1HJCA

Crystal structure of runx-1/aml1/cbfalpha runt domain bound to a dna fragment from the csf-1r promoter
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
118
structure length
118
Chain Sequence
GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analyses of DNA Recognition by the Aml1/Runx-1 Runt Domain and its Allosteric Control by Cbfbeta
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords RUNT-RELATED TRANSCRIPTION FACTOR 1
total genus 20
structure length 118
sequence length 118
chains with identical sequence D
ec nomenclature
pdb deposition date 2001-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1hjcA00
4LO9A 5AOKA 2J1XA 1GZHA 3EXJA 3D09A 2PCXA 3D07A 2X0VA 2BIQA 4G83A 2J6WA 2GEQA 4GUOA 4IBYA 5LAPA 2FEJA 5KBDA 2J1WA 4MZRA 2J1ZA 3D05A 5G4MA 1CO1A 4MZIA 2J21A 1IO4C 4AGLA 4L18A 4AGNA 2AHIA 4QO1B 4L0YA 2BIPA 4AGMA 3WU1A 1HJBC 4AGQA 3D06A 1CMOA 3WTXA 1TSRA 2RMNA 3IGLA 3US0A 4IJTA 2X0UA 4IBTA 4KVPA 1YCSA 4AGOA 5ECGA 1HJCA 3WTUA 5BUAA 3Q05A 5AOJA 3TS8A 5AOMA 5G4OA 4G82A 4IBZA 1EAOA 2OCJA 1KZYA 5A7BA 1E50A 4IBVA 3ZMEA 2X0WA 3QYNA 2WGXA 3D08A 2J1YA 2XWRA 4LOFA 3D0AA 2XWCA 1TUPA 1EANA 3KMDA 2BIMA 4IBQA 4IBSA 2ADYA 2H1LM 1H9DA 2P52A 1HU8A 3US1A 3WTYA 5AOIA 5AB9A 4XR8C 5ABAA 2IOOA 3QYMA 4GUQA 4HJEA 4A63A 2BINA 2AC0A 1UOLA 2BIOA 3IGKA 5LGYA 2IOIA 4L0ZA 3WTTA 3WTWA 3VD2A 3WTVA 2J20A 3VD0A 1GZHC 1LJMA 2IOMA 2YBGA 3Q01A 3EXLA 2VUKA 1EAQA 3Q06A 4LOEA 3VD1A 4IBUA 3WTSA 1T4WA 2MEJB 5AOLA 5G4NA 3KZ8A 4AGPA 2ATAA 4IBWA
chains in the Genus database with same CATH superfamily
3BRDA 4OZIE 3FQTB 3WIFB 5I73B 1GZHA 3EYQD 1AHWC 4Z7OB 4JFOA 2K9UA 1FHNA 2OMNA 3RWEB 1GXEA 2WLKA 1WAAA 5DGQA 4JUTA 3KXFB 2AQ2A 4ODUB 2GC7C 5CJQL 5C6WH 5I6KA 3QQDB 1I1YB 5L9DH 4MA3B 1A6AA 1N59B 2KDYA 4HJSA 3P3TA 1U8KB 1N6UA 3KPMB 3QDJD 1FJ1A 2WTPA 3HAEG 2F74A 2H4EA 5ACZA 3CCHB 4OCRL 1WYJA 3JVGC 2PCYA 3CK0L 2VXTH 3FN0H 3CLWA 1FIGL 3D18B 1BJ8A 1E7VA 2F1AA 1ZD6A 1V3LA 3ZKMD 5LCVH 2HTLC 4N9GA 4AIOA 4CN1A 1DBKH 5IMKA 2AVGA 3V4PA 2RCSL 4CMMB 4X6BA 2L8AA 1LQBC 1HI6A 1ZSDB 5KWYC 4UAOB 1T21B 4QWWD 2G75A 2BOLA 3BP5B 5IF0B 5DC4B 2XBZA 1G6RB 1SY6H 5AOMA 4XX1G 2IPKA 3BT2L 3KH4A 2NLJB 4ZAKB 2HX8A 2CO6B 3D2UA 3LKRB 1AS6A 2FR4B 4Z7WB 4KV5F 2YN5A 3DRTB 3VMNA 3OQRA 2FLRT 5IJKC 3CSYB 1OT1A 4U6YB 4YIQA 2BDNH 1DVTA 4JPQA 3VG0L 4MQSB 2C3HA 3X12A 2DI7A 2Y1YA 2YUXA 1T83C 2H6UA 3LN9A 1T0OA 4JRYE 1GZPA 1OF2B 2ADIA 2VOTA 1XCTA 2Z65C 3PWNB 4LT7A 3ZL1A 4HJGA 5EC2A 3MNVA 1WWAX 5EC1B 1C5BL 2NSQA 2XACC 4OJFL 4JGMA 1ZJBA 4IDJH 1CGWA 2ZOKB 3K81A 4OGYH 5DHYB 4QCIB 3EOBB 3B9VA 2BHFA 2DM7A 2ZKHH 3W82A 2DBLL 4N0FA 4KC3B 2HRPL 2W0FA 4Z7IA 4OCWH 3N0PB 2J88H 3EYUL 1HHIA 1SHWA 1U95B 2F53E 5IV2B 4J27A 3PG2A 1XSOA 3GS4A 1A0QH 4R5TA 1YEJL 3AG3B 3WEOA 2YR3A 4PY8I 3D2UD 1ZXQA 3EGXB 3RE0A 3WN5B 2MRYA 1AR2A 1ZDSA 1LO4H 2Z31C 1U8JA 4GXVH 5GGTH 2FWLB 4A6YL 1IQDB 1OAUH 1RH8A 4HIJA 3MRKA 3ZDYF 1ZGLP 1SXCA 3N40F 1BYNA 2GYSA 4KK9D 1YEEH 2HUEA 5E8PB 1S6NA 2UXTA 1RZGA 4UT9A 4XBGB 3GRWH 5CMAB 3RY6C 1UOVA 2LQRA 4BDVA 4G6FD 2SODB 7FABL 4OBSA 1Q1PA 3FOMA 3ISRA 4EDWH 3DECA 4PRIE 4PHXA 4EN3B 5FDWB 4WHTB 1UASA 1CLVA 1R24A 2UZIL 5D6CB 1EWHA 2EYRB 3IPFA 5I1DA 3HUJA 1HT6A 5FW6A 2XA8H 5FHAH 2WIIA 3NSJA 4R96B 2KHAA 1BLNA 4HEPA 3ZIMA 5HYQB 5HPMA 5DYOA 1EXHA 5DJ8B 1YJDL 5CZVL 1BXAA 4AQ1C 4MD5B 3ZRSA 2N7BA 4LVNC 4BZ2L 4G6JL 3MBEB 4GBXA 4F1SA 1G1YA 4I85A 5DTFB 3BPCA 1X3DA 1XHHA 4PG2C 5LVEA 2WVUA 2YWYA 3C5JA 4QRRD 4XPFH 1EDYA 2IH1B 4JANB 4WHTA 4E9TA 1DLHA 3LCYA 2FX7L 3HC0B 4F92B 2YGQA 1L7TL 3BZDA 1J8SA 3AMKA 4PGCB 3ZRCC 5M7QA 3FYEB 1FG2A 4J7RA 2VDOL 3BEWA 3VXMA 3QFGA 3U9PL 1JNLH 3QXTA 3KCPA 3SHSA 4NNPL 1E27B 3X17A 4F33B 1BQLL 1KC5H 5K39A 1JGVH 3QEGH 3S97C 3MRKB 5J12B 4DJMA 1HCZA 5E6YA 2D3VA 2P7TA 5D4HA 3T0EE 5KG9B 4EI5C 3TGXA 2BWDA 2YEZB 3GXNA 4RZCB 3L4WA 3Q3GA 1R47A 4QRUB 4L8BA 3TM6A 1CLOL 1IEAA 1TVHA 2G9HA 2G9KA 3D7PA 3CSBA 3FW6A 2EO9A 1UADC 3H8NA 3ARRA 5AW3B 2OQJB 2P49B 2OYPA 1HQRB 3P30L 1KBWA 4N2KA 2O5YL 3S88H 5I71C 3F64A 3KNBB 3PP3K 5FYKE 4EOWL 3QPQD 1ZVSB 5DD3H 2YMXH 2BIHA 5TF1L 4NAJA 5DHYA 1NWPA 1MHHA 2JELH 2K4AA 3O3DB 5GGVL 4HS3A 5HJGA 4NQSB 4PJGB 4LSVH 4U1GC 3IGKA 2IOIA 2CJUL 3BP4A 4L0ZA 4BFFA 1HH6B 3T4YB 3HMWH 3CFQA 1XB8A 5CZRA 4HJGB 5EC2B 3EDKA 3U0WH 1GAFH 3DVFA 2OPCA 3WHE1 2YBGA 4YH6A 4KX8A 1VRSA 4OGQC 4W70A 4TNEA 3GMOA 1H3WM 5D4JA 5GJTH 3D0LB 5KBLA 1YN6A 1A47A 5DDHB 5ANHA 3IMSA 2V2WB 4FTDA 3SZKC 4I0CC 3KJ4B 1KNOB 2VE6B 1G7QB 1H19A 4LEOB 2XSKA 4F57L 4LCWD 1JNHA 4X8XA 1NKOA 2EKSB 3BLKA 4M93B 1A1NB 5IV2A 5F6HJ 3BIAX 2DN7A 4FL4B 2XBDA 5BV7C 2HT3D 4JO3L 4X6CF 2X89A 5DR5H 4GS7C 5HJ3B 1EHKB 4HP5A 1A4KA 5IB2B 4R90H 5EFIB 1A4CA 2HVKB 3QDJB 4YDZA 4AUYA 3HB3B 2XN9A 2VM4A 2D3LA 1OP5H 3MRFB 1VGKA 1JMZA 5FUZH 3CN3A 2X10A 1BVZA 4CC4C 1W0VB 2F1BA 3V4VB 1IAOA 3ILPB 5D1ZA 3W0WE 5DQDL 1F18A 1E42A 2W0PA 2XBTA 3NFSH 3M7FB 1Y18A 3SBWA 1WFTA 4F93B 4UDUA 2QPUA 3T0ED 3HRPA 4R83A 4WCYH 4P57B 4QEGA 5FUOL 2R23A 1AS7A 3SOTA 5E8DL 2C9UA 1J0ZA 3AS2A 3LEXA 3B9KA 2HA1A 1JUFB 3UDWC 5IJVA 5EEZA 2OCJA 1A02N 4GY4A 2ITFA 2DQ6A 4IRZA 2CCLA 1E4WL 2MNUA 4F24A 3WD5H 1CGSL 4LHJB 5K33A 4FULA 3QJRB 4CVUA 2HT4D 5TGBA 2XQYK 4PJ5D 1FUNA 4PJIB 1IAII 1N6VA 2AJSL 2AK4D 2WLIA 4A2MA 1MPAL 1F41A 1P53A 1MN4A 4OLYH 2F2HA 3CVHH 1NCOA 3T5WA 5ID1A 4TSBL 4YPJA 3LSOA 4CU6A 3NIDB 3A6CL 5DJDA 4JN2B 3L4XA 2D7OA 1T6BX 2AXGB 3OF6D 1I3GL 4J6RH 5DJ6A 3VI3E 1JVOA 2EYSA 1ZSHA 2Z91A 1A6PA 3DROA 3UO8B 4PLJD 4XP4L 3WNOA 5HHNA 4I87A 3IJEA 1GGCH 3Q8EA 4FZEH 1PLCA 2OJZH 2G2RB 5DURD 1X5MA 2IQ9H 2G5BB 3AXIA 3DPDA 4LGPB 1I9RH 3EGDB 3S96B 4B95C 5H37A 4Y5XB 5F0PB 3HZMB 3MNZB 2YAFA 2JWYA 3AADB 4MJ2A 4DQAA 3I6LE 5DVMA 3CFTA 2HKHL 5C09D 3CU1A 3EXLA 3L1OH 1GOGA 1MW2A 2HH0H 1Z1WA 4BH8A 2JLPA 3EDJA 1AKJA 2DOCA 2WLJA 2JKXA 3T3MF 1L9QA 4O2CA 3G5VB 3MLUH 4R0LB 3REVA 2WP3T 3BVXA 1YPZE 4JFEE 3RHWF 3WFHA 4D9RD 4YSSA 1MF2H 3HPLA 2NY5L 1NDGA 2D9CA 1NDMB 2VXTL 1JF1A 1FVEB 2UV3A 3E80A 3KR3H 4NM4L 3JUZA 4IGBC 4JY5L 4MHHI 1HHJB 2P28B 2ZYRA 5DK0B 1VACB 1OCRB 1NAMB 2P8PB 4QRFA 5KSVA 1IKFL 1MZZA 3MCLL 3U79A 3FO2A 2NUPB 2WNWA 5D2LE 4GT0A 5DUML 3QFDA 4YFLI 1DJHA 1VZHA 1PX4A 4MWFB 1F4WH 5E1HB 5FK9A 2DW5A 4L1DA 3IYLW 1HN1A 2ITEA 3PP4L 4OAWB 1CDGA 2B2XL 2PXYB 2VCOA 4HD9A 3ZYOA 2PTTA 3I9IA 2KS0A 1JF5A 3MRHA 4L3FA 5FGSA 3ZHNA 4BZ1A 3BVUA 1PGRB 1ZE3C 3IK2A 1I8MB 3GSNL 4MA1C 2B1AL 3ML8A 5GZOA 1AXTH 1T3FB 4XH2B 1BZEA 5JHLA 1ID5I 1F1DA 3QNXA 2MCPL 2ZXBA 1UENA 2JTYA 3EFFA 4HJUA 4K23L 1JZ7A 5EU6B 1BEYL 4WI8A 4R97C 3G08A 1NCUA 1N6QL 3DGGA 2E9BA 1PS3A 5JPMA 4G5ZH 4XPGH 1DVUA 4BFRA 1MQKL 1Y18B 1MH5A 5GGVY 1JE6A 3AQYA 1EJ8A 4Z3IA 3ET9F 4XGZA 1TZGH 2HAZA 4LHQB 1MJ7L 2YQBA 5D2NC 1KEMH 3TNNB 1FZOB 2AQSA 3CPUA 2X6MA 2XDHA 2BNRD 2NX5A 3A5VA 3U0PB 3NPSC 1D5IL 5AB0A 3IMRA 1QWNA 3T08A 2DM4A 1N64H 4PJIE 3S2AA 1CFSA 3DETD 2NSXA 1P84J 3B9KC 4TPRL 2V9UA 35C8H 5ESVB 4ZPTB 3U1QA 5HVHB 4PGDA 5MEQA 3GSOA 1SJVA 4K3HA 4C54A 2AS5M 4FFZH 1RVFL 2V2XB 4KQ4H 1RIUH 4XBEL 4W4OA 2FHBA 4NC1C 1FDLL 3VWKD 4JG5A 1MH5B 4PJAA 1RSFA 4MGXA 3T4AA 4YDLB 2PR9A 3MV9E 2YAPA 4ZFOA 3AU0A 1BQUA 3V4VL 1UWEH 2DDQH 2AEWA 2VAAA 5B38G 2OJEB 1FAIH 5DMIL 3EYVB 3H0TA 4R7NB 3LRMA 5DQ9A 4F15C 3SKUD 1GY2A 3V95A 1QSFD 3WO4C 2KBGA 1ZV5A 2R51A 4MA7H 5CCKH 4WQOA 1AZVA 3H42H 3LKQA 5BXFA 1DVYA 2L7UA 4JQVA 2Y22A 3N1PC 2X1QA 1X6LA 4QXWA 4PJXB 3WNKA 4NAMA 1OTTD 5JHLL 3EZJB 4HX1A 2WXMA 4HIEA 2V37A 4RMSA 3SO3B 5JQIB 1XR9B 2IANB 3EH4B 1WC7A 5A43C 1OGTA 3W11D 2AV1B 2VXVH 4UF7C 3NJGA 3SCMD 1U21A 5DO8A 3NCEB 5DJCB 3IGAB 1ZANH 1N18A 4LEXH 2OMBA 3N2JA 4K9EH 1WK0A 4E0RA 4OZGB 1JGLL 1AI1H 1MHPL 3EKCA 1AYOA 3K5SA 4PJ5B 1I7UA 1WBYB 1DUZA 1NGXA 2IDQA 4IIQA 5E03A 4G8GA 4AMXA 5JHDB 4PHZA 1UD4A 2EVJA 5HGHA 1F8TL 1M71B 4R26L 4I89A 3TV3L 1PYWA 1IX2A 3IMWA 4KNSA 1JTOA 1QYGH 3JTSA 4G2AA 5EZJA 4LPXA 3TBSB 1D2PA 2XTJE 3WI9A 2W9EH 3DV6B 3POCA 4HW6A 5DRNB 3GI9H 3I50H 1E8YA 3PPEA 3O41A 4MJ5B 5EU6E 2Z7ZA 3L48A 2YFNA 4DGIL 1OM3L 5L88H 4M5YL 1OCCB 4O4YL 4Y2NA 4KXCA 4JFQA 3JV5A 2X2YA 2CXGA 1FLRL 5A16B 5F7LB 1M05B 3B2UC 2CGRH 2WINB 2B4CC 1SY6A 2NY3D 1VHPA 2CCVA 1KTJA 2OULB 2D7QA 3G5ZB 3FT3B 3KPQA 4GKSB 3I3DA 3MLSH 4GW5B 2DL9A 2ITCB 1BVKB 3GJFK 4KKPA 3I6GB 4PJDB 43C9B 4UMGA 4LSSL 3QWOA 2X4OA 1KEML 2WXGA 2OI9C 3CHOA 1XWVA 1ZV9A 1H8NA 4IU3A 5E9DD 1LK2B 1ZANL 3VSUA 3FQNA 2AJUH 2XTJD 2ZWSA 3SKOA 1P9MC 4PN6A 2ZX5A 1MWAH 1EJ6A 4GG6A 1ORQA 3OZLA 4PWJA 5TK4A 1Q72H 1U3HD 3N40P 3UYPB 2IGFL 4MHHG 2W9DL 4NUGH 2B1HL 3P69A 3UTTB 3N91A 4TMPA 2CH8A 1UG9A 5KBDA 3G04B 2C3GA 3RWDA 5I17A 2ZKYA 5F7BA 1W72H 4OCSH 3MV9B 2C5DC 3ILDA 3P9WB 3ARZA 3QCVL 3QEHA 5EPMB 2D4FA 3D85D 4AM0Q 2CRIA 1HS6A 2GK0A 5B21A 4LLMB 3V4VH 3FQ1A 3ASWA 3VXNA 1MVUB 2K3TA 3U2SB 3WU1A 4I9XA 1FNFA 4QRQB 2CO1A 1U8HA 1VSCA 4YXHH 3UYRL 1CXFA 1CD1A 1T1ZB 1P6WA 1PG7X 2X12A 2YWZA 4R5VA 3WKNA 1P7BA 4AX3A 4LLWB 3QUHA 4QRRB 1FYTE 2CIKA 1R0AL 1UJTA 3G6JE 1T5WB 4LLDB 3IF1A 3L7FB 3CDZB 4BCZA 1BFTA 4IOIA 1U3HA 4PRPE 4S1DC 3LV3A 4HWEH 2EE0A 2NQCA 3T3PF 5AW0B 2VDNL 3CDZA 3EHBD 3K2UL 4HJ1A 1AGBA 4OT1L 5GS2D 4ZMPA 5ICXA 4HK0B 2DQTH 3GJEB 1WP6A 2VJ0A 2ADGB 1YN6B 1HI6B 4NBXB 5DDHA 5I8OH 3T0DA 4GIPD 4R7DB 2WWOA 4NB7A 1BXVA 1S7VA 3ILQD 2BSTA 2SEBA 1JI2A 4H0GA 5F7DB 4Q9QL 2YGNA 3CHSA 1L9SA 4B9YA 1MFNA 3VXNB 4PWGA 1X44A 4MAZA 5MERA 1NICA 1I31A 2Y24A 3HUJF 1ZLSH 3QXAB 3O3DA 2JCWA 2XIIA 2F7IA 1IL1A 4AK2A 3PDGA 5AD0A 1Z9OA 2XV6B 2N7SA 3TEWA 5GISL 4I3RH 1HL9A 4J3WA 3TN0B 3TH3T 3UBXA 1PDKA 4GXUM 5TE4L 4UANA 4AQEA 1CDJA 2FSEA 5B39B 4K2UH 3KNBA 2O93L 1DJZA 3MGOB 3TCLA 2EUWA 5DJ0B 1HL5A 3WNMA 5DD0H 5D96C 3ZDZE 4S0TD 4JFZL 2XZAH 1XCQA 4L9LC 2PTVA 1AQMA 1JXJA 4FLSA 4JFYA 1PKQA 1MEXL 1N5AB 4P2QB 2VZSA 4OU3A 2OCFD 3QDMD 4WUUB 3F7KA 4MA7L 4K94H 4HWUA 4PVMA 4NQCB 4F7CB 1BGXL 4U49A 3A0OA 4JFPA 1IBHA 1S3KL 1YEKL 3KHQA 4NZJA 3EJRA 1CGSH 1S7SA 3I6LD 5HGHB 5GRVK 3TT1L 3MFFA 3KCPB 4P48A 2N3JA 2ITCA 1IEBB 4FTVE 4HT1H 3LPWA 4KUZH 4FG4A 3D5OF 5J56B 3M17A 3DX9A 2D03H 2EO7A 2XN1A 3HC0A 4ZYKA 1I85A 3BXNA 1M05A 1CFNB 5BZWB 3F6JA 3GWJA 4HIQA 3Q6GH 3OLEA 4FFTA 3THML 5IHBA 5L7XL 4CW1B 1BHGA 5CINL 3S8WA 5SX5K 2I26N 5FWQA 4P8QA 2DF3A 4NJ9H 4DWHA 1JZJA 5ICUA 5ICYA 3D50A 3UTTE 5CEXA 4XMKH 4XRCB 1BLNB 1AG6A 4AKQA 5DRNA 1BQRA 2Q76B 5BV7H 4M48H 1HIML 3G6JA 5AYUL 3ZE1F 4JO2L 2OMWB 5DO2C 4XP5H 1NGWB 3LKQB 5BXFB 1MJ7H 5LWYL 2NY2C 3IDNA 1A14H 5LNGA 1TZGL 1JXDA 4PY7B 4Q74A 4X6DE 2YSSB 4H40A 5JHDA 3MA9H 4C83B 4M8QA 1IQWL 3HG1D 3ISWA 5DVNA 1WFJA 3EYVA 3GBNL 4R7NA 2EIMB 3FQ2A 1Z9MA 2AJYH 3IDMA 3LS4L 1UZ8B 5H8DA 3MZGB 5JHAA 2OMVA 2NNAA 3L4ZA 4FXTA 5F8QC 5C0FA 1V27A 4KZ0A 4XCFH 1FYTB 2WQRA 4GT7A 2W1NA 4HJ0C 5CJXC 1GKOA 3GRBA 4PRPB 5KYNA 5DJXA 2M1KA 4X5RA 4XPHL 2QPFA 2HT2C 4HZLA 4ZXBC 5TPWH 5MEQB 2VABA 4FQHB 1IBDA 1AZNA 1MFCL 2P5EB 2G4GA 3DTXA 3F2LA 1JGDA 5IQNA 3LNFA 4OR1A 2VZOA 1ERNA 2O6DA 4M6NH 5D7IE 2VDLH 4Z18A 4TOYH 3PDOB 4OZFB 4KZEH 4PI0A 3QYMA 1ZHBB 4N2BA 2MCAA 4O2EA 5IUCA 1UM5L 2DQCH 4C4UA 1X4ZA 1U2CA 1AIZA 1MCDA 3AW5A 3CNKA 3INUL 4JY4A 4U1IA 4WI0A 2O5YH 3IN2A 1DCEA 1WGOA 2PO6B 1CE1H 4XP9L 4BZ1L 3MNVB 1COBA 2P5WD 1E5UI 5BRZA 1DVZA 4A68A 5I9QB 2WWKO 1B0RA 1BP3B 4FI8A 3APDA 1I1AC 5AKRA 5DC0A 3QXUA 1MLBA 2L04A 5JIPA 1TZAA 1ILSA 3EYSL 3HRZA 4PJAB 1CK0H 2XOTA 3V6FA 4N5EC 4XP6H 4RA0C 1CTOA 5EZIL 4KI5F 2PN5A 3IDGA 3IAGC 4IBWA 3LXAA 4H4NA 5LQBL 2G0KA 4ONOA 4NT6A 5PCYA 2P4AB 4NDMB 1QQDB 4X7FC 4QYAA 5AAMC 3U4KA 4YMPA 1ZPLA 3VO0A 5D7JD 4EN3C 1KGUA 3AQDA 4G83A 4P2QE 4ZPTA 5CF3A 4R90L 25C8H 2LW3A 4NENA 3VWKA 1OALA 5FO8A 3BQUA 1T03H 1WHOA 1X5FA 5CAYB 4ALAL 4ZX6A 1ZSDA 4QJ4B 4PVNA 3RGVD 4M3HA 1JG9A 3BP6A 4PM1A 4JLRA 5EORH 5C09B 4J6IA 2WOYA 3BYYA 3M1CA 5T33H 1EGJL 4CNIB 1FZOA 1NEUA 1MLCB 4RWYL 4PB0L 5L4MA 4M61A 4DHLA 5E08H 1XO8A 3NRPA 5I0DA 2YAOA 2A6JA 5DLLA 1DVFB 3LN5A 5IFAL 3BUPA 1D5MA 4GQZA 5HHXL 4KXZH 3SGJA 4NQTA 3RL1B 1J0JA 3EBGA 3PQYE 4MA3A 3ULVE 3DGGB 1V7ML 2WKGA 4X5XA 1MUJA 2OLDA 4PJ9C 5GQBA 3ROLA 4OLYL 2PCFB 4U1KB 1VESA 4ZSOA 3FO0H 3EFFB 3U1SL 3T8VA 1JVKA 4LESA 3ETSA 4M7KH 1NBZB 3V0WH 1JPSL 4PREA 4ZMLA 3HPLB 1TCMA 1OT2A 4JCMA 1FNGB 5INCB 1GC1H 1G0YR 1YEEL 1I8MA 1YEWA 1TZ8A 3IRZA 2BH0A 3GIZL 5JIDA 2PYFB 1KCSH 2E4FA 4Q6KA 3AROA 1J1PH 2ENQA 3QI9A 3FQYA 1SXSA 3VVWA 4LHUA 4G8GD 3IMVA 1HSBB 5DRZA 2B39A 2X9YA 1CE6B 4ZW8A 1B0WA 1RL1A 2X70A 3FCSA 3BWAB 3MRMB 2MIZA 3TWCL 2PLTA 1MIEL 2DMGA 3EOTL 3MJ9L 2DMHA 3TEXA 3MUJA 5DCCA 4E41E 2RTTA 4ODHH 1ETB1 5KSVB 1E4KC 1HYRC 1YSOA 5HVHC 3W37A 1FPTL 3H55A 2IG2L 2QSQA 2Y2WA 3M17B 3GO1H 3I75B 3I6KA 3P4OB 4L8CB 1F3DH 1SBBA 3WXWH 5GS3A 5EWIL 3BAXA 5JNYA 3MRIA 5DJDB 5TJWK 3FNKA 1PJWA 3SQBB 1A4AA 1VFBA 5AALA 3V4PH 2P5EE 4FLQA 5C0EB 1MW0A 2GT9B 5DYFA 5E2VH 5D7IB 2WLMA 3TPUB 4Y9GA 4G6JH 4E9QA 1T7WA 1W16A 1UB5B 2C9SA 3MU3A 1UT2A 4LE8A 3VDCA 3SDAD 1CG9A 3SKMB 4H7VA 4LHUD 1RLWA 1TLMA 3UABA 3K2IA 4OZ4A 3GBNH 5E24E 4UILH 1NC2D 3B9KB 2WMPA 5C08E 5DJ0A 1T22B 4UIKL 2VH5H 2X4PA 3GBDA 3IJYB 4DUWA 5GS0L 4OZHF 4XP5L 4NKIH 1A3LL 1XX9C 4C55A 4ANXA 1FNHA 4YHPA 2MPAL 4MCYB 3ZDXB 3X11B 1W15A 3DRQA 3CFNA 4M48L 3FQWB 5I6MA 4P07A 3CAFA 1NQBA 4B9IA 1KCVH 3HS9A 3MLXL 1SNRA 1XMWA 4XMKL 1HINL 4C56D 4WF7A 5CUSL 1IC5L 2K6YA 4TNGA 2NTFA 1E90A 2K1MA 3D06A 3FN0L 2AABH 3HAEB 4HQQL 1CICA 4GSQA 4WWOA 1GPOH 5CO1A 1IAKB 3VD5A 3QAZB 2VDMB 3I3EA 1M4KA 2F7PA 2HRLA 2RFXA 2UXFA 2DQJH 3BQUB 3SYCA 4ZTPH 5HGGS 5C09E 4FQ2L 2VDRL 3HNVL 5CM1A 1JZ5A 3QE5A 4UM9D 1AJ7L 1NCNA 4N2MA 4DP4X 1FAKT 1G0DA 2E8ZA 1NCAL 4HBCH 1HAWA 4R7XA 3LV3B 2BJMH 2DLGA 4OJCA 3QCVH 4JJ5B 4G9DA 3EH1A 4W81A 3T6ZA 4GBXD 3U30C 4NZUL 4DFHA 4ERSH 4R4ND 4YZFF 1TETL 3ZTNL 1WZKA 1SDAB 3BMWA 1LK3H 1W6WA 1K6QH 1X9LA 4TQ8A 2CRYA 2C7FA 3W9DB 4AKOA 3DO7B 1D5ZA 4TL4A 2IGFH 1EEZA 1V7MH 1ED3B 2ALAA 1OAKH 1KGYE 4Y4HD 1XIWD 5AVVB 4LZKA 4B6ZA 1C12A 3GINA 4JHVA 1JPTL 1CDIA 4NZTH 1A9BA 1CICD 1EEUA 3BP7B 5HJDA 4BBWA 4OCNC 4YHZL 4RMRA 2CLZB 3WHXA 1HL8A 3N85H 5T33L 1FORL 2VABB 5FIEA 1XF4B 4B97A 3O2DL 2ZXAA 4UM9A 4YR6A 2UZIH 3VYPA 4L37B 4P46D 4AV5A 3E8VA 2GSMB 4LSUH 4YS4A 3QIBB 4AENB 4IHBA 3IS0X 1CXIA 2V2WA 1E2WA 4KVCL 4ACTA 5HYSG 2GSGB 1TQBC 3O6LL 4GO6B 5L8JB 1NAKH 1PU0A 4GQ9H 4WV1B 4IOFD 4M5YH 4GQQA 2ATAA 3VAEA 1UJ3A 1ZHLA 3HNTL 3FUHA 3PWUA 1TEFA 1OAUL 2HJLA 1FFPA 2IANE 1CK0L 4NQSA 3MJ9A 3FB6A 4PJGA 1LD9A 4XWOC 4AG4L 2XPGA 3F5WA 3LB6D 4UU9A 5LGHH 2AEPL 5C6TL 1YDPA 3TVMA 3MNMA 3CBRA 1IBZA 3FTYA 3RGVB 3IGUA 3CVDA 1OW0C 2XIBA 3SQOL 5IW3A 2GBUA 2IQAB 4OZFG 4OZGE 4UV7H 1U92B 5D1QC 4XE5B 4DZBA 1CQYA 5AW9B 4DPAX 4S11A 1P4LB 4POYA 3D3VA 3FQRA 1AS8A 4NIYE 5JHDE 3X1GA 4OJEH 2NCEA 4KK8D 4O02A 4UAOC 2JCCF 1UCTA 4LEXL 1KFGA 5CKAA 3WKML 5F7MC 5HYJA 5I6XC 3C60A 4N2DA 4KKRA 4ODWA 1E9QA 2P7TB 5D7LA 2MQCA 4I5BB 1M7IA 2XTJB 3DO4A 3ULUF 1KV3A 1WWBX 4JFUA 4J3OH 1CR9H 1CT8B 3HLAB 4IU2B 5AQ0A 5DFVC 5JQHC 2AANA 4NUGL 1DL7L 4OJYA 5I19L 5I0ZA 7CGTA 5FGBA 1HINH 2AXWA 1CYWA 2J8UF 3MLXH 3LMJL 3QIUB 2EEBA 4PS3A 4E0RB 5SWSB 1WSST 2Y7LA 4Z78A 5T3XD 1WBXA 3IPEA 1OE1A 2DQFA 2IPTL 4NUPA 4U1JA 4XO4A 3PPSA 3BOVA 1BW8A 3SODB 1OGTB 3HI6H 3D3VB 3B9KD 3FQRB 4KMTL 3DGCR 4PJDE 3N06B 3Q2CA 1ZS8A 4QRPB 5TDOA 4A7QA 4N90E 3D9AH 4L05A 3UL4A 1Z0NA 4MMYB 3FYIB 1WFUA 3OPZL 5JUEL 5T5FA 3SKNB 1UWFA 2HVBA 1YEGL 2E56A 3OSKA 4WKZB 4XBEH 3OKKB 2IOOA 3MACH 1P5VA 3QEQE 1DHKA 2YK1H 5IW6B 4EDXA 1NIAA 4OH2A 4AVJA 1KB9J 4E5XG 3MC0A 2VITA 4XX1E 3TBVA 3WTVA 1SM3L 4BQCA 5EZLA 4HFWB 5IKCA 1QD0A 2X87A 2YAHA 3V0IA 1QAWA 2AJ3B 1NAMH 5JZ7C 1NM4A 3FH8A 5ICXB 1NLBL 4RFEB 5F96L 3QIBA 4L4TA 2X2IA 1YNLH 5GRJL 5GRYA 2P5WE 4G9DB 2BC4B 5CIPB 2IADB 2Z8WC 2ZNXA 3RPIB 2O5XH 3NEOA 1GS8A 3QA3A 4Z7VF 2FQEA 2O30A 4QRBA 5BRZD 4P2OB 5F7EL 4WHYG 2WUBH 1CTMA 2VLME 4PJ8C 1D6EB 1HKFA 4N2OA 4OIBA 4CVXB 1T5WA 4NEHB 4OFVA 3GSWB 4WI9A 1AKJD 3BPOB 5GGUB 1LP9E 1V05A 2FLBT 2ZAGA 5BS0D 3PNWB 2AW2A 1KT2B 3L08A 2JB5L 3KYNA 4PB9H 4AGLA 1XF5A 4WDIB 2VNCA 1I1AB 1JXGA 1C12B 3GZOA 4ICXA 2WIMA 3T0BA 3KL5A 2WLLB 1QP1A 1NIDA 5D7JA 3VXME 4K7PL 3R1GH 4OGXL 1FO0H 4LCCC 1VKXB 3GZQA 5IMLA 3WAKA 1M53A 2FO1A 3AM8A 3S34L 1WRFA 4NC0B 3MXVH 3IJ8A 2OMYA 2Y7MA 1CZ8H 4KVPA 2HJFA 4P2CG 4ZD3L 3U7YL 4AZ8A 5L2KA 3DOSA 1CLYL 4BCYA 1RUPL 4DP2X 2I27N 3DVNB 1LWJA 1NPJA 2EJ1A 4UOZA 3MNWB 3MV7E 4OZ4B 2VLJA 2IPKB 2Q7NA 2WVTA 1GJIA 3BIKA 1KY7A 4HU8A 2HG5B 4LLVB 1TR7A 1T21A 1YY8A 4YBHA 2W81C 5A2FA 1DZ0A 2ZX8A 3LAFA 3FQNB 1FSKB 1CICB 2H2PC 2IAMB 2YA0A 4ALAH 4JHAH 1NMAH 3HE6D 1KXTB 4UTBH 5IM7A 4Z3GA 2KZ1B 1IGYA 3JT2A 4JRLA 4KQ4L 3A4FA 4JZNA 4NYLB 4Y4HB 4OSUL 4N3TA 2APWA 3FTWA 3K74B 1BAGA 3ARGA 3VGGA 1T7ZA 4L8CA 2ZP9A 2ZWKA 3O6LH 1SJXA 2MMXA 4A7SA 3IBEA 5DGRA 4WW1A 1BV8A 4GG6F 4HXBL 4JX0A 5LN8A 4YHIB 3RJOA 1A6AB 4WJG3 4E68A 2Y9RT 5EZIH 1BFVH 1O6SB 2HVJA 3DOIA 2BSED 4LIQH 2GAZA 3MV7D 5IMMA 4AIZA 4QRPE 4ZMVA 2EDFA 3DNKA 4U4IA 3PP3H 1JF1B 4Q6YA 4FTVB 4GNKB 2YKKA 1PCXA 4KOCA 3FRUA 3MKGA 4RDQF 4K9EC 1I8IB 4K5NA 5E8EA 2ZSVB 1PD1A 5I76B 1M7XA 3ABGA 3GSUB 3RIKA 1D7DA 2HPTA 4RMVA 1BYOA 5HYIA 3KG5A 4ZZKA 3IJ7A 2B5IB 2D8KA 4NNYA 2XXCB 4YBLC 5E8EB 5JA9A 3L95B 4QXUH 5JTWA 5AL0A 1KCVL 2V5MA 2JIXD 4LRIC 4NRXB 4Y19E 3HE6A 3TBCA 2F54A 1OZTG 2NOYA 5HYSB 3V0EA 1L9PA 2R0ZL 3GZKA 4KX9A 1G6RL 1OSZA 4JRXE 4M3JA 4YSRA 2ZOLA 4OZHA 5I5IA 2P43B 2QQLH 3GI8H 3I85A 3NCBB 2EDOA 5ALBL 4FGMA 4WTZA 5HHNB 1KV7A 2DPKA 3VMOA 4LVHB 4PS8A 3ZE0F 2K0RA 3VGAB 3SD2A 5I9QC 1QPXA 2GFBA 2YQGA 1YYLL 1CD0A 2XQBH 2OSYA 3CSPA 4GMTH 5KYUB 2VZ3A 2HSIA 2VDRH 3GYRA 1MLCA 2XV0A 3GF8A 3G6AB 1F4WL 3JTTA 3T2LA 1XSIA 2C1PA 1IQWH 5A2KH 4AQAA 3C8HA 1TSRA 3V0VA 4UB0L 1PD6A 4P05A 2CA3A 3KDPB 3CSGA 1GPOL 3D69A 4LKCB 4GO9A 1YY8B 1PX8A 4RLDA 2X0UA 2DTML 3K8KA 1N2RA 3VCLA 1RZ7L 2FJFB 5EF0A 5BVPH 5DEZA 3BAKA 1S5IL 4W93A 4GG8A 5E1QA 3CXFA 2VLKD 2L7QA 1YVLA 3TT3H 1ZA3A 4GKNA 4LCWE 1WBZB 2LT9A 3VFPA 3BKJL 2DD8H 4OLXH 4P57A 1A7RH 1F8TH 3TFKC 1S7TA 4A38A 5DVKA 1L3NA 3ESVF 2NZ9C 1B0IA 2Y5TA 3THMH 2UZPA 4QRSA 2L3BA 3IDXL 1DQJA 4KO9A 4F57H 5JORB 2NDGA 3M8OH 3FSWA 2QEJA 3HJ0A 2L7EA 3CLFL 1XDTT 3ES6A 1DVSA 1CVSC 5D4IA 4QYOA 3MLWH 3UADA 2B16A 5E1AA 5AUMB 1BM7A 4Z7UF 2O6CA 4L1BA 3U0WL 5AZEH 5HHMD 5E2WL 5TK2A 4RFNB 1O0VA 4N26A 2Y3NA 5I1IH 1YHPA 4AVHA 3TA3C 3L5XH 4M43H 5EIVA 2GBAA 3KPRE 4UT9L 4D9LL 4P3CH 1X9UA 5IB3B 3QBTB 1OGPA 1MCLA 4HZLB 2VZTA 2X41A 4JFDE 1NFDA 4IRSB 4KROD 1MFEH 4M5ZL 4QLRA 4IRJA 2WZ5A 2AI0L 3DYPA 1N0XL 2FBOJ 4X6CB 2CUHA 4FLHA 2I9LB 1AP2A 1KPUB 3P30H 4TLTA 1BQHB 4I9WD 3LQZA 3SGKC 4DIXA 3SPVB 4G6MH 4I2XE 2ICWI 5IBLC 3OHXA 4R8WH 2Z31A 1E6OL 2FAUA 4O5LL 1Z9NA 1QSED 3MLWL 1U4EA 3G08B 4DW2H 3VXUA 3V9CA 4QNPE 4LIQL 2WHVA 5E00B 4KNQA 1J0KA 1E3ZA 1URIA 1JERA 1U41A 2XCMC 1HZKA 3WSQH 3MYZA 4W9EC 1ZVYA 1WQVT 5G4MA 3L3HA 4UOJA 3ZRFC 1BQLH 5HHOB 4M7KL 3V0WL 5DK2A 3MRHB 1OP9A 43CAA 4TQPA 2P5ED 2A2QT 5T1DL 4JFXA 4XMWA 3SEPA 4J28A 2AQ3A 4NWUL 4P9MH 3UTPE 4JKKA 4PRPA 4BFEA 2ITDB 5C71A 3DVGB 3I02A 3ASNB 5C0DA 5ITBL 2XWEA 3CX5K 3L45A 3CFJB 5I26A 2QGCA 3TVMD 4BE5A 4WEMB 4QUOA 1J0YA 3UBGA 1IC0A 4U6HB 2J71A 3QQ3A 2NY1C 3BXNB 5PAZA 3T77B 1RERA 4F2MB 4A2GA 3GMRA 4EZJA 4U3SA 3ULVL 1CL7I 4R6UA 4IK7A 4KY2A 4N1HB 2X7LA 4QTFA 5K39B 3UG3A 1MY7A 3IU4L 5BO1H 3ARBB 4UB0H 1IEBA 1SN0A 4QHNA 1SXBA 3WEAA 2FATH 1TYEB 1RMFH 3GXFA 3HLAA 4GMSH 4IU2A 1RUPH 3L2LA 4LVOB 5CR8A 1IJ9A 4KMLB 1JZ3A 4F8OA 1ZA6A 4XN8A 3LPGA 3QS3A 1T7VA 3J2PA 1DN0A 1SQMA 1K9TA 1LO2L 5I1KH 4O2CB 4ONGL 3TV8A 1HWWA 4ZNEE 3AS3A 3IMTA 2ICEA 4FZ8L 4JPIB 4KQ3H 1I8IA 4ETYA 3GRWL 3RWHA 4YAQB 1K4CA 2BOCB 3FBKA 3TZVD 1GAFL 1ZHNA 3OXRB 4RMWA 4U7SA 1ZJAA 5FYKU 1BDYA 1G6RH 5GGTL 1V10A 2JB5H 2ZE0A 1BOYA 1G9MC 3AUWB 3QXWA 1OP5K 5GGRA 4YSDA 2GY5A 3RLSA 4LF3B 5F9JA 3ZTEA 2BVPB 4LLAA 4Q52A 2WXRA 4LSQH 1J1XH 3VXRB 2NY5C 4W4NA 1PFCA 5IZ7A 1M9SA 2YPLA 6PAZA 1T5XB 3RKDD 1TJHL 3HFFA 2AC0A 2CUMA 1KIUB 1YMMA 4L8DB 4PLKC 3ESUF 4GI6A 4PLOB 2Q8AL 1H3PH 4RMTA 4HOWA 3M8OL 1L9RA 1M42A 1XZWA 5EA0L 2VDLL 3BSZA 5HY9B 4EI6B 3V6OA 3WELA 1RP8A 1BPLB 1HIMH 1TPXB 2NY3B 4H8QA 4HH9B 5DZNA 3VJ6A 4Y4KD 4C4KT 1DQIA 3LQAH 4G1EB 4OJFH 3L6FA 4XNXL 1FQ9C 2GHZA 1KJVB 4LPWA 1FRGL 1X9RA 3MYJA 3TZVA 3V5DB 3ARED 4ODTH 1JUFA 2FWSA 3FMGL 3AXHA 5HI3D 4OKVA 3SCMA 4IBYA 1ACCA 2WANA 3O0LA 4XBMA 2Q87A 2BDNL 3C5SA 5F89A 2D03L 1PDKB 3UBXB 5F9AC 3H6AA 5HP5A 1R3LA 3D05A 5JYLA 3LKOB 5AVQB 1XB3A 5FKPB 3RDJA 3QIBD 2ETWA 1JBJA 3R4DA 1OP4A 1LMKA 2YPLD 1PNDA 5D6DC 5EEXA 1KGWA 4AEIH 4BKLB 1YMMD 5SWQB 4PRHA 5GS0C 4GEJA 5AW4B 4G8FB 1AY1L 4FL4C 2MNJB 1D3CA 4H8VA 3NYKA 4X9BA 5J6HB 1SQ2N 2A6IA 1OWRM 2XG5B 1TTAA 2A4CA 2VMJA 2NY2B 3RJQB 4HIHB 2AK1H 2Z1KA 2R29L 4RRPG 4WI3A 4AK1A 1OSPH 4NQXB 1Z5LB 5ITFB 5J13C 1Q1JL 1WITA 2IGLA 1RJLA 4HMCA 5DVPA 5JW3L 4ZUTB 2FZ3A 2R56H 3P4MA 2P44B 5CGTA 3AREA 5DD1H 3VSTA 5IF0A 3VM7A 1K5NA 2X4RB 2AZAA 5ENWA 5EDXA 3RZCA 1F4HA 3WCYA 1MFDH 2F58H 2JKTM 1QSVA 3PS6A 4N8PA 2H1XA 4GAGL 5ABDE 4ILDA 1R3HB 3TN0D 3CJJA 1U30A 1OB0A 4FD0A 5K9QI 4YVUA 2KZKA 2XU9A 3IFPA 2OBGA 4FKHA 3CFEB 2Z7YA 3HG1A 2GK0B 5BPPA 4CADB 5L4JA 2A9BA 2ZUQC 2LAAA 2WP3O 5IQOA 1EMTH 3AWFA 4LLYB 2IBZY 4KAQL 3HPJA 1WFMA 5DQDH 1FC2D 4B7LA 1JHKL 3MV9A 4OCWL 3D51A 2QDVA 1PQZA 2IC2A 4O2FA 5T1LD 4ODUA 4HWEL 1OF0A 2CJTA 4LDOB 2W60B 2Q3ZA 5DMYA 4JG1L 5LBSH 4XVTL 5A6MA 1IEHA 2EDNA 1FFQA 1QUNB 2HT3C 2B59A 2YLKA 3BDBA 3OX8A 2A77H 3U9UA 5GSVB 1KFAL 5D7EA 1A1OB 2XWXA 5AEAA 3WL9B 4P3DB 3QULB 3JV6A 4MXWH 2ZUVA 1YYLH 2J1XA 2XQBL 3O45B 2E7LC 3K72B 1AZBA 2PCXA 4ADJA 1IM9A 2XTLA 2X2UA 3N3EA 3F04A 4JKPH 5E23A 3LKSB 3RPBA 1F42A 5DJ2A 1FG2B 4R84A 4XAKD 1RKRA 3LIZA 4ZODA 2VKWA 3UPCA 5DJYB 4E2OA 3LJ3A 5AAPA 1Y0LB 3MHZA 2XT1B 3C5JB 5L6YH 2VDNH 1QFWM 2Z0UA 1I75A 3QEUB 3KBPA 2X70B 3G6DL 2EIZB 4XPGL 1H5BA 3RDTC 1Q72L 1WT5C 5C0CA 4B9ZA 1ZY9A 4OCMC 3P9MA 4HS6B 2BXYA 3S88L 4IKIA 2HJKB 2E6JA 5SX4H 4P2YA 1KPVA 3O3EA 5CEZD 2EO1A 2R2EA 2AK4E 3DX1A 5SWSE 2MOGA 3AQXA 1PYWB 4PJGF 1DLFH 1A7NH 1WE5A 3ATBA 3LDBC 2WVVB 4AYFA 4IBZA 3WY4A 4XC3H 3D3VE 3NESA 4ENZA 1KZYA 3VXUB 3QH3A 4PWKA 4KO5A 1I9IL 4GW1A 1INQB 4HJTA 1SMAA 1AMYA 2WNGA 4X5XB 4F37K 4UIMB 4TLSA 1SHMA 1KTBA 2OR8A 2ZF8A 1Q0YH 2WZPA 2X89D 3VX1A 1NCCL 4XNQB 5E4EB 5GGTA 4RCAA 4JDTH 4CVWA 3OXSA 3GXUB 1PZBA 3D39A 1DQQA 2JQAA 3NJIA 4HKZB 5C0GA 2V2XA 4WGVB 3EDDA 5E6UB 4ANVA 3BIBX 2PPFA 1UOWA 3FO9A 4IHOA 4KK6D 2YO3A 4RGNB 4PRBA 4MQ7B 4TTDC 2R56L 1H0DA 4JY5H 1JZFA 1PW3A 2E5EA 4JN1L 4RNRB 2KH2B 1AGDA 1BVOA 3QPXH 1KOAA 3TIEB 4HUCA 2E75C 4Z6AT 5E5LA 4HULB 1OSPL 4GUQA 3S35X 4DP1X 4UI2A 3TURA 2ODIA 1ECZA 2VMDA 1E9OA 2GITA 2P5WB 3GMQA 3MLSL 3D30A 4J3OG 4Z7OE 3VD2A 1TQBB 2XWBA 4AM0A 1Q4NX 4X80H 3VWJB 1DQLH 3FS9A 4ZFOB 1OGAE 5BOZG 4LARH 4NO3B 1TT6A 4HUVA 3S5LB 4JN1H 1AP2B 1HX0A 1KPUA 3G9VA 3N85L 4NO2B 1EHAA 1EO8L 2B9BA 2UZXA 3BKYL 3IKCB 3Q5OA 4K7PH 2R69H 5EBWB 4FZEL 4XCEB 2H32A 2NY6B 3LMJH 2R1XA 4MDJA 4X5QA 5DT1L 1WUZA 3MCYA 2CO4A 2BOBB 4X5WA 3VRLF 4FJYA 1QFUL 3KAAA 3MREB 5BOPA 4KK6C 4L9LA 5HDBF 4N8VA 5D1QB 2ZJSH 1Q9WA 5I1LA 2Z35A 1T83A 2KLSA 3B4NA 2A83B 2PWFA 4GBXC 1JD7A 4NHUB 2R4RL 4QYOB 1PZ3A 2JKWA 2P8LA 3OMAB 2NT0A 3V0VB 3V4PB 1VJSA 3BAIA 4MQ7A 3RVUC 2CKBH 3BSGA 3SDAA 3F00A 1YMME 3VXUD 5EU6D 3FQUB 4RZKA 3MJ7B 4TQIA 1H3PL 3E3QC 4FFVD 4L3AA 5I5MA 4X9YA 3GIZH 4B96A 1U8CA 4N2FA 4X9FA 4Y2DC 4NCDA 2IDTA 3EJPA 2W0KA 1A3RH 3QRLA 2FGWH 5DFWH 4AYGA 2EIBA 2ZJSL 3NBNA 1TO5A 5FS5A 3TX4A 4APQA 3G6DH 3FN3A 3PJSB 4GLRH 2FB4H 1YA5A 35C8L 4P9HC 2I7OA 3SOBL 1RZ8B 5KS9E 3WIFA 3PIQB 1F58H 3BPNB 4L3ED 1T3FA 3BUTA 5FYJD 1XF1A 5TFSL 1S3RA 3F6LA 5ICZB 4N22A 4MKMA 4NRZA 2R7EB 2FJGB 1FFRA 5FUZL 5FEBA 3WFZA 3KYOA 2IXQA 3PFUA 5DMIH 1FL6A 3H2WA 1J1OL 2F53B 2D0GA 2VLKB 4X0KA 2WYTA 2A4EA 1XF3B 1LQSR 4P5MB 3ZE2F 4KKBC 4P0DA 1YNTA 3ZE1B 3UTZB 1GH7A 4I0PB 3AT8A 1X5IA 4RDBA 5BO1L 4AV4A 5BZWA 2ZG3A 4L9DA 5FGCE 4LVOC 2ESVE 3CC5A 4LCUA 2CU9A 3MBWB 5TH2A 4YHZH 4QMEA 5KVDE 3K2KA 3K8MA 5GJTL 3FTUA 2EYSB 3FCSB 5KVFE 4YE0A 1B2WH 4Y19B 4RGNE 4NYLA 4Y4HA 4B50A 2A5UA 2C7UA 5ID1B 4GW4B 4TLUA 5DI8A 4ELKA 4RA3A 3WKMH 3X2QB 3KGTA 4PRIB 2BZDA 3U6RA 4PBVC 3WAJA 1LK3L 1FPTH 3VA2C 2G0LA 1P9MA 4KKZA 1YECL 2OSWA 2H7WA 3VFOA 3IDJB 2WQ8A 4FFZA 4CGTA 3T04D 3ASOB 4MXVE 4ODVH 4Z7QB 3DVNA 5EUOA 2W60A 5JDJA 1SJHB 3QUMA 4J3XA 1WD8A 2ENPA 3FF7A 5E7FA 1NA8A 3V9EA 1DJSA 4ZPVA 4I18C 2J1WA 4FG6C 3UIYA 1XL4A 2OA9A 2VMCA 5TE7H 4X7SH 3OKDA 1TF4A 5AD0B 4C4KO 1JJUA 2VQUA 1KIRB 3NCYS 4W1TA 4GIAA 4XPHH 1CDBA 1XGYL 4M93C 4G80A 1MNUL 4IBLT 3KW7A 1IV8A 3ML9A 1ZK5A 3FO0L 1SXAA 3O6FA 1J5OH 2HH0L 3HHMA 2G5UA 1A9EA 4AT6A 2B2XH 3MRBA 5EB9A 3T0EB 5GGUA 2QHRL 4I1RA 2AJYL 5T3ZD 2K9FB 4F27A 1SYSB 2GHWB 5BUAA 2R0KL 5E5RB 4IOFC 5AZ2H 4FXGA 2G30A 3G3LA 3GT6A 3C8KA 4Q2ZB 5IMOB 5EO9A 2EKSA 2L4OA 2FQGA 2FSDA 5DO2D 2QVMA 4RFEA 3WDIA 4YGVB 4ABQA 5IFHH 3FFDA 3VGEA 4FP8L 1LP9A 4N25A 3ZT5A 3UERA 4F20A 2QPSA 4TM9A 2AQQA 2IMMA 5DEGB 3TEUA 2QADC 5CJOH 3WIIH 4TSBH 3D25A 3U2SA 5CJXA 1JPEA 1C08A 3NT0A 2EDEA 1D5XA 3DMMD 4XNXH 4RGND 5GZNC 1IC1A 4FFYL 2ODHA 4FLRA 4XBPA 2EDQA 5EWIH 3WIHL 4WI0B 4QHPA 3KVPA 2FQDA 3U4BL 4F7EA 1RK1B 4HV8B 5FFOA 5IQLA 2V2TB 1R3LB 1QSZA 3O6FD 2QR0A 3GMPB 3K2MC 1JK8B 5CP7B 3RWDB 2A74A 3PNRB 1DBJL 1IMHC 2TAAA 4MMYA 4YHKH 4LCYA 1ZDQA 1P7QD 3WTTA 1F3JB 1E6OH 2CJ3A 2YZ1A 4IEFB 2DQJL 2UUDH 4J4PC 4BZ1H 1J8HD 2DLFL 3B2VL 1ZT1B 3NCXA 1AFVH 3P2BA 4H25B 1U8PB 3D8MA 4D7PA 1N0XH 4NAQA 3CFCH 2VM3A 3ME0B 4N6RA 2F58L 3FCTB 1I8AA 1NTDA 1YRKA 3HBZA 4TOYL 1CF8L 1ID2A 2Q5BA 4OFKA 1AZRA 1EPFA 3IRCA 2VM9A 3EOAB 1K85A 3Q8BA 2JJVA 4FI6A 5IY5B 1BVKA 4HJ0D 4PJDA 4BHUA 2XXFA 1PLBA 3DMMA 4ES9A 2WQWA 5F7WC 5INDA 4ES8A 2P46B 4Y2DA 1G43A 1X5ZA 1YO4A 3L13A 4M62L 3PWJA 1UA6H 2GW5A 5DR5L 1QFWI 4I3RL 4WKZA 5DZAA 1FYTD 5LAXB 4QXUL 5CBAB 5EDSA 3VW3H 2R29H 3FUFA 2VC2L 4RISH 4L0PB 2J21A 4F2ME 2EECA 4FYRA 1MI5E 2FYYB 1AFVL 3VG0H 5GIRA 1ZEAL 5JW4R 4L0YA 5FOJA 4PWEA 2NUTA 1JGIA 1P7QA 5HHPA 1C5CH 5HYQA 3CIQA 2D7TH 5D71L 3UOAB 3LZNA 4IMLB 4GKZA 3NFSL 5E9DA 4KKCD 3S36L 1U93B 3JTSB 3QNFA 4ZMXA 3LPOA 4YO0A 5FFGA 1A6VL 1YDPB 4NWUH 4BWTA 2NY1D 1KXVA 3KLSA 4NFBA 2QGEA 4EVNB 4PVLA 4LSVL 4WWNA 2QDWA 1J5OL 3DMMB 1J87A 2PPAA 2ALWA 4J2QA 3TJPA 2IBBA 3SJVA 1W8OA 1WUNT 3ELAT 3MGTB 4X7EC 4XPTH 3VI3B 1DYZA 4ODHL 2DTMH 5EULV 2C3WA 4ZMQA 5E7BA 3RDTB 4F3FB 2IH1A 2YFOA 4JANA 4WV1A 5ES4B 1IGCH 5E9DB 4PJHF 3IGAA 5SV4A 2Q20A 5I6LA 5L2KD 5FYJU 5HHVH 4CSSA 4F15B 4ZNCD 2BIMA 3ZZSA 2K8MA 3RRQA 2ZWYA 4AENA 4L1HA 1BMZA 1DO6A 2ADYA 2NUTB 4JW3A 4ZSOE 2IANA 5I75C 2P8MA 3BGFB 3IBOA 5KSBF 2OTUA 1U3NA 5I5RA 5MI0B 1XF4A 2A9MH 3VFUB 3B56A 3DV4B 1LEKA 4PCYA 1OTUD 3CMOL 4I1NB 4UCFA 2DRUA 4JDZB 3BAEH 2FNBA 1CXEA 4FRWA 3T6XA 5JLZB 4I1PA 3PWJB 1YPZB 3GIVB 1MJ8H 4JFEB 1IL1B 2UXGA 1U8IA 3PL6A 2A9DA 2EXYD 1NKGA 1K2DB 2Q10A 1UA3A 4K8RC 5TF1H 4FQXB 15C8H 3EJCA 3CZSA 3NOIA 4BM7A 4O9HL 4MNHB 1O9ZA 5JXAL 1BVNP 1NIFA 3SYOA 2NSMA 3CVCA 2OX5B 3FB5B 4KQ3L 3RVTD 1QBBA 2J7LA 3S3JA 3T4AB 2BRQA 1OB1B 4P5SA 5BJTA 2BNQE 3NA4A 2RBLA 5B4MD 3V0JA 1I1FB 1MY5A 2I9TA 1J05B 1O7DE 4RWYH 5KANG 3F7VA 1KB5A 4W9LC 4GI9A 2VGLM 2J44A 3DHUA 1RJLB 3KVDD 1NSNH 4ZO8A 4ZAKA 2ZUWA 2YKLH 2O5XL 2OSLB 4AI7A 5GSRA 2W0FB 2Q8BH 3RBGA 3KPLA 1GTFA 4WENB 5D1XE 5EU5B 2J1ZA 1CFSB 2UWEF 4JO2H 3N1FC 4LLWA 4Y8DC 3WMQA 3AG1B 1YUHA 4LSPH 1NFDE 4XBPB 5K9JH 2EKJA 4FLOA 1RHHA 1ZHKA 2YXMA 3DJ9A 3AG2B 3P3UA 2BY2A 3S36H 1E5BA 5EPMA 5GGSA 2J2ZB 4RESB 5KSUB 5KJ4A 2G3MA 2OTWB 3EG9B 3IVKB 4PR5A 4MCYA 1UH3A 2BRRL 4QD2E 3B9AA 4KUCF 3FFDB 3NAAH 2VO8A 5I17B 5D93B 5JPMB 4H8WC 1R34A 4KNUA 4F7KA 3CV5A 4HEME 2AMUA 1UCBH 3BGMB 1ZA3B 4MD4A 3MJ6A 4U1SA 3SPIA 5IMOA 4PBWD 1CD8A 2AXHA 4KI5C 1K3IA 2XC8A 1KBKA 4M29A 5CBEB 2ZG2A 4RISL 3TT1H 1O9VA 1WS8A 2F9BT 5HPOA 1H15A 1N0LA 1L0PA 1UA6L 2VSDA 3S34H 3STZB 1HEHC 4OGYL 1MWOA 4LVEA 1DQDH 2A1WL 1A7OH 1UXLA 5T3XE 5I1AB 5SWZE 1P7HL 4XVJL 4IU3B 1QRNE 2NTFB 2QV2A 2OZ4L 2VR3A 1YQVH 1CCZA 3HVDA 2Y3AA 1M7DA 3DOHA 4PSRA 5IB5B 5TFSH 3T0XA 3WTYA 5CJOL 2J8UA 3I6GA 1QFUH 4F8PA 1MRDH 1QKZH 3FQWA 5CZKA 5AB9A 1X5AA 1R3KB 3GBLA 5DT1H 4AQOA 5M94B 1UM6L 3CXDH 3VH8A 2YRPA 3HW7A 3V0GA 4U4BA 3NN8A 2DLFH 3B2VH 4Y4KB 3VGDA 4LQFH 1MCIA 3NZSA 3V6OC 1FH5L 3R06B 3B2PA 3QUMB 3QUXC 4JZJC 1AIFB 4ZFZB 3MRPB 4HKXA 5L8LB 2ERJB 3B1TA 1ZXKA 3A3YB 2BIOA 2ZP8A 4CSTA 3OV6A 3HE6B 1SVBA 1F6AA 1F3DJ 3ZHLA 2IXQB 3Q01A 1Z3RA 5FHBL 1XT5A 1NCHA 2I24N 2FEEL 3T8XB 2X2JA 5C92A 2WK2A 1C16A 1T04A 2EDKA 4EBQL 4N0RA 4BH8B 1GYAA 4RGNC 3U7AA 3O4LA 4G9FE 4Z3TA 2VDML 1FNGA 1NCWL 3W2DL 1SLXA 1R5WB 3CLEH 3ZTJH 4EQ2A 1J11A 1RSYA 2APVA 2DWEB 2KYIA 1S8DA 2VDRB 3QUMH 1DTUA 1HILB 4QGTA 4BUQA 3ROLB 4AW4A 3O8XB 4K55A 2ICEC 1OANA 3BPLB 3QC6X 4JO5A 1JHLL 3UJTH 2EVGA 4W6XB 1B0GA 1OD9A 3EYFB 3HNTH 3DETC 2BNQB 2DH3A 2AK4B 2BVOA 3HE6C 2AAAA 3ZL4H 4WWID 3DI3B 5DJCA 5EU7E 5EBGA 4LGRB 4UM8A 1KJ2A 2N4IA 1CXLA 5FYKL 2A38A 1QSEA 3NIDF 4NKDB 2E4TA 2C4FU 3GRWA 4ACPA 2Q8BL 1CLYH 3T4AC 4AYSA 2DICA 2VL4A 2YHGA 1T1XB 2DZEA 4MKTA 4HIXH 3AAZA 5ADPL 3SCMC 1DBKL 3KDMA 5AB1A 4DKAA 2APXA 1LDPL 5FYKD 1HHKB 1NCIA 3NZ8B 4G3YL 1GJUA 3TA3A 4EI5A 1NBZA 3O4LD 5CBEA 1U3JA 1T1YA 2YPKA 1EO5A 5KOMC 4Q6IB 2LFGA 4YOKA 5I0WA 1Q9KA 2OJEA 5KTEL 5JXAH 4M1CC 1MUJB 2DI9A 2DWYA 5TE4H 1HZLA 2X42A 3IGFA 4PJAF 3W39B 3LQAC 3QQNA 3EBAA 4MD0B 2XWDA 3LKPB 3JWDC 4PV9B 4UDUB 3ABKB 4NO2A 3RL1A 4PP1D 3IVKA 5L6YL 1MCWW 2UY7B 4AVIA 5BUPA 2HTKC 3VQ2C 3MV7A 1A7PL 2D73A 3BAEL 4PG2A 4D8PA 3QZWB 2GJZB 2H47C 4CU7A 5I1GH 1A2YA 4P9HH 1RZJC 2PNDA 1I9IH 1OT4A 1HSAA 3PWPD 1MXGA 3U30B 3ZN6A 1JN6B 4GEIA 3WLWC 2GJPA 4GSRA 1RUKH 2LU7A 2VQ1A 5CSZB 1DN2A 4GQPH 3HTLX 5DEFB 1QATA 8CGTA 3VD7A 4OF3A 2OSLA 1T89A 1FBIL 1JDAA 3GSVB 3DSNB 2JE8A 2BOBA 3PXHA 4IRSD 4X5WB 3WUWG 3V5HB 3TH4T 5F3BA 1OKEA 4IKNA 3D48R 4OFDA 2KDGA 1CPUA 2QADB 5B3JF 5J1AB 5DRXA 2R8SH 3NIGB 1NMAL 4UTBL 3NPZB 3OXSB 4RETB 4XN7A 2BNQD 4AIXA 5EO0B 4XXWA 4JVPA 4NO3A 3LXUX 5DUBB 2UY6A 3BGAA 3GHPA 4ANUA 2NDFA 4MNHA 3BLPX 4J12A 1I7TA 4OCYL 3ZPDA 1JRHH 4W9GC 1T1YB 2EE6A 4J1UA 4KDWA 1FH5H 2BNRA 2NX5D 1MW1A 1AOHA 2OJZL 5KYYA 3N1MC 1WCBB 2O1AA 3NFPA 3QUXB 4JZJB 3VGAC 2BVEA 1FVDA 4MXWL 4TXVB 2E6QA 3FF8A 4QRRE 4WNJA 1NWOA 1YNTF 4U1MB 2Y06H 3G6JB 4XMPH 1WCQA 1I3GH 5HGBA 5E8NB 1FNEA 5E1IA 5IG7B 4TTDD 3GLEA 2OQJA 3OGCA 2QQKL 1OAKL 5AL8A 5E2VL 5TQ0H 4NQDB 3H9HB 3S2CA 3R1GL 2QFPA 1AVAA 1W8EA 5KBNC 4TLKA 5KS9B 2B0SL 2CR6A 1BEYH 1BPVA 1LE5A 4UM8B 2V5YA 4YDJB 2JMRA 1SBSL 3WJJC 4JG1H 1TETH 4MAYD 3APFA 3S6CA 4G3YH 1A66A 2NNAB 5C0FB 1B0GB 1VA9A 5CS7A 5ECGA 1KGXA 4NQEB 2FO4B 3DX9B 4WVRA 4ZOBA 4BH7A 4MMXC 3W57A 3CFCL 1KCUL 1INQA 1PSKH 3F6IA 1XAKA 5IHUH 5EF2A 4Q0XH 4MMZB 1S8DB 2VLKE 3MCG1 3V5KB 1E5AA 3N6YA 4J8QA 4XWGH 2YD8A 4PGCA 1PLGH 1TOXA 4XMLL 1BFOB 4FQQB 1W8NA 4TUKL 2FGZA 3MPCA 3MRDA 2X6UA 4TSCH 1KPVB 4FA7B 5ANMB 3ZL4L 3FT2B 2ZUUA 1MHCA 4PJ9D 4MJID 4FOMA 1F97A 1OM3H 3U9WA 4AUUA 4FTVA 1ADQA 1P5UB 3FT4A 3IN0A 4PJ8B 3O6FC 3ETTA 3EIFA 3WUWB 5HPMB 4HUNB 4J5VA 3LH9A 4M9OA 3E0GA 4K3EL 4RAUA 4FXKB 1FRGH 5I0VA 2VDMH 3DUSB 5HGAA 1KTDA 2ZYHA 4UQDA 4RAHA 4JO3H 2J8HA 2J12B 5I6PA 5BS0B 5IBTH 3P3YA 1PTZA 4LLYA 4AQZA 1XGZA 2HFFB 4MRBA 1FZKB 3CC1A 4I18A 2H0PA 3IAPA 2BW5A 4NCC1 5H37G 4DEPC 4AJYV 5JPNC 1LVEA 4Z0XB 1KTLA 3TTYA 1RZGB 1UXWB 2BPBA 2ROYA 4DEUA 2C9PA 3QNZB 5C97A 3KXFE 4K9EL 5D1ZC 1XH2A 2YXFA 4KKNA 2IAMA 1A1OA 5F3HA 1U8JB 1T5KA 4M1GH 5EORL 3O2DA 3STZA 1IKOP 4H25A 3KLKA 5MI0C 3W1ZA 1ILUA 1GGCL 4PV8B 4HCRH 3AREB 3K4AA 2FIKA 2B7DT 1JZIA 4BKSC 1HHIB 1NLDL 1KIQB 1QASA 3V0AC 1H8SA 4LLDA 3DIFA 2K6ZA 3HZVB 5KN5B 1RP9A 1JWMB 3AXLB 3UG5A 4N0FB 4BUHA 3SDDB 1DCLA 1Y07A 4F7EB 5DMGD 4EZLA 2A9ML 3IFOB 3H9SA 1J8HE 1TQWA 2YC1B 3LH2H 5SWQA 4GRLA 4P2RD 4B3VA 3VFMB 3B9DA 4BSWA 2YPVA 4LL4A 4P46A 2LTQC 3MRFA 3P2DA 1KCSL 1S7VB 1TJHH 1NL0L 5JOPD 4NQVA 3BH9B 3BVVA 2X6CA 1YECH 4KJQD 2WWMD 5CUSH 4G6FB 2J55A 3E6HB 4ZUVA 3ZLQC 5C6TH 5DS1A 2AEPH 4NQDE 1K72A 1UACH 5FO7B 4ZUTA 2K45A 3HZYB 2FECI 1RQ5A 2A0LD 2EILB 5F93C 3F7VB 2HLEB 3S98A 2VXUH 1HEZB 1S4IA 3OR7A 5HTSA 3ZMEA 1ZWIA 2KERA 1WA2X 3QISA 1DFXA 1TQUA 2B5IC 3ULVD 3H7LA 5DHMC 5K9JL 2XFXA 2Y7SA 5J3HD 4AT6B 4B3EA 4GQ9L 3ULUE 3SKOB 2H1PH 4LDLB 2BM3A 3FRPG 4MB1A 4WY7H 1BF2A 3TYGL 2CHDA 3S5LG 2D7TL 5D71H 1UT1A 1ZLUK 2ZWLT 1AHKA 2ZIDA 2JH2A 3D85A 4JDVB 4WWKC 1ZEAH 3DBXB 3O3BA 1L5GA 1SOXA 2YKLL 5EOCL 1T5XA 4LB8A 4R3SB 4XOCA 3SDAC 4AEFA 2BHZA 3E7JA 1Z9SB 2D31A 3GB7A 3QQXA 4GPVA 4JFTA 4H44C 4JDZA 5JW4N 3CXHJ 2W92A 4OKVB 4WEUD 4OD1L 4ICWA 3MV8D 2HLFC 3IAQA 4N2CA 4PV1C 3TOPA 4HUUB 2FX8L 4QRUA 4Q9RL 4URTB 2JB6B 4DGYH 4S1RH 3U82B 3K46A 4ZFQA 5BS0E 5F1OB 1LK2A 1V3JA 2FJHA 3L9EA 4RSVA 2MQ0A 1IBGH 4YFDB 1W0WB 4MS8D 1E27A 3FT9A 43C9A 1FZKA 4I18B 4X8GA 5DUMH 3VG9B 1DJIA 1GA2A 4YSCA 3P4OA 4LVNB 3I6KB 3ZO9A 1MFDL 5C0ND 1N7ML 4O5LH 4P04A 4ZTPL 3DUHA 3ZW3A 1E2VA 2AQRA 5JIKA 5CEZE 1EAPB 3RVWC 5DTFA 5F7KC 4WI4A 4BGDA 2CALA 2R4RH 5T3ZL 1SOKA 4BFGA 4S1RL 1OM9A 2XI9A 1B6DA 1ZHNB 5TDNA 1IC5H 1KLFB 2TSBA 3FN9A 4Z0BH 1JYNA 4DP0X 3B2MA 5F1SA 4JPVL 3NSCA 4HEMA 4HIEB 2JKNA 1LP9F 4DZBB 1FNEB 2ZF9A 4PWIA 5J12C 4J3BA 2ED8A 3RZCD 5ERWA 3O4OC 1KEGH 4MDIB 1DUYB 3FUDA 1MG3C 3NSFA 5EZJB 5LAXA 5D72H 1SJMA 4IBTA 4M4RA 4LNRA 4N1EA 4AGOA 2Z4TA 5FYJL 1H3UA 3VVVA 5KYYB 5JA8B 4YNYA 3OKLA 4PB0H 2XNAA 1J8HB 3BH8B 5DZPA 4ELME 4V1DD 2V7HA 1KGCD 3DWTA 3QDGE 4W9HC 1R1CA 5G4OA 3UAJD 4TNWK 4ISVB 1EAOA 4ZSOB 1SY6L 1KCLA 1A7BA 4M4PA 1C5CL 3APMA 4CN4A 1U8QB 1WBYA 1QFHA 4GAFB 4NN5B 3CDGA 4KHXH 4YHOL 4YSOA 4V2CB 3VDBA 1QFWL 1IM3A 2XETA 1B3IA 1GYWA 1X5GA 4QWWC 3ULUL 2ZSWA 5IROA 1EBAA 4QT5B 4E41B 5IFJA 4PYHA 2V3FA 1EGJA 1BOGA 3N0AA 3QQ9C 4OF7A 4LBEA 2YEQA 1GS6X 4F2EA 1WC7B 3FPXA 4NJ9L 3RX7A 3CVHL 2KC0A 5DD5L 5AAWA 1FZMB 4QY8A 4UM9B 1GGBH 1MI5D 1MCNA 1TJMA 2QZ5A 3WXWL 4LSRL 1QBLL 2Y25A 1EFXA 4X4ME 3RP1A 4A7TA 4AQ1B 4PJXF 2VQ1B 2UUDK 2IAAC 4G7RB 4HJEA 5D5MB 2XWTB 2VMFA 3M1BA 2C3XA 5EH1A 1QPKA 5E0FA 1IIIA 4ODVL 1J9QA 2X4TA 4EKXA 2GI7A 4U1NB 2WYHA 3L3KB 3UAJA 3ZZQA 1C08B 1J7VR 1BA9A 4KGLA 2J20A 4F91B 1FWXA 1XGPB 1U0QA 2NXZC 2BSSA 2ED6A 4Q0XL 5DHVH 4IK6A 4YHKL 5EO0A 5E70A 1KN4H 3BAWA 3OM3B 4JPKL 1MLBB 3ZDXE 1B4TA 2ZICA 3NH7L 5C07E 4P4KB 2Z6FA 3L7EB 3ULSA 3MA7A 3JTBA 4F7PA 4NNPH 2XXMB 2JJTA 1NIBA 4GG8B 3VSVA 2VLRA 4KRPD 4BK5A 5DHDA 4K2UL 2FEJA 5A2LH 4GXUN 3KW8A 2MHAB 5D1XC 1XD1A 4HS8H 3MRBB 1QBMH 1GYUA 1S7QA 4B27A 1IAKA 1U8OA 2LABA 3AAZB 4XMPL 3D4ZA 5IB4B 1RZKC 4HEPG 1FA4A 3BD3A 4JRWA 5CILL 3C9NB 5J9PA 2A9AA 1YJDH 5FYLD 4NRYB 2CMRH 4WEBL 5DJXB 3CUPA 5JORA 1QSFA 2W59A 4OB5H 1QI3A 4JKPL 2KI6A 3TVMC 1AD9A 3UGEA 1PMYA 3RGVC 5E6ZA 3LDBB 3SGDI 2ZSWB 3JWOL 4JM4H 2HLAB 4UOW0 3SDYL 4JGUA 5HD8C 5MHSE 4F8NA 4MQXC 2WN3A 5IBUB 4ABWA 1LNUA 2JVUA 4YVNA 2ROXA 1UJ3C 3EBIA 1S7RA 2JIXA 2PUQT 3O9WA 4IRSC 4F8TA 2YPKB 1WT5A 3SKMA 1R5WA 2J4WL 2GTQA 4MZ3A 1QEXA 2EDXA 2VLRD 1R0AH 1XGRA 1L0YA 3KDMB 3A67H 4NLHA 4R0LA 4H2AA 3CDCA 4G70B 4LKCA 5MEPA 2CNYA 2XWCA 3C5ZD 3P9MB 4HS6A 4TVUA 4B5EA 4ELMB 3QR1A 1CLOH 1TITA 3QDGB 3PHOB 3QI9C 1H3VA 3N50A 4LP5A 1YYMH 1D2OA 3QUKA 4G6KH 3S35L 1ULVA 4FHBD 4Y19A 1S7XA 5IW1B 3HZMA 1AD0A 1WF5A 3BPOC 4J8RA 3TJEH 3MRQB 4XO9A 1BIIB 1C8QA 4AV0A 4K71B 5IHUL 5GRVL 4GRWH 3FO2B 5TH2B 3MBWA 2DKSA 5KJRH 5HDRA 1VERA 2XKNA 2Y7QB 1CZ8L 1NZRA 5LN4A 4ZD3H 1V55B 1RIVH 1EA9C 3TYFB 3UCRA 2A6DA 4KTDL 4XVUD 1HILA 2VDOH 5BVJB 1QUPA 3UC2A 1AGFB 5BZXA 4N5UA 4XPBL 2F54B 1M7DB 1PBYA 2XXGA 1J0IA 1AQDB 4BZ2A 4E36A 5KTEH 4PCKA 1NJ9A 4KJPC 5DUJA 2CRZA 3VI4B 2UWEA 3KCWA 4KHTL 1XBRA 1NCBH 2QSCL 2YK1L 1V7NH 5D5ME 5CJ5A 2EDBA 2Y06L 3CHRA 4JPWL 4FNPA 5H4YA 4WSGA 4HUUA 2OYMA 3CVHA 1WA0X 1HCYA 1K8IA 1DSFL 1BZ7B 4U1KA 1BZ9B 2PCFA 1MXDA 3V2AR 5IMMB 4G7VL 4XVSH 3PV7A 4JFHE 3CFDA 2F8IA 4XCYA 3G5YB 5LAPA 5FA3A 1A7RL 2WB1A 4QHKI 4YHIA 5EV7A 3WJMA 3DROB 1CURA 3HPJB 3MAWA 1DO5A 4OW6A 1MELA 3R7QA 5D1ZB 2BLFA 3QXAA 1HXMB 3TCXA 2E86A 5BRZE 3M86A 4TNVK 4OIIL 1OE3A 1BVLA 5ID0A 4X8JB 4O00A 3JZYA 4OKDA 3UP6A 3CFEA 2BVQB 5FDYA 4I3SL 4V1DB 3WMPA 4AGQA 1UGNA 4FABH 5F7DA 3VXTA 3LQMA 2H2PD 3RTQB 5IB4A 4JDTL 4S1DD 3KBHE 2DMKA 3IGLA 4YZWA 1RZQA 2MQGA 4C47A 4YXHL 3KPSA 5FO9A 3WY2A 5C86A 3KPLB 1OHZA 1RK0B 1A6TB 1B4JL 4XNUL 4KJWC 4HLEA 5IGXL 1YG9A 4KDVA 3CZLA 2WV3A 2Z31D 4JEGB 1L9NA 3HZYA 3WE6B 3B8SA 3ARSA 3QCUL 4GRLC 2IADA 3TTSA 1Z2KA 3GTNA 1G7QA 3IF1B 5KVEE 1J05A 2C1OA 2G3NA 2AJXL 2DBLH 1FCGA 1KDIA 1CFQA 2CKBL 4KRPC 4FFYA 3TN0C 2MKWA 1SBSH 3ILEA 1BGXH 3EG9A 3GMOB 2JV6A 4Y5YA 2WBJA 2CPCA 3RVTC 3ISYA 1OQXA 2CO2A 2VXVL 3P73B 4ODXB 5DHVA 4E42B 2XY2A 1W0VA 3WNPA 4BK8A 5DVLA 1ZHKB 4KXBA 3EDFA 3BW9A 4ZDHA 2PW2A 3BDYL 5CLXA 3I3BA 3HA0A 4C56A 1VGKB 5FKPA 5BQ7B 1EO7A 2Z92B 1RIHH 3II1A 4RGOH 1CR9L 3NIGE 2KQNA 1JWMA 2ZYIA 3HRZC 3LRGA 1U6AL 4LLQA 3ZUNC 5AVXB 2QGDA 2IAMC 2DS4A 3MSPA 3CG8A 4DEPB 3DV4A 1LMIA 3EYOA 4I77H 4P49A 5E4IA 4HUWB 3FO9B 4J3VA 1LO2H 5JDSA 1EAJA 4X80L 1TVHB 3UYPA 2CM6A 1MJJB 4Y89A 1D7FA 4PV8A 4LBEB 3RFZC 3C6LD 1WIPA 4U1GB 2NY4C 3BWSA 2CBPA 4I9WE 3JV0A 5F7HA 4QT5A 3FOLA 3BFQG 1JYWA 3BUBA 3ZMRA 4C57C 4DK6A 4YWGL 1RZFL 1XFPA 4HKBA 2VITB 4BHUI 3QXDA 4UUJA 3BP4B 3DBSA 4QTHB 2LAGB 1ECYA 5HI3C 1QTSA 2XJLA 2LOEA 3BEWB 3MJWA 4NKQB 3VXMB 4EUPA 3FRPA 3VI4E 1QYGL 3OKLB 4KNTA 5IEKA 4OLWL 2Q6WA 1JHKH 3SKNA 2V8LA 3WEXB 3LXBA 3RWFA 4NQEE 3T1FA 2V9QA 1Q0YL 1RAMA 1LTXA 3PY9A 1ZS8B 4N87A 4QRPA 3WSQL 1KLFA 3FT4B 1F4YH 1NCGA 3IE4A 1CFMA 2AVFA 1H5BB 4G8GE 4U3CA 3RWHB 1HEJC 4MS6A 4R2GD 5A40E 1P7KB 2YUVA 3DV6A 4TF4A 3C6LA 4P2AA 3P77B 4EN3A 1XD0A 2WXOA 4YDVA 1R5VB 1M57B 2VLMD 3HR5B 4LAJH 4NZTL 4ZW6A 4X7CC 3HZ3A 2ZAIA 3MFFB 3O6ML 3EOAA 1Z7JA 2FRGP 2HPOA 1W0WA 5C3TA 3ZSTA 1ZHLB 3QJHA 4HMEA 1U3HC 3U7WL 3QULA 2X05A 2WKOA 5HJBA 3ESOA 4QRTB 1I85C 1WZ1H 3PAUA 1MWAL 1BREA 1U36A 3BFWA 1FO0B 3CFMA 4D9LH 1DQDL 3QWQB 1HHGB 3ARWA 1N5AA 2AV1A 3CU7A 4IIZA 1IKNA 4P2QA 5LHDA 4J3OC 4LOUC 3SE4C 3LNDA 4Z7VA 1K5WA 2P52A 3BVNB 4U0RB 4WI6A 4N0YL 5H35A 4NP4H 9CGTA 1BD2B 4NGHH 1QR1A 1LEGA 5F1NA 4G8IA 2YAMA 2D7NA 4XXWC 2FSEB 5B39A 1R3IH 5IROD 2QR0B 1JNNH 2H2SD 3C60D 3NJVA 5I74C 3RDTD 4R2GB 2HLFD 3FOMB 3BD5A 4WCYL 3O3UN 2ISDA 5I15H 4DN4L 4WUKH 4BEIA 2FX9L 1FC1A 2DYPB 1RJYA 3QXDB 4UUJB 4XBGA 3V4PL 1ED3A 1MFAH 3QUYC 3HIZA 3EJSA 4FABL 4X7DC 4DGIH 3C6SB 5AYTA 4EBQH 5ILTL 3D4CA 5I24A 3GO1L 3W9EA 2UZYA 3GJEA 2KLRA 3CSFA 3LPFA 1CBJA 3K7UA 3OL2A 4NUJA 4WU5B 5B38A 5JXED 3B9EA 4PJ7E 1DBBH 1JP5A 3HI6L 5GRUL 3FTVA 2W0LA 3R7RA 4WLCA 3SDCA 3VFRA 4NJAL 4G7VH 2F7QA 2EXSA 3D2TA 4ZS6C 4FJ6A 1J1XL 1AANA 1DSFH 4FKEA 2B15A 1QNZL 2O5ZH 1J9RA 2ATPA 3APCA 5SWSD 2VR7A 4BRVA 4B0MB 2GVYA 2DLIA 5GPRA 1RK1A 4HV8A 4X6BB 4X9HA 1QLEH 3DXAB 5J11C 4C56B 3A6CH 5EC1A 4L29A 3LVEA 1H6EA 1BIHA 1BQKA 4FXLA 4M62H 1EEZB 2X9WA 3QUZD 4GRMB 4MDRA 4XVJH 2YC1A 3RFRA 4FNLH 4FQPA 1JPGB 2PYEA 1XGUA 1WO2A 3AUVA 4X6FA 3QDME 1MJ8L 4X2UA 4OD3L 4YIQB 3HLKA 3CSYA 2R2CA 2ZX9A 3VG9C 3VXOB 5IT2H 4QXVA 2JK5B 2IV9A 2FATL 4GMSL 4L4TD 1DE4A 4PUBH 2AXJA 3MYJB 2X6BA 3GK8H 4HF5H 3WJLC 2MCG1 3LVTA 1BMWA 1IM9D 2B3RA 2XWJB 3E8UL 4ONFH 1I8LC 5GGRY 1RULL 5LUMA 2ZCHH 2VW7A 3H3PH 3Q6FA 1K4DA 3LB6C 4ZX5A 5GS1A 2OL3A 2IDCA 4AG4H 1XVSA 3DPBB 3N41F 2CHWA 5IMKB 5GZND 1FDLH 3PL6D 2QLVB 4NM4H 3KLAA 1UZ6E 3M7OA 3LEYH 5ALCL 1WAAE 3UBFA 3VM5A 3GC3A 3KWWA 3AGVA 4X8JA 3MRIB 1KIUA 2EDJA 2GFBB 4FCHA 4XCCH 3P40A 2UYLB 4NQCE 3J8F7 1E4XI 4DNLA 1NAMA 2FX7H 3DURA 2CAKA 5EN2B 2JFCA 1TKWA 3SDYH 2BO0A 2BS71 2ZWNA 3BWAA 3BRFA 4P99A 3CZEA 2WXHA 4DW2L 1I9EA 3TNMB 4S0HA 4PJ8A 3ARBD 1K4CB 2BOCA 4GXFA 1CE1L 4XP9H 3GK8L 4HF5L 2VW4A 5F7FA 1EGJH 3HZKB 6PCYA 1C16B 2BHUA 4PUBL 4HUXA 2WZPD 3GSUA 1ICTA 1WZMA 4FMFA 2XQ0A 5HHOE 3ENEA 4MYWB 5FM8A 4ZFGL 1LYQA 2Q1EA 4AH2A 1KJ3L 3QW9A 2NYZA 4P2RB 5CIPH 4NPJA 1O6TA 4APQB 5BOJA 3OTTA 2B08A 1TTRA 2R0LH 3ARGD 1XGTA 4URKA 2PR4H 2XIDA 3VXSA 3PWVB 4CN6A 1BX2B 1EH9A 3GSNH 5I1JL 4TNVF 4WJ5B 1CGXA 1KN4L 4JPKH 3K6NA 3T2NL 3HB3C 4ENEC 2OXHB 4X6DB 4OI8A 4LPUA 3TBYB 1IGYB 1N8ZB 5BW7A 3I2CL 2EIKB 4OI9A 4PJ8D 3RVUD 1I4FB 4Q14A 5DWUH 2WQVA 2ZXWB 4GYBA 4LU5H 2D7PA 5IJCC 5JMOC 4Z7UA 1JF6A 2EADA 2V5RA 1VEOA 4FNTA 5GRUH 3FUIA 4PJIA 1DFBH 2I60H 3EO1A 5FM5M 2GJJA 1WFNA 2X4NA 3BT0A 4QOKE 3BIKB 1GSKA 1T89C 3PIQA 2G3XA 2HYMA 5TQ2H 4Y16B 5ITBH 1S7RB 5K69A 2F8XC 4HZ1A 3OMIB 1FL3B 2YMOA 4P5KB 2JSFA 4XN9A 5DD5H 3FFCA 2R23B 2XX0A 2DMBA 2VN3A 5FA4B 4E9WA 2IH8A 2HLAA 3ROOB 1B2WL 1CB4A 2LE9A 3MLUL 1U8CB 1UUNA 5I15L 1UEYA 3KMDA 3VXRE 1SJEB 4RAVA 5DRXB 1JNNL 4Z5RA 2LU5A 3GM8A 4PJ6A 1QFWH 4F80A 4HHAB 4H1LB 1BSIA 4KHXL 5E4AA 4DVRL 3P3SA 2XFGB 4YXLH 4JFVA 2Q3AA 3US1A 1RLBA 3V5HA 1F45A 1YN7B 4PRDB 4R4BA 4MB3A 1XF5B 4TTGA 2P8LB 2Z34A 4N0YH 3ZQWA 5E4EC 2WZ6A 5CSZA 1D5RA 2E46A 2HUHA 1QACA 1ACYH 3KGSA 1SVCP 5BNXD 5D1QA 4WFHD 1NOFA 3GTTA 4HC1L 1CFVL 4E9RA 1OW0A 4NX0A 8FABA 1AE6L 2GIXA 3WMSA 1G7JA 2GSIB 4HPYL 2H3NB 4M5ZH 1MEXH 5LXGL 3B5GA 4H1LA 4WTXA 1KYOJ 2HKAA 3VD4A 5I30H 4JFZH 2IOMA 4YLQT 4FNSA 1TJIL 4L3EA 3UIZA 2F7RA 1MIEH 5DMJB 2L7JA 2UZYB 3ZKND 1N9PA 1BBJB 6FABH 4NZ8A 4PV9A 3BZFA 1E8XA 2WC7A 4TRPH 3GSXB 1UM4L 1USQA 4LBAA 4AM0B 3WXVL 4WFFD 1QVOA 4KJQC 3WE1A 2FO8A 5HDWA 3UPRB 3WS3B 5F0LB 3QCTL 1MRFH 1OO2A 1ZVHA 4K5LA 1IFHL 2XTSA 3GKWH 3HG1E 5FGRA 3L3JA 3NJLA 3NSDA 1A65A 3WN6A 2B1OA 1GR7A 4MS8C 2ZUSA 3CZGA 2VXSL 5IHHA 3SDDC 5D7IF 4NLAA 4YL4A 1TTUA 2X3AA 1HWGB 2Z4QA 3PUUA 4M9PA 3TIEA 4X50A 5E95B 1KJ2H 1JGDB 1YZZA 2AV7A 2R2EB 3DTXB 2EINB 1KIPB 3WIHH 4UV7L 1TNNA 3JVFC 4MXVF 1T4KA 5KBPA 1QOKA 4Y16D 4GP5B 4UINL 1HKLL 3HI5L 3FU7A 4UQ3B 1DQQB 1HHGA 1KJMB 4UTAA 5E99H 5T1KB 4FP8H 5IFJB 2ZKWA 2NCMA 2OMXB 3LNEA 1MG2C </