA 4JRYA 1FQ9C 1MEXL 3CK0L 3CX2A 2VLJD 4RAVA 1VACA 4F8TA 3GSOA 3FZUD 1DBKH 1QBBA 2WZ6A 2UWEA 3IPBA 2Y3AA 5E24E 3IWVA 4JREB 2F8XC 2IC2A 3N44B 4PLNC 4BFJA 2O6PA 4ERSL 2E27H 2I85A 3CXHJ 3L7EB 4LSQH 5HJDA 3TNNB 4GKNA 4K5NA 4QY8A 4AI7A 1OALA 5IW1A 2Z65C 2ZCHH 4PJ5D 1WC7B 4KV5E 3HG1B 4NQTA 3B7SA 4G9FA 4MJIA 4UYPA 1XGPA 1DLHB 2N1KA 1LP9B 3GJFH 3LCYA 2CNYA 4WU5A 3SKNA 1Y1UA 5ABZA 3WLWC 4JHWH 1CI3M 1ZLWK 1GZPB 3ECBB 4NQEB 4JEGB 2D7TL 4M6MH 4XE5B 1HKFA 3K5SA 3T8VA 5I24A 1VFAB 1CFMA 3L4CA 4ENEC 1JNJA 4KY1L 1QW8A 1QWNA 2VUOA 4MB1A 1ILUA 2R51A 1UOVA 2CIIB 4D9LH 1QYGH 3DUUA 3NCBB 4K7PL 1WV7T 4GJTB 1J9RA 1YAIA 1HILB 1P84J 3PHOB 4DZ8A 3N41B 3K2KA 4KK5C 3QIWD 2HWZH 3KJ4B 3QDJB 3MBEC 1I7RA 2IALA 4R0LB 1NDMB 4P2OD 3VFVB 2Y72A 1V27A 5I73C 4GS7C 2ESVD 1EEZA 1DQLH 1TLKA 2R56L 5KS9E 4ZSOB 4AEFA 4XN5A 3B9KD 3KEDA 2VM9A 5K9KA 4JFZH 1ZVSA 5F7WC 1KIPA 1VSCA 4CVZA 2B7DT 2MPVA 1S7UA 1KTKE 4MS8D 1RZKC 1TZHB 2H6UA 3IB4A 3GHBL 4Z7IA 1T1ZB 2NW3A 4M6NL 5F0PB 1ETB1 1HWGB 1KB9K 4XN9A 1PCXA 3NP4A 1YEDA 4FKKA 3PFUA 4LLDB 3R0NA 1SQMA 5I76B 1OK0A 5IB3A 4PBXA 1RK1A 2X1XR 3H7LA 1A1NB 2QVIA 1SY6L 2ZZUT 4U1LB 3CAFA 5IQ9B 4MQ7A 1G9NC 3LKSB 2EYRA 4KJYA 4LPCA 4CMHC 4FXGA 5DZJA 2FLMA 5F70A 1BGXH 4AVHA 4NXKA 1F00I 3FSOA 4K3HA 4Z0BH 4NRZA 4O00A 1SXAA 3AU0A 2N7BA 1EZVY 1FZKA 4IMLB 1WDAA 2EDJA 3Q3GA 3SDCA 4HOWA 4XMVA 2GT9B 2R2EB 1BF5A 3LRHA 1D5MB 4LZKA 4PJIA 1XB3A 2XN0A 1SLWA 3T2NL 3FO2A 2CJUL 4DEPB 5MENA 2DIJA 5FCSH 2B16A 2MTAA 3LHAA 4PS8A 5E51A 4TL5A 4KKPA 4NS0A 3GINA 1E5UI 1P5VB 1NBVH 2HT4D 2BVPB 1RFDL 3L4UA 3MNVB 1IGJA 5JOEA 1TPXB 7TAAA 5BRPA 2JJWA 5FYJH 1KTLB 2OZ4L 2VW4A 3I02A 3T4YA 4KPHL 4D8PB 3ZKXB 2XVGA 5TE7L 4F9LC 1SOKA 1BLNB 2CO7B 4D0DA 2DM7A 2I25N 3QULB 1A7OL 2VSDA 5GJTH 1YO4A 1XGUA 4MRBA 3QO0A 3DOSA 3ASOB 3KS0J 4P59L 1Q0XH 5D70L 5A6IA 1Z5HA 5KOMC 3FMGL 4CMMA 4HQQL 2IBBA 2DDQL 2TAAA 1W8NA 2FUTA 4JFEE 1RZJH 3BYYA 1NDTA 1XEDA 1NCDL 3FB5A 5B1AB 2JH2A 3AS3A 3HBPA 4Y2OB 1QWUA 1EHKB 3UDWA 5C0EA 5ESVB 1NC4D 2C9QA 3O81A 1CD9B 2G75A 2WSKA 5BXFA 3PNWB 2OJEA 3G6JB 3NFNA 5CCHE 3HNTH 3OKDA 1RHFA 1JCKA 1A1OB 5F9OH 1Q1JL 3L4YA 1EXUB 4HK3N 3FO9B 1D6VL 2R9HC 3K46A 4KTEH 5DS1A 2I32A 4I9WE 1IM9D 1W0WB 1J86A 2FDBP 4FNLH 1ZHNA 4UDTA 3L3OA 3T0EE 3ZY7A 3UAAA 2ZSWA 5DEZA 2FEEI 1EUTA 2PYFB 2L4OA 5A2IH 1GS8A 3G5ZB 1ACXA 3IFPA 1EFXA 1WWAX 5JYMA 4O2FA 3U1PA 1CI5A 2H7WA 2K70A 3H9HA 1AACA 1V7MH 2Z93A 2XFGB 3ES6B 2YN5A 3E8VA 2V9TA 4U1KA 5HHPB 1BOGA 2YGNA 1PX3A 1ZOXA 3FTGA 4ONGH 4IKIA 3ZE1E 3RHWF 1ZT4A 2FSEA 2IV9A 1CG9A 3U0PA 3CD4A 5HGDA 3BUYA 1I8KA 3Q5YA 4UYQA 1JF6A 1I75A 1FZOA 1F86A 1CLOL 1PMYA 1NGPL 2P5EA 4QRSB 2YGPA 1J7VR 2PWHA 4K2UH 4PN6A 4ODXB 1KCVL 4YOKA 3D3VD 4F33B 4YXHH 2X38A 3LEYH 3WY3A 1VF5C 5LAPA 4AXWA 1GIGL 5DDHB 5EB9A 1C5CH 3EOAB 2ATPA 5HY9A 4DQOL 4N2CA 2NUPB 1JZIA 4N2BA 1GR7A 3FUHA 2HJKA 2VKXA 3QORB 1ED3B 3ESNA 4LO9A 3OQ3B 4ZAKC 5F3HB 3SGKA 3QDHA 4OM0H 5DJ2A 3RJOA 3VXSB 3COOA 3PDDA 4NM4L 3B5GA 4GQQA 4ZTPH 3ATFA 4MNGA 1CICA 1R1CA 1COBA 5BQ7B 5D2LA 5FB8A 2ZUSA 4IS6A 1QLEB 4TUKL 5F0MB 4LCWE 1G1OA 2ZSVB 4DO6A