1HJFA

Alteration of the co-substrate selectivity of deacetoxycephalosporin c synthase: the role of arginine-258
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
309
structure length
273
Chain Sequence
b'MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDIVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLETGSYSDYSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFLRMAPHYDLSMVTLIQQTFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAASQTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
publication title Alteration of the 2-Oxoacid Cosubstrate Selectivity in Deacetoxycephalosporin C Synthase: The Role of Arginine-258
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
total genus 80
structure length 273
sequence length 309
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2001-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1hjfA00
1UOFA 1OBNA 2DBIA 1BK0A 1E5SA 2VBBA 1HJGA 1W3VA 2BU9A 1ODMA 1RXGA 5C3QA 1QJFA 1W2OA 2DBNA 1W06A 2VBPA 1IPSA 1E5RA 1DCSA 2VAUA 1HJFA 2JB8A 1HB4A 2VE1A 1W3XA 1UO9A 1HB3A 4BB3A 1W2NA 1UZWA 1E5IA 2WO7A 2BRTA 1W05A 1HB2A 1OC1A 2Y6FA 3ZKUA 2IVJA 5C3PA 1WA6X 2VBDA 3ZKYA 1HB1A 4XAEA 1GP4A 3OOXA 2CSGA 1E5HA 5C3RA 1ODNA 1W28A 5C3OA 2Y60A 2VCMA 1GP5A 1UOGA 5C3SA 3ON7A 1W04A 5APAA 4RGKA 2BJSA 1W2AX 1BLZA 1RXFA 2JB4A 3ZOIA 2IVIB 1GP6A 1QIQA 1UOBA 1QJEA 1W9YA 1W03A 1UNBA
chains in the Genus database with same CATH superfamily
1PGL1 5DAPA 5F1RA 3CIHA 1WMDA 4S2GA 4K9SA 1GOHA 3OPWA 5CKMA 2XR4A 2PA7A 1RHI3 1ENSA 2W1WA 4OZXA 2DFCA 1W6PB 1GYKA 1OF4A 1SFYA 2X29A 1HRV2 4KBZA 3AC0A 1QXRA 1VPHA 1FV3A 4LKDA 4MV2A 3KS7A 4UFMA 1LJ7A 2YPJA 3NKTA 4LNVA 2F6BA 4D6RA 2PHTA 3VB9A 5J48A 2WO3A 3GF6A 2ZGSA 3U37A 3O0VA 4AI9A 3BODA 2RDRA 1VRH3 5A6QA 2P6HA 4J1WA 1US2A 5T5PA 1T6GC 1CIWA 3LA2A 2A5ZA 2BVVA 3CMGA 4XFGA 4EWDA 1JYWA 4Z92B 2G19A 2WO1A 4MGYE 1YHFA 4GD4A 3B93A 2DCZA 2IFWA 1UO9A 3H1MA 3CBNA 3T0AA 1WMFA 3TOJA 2ZGPA 4AVVA 1DHKB 4HOOA 3VDDC 1W8FA 4COZA 4OFGA 2OVUA 4LHNA 1PK6C 3PUHA 1CESA 4QPGB 2DU1A 2FCVA 3NVCA 1QXJA 3OPTA 1JXNA 1AXYA 4JGZC 2E32A 4ASMB 1OXCA 2ZOEB 4Y5SA 1AR62 5G04L 1QJY1 1J58A 3EQEA 4FTEA 4ZZ5A 3HNMA 4BQXA 1G9AA 1AYN2 1CAWA 4KI5M 3T0DA 1OOPC 1DDLA 3AYDA 4Y1YA 3WF4A 2V4VA 4CEYB 4AZZA 5CA6A 3KT7A 3MFAA 1J83A 4QGLA 4L97A 2JD9A 3LOBA 1NQDA 3KQ4B 2EF6A 3SISA 5JIAA 1OLME 3ALQA 5FZ9A 3ZYJB 1HDKA 2SBAA 3TEXA 2HYKA 1CZTA 4I3PA 2ADEA 1QJU1 3RYKA 1X33A 4Q4Y3 5J09A 1QQP1 4BYYA 5EHDA 4JCKA 2JDAA 1XJAA 1ENXA 4HK9A 1EV11 5FZ6A 5L7OB 1DGLA 1ZZ8A 2VUDA 5IVJA 3H3LA 4AR2A 4XC9A 2GMMA 2Z79A 4CUGA 3V64A 2G9FA 1FV2A 1W8ZA 1WLTA 5C70A 2W08A 3HQUA 2B4KA 1ASJ2 2ZHMA 1PK6A 3O5SA 2GC0A 4WM7A 1UX7A 2WS92 1VBB2 3SEPA 4YM1A 1AR72 4Q4X3 3UV9A 4YG6A 4NRMA 2A7AA 5I91A 1UY4A 2ZX3A 1BLZA 2D93A 1Q5OA 1VMJA 3LDBA 5KHKA 4XJWA 2EA7A 4LBOA 2BOJA 3PVEA 3LIHA 2R6QA 5KHHA 4OVEA 1UYYA 3BPZA 3GXUA 4LIUA 4PIXA 4YM3A 2PAEA 5KHGA 1X9PA 4BQYA 3WG2A 2O0OA 1CX4A 1GQGA 2GH2A 2OPKA 5D21A 4DUVA 2VOKA 4HVQA 4JZRA 5BNNB 4DO0A 5FP3A 3SMHA 1QJX2 3RMYA 2QZ3A 3NL1A 5FXVA 2HWF2 1W8TA 1DQ1A 4LE4A 3OBRA 5FZOB 5K8SA 4YARA 2B46X 3AFKA 4QKFA 1N1TA 3OTFA 4GULA 4B7EA 4URAA 1ZRCA 4XF1A 5JI9A 1RUF2 5J3UA 4IEZA 4H7MA 5FMCA 1FPN2 1O3RA 3CO2A 2QQNA 2YG0A 2VL4A 4ATEA 1HV1A 5C33A 2R071 3PVNA 3LOIA 5H9SA 1CR7A 3WF0A 3PJQA 5FUNA 5KXDA 3T4HB 3FUOA 4CU9A 2JG9B 2RJKA 2BU9A 3LE0A 3NV4A 4FPHA 1HRI2 1QOSA 4LBKA 1RGSA 3I59B 3U14A 1BK1A 2ZGMA 3JXSA 3WW2A 3HD8B 3GZTB 4NR1A 1TME1 1N1SA 4R9CA 3M2MA 4UW5A 1ULPA 1ZX5A 1W99A 4I02A 1V9U1 3RWNA 5FOJB 1HXS2 2W1UA 3AKTA 1IPSA 5EV7A 2RM23 1HJFA 2JB8A 5FTTC 4YZ1A 5DDJ1 1RINA 1UX6A 2O1QA 2VE1A 4K20A 1YIPA 2XJVA 2UYBA 1ZVFA 5FBZA 2ZGNA 2Q8CA 2R1DA 3VKFC 1W6NB 2B9UA 1OLQA 2NZ9A 3CZUA 2H0VA 3DPRB 1RVF2 3MUY1 4W6WA 3VBSC 5JR2A 4HETA 2KA3A 1QNWA 1F4AA 5A7SA 3VHRA 2HBUA 1Q8QA 4DUWA 1D2SA 3AKPA 3UGHA 4QDSA 3PVOA 2B45X 2BBVA 2RS33 5J98B 5JSPA 2GDFA 2RDQA 1W0OA 3IDAA 4JVAA 1OT5A 2BOIA 5CIRA 5H9RA 2CTVA 3CEWA 3HAGA 3WOGA 3WP4A 3JBG1 1O4TA 1VBE2 1Q8VA 2B7YA 3ZKYA 1LOFA 4YFWA 4Q8LA 3UESA 5JOXA 3E6DA 5T52A 4GH4A 3W21A 1Y3TA 4GJZA 4XFCA 4CDQB 5LB6A 2VNGA 4PIZA 5LBEA 3WV6A 1NYWA 3M1HA 1XC6A 3MPPG 2MEV2 4FPOB 5FMOL 3EYPA 2W0XA 3INAA 5JCTA 1RUD1 4XFBA 4XPVA 5A7PA 1QH6A 2VZOA 2XJPA 1REFA 1NOVA 3MO4A 2ZX1A 3GBWA 1EAH2 2VOTA 1GR3A 1F5FA 1R64A 4LITA 2RR11 3MPBA 3O12A 1PIV2 3R4UA 4XILA 1W0PA 1ALYA 2JX9A 1NAEA 1GNZA 2OS2A 2PHUA 3FUQA 2ZGRA 3ZYIB 4COWA 3ZFFB 5FPLA 1XOYA 2FDKA 4AQSA 4XJZA 4INDA 1NZCA 1SHWB 2GNDA 4ORFA 5APAA 1ND3A 1FNYA 1ENQA 2GP3A 1GNYA 4YW3A 1U5YA 3MIHA 3LAGA 5FWJA 2WYSA 2E33A 3AP6A 1XNDA 2VH9A 2RV9A 1WW6A 5FZ3A 1BBT3 1W2UA 2IC1A 5F2WA 3S30A 3ZOIA 3THCA 2XH6A 3MI8A 4YLZA 1KFXL 5EYYA 1PMJX 2D6OX 4QWNA 3OBZA 4FXKB 3NNMA 3AZYA 3M3EA 4CSWA 5ANQA 1HQNA 2XJUA 2CYFA 2CV6A 2JDMA 2XQRA 1H8TA 2QDNA 4P08A 4CU7A 1HRV3 4CCEA 5HV4A 1JW6A 5FZCA 1PVXA 3ILFA 4BIOA 4A7YA 1Y43B 4YM2A 1YFWA 4YZ5A 5HCAA 4QM9A 2VZQA 5L7OA 4DXSA 3T3YA 5KBFA 1EV13 1TE1B 1K12A 2P34A 3MLKA 3W58A 3GGLA 5GZDA 4Y24A 3VBUA 4XF0A 3WNNA 4JC1A 2E7TA 1UY0A 4IE5A 3ZXAC 2EIGA 2VMEA 5SV5A 1A34A 1QHDA 4CP9A 3WW3A 5CISA 2WBKA 3POBA 4G3YC 2ARCA 1PMHX 1DCSA 4EYUA 3VKMA 1XNCA 3ZYFA 4IXLA 1N3PA 4UXAA 1WD3A 2ZKLA 1F31A 2CU5A 2D7FA 4RHV2 2BBAA 3AJYA 3VDDB 4CXWA 4EN6B 3PUSA 1HW5A 3FHAA 1PK6B 3EJKA 2WINB 3ACHA 1W2NA 1AR63 1UZWA 3I2HA 4HSLA 2PTMA 4XXPA 1DLLA 3R0RA 5I0RA 3LD8A 1J59A 1PHMA 4HKLA 1AYN3 4C1XA 4COUA 2VNOA 3T09A 3S6PA 2VCCA 1OC1A 2XKPA 2WNEA 4RS5C 4BU2A 4LO8A 2OZJA 1OA4A 4LBQA 4WM8C 5A1LA 1GZWA 4OI1A 3U75A 1TG7A 3G6JB 3ZXDA 2WN2A 1WD4A 2ZAAA 2HEYF 4A45A 4O61A 1APNA 5K0UA 5C9AC 1H4GA 2WA3A 3KGLA 5A3MA 2ZA9A 2YFZA 4P9LA 1DYOA 2VW0A 3DF0A 3CJIC 5A3LA 4P5HA 2Q1ZB 3HBKA 4FFGA 3JU9A 1AYM1 5I0DA 3OUHA 1ASJ3 1H9PA 1LEMA 1IG3A 3OD4A 2WS93 1VBB3 1V6IA 2AEZA 1AR73 2IFRA 3ES1A 4PLNA 4XEZA 1IKQA 4R52A 1RUOA 3LGRA 1OI6A 4HKWA 4K1ZA 3GCXA 5DDJ3 4B1MA 4Q0SA 3WUCA 4YM0A 5L73A 4H2AA 4P14A 5CAZA 1MVQA 3PTRB 3R4DB 4K7JA 5GALA 4RR3C 2YU2A 2WFF1 5A70A 1OHFA 3OYWA 2NLRA 1RUH1 2HWE2 3I3DA 3WF2A 4WM8A 5JPNB 2YUEA 1QJX3 1Q8SA 1S55A 3N9OA 1RL3A 4EWEA 3NNJA 1F8VA 1YEWA 3ZXFA 2J1EA 2HWF3 2HWC1 1X9TA 3FBYA 5IVEA 2W9XA 1DGRA 4QKDA 1WCSA 4QX5A 5FYCA 2OQ7A 2A6XA 4HPKA 3WX5A 2Y8KA 5A7QA 4M00A 1RUF3 1FPN3 2WZ8A 4LEJA 1GICA 2VQ0A 4XUPA 2WO2A 4Q4V2 3VBRA 2VD7A 4MVTA 1XXNA 4RQPA 2OX0A 2XGXA 3TYJA 2VU9A 4EE2A 3SH5A 2IXHA 1HRI3 5FZFA 5IVBA 4YW5A 3RRDA 1JYVA 1X36A 2WT2A 1KD7A 3K4AA 3PU3A 2A6YA 1F2NA 3ZFEA 3ZPOA 4FPLA 1IHMA 5DN2A 1LEDA 2Y6KA 3NNGA 4GH4B 4Z82A 1WW7A 1AR81 1STMA 4DFSA 1IQDC 3VD5A 3X29B 1HXS3 3FJSA 3PLQA 4KG0A 1TMF2 3ROUA 1ZZBA 3K2OA 1QXPA 4KH9A 3RWKX 2W52A 2RS52 4QT6A 3WDTA 4RR3A 5CB7A 3W5NA 1H1IA 4JQRA 2VUCA 3IMNA 2XVGA 3J8F1 2V4AA 4NPMA 3HNYM 4AI8A 2QDRA 3ILRA 1DGWX 1RVF3 2BP6A 2JDUA 2W1SA 4L92A 1E5RA 1S2KA 5DZFA 1MQTA 1GNHA 5FLIA 4FPJA 3VLBB 1AUYA 4E4ZA 4AAXA 2A6VA 2E31A 2EICA 1BEV1 1HB3A 4PHZA 1TNRA 5FP8A 1LENA 1R1A1 1YQCA 3FFQA 5FZHA 1XYPA 1CAUA 1ND3B 3M8LA 1QEXA 2B42B 1VBE3 2QQUA 2HEVF 3MV01 1COV1 4IV3A 1GWLA 4LLOA 3IZOA 3KZ4C 3WDYA 4BOWA 1A3KA 2D44A 2VNVA 1W6OB 1BKZA 4JKKA 3LB9A 4CDWA 2HH9A 2MEV3 2XBO1 3I4IA 2D3PA 3V0AA 1HN1A 3J7LA 4D8MA 1ZRDA 3LDKA 1VBD2 2LROA 3PVBB 1WZXA 4XJUA 1JYNA 1S0DA 3VDCA 2H6BA 2WLPA 4YSFA 3E1F1 1H8TB 2E63A 3QCWA 4LK6A 4DRRA 5FY8A 1EAH3 1H30A 4PBPA 4Q4W2 2DCKA 1LB2A 1PIV3 1ZREA 1ULFA 4LO5B 1OH4A 1O7FA 4JKLA 5JMOA 2WLQA 4IEUA 1SPPB 1C8M2 2FDIA 1XRUA 5JR7B 5T55A 1H2MA 2YB7A 1FMD2 3E5UA 3OG2A 1AL22 2LS6A 1DU3D 4LXLA 4MGKE 4E2GA 2BW8A 2Q0AA 3AXEA 3WNXA 5DQ0A 2OT7A 2O8QA 2QFEA 4DY3A 1NE4A 1JHJA 3I8TA 2D3RA 1U5XA 4ZY9A 4CP9B 1RJ7A 5A3NA 4HFSA 2BGPA 4AVAA 5C71A 5I8TA 5JZGC 5L36A 2BV4A 4PIYA 4CPBA 3VDBA 2BZDA 3RNSA 3ZMOA 2YROA 1X50A 4ZU5A 3NW4A 2VPVA 2P3YA 1UL9A 2D97A 5GLWA 2RMU2 1NKGA 1OFSA 2V73A 3DYOA 3I2GA 4L11A 4IQPA 4CEYC 5EP9A 1QDOA 1VBC2 4RN5A 1MS5A 3RZKA 1J3QA 2Q5TA 3NRUA 4K6BA 4P5YA 4Q2FA 5F2SA 1RHI1 4V2VA 5DZGA 4AFMA 5J96B 2WZR2 1JOPA 5KXBA 5JI7A 4EJRA 5HCBA 4ATFA 3ZLIA 2AC1A 3DYPA 5A7WB 3CLPA 2ZHLA 4LBQB 1PZ7A 4GWNA 5EPAA 1DQ2A 5CBLA 1E57A 1OA2A 2OXBA 3N7KA 4C0HA 3JUUA 3J9SA 3KF5A 2BFUS 2ILMA 2J1TA 4BIFA 4E8DA 5K0UB 2A1XA 2WR9A 3HN3A 1TEIA 1VRH1 4NHKA 3OF1A 1ACCA 4XF4A 1UWWA 1CZSA 1H2LA 3AZZA 4I09A 1Q8PA 1E5SA 1AL21 1PNFA 4CYDA 5JUVA 4K8RB 1WGPA 2JDYA 4GAZA 2R0HA 1A78A 5JZGA 5FRAA 3T2PA 2VG9A 4RHV3 3LDRA 4F83A 1UKGA 2QBXA 5C3QA 4XJ8A 2QTWB 2VULA 1DYKA 2V5DA 1PO12 1S2BA 3UKNA 2PHDA 1LCLA 3MUZ1 5E16A 4R8HA 1MEC2 3WCSA 4AAPA 2A3XA 3LA7A 5F7UA 2JXAA 3PIJA 3SKVA 1AR92 2XJRA 4NAOA 3G7DA 4XXAA 1W9SA 1U5ZA 2ZCWA 4JRAA 4XIOA 3ZXKA 1OLMA 1ULGA 4IW3A 3KV6A 4KL1A 4RS5B 4S2DA 3VZOA 1RYYA 4XJAA 4Y33A 4CCCA 2AYHA 2OIIA 3GHMA 4WM8B 1WUVA 2YGMA 2WRAA 2DCJA 2P4EA 3D82A 2PXJA 5FZEA 4D0QA 4EZ4A 3LEIA 4CCNA 2W95A 3JB8A 4QQPA 1U5IA 3RZHA 5JXJA 5J37A 3NO8A 3ACGA 4CCJA 4KWUA 5C9AB 5A3OA 5IVCA 2ZX4A 1V6LA 1CPMA 2JDPA 2JG9C 4HVOA 1GBGA 1PO22 4Q4Y1 3GBGA 3CJIB 4CEWA 4MUVA 4UFKA 3H0OA 2H0BA 2W91A 2LUWA 3VBRB 5CFDC 1XBFA 2GC3A 1EPWA 2J1RA 4PLMA 4RQPB 1DGWA 5D8AC 1MZ6A 3K75B 2JG8C 4Y3OA 5LCWL 3I2JA 3HT2A 4S2HA 3LIGA 5LBCA 4AL9A 5KR7A 5KXEA 4GXLA 5IK8A 3EBRA 1J1LA 3CDZB 1ODNA 2BNOA 4NHYA 4Q4X1 1KEXA 2JDZA 4N9HA 4WBBA 2ZJCA 2GZWA 4MXWA 4ES8A 2GN3A 5LRRA 1AHSA 2VXJA 4U2AA 3E6BA 2G4IA 4XE9A 3O1UA 2EVXA 1CJDA 1W8OA 1EP0A 4Y20A 1GP5A 2HWE3 1GMMA 4W8JA 1K45A 2CWMA 5HCHA 2W92A 4RR3B 1PGW1 4W6YA 1HX6A 3Q8BA 1AZDA 4ZS2A 3I2KA 4LA2A 1UYXA 1UF2C 4ZPIA 2C1FA 1RUE2 1Y9MA 2XG3A 4M4PA 1Z0HA 1NA1C 1MQTB 1UXXX 2VQUA 4QGMA 5FO7B 1Y4WA 3KCYA 4Q4V3 2VM9A 4HN0A 3HIFA 1UXZA 4XBNA 1UZZA 5FPZA 4P9JA 4NVPA 4AXOA 1DBNA 2VNRA 3GYDA 1LKNA 1CAUB 2XBO3 2XDVA 4D94A 5CFDA 1C8NA 3CNAA 4IV3B 4XZUG 1LOEA 4XDQA 5D8AA 5E89A 3OPZA 2JG8A 1UAIA 4IE7A 2CAUA 1MR5A 3OGSA 1UU4A 4ZU4A 1WKYA 1ZBE2 4P02B 3RYRA 1LHNA 1W9TA 3NV2A 4WVZA 3NV3A 5FZ7A 1TMF3 4UFJA 1UNBA 4CDWB 2VVDA 1VJ2A 4KWKA 2OKXA 3CJXA 2PHFA 3ZIWA 2RS53 1FATA 2VMFA 3BTAA 1HLCA 2C26A 4FAHA 1C28A 3KV9A 1PGSA 4IEYA 3V0AB 4PI0A 1MS4A 2GAUA 1JH5A 4QB6A 1G7YA 4ZONA 2RM21 3LSEA 4AVBA 4W50A 3DXTA 3HN1A 3PUQA 3R6SA 5CG8A 2QZ2A 3KGZA 3NJXA 1MS1A 1SZBA 4DINB 2AACA 3BN6A 3RG0A 4NIGA 5FFOC 3RQ0A 4AQ2A 5FPVA 1EUUA 1WBLA 3GCWA 1DZRA 4UT5A 5FZMA 5FAXA 4YFZA 4FCAA 3Q9OA 2QVSB 3KCXA 4FO9A 3I3BA 4LHKA 5BUVA 2UWBA 4FP3A 4LJHA 1GV9A 2ARAA 4XBQA 1LESA 3WINE 2RS31 3AYEA 3FMGA 3OBAA 1OUSA 4LO4B 3NWKA 4FFIA 2VGDA 3SEEA 5GLZA 3OUIA 2CL2A 3VKNA 2WO7A 1HN0A 4Z07A 4BM8A 4LO7A 4QB2A 1VMHA 3C2UA 3S5QA 4C90A 5IK5A 3E6CC 4XF3A 1VBD3 2H6CA 3L2HA 3VKOA 5B2GB 2QQMA 5JSRA 4JDMA 2BEOA 1PVC2 5A7NA 2HWD2 1D0GA 1O5UA 5FXWA 3HVDA 4Q4W3 5F3IA 1WCUA 4AOCA 4XW3A 3D6EA 5FLHA 4RFRB 3VD9A 5DG2A 4PLOA 2WNVA 2LTNA 4NIDA 2VBDA 2JDHA 3J26N 4NE9A 1T2XA 1URXA 1C8M3 4OMDA 4NIAA 1JUIA 4AHYA 1SEFA 4A2UA 1FMD3 2VW1A 2Q1FA 1AL23 1ULOA 3ZFGC 3WP5A 5JXHA 2ARXA 4YGBA 3P3NA 3ACFA 4LKFA 3IAPA 1V00A 3KHCA 1MPXA 2Z69A 1QKQA 4UFHA 4XDOA 3WNPA 3ZX7A 4ARXA 2ENRA 5KWRA 3JQWA 2P17A 4IEQA 3IN9A 5EXOA 1JZ8A 1GKBA 4WM7C 2C4XA 5FYTA 1FX5A 2WN3A 5F5AA 1VIWB 1UZYA 1FT9A 2TNFA 3KLSA 1CVNA 4OUEA 5FY9A 2QQWA 3C7FA 4ZU7A 3KVAA 4DOUA 1BBT1 1G8WA 5IK4A 4FI9A 3VL9A 1V6NA 5JZGB 4D6QA 3ZDVA 5C4WA 4CP0A 3O0XA 1UYZA 2AH2A 2ET7A 4N43A 3MZHA 1VBC3 3AKSA 3HJRA 5BXXA 2Y0IA 5BNPC 1O5LA 3B69A 1NY72 2R042 4RGGA 2YU1A 2WZR3 3T30A 5HI0A 5M0TA 1IPKA 1HRV1 4A6OA 5JLVA 3SH3A 3CU7A 5C5TA 3WNKA 4Y26A 1VAMA 4ES9A 1LGCA 1DLCA 1B09A 4Q26A 2J1AA 3CQOA 3QBQA 4AVTA 1GFF2 3JCIA 4C91A 3MBWA 2AGSA 1NG0A 4HZFA 3O0WA 3UK9A 3ZPYA 5AFEA 3ZFGA 3RZGA 3FFZA 2XJSA 4N7UA 1H8VA 5LA1A 2FHRA 4CDQA 4DNYA 4XFHA 1O6UA 4AEDA 5ACA2 1YFUA 3L2YA 3A0KA 1S0EA 2VR4A 5L9VA 2ZKNA 5T5OA 5DUVA 1ZRRA 3KB5A 2AZ5A 3GJAA 2GU9A 1J1TA 5T54A 1UY2A 3RVHA 3RZLA 3POYA 1UW8A 1PM7A 2FBEA 2DBIA 4QX0A 4PQ9A 1KQRA 3N4MA 4TTGA 1BK0A 2VCAA 4AHZA 1PO13 4AWDA 2X8KA 5JIUA 1GUIA 3KCCA 4IEPA 5LY2A 1MEC3 3A21A 3H8UA 5DAVA 5ANNA 4FOVA 2VC9A 3KD4A 1PM4A 1AR61 2YC0A 1AR93 4PI2A 4NHXA 5BNPA 3BTYA 3AKRA 4MXWB 4P9IA 1AYN1 1AX0A 1JU4A 2A6WA 3IMMA 4A3ZA 3ZYHA 2QJVA 2ERFA 4Y20B 5D1IA 3ZYPA 4JDOA 4XZPA 1IS6A 1KDKA 2VQTA 4NAMA 1JZ2A 4NIHA 4MG2A 2VO5A 2ZZJA 1B35C 3O1OA 2BGCA 4H3WA 4YW7A 2KR2A 4HANA 3OCPA 1ULDA 2VOXA 5FWEA 3ZR5A 2OYZA 3SXWA 4Q29A 1PO23 2N7GA 1G9BA 5FK7A 1LOFC 3DXUA 2UY9A 1HV0A 3K51A 5IAVA 4GH4C 2R062 5F3EA 4UF0B 2B5HA 3UGGA 3BVCA 4WVMA 3VBOA 1ZRFA 1NT0A 5LBBA 3AMQA 1FXZA 2Y26A 5CFDB 3B9IA 4ISRA 3I2IA 4XMIA 1ASJ1 1PZ8A 3RJRA 5J1XA 5D8AB 2JG8B 4E4HA 2WS91 1VBB1 2ATFA 4HK8A 1AR71 4JHZA 4TLGA 1J84A 2DURA 2DCTA 1CQ9A 5FY5A 4A7ZA 1KITA 2Z5WA 4YZ4A 5A32A 3MIFA 2W46A 4LPLA 5FK8A 1POV0 2IUWA 4KMQA 5FKCA 2KM2A 4AEKA 5FYMA 5IW0A 3T0BA 2X10A 1SLBA 3OGVA 4A41A 4RSUA 2P3IA 1LNSA 4FFFA 5CKQA 5AC92 5C3OA 4OI0A 5JXIA 4J25A 2WT0A 3U1XA 2VZPA 3VGIA 1RUE3 2CNAA 1NXMA 5F6LB 4M0NA 2OW4A 3QLQA 3P5BA 4QU2A 1ND3C 1QJX1 1W39A 4UW3A 5A3TA 2ZMKA 1B35A 4YW1A 3J7NA 4K1YA 5JOWA 5A1FA 4P9XA 1O59A 1SCRA 2OUHA 2HWF1 3BOWA 4X6QB 3TNQA 1S0IA 4K40A 1NA1B 4I3GA 4BJ0A 5EJ1B 1WMEA 2RDSA 4I30A 3WP6A 1DQ0A 1RUF1 3W9AA 1FPN1 3WD5A 3ZXEA 3W59A 4IGQA 3DCQA 2BJSA 2JD4A 5IYYA 1LHVA 3AK0A 5F9TA 4IGOA 4XETA 1ZBE3 2UU8A 1HRI1 2GH8A 1SBFA 1H8TC 2ZABA 4FAGA 4O9EA 3HT1A 2LRPA 4MGSA 5IHRA 1GP6A 2WQZC 3J7MA 1W0NA 2VTFA 4FPFA 3HBZA 4K21A 5GZCA 4AVCA 4BLIA 3ZYGA 4B29A 1HXS1 4F8AA 2ORZA 1IS3A 1W9YA 3POWA 1H1MA 1AX1A 4Y1VA 1BMV2 1XU2A 5TSWA 3H3ZA 3NJZA 5EQUA 3TRSB 2K2SA 3DV8A 2VQAA 2O8OA 1IPJA 2A70A 3DEMA 3DKWA 3OD0A 5EYXA 3VBUC 3CL1A 1UIKA 2B39A 4E8CA 3D8CA 4MSVA 1RVF1 2QQKA 1DZQA 2Q8OA 3U4SA 4XF9A 1YFYA 2BPA2 2RG4A 2JDNA 1S4CA 4UBHA 1XQNA 4OZOA 5F6KA 2UURA 1ODMA 4YW4A 3ZSJA 2YC2A 4NIIA 2BWCA 2D6KA 5FPXA 3GZAA 4Q27A 2C5DA 4BMBA 1VBE1 3AZVA 2XB6C 3ELNA 3EB7A 2GMEA 2W47A 1PX3A 4IL7A 1RC6A 5LATA 1H2KA 5FZKA 4LBQD 5GJ6A 1ST8A 1WCKA 1IS5A 2EIBA 4ISQA 2MEV1 5JXGA 4OHXA 1PVC3 2Z2SB 1CAWB 2HWD3 3DGTA 4M3CE 2HWB2 1G9CA 3WQ1A 1ND2A 5K0UC 1POV3 3OGRA 1UMHA 2VZRA 4XHXA 1CD3G 1EAH1 3I3MA 2G9GA 1BMV1 3AXDA 2A6ZA 1IOAA 3E5XA 5DAQA 1PIV1 5JOZA 4PDWC 4HBNA 4L8QA 5C3PA 1ZZ9A 3IIAA 2ID4A 4QPIA 2BYVE 2JWPA 4A6SA 3WZ1A 5E1RA 1FI2A 3ZFGB 5I8SA 3DECA 4JX0A 4BISA 1R092 3SCGA 4Y1UA 1JODA 2E7QA 2VECA 3IPVA 4IEWA 4QM8A 2E51A 1N47A 1C1LA 3OB8A 3PURA 2XLAA 4XDPA 3VD4A 4GWJA 1EPZA 2VOWA 2WABA 4WM7B 1RITA 1N3OA 5IWFA 1LHOA 3F2ZA 4I0BA 3T2TA 3WQBA 3DUIA 4Y22A 2RVAA 2WAAA 3HMYA 1QOOA 5FY7A 4M0HA 1ZZ7A 3SH4A 2Q4SA 4UI9L 1WA4A 2R043 1W9WA 4KGGA 3AP4A 1QH7A 4YPJA 1F4HA 4BE3A 5BNPB 3ACLA 4FVVA 2DV9A 3LCPA 3RZZA 2ZACA 3GZUC 5FYSA 4IV1A 5KC6A 3UKTA 2XUEA 3GM8A 4CU8A 1W04A 3VHOA 4ZXEA 4PDWA 3TN92 2K0GA 3RGBA 3V56A 3VBRC 1Q8OA 5ACA3 1H2NA 5FMOS 1X7NA 3VKLA 4RQPC 1UU5A 1IKPA 1NZIA 2NMOA 1BZWA 3UT0A 1JZ3A 3FX3A 4OHZA 1Z7S2 4LE3A 4CDXA 4LMFA 2V5YA 1CN1A 1P8JA 4FP2A 1KFUL 3ZFEC 5JVVA 4W6XA 1JZ6A 2EXHA 3NKGA 4WVMB 4AFCA 3MDPA 1W8NA 5LA9A 3QH6A 2MHFA 4YG3A 4BQ4A 4MGQA 4FBFA 4L0PA 4N7IA 4GJYA 4RHV1 1MS8A 5HBAA 1X8EA 3OUJA 2FCTA 1RUJ2 1UY3A 2EXIA 4FPYA 4AI0A 1NLRA 2ZBJA 1WCQA 1Y7BA 3GALA 4A4AA 5A32B 4PQQA 4QX1A 2HLEA 2IXKA 1MQTC 3H8XA 3BGAA 2Y64A 4QXHA 1O4ZA 2DVGA 2IZWA 1CAVA 1LU2A 5DG1A 2XOMA 1YQ6A 2KD7A 2FMDA 2D43A 1U0AA 2VBPA 1B35B 4K3UA 5AVPA 1ZA4A 2ZEXA 2C24A 4IV3C 4QQHA 5A3WA 3WDXA 1G9FA 1WWYA 2ZEYA 1S1AA 5FUPA 1O4YA 4E2QA 3AP7A 1KJRA 1CZVA 2R063 3O1TA 1YNAA 1QDCA 3BCWA 3ME2A 3PTYA 4CDWC 1XSQA 5DABA 4JV4A 3MF9A 1RUC2 3OEBA 4OI4A 3WF1A 3AX4A 3KF3A 5A6ZA 3RDIA 2W1QA 1UPIA 2DWRA 1DZTA 2NMNA 1AF9A 2HEWF 2BNMA 5A7OA 1YI9A 2VZVA 3V65A 3IDBB 4I0AA 2FDHA 1S0GA 4IESA 3TB0A 3HWJA 3KVBA 5AC93 1PNGA 2X53S 1JMUB 2PHLA 1I5ZA 1LTEA 2ZMLA 3RFRA 2HWE1 2NYYA 4CUAA 5CZKA 1YWKA 4NHMA 1W8WA 1XNKA 3MHZA 4DPNA 3HNBM 3RZJA 4CE8A 3O1VA 3WVJA 3H7YA 3O1MA 4QX7A 4ZS3A 4GWMA 2Y60A 1ZZ6A 4RL7A 1ULEA 4CPBD 1CAXA 1SCSA 5JWPA 3B9CA 4AE2A 5CADA 1V6OA 1VBA2 2F4LA 2O14A 4Q4V1 4Z2WA 3K46A 3VD3A 4Y4YA 2JE9A 4N90A 2EALA 4QDQA 5H9QA 1SLIA 1W8UA 2CGPA 2V09A 3AB0A 2PFWA 3AMMA 1VLNA 2TUNA 4B3NA 3I7DA 1G86A 1C5IA 1W8HA 3CHXA 5CEHA 1KGYA 1TMF1 3Q8EA 1LOAA 4HL0A 5DAXA 5FXZA 1GWKA 3S0MA 5KXCA 2RS51 5FP4A 3LEKA 1Q3EA 2J1SA 2PLV2 3U11A 2EXJA 3GBFA 3JD72 3NQHA 3OJBA 3PUAA 5HXMA 1FOD2 1J3PA 2ZX0A 1UOBA 1QF3A 3RMXA 4QX2A 2FZ1A 2BWAA 4D7SA 4TN7A 3VBUB 1XSRA 1VAKA 2OA2A 3FWEA 1GWMA 5D2AA 4COYA 4EN9B 3DKQA 4Y1XA 2W5FA 2Y0OA 3S7IA 1C57A 2WZPP 3ZIXA 3EO6A 4Y1ZA 5FP7A 5FV3A 4QPIB 2LW8A 3POSA 1WMXA 4AQ6A 3AP5A 1UOFA 2ETEA 1ZYBA 4BH9A 1RUG2 4AGRA 1CGPA 4Q5OA 4NRQA 4MO3M 3IPVB 2WJSA 4C1WA 2Z42A 3N36A 4XFFA 5FY0A 4AEJA 3TNPB 3B00A 1HJGA 5F5QA 3H3UA 1OUXA 1DGRN 1JOJA 1QNYA 2E9QA 3AP9A 4IE6A 5FZ0A 2PHXA 3L9JT 4DZGA 4Y22B 3P1IA 2ZGQA 1S0FA 3JQXA 4MH0E 5BNOA 4NROA 1J3RA 1S0BA 2HWB3 4UBGA 2Y33A 5EFUA 3PNAA 1VBD1 1RUI2 5EWSA 1H1AA 3KHBA 1GZWB 1SFNA 3RYPA 4MGTA 4OCTA 2P5BA 3DYMA 4Q4W1 3LFMA 1W6PA 1S0CA 1LECA 4XJ9A 2Q8EA 5G05L 3IT8A 3TWIA 3WG1A 4IV1B 1H9WA 2MPFA 1D4M2 1C8M1 1H6YA 2VOVA 1K3IA 4OLLA 4BQ2A 2P1BA 4PDWB 1FMD1 3WG4A 1R093 4CEWC 4MZUA 3IDCB 3UJQA 2W3JA 4Z1VA 2OZ6A 3I97A 1XNAA 2D98A 1LAJA 1NXD1 5F3CA 1QU0A 3BIWE 4ZKTB 3N9NA 1MZEA 2VMCA 4LUKA 2R49A 4XACA 4AW7A 4BXFA 3LZZA 4BWOA 4DUXA 2GNMA 5DMYA 3ITQA 3D0SA 1T6BX 4GMP0 4L9BA 5FZBA 1I3HA 1MZ5A 2D6PA 2R1BA 2WWSA 4QPGA 4J1XA 2RMU1 2YY1A 4DQAA 1JTZX 4BHPA 4N9IA 3O7OA 4QDRA 1VBC1 3QACA 1K5JA 5C3RA 3ORJA 3QH7A 2DFBA 3OYWB 4JKMA 4NHLA 2QQLA 1REEA 4KU8A 5J36A 5A80A 2WZR1 5B4NA 1WLDA 3K4DA 2W39A 1VMFA 1RMU2 1NX9A 4UW4A 2YMZA 1V0AA 3TN93 3ZSMA 1CAVB 2RS12 1UMZA 2OQ6A 4HG6B 4HT1T 3AFGA 3MIBA 4HPKB 1LRHA 2NQYA 3IM0A 4OULA 1NLSA 4KG8A 1PZ9A 3WEZA 1Z7S3 5FIXA 4BQ3A 1RUNA 2D3SA 1NLQA 5LEJA 5K4LA 3LA3A 3BALA 3TEYA 3AL6A 4MGIE 2JEMA 1JU3A 5A6YA 4JAAA 4ASKA 1GZTA 2ZS6B 3D0JA 3VBFC 1SDWA 2R32A 5ABJC 3USUA 4KU7A 2J22A 1YQ2A 1HQWA 1AVBA 1WLWA 4UW6A 4XFAA 5B4XA 4UFIA 3AVRA 3ZFEB 4YGCA 1QIQA 2XLGA 1OPMA 1RUJ3 2HBTA 1LHUA 5GKAC 4CCDA 4YVSA 1MVEA 4GWIA 5GZEA 1PO11 4UWDA 2VMIA 3T4VA 3THPA 4AEMA 3NV1A 1NE6A 3RSJA 1F5JA 1UOJA 3FL7A 1MEC1 3SNMA 1JI6A 4HXCA 3SITA 5C8CC 2FZ2A 1AR91 1DQ6A 2RE9A 3MICA 4ASLA 1LODA 4QD2A 4V1PA 3GNEA 4W65A 4XHBA 1MS0A 2AUYA 4YVWC 4O65A 1SG3A 3ENRA 4YZ2A 1BVVA 4Y5Z0 4KQ7A 1TZOA 5F5CA 4PF1A 1L7QA 5BPXA 3ZN6A 4M01A 3THDA 3AMPA 5K9YA 1CIYA 1YUDA 4PF5A 3FHQA 3PL0A 5FYUA 4AYUA 3A7QA 2ZX2A 1K42A 1KS5A 2XJQA 1ZRIA 2VZSA 4JHTA 4BXSV 4LA3A 3HPNA 5BNNA 5LEKA 3MIEA 5DZEA 3AVSA 1PO21 1VB2A 1CAXB 2Y6HA 5LRSA 3C8XA 3K77A 3VHPA 3VBFA 3ABZA 1RUC3 5ABJA 2VMHA 2VAUA 1DQ5A 4YW6A 3FLPA 3KM5A 3ST7A 3A23A 1ZBA2 3RI8A 3ZSKA 4R9DA 3N7MA 4TXWA 3M3QA 4SBVA 1R082 5IVVA 5GLTA 4OQ9A 5E6HA 1XNTA 4Q0UA 5T50A 4BA6A 3I2DA 1PGL2 2HJIA 4LUMA 4LBLA 4YW2A 4GMP3 3I59A 1XYOA 1IGOA 1W05A 1ZA7A 2A3WA 2WNVC 4GB32 1NUKA 1JZ5A 3LFIA 5C8CA 2ZGTA 4Q0PA 5I93A 2JKBA 3EMRA 4Z8BA 2CDOA 3BU7A 4QU1A 3U0ZA 1O8SA 2XL9A 1LULA 2NPIA 4OHVA 3BPSA 1AX2A 4YVWA 5EJ3A 1GU3A 1WA6X 4QX8A 5HV0A 3WNMA 5FZDA 5FUIA 1W2TA 1RUE1 4EWAA 1HB1A 2WYFA 1YCIA 5FZ8A 1GP4A 3EXUA 3M70A 1DP0A 4Q0QA 1VBA3 3ZYBA 2QQPA 1XPWA 3VHNA 3U78A 2J7MA 1UZ0A 4XCBA 1C4RA 3AZXA 2WFPA 1IZ3A 1E5HA 2BGOA 4L2NA 1OQ1A 3B3QE 3ZXLA 5C4WC 5FOBB 2WZEA 5LY1A 1VRBA 2ZXQA 4Q1RA 4N43C 4RFT0 3FLTA 4X6RB 4HN1A 5E88A 1NCRC 4DXTA 4QXKA 4J6GA 5FO9B 1ZBE1 4K8FA 4MLOA 4YZ3A 4BLJA 4IE4A 4DEVA 5CFCA 4LQRA 1YXWA 1YIFA 5CU1A 5HXVA 4BZ4A 4RA0A 3D3AA 3D4KA 1OSGA 3HQXA 5IVYA 5BNOB 4LR4A 1QJY2 2XVKA 2YXSA 2PLV3 3JD73 1UD1A 1I5PA 1FOD3 1BXHA 1JYCA 4Y4RA 3T2OA 5FZGA 4OHYA 4D69A 3V0BA 3OY8A 4LIVA 4RGAA 4GB31 4YG0A 2W87A 2G1MA 2TBVA 3IWZA 3MIDA 3MV11 4MHRA 3W5MA 4KWLA 4AEDC 1RXFA 3WQ7A 4GALA 2WL1A 4QAWA 3URFA 1VE0A 4YYOA 3H8OA 4XCAA 3S5AA 3EHKA 2BQPA 1EY2A 3T1MA 2B8MA 1QJU2 1QQP2 1GQHA 1RUG3 3VBHA 3ZFFA 2VVEA 1EV12 1DFQA 3LF7A 3KT1A 4JDNA 2X5IC 2VY0A 3AM2A 2VZ3A 3T1LA 2RMU3 3LEMA 1DYPA 4YNIA 1NCRA 1O3QA 4M3CA 4A42A 4S2FA 1KS4A 5FYBA 1SFPA 4MX3A 5A33A 3AMHA 4N53A 4AGGA 3DN7A 1RUI3 1VAVA 3CF6E 4BQ5A 3N7JA 1PVC1 1WBFA 2K9ZA 2WUHA 2E26A 2HWD1 3ZYRA 3N9MA 1Y9GA 1OLRA 2F17A 3T08A 3UGFA 1IS4A 2VZ1A 4AHXA 3POJA 1AJOA 1OF3A 2A73B 4XQ4A 4I2OA 1QJFA 2E7AA 1POV1 2NM1A 4QHOA 1D4M3 4QKNA 2P3KA 1MZFA 3I2FA 1POQA 5FR3A 4P9YA 4NPRA 1OKQA 3VV1A 5JPMB 4QQOA 4KNCA 2Z4FA 4Y5TA 1LGNA 3VBOC 5IAXA 1W3XA 4CEWB 5L9BA 4TSVA 2XKOA 2XQXA 3ZSEA 2GP5A 2PAKA 1XE7A 4IE0A 1XNBA 4XQDA 3ZSLA 4CU6A 3U07A 4XBLA 4AFAA 4CP2A 1H4HA 1O8PA 2X5IA 3N9QA 3AYCA 1CWPA 3OBTA 2R072 2DUOA 4WV8A 2X05A 3H42B 3ZKUA 4E4SA 3NAPC 3MW2A 3USUB 4MHUA 3GDBA 3VZMA 4XIKA 5FZAA 3C7GA 3NJVA 4YVSB 2KXLA 1UKRA 3I49A 3H9AA 3VDDA 1VR3A 1TME2 5T5LA 2XLFA 3H1YA 1JYXA 1NY71 1ULCA 1V9U2 2R041 3FN9A 1HKDA 4GA9A 4JGZA 1JUHA 1RMU3 1V6KA 1OPOA 2RDNA 5DDJ2 2WNUC 2V72A 2RS13 2WIIB 3E5QA 4LBNA 4NMIA 1UU6A 4P9GA 4SLIA 2YHJA 2QQJA 1UYPA 4XFIA 4GIQA 2D5FA 3WW4A 2ZAHA 3AYAA 2PQSA 2AENA 3ZN6B 1ZNPA 1OOPA 2BDRA 4FXGB 5EZWA 2I45A 5A3PA 1U12A 1V6JA 5ACA1 3WT3A 3OSDA 4QPYA 1MS9A 4ZXKA 2IXLA 3ETQA 4OUMA 4AI2A 1OH3A 2OUJA 1BHGA 1GQPA 2CHHA 1NCQC 5DUWA 2I07B 4OMCA 4FTBA 2W68A 2JKXA 1JN2P 3ACIA 3LPFA 3AMNA 2QE3A 1QY4A 3JBG2 2ZTNA 3VBFB 2JE8A 5ABJB 4H55A 3NAPA 4I01A 4ZZ8A 4LHSA 1OA3A 5FPUA 3Q8CA 2DF7A 2XVLA 2VMDA 4QXBA 4WZCA 4JQTA 1C5HA 1YC61 4XABA 3BUCA 3AZWA 1DF0A 2WSVA 3E97A 3O1PA 2YBKA 4LKEA 1LHWA 4CVUA 2XHKA 2YFUA 1X82A 3B02A 1RUD2 5C8CB 3GJBA 4NWWA 1O3SA 3C7OA 1I6XA 1L7RA 2WWUA 3WNLA 3FBMA 2WNUA 3JB4C 4QHBA 3SC7X 2D6MA 3KV5A 4YVWB 2DDUA 3IBMA 3VZLA 2EIEA 4E4DX 4WZFA 4FFHA 2RR12 1D0HA 2YDEA 1NQJA 2P37A 4G4FA 1TQ5A 3IIIA 4JGYC 4BK5A 2FMYA 4OUSA 5LASA 4G9SB 1GOFA 3ECQA 1OBNA 3N9LA 1G9DA 1CX1A 5GZGA 4EN7B 3ATGA 1NCQA 2P6CA 2Y38A 2R061 1TVGA 1RB8G 1C1FA 1W3VA 2E53A 1ZBA3 3FZ3A 1PMIA 5DUUA 3TEWA 2D6NA 3VZKA 1R083 3WY6A 2ARBA 5IJRA 2DVAA 4BK4A 3BYWA 1LU1A 5FJHA 2OPWA 1N3QA 4QXCA 1UMIA 2WDBA 2WA4A 4GB33 5FCCA 1ND2C 4JRLA 3T2QA 1KDMA 4IEXA 5CFCB 5FQ0A 4V2WA 2YV8A 4DB5A 1UIJA 4FPGA 2PQQA 3ZDSA 2ES3A 2JIGA 2WNVB 3B94A 5F37A 1SDDB 2JENA 2ZEZA 4XTPA 5AC91 5HPOA 3MLJA 4U36A 1VP6A 4QPIC 2Y6JA 2BRTA 3ZM8A 3OY8B 3ILNA 3VD7A 2WKKA 5I0SA 1JZ7A 3V0BB 4QPWA 3O1SA 2WSUA 4HMZA 5EIYB 1EUTA 1HB2A 4FOYA 2Y6FA 4JGYA 4XUOA 3HR9A 3TBDA 4A44A 5CNAA 4CCOA 5I8YA 4ZHNA 4BQ1A 4P9WA 3B5LB 2YC4A 4EN8B 4NPLA 5LZ6A 1KRIA 1D2QA 2GMPA 3PMEA 3VBSA 1OQEA 1DG6A 2WQ8A 3R05A 3WG3A 2SLIA 4META 3VBHB 4AF9A 1G6NA 5GLUA 1A8DA 2WWJA 3OEAA 1F15A 1FAYA 2PMWB 4XMAA 4NOTA 1I9RA 1KJLA 2CGNA 2ZMNA 1F9KA 4XAEA 5LW9A 1SBDA 5C4WB 2GALA 1GZ9A 3MW3A 3DL3A 3IDEA 4ARYA 1D7PM 2DUPA 3OOXA 2Y6GA 4FPKA 4HVRA 4N43B 4NWVA 5FYIA 3SKJE 3THTA 1NCRB 1SQ4A 1X8MA 4M3CB 5FPAA 2UWCA 3ZXGA 2XWBB 2VW2A 1W6OA 1W90A 4COVA 1QJY3 1BJQA 5A33B 1GOGA 1AXZA 4IV1C 4N53B 5FZLA 1PX4A 2LM3A 2NN8A 2B9VA 2RJLA 4DS0A 3AL5A 4FT8A 2ZGUA 1VB4A 5FLJA 4A3XA 1OQDA 4EN0A 3UJOA 4DXZA 1Q56A 2XPJA 5CVRA 3HQRA 1UOGA 4AFBA 4KWJA 2ZGKA 4B8EA 1D4VB 4XOGA 4AEDB 2RHPA 3MF6A 1VALA 4CDXC 4CDUC 2MNGA 2YGLA 1REDA 1QJU3 3LPGA 5DAWA 3WHUA 1JYTA 1QQP3 1SPPA 1W2AX 2EAAA 3F95A 4B4PA 5A3UA 5L19A 4CA9A 4CCKA 3VL8A 1XE0A 4TLFA 1IQAA 2VMGA 4DRVA 1BVP1 4TYSA 2IVIB 2GSYA 4MADA 3M3CA 3ZO0B 3JZVA 3WLUA 1AYM2 5FREA 3BB6A 1O91A 3POGA 4HONA 2X5IB 2QNKA 1I1EA 3C7HA 2DVBA 2VZTA 1LGBA 1YJKA 2Q8DA 4F3JA 3C3VA 4FSJA 4UAPA 1YO8A 4L99A 1YRZA 2P3JA 5IT6A 4QMAA 4XUNA 4QQ2A 4JTNA 1QOTA 2ZGLA 4ITCA 1AXKA 1S0JA 1WCDJ 2HWB1 1MS3A 2RJ2A 4P00B 1FNZA 2PN5A 3WF3A 3N7LA 3POEA 1M06G 1LOBA 2WFF2 4AVSA 4Q0VA 4D7YA 3LWCA 3N3HA 3WHTA 4JGZB 1RUH2 2XONA 4URTA 4Q1PA 1JZ4A 3R4SA 5C5UA 4GKYA 3UL2A 1H6XA 3I3EA 2WNOA 3MYXA 1OURA 3P3PA 5JDBA 5A7WA 2WC2A 1SMVA 3ZR6A 4Z2AA 5DXDA 1A8MA 2HWC2 4HKOA 4CDUA 1OOPB 2ZEWA 4FOWA 1W2OA 2DBNA 1R091 2GNBA 2R7EB 4GQ7A 3WSOA 3WW1A 3NNFA 4PBOA 4C0BA 2AR6A 3VBOB 4YWAA 2XXZA 2CDPA 3N35A 2C9AA 3NNLA 4OI2A 1IG0A 4QGNA 2Y6LA 2R073 4UFLA 2LALA 4EV0A 1AJKA 3S57A 1YQ8A 2VZUA 5FYYA 3SQOA 1ZM1A 2R0FA 4GZ9A 3WDVA 3B01A 3NAPB 1Q43A 4XQWA 1TME3 4LBJA 4EZHA 5IK7A 1AR82 1OFNA 4ET7A 3M3IA 4QX3A 1V9U3 5FBJA 4NJ4A 5AVAA 4LBMA 1XU1A 2VCBA 2XJTA 4FTSA 2IVJA 3MLLA 4CCMA 4OQ8A 1OVSA 4LK7A 1BQPA 3ZMNA 3ETPA 3ZN5A 1YYNA 3H8RA 3PUIA 3J8F2 2XL7A 1UPSA 2WNUB 1SACA 5F32A 5GM0A 4FQ4A 4RS5A 3TN91 1M4WA 4R9BA 4AI1A 1SLCA 5FZ4A 2Q30A 2QCSB 1K5MC 4BPZA 4DMIA 2D6LX 4NN0A 2EIDA 3WP3A 4DIQA 2EAKA 1BEV2 2J1UA 3KV4A 4LHLA 1Z7S1 4MGZE 1R1A2 1Y9QA 3C7EA 5FY4A 3RI9A 3NSTA 4NUBA 4M4RA 4QKBA 4AK3A 2IWGB 3OGGA 1DIWA 5C9AA 1CPNA 3JBG3 5FYHA 1NCQB 1COV2 4GKXA 1YQ5A 2IXIA 2ORXA 3CJIA 5DUXA 5HCFA 1GZCA 1FYUA 5CKNA 5BYNA 1GANA 3A4UA 3GHNA 5FO8B 4CXXA 1RUJ1 5FYZA 4IETA 3K3OA 4BQWA 2XBO2 3UNPA 5JMCA 2IXJA 5LK7B 2BFUL 3ON7A 5A6XA 1N1YA 1RUD3 2P2KA 4RGKA 5FQ0B 4XURA 2DVFA 2FDJA 5CYYA 1L3JA 3ASIA 1YLLA 2I2SA 2I74A 4I0WB 4D3WA 5SV8A 2RR13 3I54A 2BUKA 2W2IA 4X8NA 1OD5A 4KGQA 5KHIA 3H1WA 3IKWA 4BMEA 3SCFA 4W4ZA 3BU0A 4JGYB 2JDKA 1K5MA 3GZEA 3ES4A 4LOSA 3FLRA 1ENRA 5JSOA 1LOCA 2GN7A 1H0BA 4LO6B 3VBSB 1EYBA 3Q8AA 3LKJA 1UQXA 4NRPA 2J42A 1ZZCA 4R4ZA 5BNOC 4AHWA 1RUC1 4AQTA 1SLLA 1QJZA 4X8PA 4XVHA 4RD7A 2YZ4A 3H50A 2FD8A 2VUJA 4LTAA 1W6MA 2XMLA 4XAAA 1RTVA 1XE8A 4XUQA 2IXCA 3I2OA 4B7KA 3PDQA 2XUMA 2JE7A 3KT4A 3PHMA 1ND2B 2DUQA 4GMP1 4CRQA 3MFCA 4HLTA 3J7HA 3S7EA 1RHI2 3K4ZA 1JBCA 5FMBA 3FHIB 1W06A 4QB1A 4B4QA 3BIEA 4KBBA 4OYUA 1JHNA 5IFTA 1V6MA 2NP0A 4A7KA 2DTWA 3WQ0A 3UYJA 2HYXA 1HIXA 3MGUA 1HQLA 2DCYA 1YI7A 4E9KA 5L9RA 3NMBA 2VTXA 2Y34A 1W6QA 3Q8FA 3ZXJA 3RPQA 4D7TA 3N9PA 1VRH2 3H7JA 1A6CA 4JTOA 5FYVA 1VBA1 3WR0A 3POIA 3RJ2X 4AI3A 5LBFA 2QKDA 2BNNA 2BERA 1SLTA 4N8MA 4YRDA 2CAVA 2BTVC 5FPBA 1CONA 2G9ZA 3A0NA 3RS6A 4QPGC 1GLHA 2X09A 1TNFA 4CXYA 1XYNA 2J1VA 3K3NA 5DPNA 5LA0A 3WUDA 1YJLA 2QQVA 3K48A 1DQ4A 1UZVA 3POFA 3D5OA 5ERLA 3RZMA 3WXPA 4LLFA 1QGLA 3QOPA 4FPCA 4HSJA 4LOTA 4YGDA 2Q1MA 1WW4A 2PELA 3ZN4A 5E8AA 2PLV1 2R30A 3JD71 1FOD1 1F35A 2K46A 1AL0G 3O14A 4O7XA 3APBA 4YGEA 4IUGA 5LA2A 4PCRA 2AEYA 1XB9A 4UYBA 5IVFA 2C0ZA 4FPEA 4AGVA 4H14A 2GNTA 2VCMA 2ADDA 3NJYA 3MIGA 4CZSA 5JAXA 4IDZA 4CDXB 1UY1A 2AREA 1LOGA 5F8PA 1O3TA 4CDUB 1ONAA 5FP9A 3TAYA 5KC5A 3I3QA 5L7OC 2VTXJ 2ZPXA 3KMHA 2R16A 2VVFA 3M7AA 3WNOA 4Q4Y2 4C8DA 1RUG1 2TEPA 1AYM3 3MEPA 3KQRA 4IEOA 2C6SA 4YVSC 4IGPA 4PT6A 4R4XA 5T5JA 2YPDA 2EXKA 4BDVB 4E27A 1N1VA 4BCUA 3SCHA 3SLIA 4E2SA 2ZGOA 3CZJA 1MACA 4EQVA 5BY5A 3PU8A 2FCUA 2VXRA 4D6SA 5LWBA 3A22A 1QWRA 3AKQA 4Q4X2 2PHRA 3WDWA 1RUI1 4QHZA 3SHRA 3WCRA 1QJEA 2VJXA 2W94A 2WFF3 3BOPA 2E6VA 3KWVA 5FJKA 4CCLA 3BTXA 3IAQA 3M4FA 5FXXA 4IERA 1RUH3 1YFXA 4B1LA 1RJ8A 1SLAA 2PYTA 4CEYA 5BV6A 4R9AA 1PGW2 5BNNC 1JOBA 3IB3A 1CJPA 3KSCA 4FOQA 3VZJA 2QQIA 2ZZQA 1D4M1 3OGJA 2HWC3 1Z78A 4FQZA 2A3YA 2YBSA 4AG4A 2HKXA 5JOYA 3LQCA 5FZ1A 2UWAA 2UYAA 5IUQA 4F7ZA 3VN4A 1OMIA 1SBEA 2XHNA 1US3A 5FMDA 3ZVXA 2VBBA 3PJYA 1WLCA 4EROA 2ET1A 3VUOA 4CTEA 1RXGA 3UETA 1UN1A 1KXGA 2JIJA 3BTZA 4LT5A 3J4UH 2A71A 3CKHA 1JS9A 4XUTA 2PHWA 2QUOA 4MXVA 4QQLA 2FDFA 4O9GA 1OKOA 3B7MA 4DEQA 1AR83 4WVVA 2D40A 3HOBA 1HB4A 1BCXA 2DTYA 2WQ4A 4CP1A 2FQPA 5FZIA 1W9FA 4ONUA 3VDAA 4BB3A 2C9KA 3LEGA 2CWSA 3O1RA 1E5IA 3TEZA 4UOJA 3W20A 3PIGA 4MOAA 2DU0A 2RM22 3J8F3 2DVDA 5AFBA 4TZDA 2JICA 1RMU1 3WDUA 4CUCA 3DPRC 5FDBA 2RS11 4DY5A 5A1AA 3AJZA 5FKBA 5GLVA 4CUBA 3U10A 4LORA 5IATA 5EJZB 2YYOA 2WAOA 3QD6A 1BEV3 5FZOA 4AFDA 3LSDA 2L9LA 4Q8KA 4LULA 5C8WA 1R1A3 1LR5A 3MW4A 5FY1A 3U4XA 3BKZA 1RIRA 1K5MB 5F39A 4XTMA 1OD3A 1BYHA 4B4RA 1GSLA 2RS32 5LK5A 1COV3 2ZHKA 5KHJA 3HEIA 2CSGA 5CFCC 2JG9A 1C3HA 1QMJA 3VZNA 5IFPA 2DYCA 4UF0A 1W28A 2JECA 4CDQC 5C6CA 5F3GA 5I0UA 3M3OA 2PAMA 2GC1A 2VUAA 1V70A 1W6MB 1OVPA 5T3NA 4XYXA 4H7LA 2WT1A 4IEVA 1WW5A 3USSA 4OHWA 4LKSA 4DXRA 2F4PA 5C3SA 2D5HA 3FE5A 4MYEA 1W6NA 4WVWA 5GZFA 5K7PA 3DPRA 4M3CF 3PMSA 3UKVA 5H9PA 3VBHC 3ZFFC 4NO4A 4TWTA 2JJ6A 1S2EA 3FC0A 5BNQA 1JYIA 2FDGA 2JB4A 2XWJB 5F5IA 3P6BA 1W6QB 5CG9A 2YBPA 5J7MA 2A75A 1NA1A 2QQOA 1R1ZA 2BVBA 3BI3A 1L7LA 2CY6A 5I0TA 2UY8A 2GC2A 4N53C 1ZBA1 2ZHNA 5ISLA 1UCXA 1R081 1W03A 2CGOA 1BBT2 5C7GA 4RYDA 4PJYA
chains in the Genus database with same CATH topology
1UOFA 1OBNA 2DBIA 1BK0A 1E5SA 2VBBA 1HJGA 1W3VA 2BU9A 1ODMA 1RXGA 5C3QA 1QJFA 1W2OA 2DBNA 1W06A 2VBPA 1IPSA 1E5RA 1DCSA 2VAUA 1HJFA 2JB8A 1HB4A 2VE1A 1W3XA 1UO9A 1HB3A 4BB3A 1W2NA 1UZWA 1E5IA 2WO7A 2BRTA 1W05A 1HB2A 1OC1A 2Y6FA 3ZKUA 2IVJA 5C3PA 1WA6X 2VBDA 3ZKYA 1HB1A 4XAEA 1GP4A 3OOXA 2CSGA 1E5HA 5C3RA 1ODNA 1W28A 5C3OA 2Y60A 2VCMA 1GP5A 1UOGA 5C3SA 3ON7A 1W04A 5APAA 4RGKA 2BJSA 1W2AX 1BLZA 1RXFA 2JB4A 3ZOIA 2IVIB 1GP6A 1QIQA 1UOBA 1QJEA 1W9YA 1W03A 1UNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UOF A;  1OBN A;  2DBI A;  1BK0 A;  1E5S A;  2VBB A;  1HJG A;  1W3V A;  2BU9 A;  1ODM A;  1RXG A;  5C3Q A;  1QJF A;  1W2O A;  2DBN A;  1W06 A;  2VBP A;  1IPS A;  1E5R A;  1DCS A;  2VAU A;  1HJF A;  2JB8 A;  1HB4 A;  2VE1 A;  1W3X A;  1UO9 A;  1HB3 A;  4BB3 A;  1W2N A;  1UZW A;  1E5I A;  2WO7 A;  2BRT A;  1W05 A;  1HB2 A;  1OC1 A;  2Y6F A;  3ZKU A;  2IVJ A;  5C3P A;  1WA6 X;  2VBD A;  3ZKY A;  1HB1 A;  4XAE A;  1GP4 A;  3OOX A;  2CSG A;  1E5H A;  5C3R A;  1ODN A;  1W28 A;  5C3O A;  2Y60 A;  2VCM A;  1GP5 A;  1UOG A;  5C3S A;  3ON7 A;  1W04 A;  5APA A;  4RGK A;  2BJS A;  1W2A X;  1BLZ A;  1RXF A;  2JB4 A;  3ZOI A;  2IVI B;  1GP6 A;  1QIQ A;  1UOB A;  1QJE A;  1W9Y A;  1W03 A;  1UNB A; 
#chains in the Genus database with same CATH topology
 1PGL 1;  5DAP A;  5F1R A;  3CIH A;  1WMD A;  4S2G A;  4K9S A;  1GOH A;  3OPW A;  5CKM A;  2XR4 A;  2PA7 A;  1RHI 3;  1ENS A;  2W1W A;  4OZX A;  2DFC A;  1W6P B;  1GYK A;  1OF4 A;  1SFY A;  2X29 A;  1HRV 2;  4KBZ A;  3AC0 A;  1QXR A;  1VPH A;  1FV3 A;  4LKD A;  4MV2 A;  3KS7 A;  4UFM A;  1LJ7 A;  2YPJ A;  3NKT A;  4LNV A;  2F6B A;  4D6R A;  2PHT A;  3VB9 A;  5J48 A;  2WO3 A;  3GF6 A;  2ZGS A;  3U37 A;  3O0V A;  4AI9 A;  3BOD A;  2RDR A;  1VRH 3;  5A6Q A;  2P6H A;  4J1W A;  1US2 A;  5T5P A;  1T6G C;  1CIW A;  3LA2 A;  2A5Z A;  2BVV A;  3CMG A;  4XFG A;  4EWD A;  1JYW A;  4Z92 B;  2G19 A;  2WO1 A;  4MGY E;  1YHF A;  4GD4 A;  3B93 A;  2DCZ A;  2IFW A;  1UO9 A;  3H1M A;  3CBN A;  3T0A A;  1WMF A;  3TOJ A;  2ZGP A;  4AVV A;  1DHK B;  4HOO A;  3VDD C;  1W8F A;  4COZ A;  4OFG A;  2OVU A;  4LHN A;  1PK6 C;  3PUH A;  1CES A;  4QPG B;  2DU1 A;  2FCV A;  3NVC A;  1QXJ A;  3OPT A;  1JXN A;  1AXY A;  4JGZ C;  2E32 A;  4ASM B;  1OXC A;  2ZOE B;  4Y5S A;  1AR6 2;  5G04 L;  1QJY 1;  1J58 A;  3EQE A;  4FTE A;  4ZZ5 A;  3HNM A;  4BQX A;  1G9A A;  1AYN 2;  1CAW A;  4KI5 M;  3T0D A;  1OOP C;  1DDL A;  3AYD A;  4Y1Y A;  3WF4 A;  2V4V A;  4CEY B;  4AZZ A;  5CA6 A;  3KT7 A;  3MFA A;  1J83 A;  4QGL A;  4L97 A;  2JD9 A;  3LOB A;  1NQD A;  3KQ4 B;  2EF6 A;  3SIS A;  5JIA A;  1OLM E;  3ALQ A;  5FZ9 A;  3ZYJ B;  1HDK A;  2SBA A;  3TEX A;  2HYK A;  1CZT A;  4I3P A;  2ADE A;  1QJU 1;  3RYK A;  1X33 A;  4Q4Y 3;  5J09 A;  1QQP 1;  4BYY A;  5EHD A;  4JCK A;  2JDA A;  1XJA A;  1ENX A;  4HK9 A;  1EV1 1;  5FZ6 A;  5L7O B;  1DGL A;  1ZZ8 A;  2VUD A;  5IVJ A;  3H3L A;  4AR2 A;  4XC9 A;  2GMM A;  2Z79 A;  4CUG A;  3V64 A;  2G9F A;  1FV2 A;  1W8Z A;  1WLT A;  5C70 A;  2W08 A;  3HQU A;  2B4K A;  1ASJ 2;  2ZHM A;  1PK6 A;  3O5S A;  2GC0 A;  4WM7 A;  1UX7 A;  2WS9 2;  1VBB 2;  3SEP A;  4YM1 A;  1AR7 2;  4Q4X 3;  3UV9 A;  4YG6 A;  4NRM A;  2A7A A;  5I91 A;  1UY4 A;  2ZX3 A;  1BLZ A;  2D93 A;  1Q5O A;  1VMJ A;  3LDB A;  5KHK A;  4XJW A;  2EA7 A;  4LBO A;  2BOJ A;  3PVE A;  3LIH A;  2R6Q A;  5KHH A;  4OVE A;  1UYY A;  3BPZ A;  3GXU A;  4LIU A;  4PIX A;  4YM3 A;  2PAE A;  5KHG A;  1X9P A;  4BQY A;  3WG2 A;  2O0O A;  1CX4 A;  1GQG A;  2GH2 A;  2OPK A;  5D21 A;  4DUV A;  2VOK A;  4HVQ A;  4JZR A;  5BNN B;  4DO0 A;  5FP3 A;  3SMH A;  1QJX 2;  3RMY A;  2QZ3 A;  3NL1 A;  5FXV A;  2HWF 2;  1W8T A;  1DQ1 A;  4LE4 A;  3OBR A;  5FZO B;  5K8S A;  4YAR A;  2B46 X;  3AFK A;  4QKF A;  1N1T A;  3OTF A;  4GUL A;  4B7E A;  4URA A;  1ZRC A;  4XF1 A;  5JI9 A;  1RUF 2;  5J3U A;  4IEZ A;  4H7M A;  5FMC A;  1FPN 2;  1O3R A;  3CO2 A;  2QQN A;  2YG0 A;  2VL4 A;  4ATE A;  1HV1 A;  5C33 A;  2R07 1;  3PVN A;  3LOI A;  5H9S A;  1CR7 A;  3WF0 A;  3PJQ A;  5FUN A;  5KXD A;  3T4H B;  3FUO A;  4CU9 A;  2JG9 B;  2RJK A;  2BU9 A;  3LE0 A;  3NV4 A;  4FPH A;  1HRI 2;  1QOS A;  4LBK A;  1RGS A;  3I59 B;  3U14 A;  1BK1 A;  2ZGM A;  3JXS A;  3WW2 A;  3HD8 B;  3GZT B;  4NR1 A;  1TME 1;  1N1S A;  4R9C A;  3M2M A;  4UW5 A;  1ULP A;  1ZX5 A;  1W99 A;  4I02 A;  1V9U 1;  3RWN A;  5FOJ B;  1HXS 2;  2W1U A;  3AKT A;  1IPS A;  5EV7 A;  2RM2 3;  1HJF A;  2JB8 A;  5FTT C;  4YZ1 A;  5DDJ 1;  1RIN A;  1UX6 A;  2O1Q A;  2VE1 A;  4K20 A;  1YIP A;  2XJV A;  2UYB A;  1ZVF A;  5FBZ A;  2ZGN A;  2Q8C A;  2R1D A;  3VKF C;  1W6N B;  2B9U A;  1OLQ A;  2NZ9 A;  3CZU A;  2H0V A;  3DPR B;  1RVF 2;  3MUY 1;  4W6W A;  3VBS C;  5JR2 A;  4HET A;  2KA3 A;  1QNW A;  1F4A A;  5A7S A;  3VHR A;  2HBU A;  1Q8Q A;  4DUW A;  1D2S A;  3AKP A;  3UGH A;  4QDS A;  3PVO A;  2B45 X;  2BBV A;  2RS3 3;  5J98 B;  5JSP A;  2GDF A;  2RDQ A;  1W0O A;  3IDA A;  4JVA A;  1OT5 A;  2BOI A;  5CIR A;  5H9R A;  2CTV A;  3CEW A;  3HAG A;  3WOG A;  3WP4 A;  3JBG 1;  1O4T A;  1VBE 2;  1Q8V A;  2B7Y A;  3ZKY A;  1LOF A;  4YFW A;  4Q8L A;  3UES A;  5JOX A;  3E6D A;  5T52 A;  4GH4 A;  3W21 A;  1Y3T A;  4GJZ A;  4XFC A;  4CDQ B;  5LB6 A;  2VNG A;  4PIZ A;  5LBE A;  3WV6 A;  1NYW A;  3M1H A;  1XC6 A;  3MPP G;  2MEV 2;  4FPO B;  5FMO L;  3EYP A;  2W0X A;  3INA A;  5JCT A;  1RUD 1;  4XFB A;  4XPV A;  5A7P A;  1QH6 A;  2VZO A;  2XJP A;  1REF A;  1NOV A;  3MO4 A;  2ZX1 A;  3GBW A;  1EAH 2;  2VOT A;  1GR3 A;  1F5F A;  1R64 A;  4LIT A;  2RR1 1;  3MPB A;  3O12 A;  1PIV 2;  3R4U A;  4XIL A;  1W0P A;  1ALY A;  2JX9 A;  1NAE A;  1GNZ A;  2OS2 A;  2PHU A;  3FUQ A;  2ZGR A;  3ZYI B;  4COW A;  3ZFF B;  5FPL A;  1XOY A;  2FDK A;  4AQS A;  4XJZ A;  4IND A;  1NZC A;  1SHW B;  2GND A;  4ORF A;  5APA A;  1ND3 A;  1FNY A;  1ENQ A;  2GP3 A;  1GNY A;  4YW3 A;  1U5Y A;  3MIH A;  3LAG A;  5FWJ A;  2WYS A;  2E33 A;  3AP6 A;  1XND A;  2VH9 A;  2RV9 A;  1WW6 A;  5FZ3 A;  1BBT 3;  1W2U A;  2IC1 A;  5F2W A;  3S30 A;  3ZOI A;  3THC A;  2XH6 A;  3MI8 A;  4YLZ A;  1KFX L;  5EYY A;  1PMJ X;  2D6O X;  4QWN A;  3OBZ A;  4FXK B;  3NNM A;  3AZY A;  3M3E A;  4CSW A;  5ANQ A;  1HQN A;  2XJU A;  2CYF A;  2CV6 A;  2JDM A;  2XQR A;  1H8T A;  2QDN A;  4P08 A;  4CU7 A;  1HRV 3;  4CCE A;  5HV4 A;  1JW6 A;  5FZC A;  1PVX A;  3ILF A;  4BIO A;  4A7Y A;  1Y43 B;  4YM2 A;  1YFW A;  4YZ5 A;  5HCA A;  4QM9 A;  2VZQ A;  5L7O A;  4DXS A;  3T3Y A;  5KBF A;  1EV1 3;  1TE1 B;  1K12 A;  2P34 A;  3MLK A;  3W58 A;  3GGL A;  5GZD A;  4Y24 A;  3VBU A;  4XF0 A;  3WNN A;  4JC1 A;  2E7T A;  1UY0 A;  4IE5 A;  3ZXA C;  2EIG A;  2VME A;  5SV5 A;  1A34 A;  1QHD A;  4CP9 A;  3WW3 A;  5CIS A;  2WBK A;  3POB A;  4G3Y C;  2ARC A;  1PMH X;  1DCS A;  4EYU A;  3VKM A;  1XNC A;  3ZYF A;  4IXL A;  1N3P A;  4UXA A;  1WD3 A;  2ZKL A;  1F31 A;  2CU5 A;  2D7F A;  4RHV 2;  2BBA A;  3AJY A;  3VDD B;  4CXW A;  4EN6 B;  3PUS A;  1HW5 A;  3FHA A;  1PK6 B;  3EJK A;  2WIN B;  3ACH A;  1W2N A;  1AR6 3;  1UZW A;  3I2H A;  4HSL A;  2PTM A;  4XXP A;  1DLL A;  3R0R A;  5I0R A;  3LD8 A;  1J59 A;  1PHM A;  4HKL A;  1AYN 3;  4C1X A;  4COU A;  2VNO A;  3T09 A;  3S6P A;  2VCC A;  1OC1 A;  2XKP A;  2WNE A;  4RS5 C;  4BU2 A;  4LO8 A;  2OZJ A;  1OA4 A;  4LBQ A;  4WM8 C;  5A1L A;  1GZW A;  4OI1 A;  3U75 A;  1TG7 A;  3G6J B;  3ZXD A;  2WN2 A;  1WD4 A;  2ZAA A;  2HEY F;  4A45 A;  4O61 A;  1APN A;  5K0U A;  5C9A C;  1H4G A;  2WA3 A;  3KGL A;  5A3M A;  2ZA9 A;  2YFZ A;  4P9L A;  1DYO A;  2VW0 A;  3DF0 A;  3CJI C;  5A3L A;  4P5H A;  2Q1Z B;  3HBK A;  4FFG A;  3JU9 A;  1AYM 1;  5I0D A;  3OUH A;  1ASJ 3;  1H9P A;  1LEM A;  1IG3 A;  3OD4 A;  2WS9 3;  1VBB 3;  1V6I A;  2AEZ A;  1AR7 3;  2IFR A;  3ES1 A;  4PLN A;  4XEZ A;  1IKQ A;  4R52 A;  1RUO A;  3LGR A;  1OI6 A;  4HKW A;  4K1Z A;  3GCX A;  5DDJ 3;  4B1M A;  4Q0S A;  3WUC A;  4YM0 A;  5L73 A;  4H2A A;  4P14 A;  5CAZ A;  1MVQ A;  3PTR B;  3R4D B;  4K7J A;  5GAL A;  4RR3 C;  2YU2 A;  2WFF 1;  5A70 A;  1OHF A;  3OYW A;  2NLR A;  1RUH 1;  2HWE 2;  3I3D A;  3WF2 A;  4WM8 A;  5JPN B;  2YUE A;  1QJX 3;  1Q8S A;  1S55 A;  3N9O A;  1RL3 A;  4EWE A;  3NNJ A;  1F8V A;  1YEW A;  3ZXF A;  2J1E A;  2HWF 3;  2HWC 1;  1X9T A;  3FBY A;  5IVE A;  2W9X A;  1DGR A;  4QKD A;  1WCS A;  4QX5 A;  5FYC A;  2OQ7 A;  2A6X A;  4HPK A;  3WX5 A;  2Y8K A;  5A7Q A;  4M00 A;  1RUF 3;  1FPN 3;  2WZ8 A;  4LEJ A;  1GIC A;  2VQ0 A;  4XUP A;  2WO2 A;  4Q4V 2;  3VBR A;  2VD7 A;  4MVT A;  1XXN A;  4RQP A;  2OX0 A;  2XGX A;  3TYJ A;  2VU9 A;  4EE2 A;  3SH5 A;  2IXH A;  1HRI 3;  5FZF A;  5IVB A;  4YW5 A;  3RRD A;  1JYV A;  1X36 A;  2WT2 A;  1KD7 A;  3K4A A;  3PU3 A;  2A6Y A;  1F2N A;  3ZFE A;  3ZPO A;  4FPL A;  1IHM A;  5DN2 A;  1LED A;  2Y6K A;  3NNG A;  4GH4 B;  4Z82 A;  1WW7 A;  1AR8 1;  1STM A;  4DFS A;  1IQD C;  3VD5 A;  3X29 B;  1HXS 3;  3FJS A;  3PLQ A;  4KG0 A;  1TMF 2;  3ROU A;  1ZZB A;  3K2O A;  1QXP A;  4KH9 A;  3RWK X;  2W52 A;  2RS5 2;  4QT6 A;  3WDT A;  4RR3 A;  5CB7 A;  3W5N A;  1H1I A;  4JQR A;  2VUC A;  3IMN A;  2XVG A;  3J8F 1;  2V4A A;  4NPM A;  3HNY M;  4AI8 A;  2QDR A;  3ILR A;  1DGW X;  1RVF 3;  2BP6 A;  2JDU A;  2W1S A;  4L92 A;  1E5R A;  1S2K A;  5DZF A;  1MQT A;  1GNH A;  5FLI A;  4FPJ A;  3VLB B;  1AUY A;  4E4Z A;  4AAX A;  2A6V A;  2E31 A;  2EIC A;  1BEV 1;  1HB3 A;  4PHZ A;  1TNR A;  5FP8 A;  1LEN A;  1R1A 1;  1YQC A;  3FFQ A;  5FZH A;  1XYP A;  1CAU A;  1ND3 B;  3M8L A;  1QEX A;  2B42 B;  1VBE 3;  2QQU A;  2HEV F;  3MV0 1;  1COV 1;  4IV3 A;  1GWL A;  4LLO A;  3IZO A;  3KZ4 C;  3WDY A;  4BOW A;  1A3K A;  2D44 A;  2VNV A;  1W6O B;  1BKZ A;  4JKK A;  3LB9 A;  4CDW A;  2HH9 A;  2MEV 3;  2XBO 1;  3I4I A;  2D3P A;  3V0A A;  1HN1 A;  3J7L A;  4D8M A;  1ZRD A;  3LDK A;  1VBD 2;  2LRO A;  3PVB B;  1WZX A;  4XJU A;  1JYN A;  1S0D A;  3VDC A;  2H6B A;  2WLP A;  4YSF A;  3E1F 1;  1H8T B;  2E63 A;  3QCW A;  4LK6 A;  4DRR A;  5FY8 A;  1EAH 3;  1H30 A;  4PBP A;  4Q4W 2;  2DCK A;  1LB2 A;  1PIV 3;  1ZRE A;  1ULF A;  4LO5 B;  1OH4 A;  1O7F A;  4JKL A;  5JMO A;  2WLQ A;  4IEU A;  1SPP B;  1C8M 2;  2FDI A;  1XRU A;  5JR7 B;  5T55 A;  1H2M A;  2YB7 A;  1FMD 2;  3E5U A;  3OG2 A;  1AL2 2;  2LS6 A;  1DU3 D;  4LXL A;  4MGK E;  4E2G A;  2BW8 A;  2Q0A A;  3AXE A;  3WNX A;  5DQ0 A;  2OT7 A;  2O8Q A;  2QFE A;  4DY3 A;  1NE4 A;  1JHJ A;  3I8T A;  2D3R A;  1U5X A;  4ZY9 A;  4CP9 B;  1RJ7 A;  5A3N A;  4HFS A;  2BGP A;  4AVA A;  5C71 A;  5I8T A;  5JZG C;  5L36 A;  2BV4 A;  4PIY A;  4CPB A;  3VDB A;  2BZD A;  3RNS A;  3ZMO A;  2YRO A;  1X50 A;  4ZU5 A;  3NW4 A;  2VPV A;  2P3Y A;  1UL9 A;  2D97 A;  5GLW A;  2RMU 2;  1NKG A;  1OFS A;  2V73 A;  3DYO A;  3I2G A;  4L11 A;  4IQP A;  4CEY C;  5EP9 A;  1QDO A;  1VBC 2;  4RN5 A;  1MS5 A;  3RZK A;  1J3Q A;  2Q5T A;  3NRU A;  4K6B A;  4P5Y A;  4Q2F A;  5F2S A;  1RHI 1;  4V2V A;  5DZG A;  4AFM A;  5J96 B;  2WZR 2;  1JOP A;  5KXB A;  5JI7 A;  4EJR A;  5HCB A;  4ATF A;  3ZLI A;  2AC1 A;  3DYP A;  5A7W B;  3CLP A;  2ZHL A;  4LBQ B;  1PZ7 A;  4GWN A;  5EPA A;  1DQ2 A;  5CBL A;  1E57 A;  1OA2 A;  2OXB A;  3N7K A;  4C0H A;  3JUU A;  3J9S A;  3KF5 A;  2BFU S;  2ILM A;  2J1T A;  4BIF A;  4E8D A;  5K0U B;  2A1X A;  2WR9 A;  3HN3 A;  1TEI A;  1VRH 1;  4NHK A;  3OF1 A;  1ACC A;  4XF4 A;  1UWW A;  1CZS A;  1H2L A;  3AZZ A;  4I09 A;  1Q8P A;  1E5S A;  1AL2 1;  1PNF A;  4CYD A;  5JUV A;  4K8R B;  1WGP A;  2JDY A;  4GAZ A;  2R0H A;  1A78 A;  5JZG A;  5FRA A;  3T2P A;  2VG9 A;  4RHV 3;  3LDR A;  4F83 A;  1UKG A;  2QBX A;  5C3Q A;  4XJ8 A;  2QTW B;  2VUL A;  1DYK A;  2V5D A;  1PO1 2;  1S2B A;  3UKN A;  2PHD A;  1LCL A;  3MUZ 1;  5E16 A;  4R8H A;  1MEC 2;  3WCS A;  4AAP A;  2A3X A;  3LA7 A;  5F7U A;  2JXA A;  3PIJ A;  3SKV A;  1AR9 2;  2XJR A;  4NAO A;  3G7D A;  4XXA A;  1W9S A;  1U5Z A;  2ZCW A;  4JRA A;  4XIO A;  3ZXK A;  1OLM A;  1ULG A;  4IW3 A;  3KV6 A;  4KL1 A;  4RS5 B;  4S2D A;  3VZO A;  1RYY A;  4XJA A;  4Y33 A;  4CCC A;  2AYH A;  2OII A;  3GHM A;  4WM8 B;  1WUV A;  2YGM A;  2WRA A;  2DCJ A;  2P4E A;  3D82 A;  2PXJ A;  5FZE A;  4D0Q A;  4EZ4 A;  3LEI A;  4CCN A;  2W95 A;  3JB8 A;  4QQP A;  1U5I A;  3RZH A;  5JXJ A;  5J37 A;  3NO8 A;  3ACG A;  4CCJ A;  4KWU A;  5C9A B;  5A3O A;  5IVC A;  2ZX4 A;  1V6L A;  1CPM A;  2JDP A;  2JG9 C;  4HVO A;  1GBG A;  1PO2 2;  4Q4Y 1;  3GBG A;  3CJI B;  4CEW A;  4MUV A;  4UFK A;  3H0O A;  2H0B A;  2W91 A;  2LUW A;  3VBR B;  5CFD C;  1XBF A;  2GC3 A;  1EPW A;  2J1R A;  4PLM A;  4RQP B;  1DGW A;  5D8A C;  1MZ6 A;  3K75 B;  2JG8 C;  4Y3O A;  5LCW L;  3I2J A;  3HT2 A;  4S2H A;  3LIG A;  5LBC A;  4AL9 A;  5KR7 A;  5KXE A;  4GXL A;  5IK8 A;  3EBR A;  1J1L A;  3CDZ B;  1ODN A;  2BNO A;  4NHY A;  4Q4X 1;  1KEX A;  2JDZ A;  4N9H A;  4WBB A;  2ZJC A;  2GZW A;  4MXW A;  4ES8 A;  2GN3 A;  5LRR A;  1AHS A;  2VXJ A;  4U2A A;  3E6B A;  2G4I A;  4XE9 A;  3O1U A;  2EVX A;  1CJD A;  1W8O A;  1EP0 A;  4Y20 A;  1GP5 A;  2HWE 3;  1GMM A;  4W8J A;  1K45 A;  2CWM A;  5HCH A;  2W92 A;  4RR3 B;  1PGW 1;  4W6Y A;  1HX6 A;  3Q8B A;  1AZD A;  4ZS2 A;  3I2K A;  4LA2 A;  1UYX A;  1UF2 C;  4ZPI A;  2C1F A;  1RUE 2;  1Y9M A;  2XG3 A;  4M4P A;  1Z0H A;  1NA1 C;  1MQT B;  1UXX X;  2VQU A;  4QGM A;  5FO7 B;  1Y4W A;  3KCY A;  4Q4V 3;  2VM9 A;  4HN0 A;  3HIF A;  1UXZ A;  4XBN A;  1UZZ A;  5FPZ A;  4P9J A;  4NVP A;  4AXO A;  1DBN A;  2VNR A;  3GYD A;  1LKN A;  1CAU B;  2XBO 3;  2XDV A;  4D94 A;  5CFD A;  1C8N A;  3CNA A;  4IV3 B;  4XZU G;  1LOE A;  4XDQ A;  5D8A A;  5E89 A;  3OPZ A;  2JG8 A;  1UAI A;  4IE7 A;  2CAU A;  1MR5 A;  3OGS A;  1UU4 A;  4ZU4 A;  1WKY A;  1ZBE 2;  4P02 B;  3RYR A;  1LHN A;  1W9T A;  3NV2 A;  4WVZ A;  3NV3 A;  5FZ7 A;  1TMF 3;  4UFJ A;  1UNB A;  4CDW B;  2VVD A;  1VJ2 A;  4KWK A;  2OKX A;  3CJX A;  2PHF A;  3ZIW A;  2RS5 3;  1FAT A;  2VMF A;  3BTA A;  1HLC A;  2C26 A;  4FAH A;  1C28 A;  3KV9 A;  1PGS A;  4IEY A;  3V0A B;  4PI0 A;  1MS4 A;  2GAU A;  1JH5 A;  4QB6 A;  1G7Y A;  4ZON A;  2RM2 1;  3LSE A;  4AVB A;  4W50 A;  3DXT A;  3HN1 A;  3PUQ A;  3R6S A;  5CG8 A;  2QZ2 A;  3KGZ A;  3NJX A;  1MS1 A;  1SZB A;  4DIN B;  2AAC A;  3BN6 A;  3RG0 A;  4NIG A;  5FFO C;  3RQ0 A;  4AQ2 A;  5FPV A;  1EUU A;  1WBL A;  3GCW A;  1DZR A;  4UT5 A;  5FZM A;  5FAX A;  4YFZ A;  4FCA A;  3Q9O A;  2QVS B;  3KCX A;  4FO9 A;  3I3B A;  4LHK A;  5BUV A;  2UWB A;  4FP3 A;  4LJH A;  1GV9 A;  2ARA A;  4XBQ A;  1LES A;  3WIN E;  2RS3 1;  3AYE A;  3FMG A;  3OBA A;  1OUS A;  4LO4 B;  3NWK A;  4FFI A;  2VGD A;  3SEE A;  5GLZ A;  3OUI A;  2CL2 A;  3VKN A;  2WO7 A;  1HN0 A;  4Z07 A;  4BM8 A;  4LO7 A;  4QB2 A;  1VMH A;  3C2U A;  3S5Q A;  4C90 A;  5IK5 A;  3E6C C;  4XF3 A;  1VBD 3;  2H6C A;  3L2H A;  3VKO A;  5B2G B;  2QQM A;  5JSR A;  4JDM A;  2BEO A;  1PVC 2;  5A7N A;  2HWD 2;  1D0G A;  1O5U A;  5FXW A;  3HVD A;  4Q4W 3;  5F3I A;  1WCU A;  4AOC A;  4XW3 A;  3D6E A;  5FLH A;  4RFR B;  3VD9 A;  5DG2 A;  4PLO A;  2WNV A;  2LTN A;  4NID A;  2VBD A;  2JDH A;  3J26 N;  4NE9 A;  1T2X A;  1URX A;  1C8M 3;  4OMD A;  4NIA A;  1JUI A;  4AHY A;  1SEF A;  4A2U A;  1FMD 3;  2VW1 A;  2Q1F A;  1AL2 3;  1ULO A;  3ZFG C;  3WP5 A;  5JXH A;  2ARX A;  4YGB A;  3P3N A;  3ACF A;  4LKF A;  3IAP A;  1V00 A;  3KHC A;  1MPX A;  2Z69 A;  1QKQ A;  4UFH A;  4XDO A;  3WNP A;  3ZX7 A;  4ARX A;  2ENR A;  5KWR A;  3JQW A;  2P17 A;  4IEQ A;  3IN9 A;  5EXO A;  1JZ8 A;  1GKB A;  4WM7 C;  2C4X A;  5FYT A;  1FX5 A;  2WN3 A;  5F5A A;  1VIW B;  1UZY A;  1FT9 A;  2TNF A;  3KLS A;  1CVN A;  4OUE A;  5FY9 A;  2QQW A;  3C7F A;  4ZU7 A;  3KVA A;  4DOU A;  1BBT 1;  1G8W A;  5IK4 A;  4FI9 A;  3VL9 A;  1V6N A;  5JZG B;  4D6Q A;  3ZDV A;  5C4W A;  4CP0 A;  3O0X A;  1UYZ A;  2AH2 A;  2ET7 A;  4N43 A;  3MZH A;  1VBC 3;  3AKS A;  3HJR A;  5BXX A;  2Y0I A;  5BNP C;  1O5L A;  3B69 A;  1NY7 2;  2R04 2;  4RGG A;  2YU1 A;  2WZR 3;  3T30 A;  5HI0 A;  5M0T A;  1IPK A;  1HRV 1;  4A6O A;  5JLV A;  3SH3 A;  3CU7 A;  5C5T A;  3WNK A;  4Y26 A;  1VAM A;  4ES9 A;  1LGC A;  1DLC A;  1B09 A;  4Q26 A;  2J1A A;  3CQO A;  3QBQ A;  4AVT A;  1GFF 2;  3JCI A;  4C91 A;  3MBW A;  2AGS A;  1NG0 A;  4HZF A;  3O0W A;  3UK9 A;  3ZPY A;  5AFE A;  3ZFG A;  3RZG A;  3FFZ A;  2XJS A;  4N7U A;  1H8V A;  5LA1 A;  2FHR A;  4CDQ A;  4DNY A;  4XFH A;  1O6U A;  4AED A;  5ACA 2;  1YFU A;  3L2Y A;  3A0K A;  1S0E A;  2VR4 A;  5L9V A;  2ZKN A;  5T5O A;  5DUV A;  1ZRR A;  3KB5 A;  2AZ5 A;  3GJA A;  2GU9 A;  1J1T A;  5T54 A;  1UY2 A;  3RVH A;  3RZL A;  3POY A;  1UW8 A;  1PM7 A;  2FBE A;  2DBI A;  4QX0 A;  4PQ9 A;  1KQR A;  3N4M A;  4TTG A;  1BK0 A;  2VCA A;  4AHZ A;  1PO1 3;  4AWD A;  2X8K A;  5JIU A;  1GUI A;  3KCC A;  4IEP A;  5LY2 A;  1MEC 3;  3A21 A;  3H8U A;  5DAV A;  5ANN A;  4FOV A;  2VC9 A;  3KD4 A;  1PM4 A;  1AR6 1;  2YC0 A;  1AR9 3;  4PI2 A;  4NHX A;  5BNP A;  3BTY A;  3AKR A;  4MXW B;  4P9I A;  1AYN 1;  1AX0 A;  1JU4 A;  2A6W A;  3IMM A;  4A3Z A;  3ZYH A;  2QJV A;  2ERF A;  4Y20 B;  5D1I A;  3ZYP A;  4JDO A;  4XZP A;  1IS6 A;  1KDK A;  2VQT A;  4NAM A;  1JZ2 A;  4NIH A;  4MG2 A;  2VO5 A;  2ZZJ A;  1B35 C;  3O1O A;  2BGC A;  4H3W A;  4YW7 A;  2KR2 A;  4HAN A;  3OCP A;  1ULD A;  2VOX A;  5FWE A;  3ZR5 A;  2OYZ A;  3SXW A;  4Q29 A;  1PO2 3;  2N7G A;  1G9B A;  5FK7 A;  1LOF C;  3DXU A;  2UY9 A;  1HV0 A;  3K51 A;  5IAV A;  4GH4 C;  2R06 2;  5F3E A;  4UF0 B;  2B5H A;  3UGG A;  3BVC A;  4WVM A;  3VBO A;  1ZRF A;  1NT0 A;  5LBB A;  3AMQ A;  1FXZ A;  2Y26 A;  5CFD B;  3B9I A;  4ISR A;  3I2I A;  4XMI A;  1ASJ 1;  1PZ8 A;  3RJR A;  5J1X A;  5D8A B;  2JG8 B;  4E4H A;  2WS9 1;  1VBB 1;  2ATF A;  4HK8 A;  1AR7 1;  4JHZ A;  4TLG A;  1J84 A;  2DUR A;  2DCT A;  1CQ9 A;  5FY5 A;  4A7Z A;  1KIT A;  2Z5W A;  4YZ4 A;  5A32 A;  3MIF A;  2W46 A;  4LPL A;  5FK8 A;  1POV 0;  2IUW A;  4KMQ A;  5FKC A;  2KM2 A;  4AEK A;  5FYM A;  5IW0 A;  3T0B A;  2X10 A;  1SLB A;  3OGV A;  4A41 A;  4RSU A;  2P3I A;  1LNS A;  4FFF A;  5CKQ A;  5AC9 2;  5C3O A;  4OI0 A;  5JXI A;  4J25 A;  2WT0 A;  3U1X A;  2VZP A;  3VGI A;  1RUE 3;  2CNA A;  1NXM A;  5F6L B;  4M0N A;  2OW4 A;  3QLQ A;  3P5B A;  4QU2 A;  1ND3 C;  1QJX 1;  1W39 A;  4UW3 A;  5A3T A;  2ZMK A;  1B35 A;  4YW1 A;  3J7N A;  4K1Y A;  5JOW A;  5A1F A;  4P9X A;  1O59 A;  1SCR A;  2OUH A;  2HWF 1;  3BOW A;  4X6Q B;  3TNQ A;  1S0I A;  4K40 A;  1NA1 B;  4I3G A;  4BJ0 A;  5EJ1 B;  1WME A;  2RDS A;  4I30 A;  3WP6 A;  1DQ0 A;  1RUF 1;  3W9A A;  1FPN 1;  3WD5 A;  3ZXE A;  3W59 A;  4IGQ A;  3DCQ A;  2BJS A;  2JD4 A;  5IYY A;  1LHV A;  3AK0 A;  5F9T A;  4IGO A;  4XET A;  1ZBE 3;  2UU8 A;  1HRI 1;  2GH8 A;  1SBF A;  1H8T C;  2ZAB A;  4FAG A;  4O9E A;  3HT1 A;  2LRP A;  4MGS A;  5IHR A;  1GP6 A;  2WQZ C;  3J7M A;  1W0N A;  2VTF A;  4FPF A;  3HBZ A;  4K21 A;  5GZC A;  4AVC A;  4BLI A;  3ZYG A;  4B29 A;  1HXS 1;  4F8A A;  2ORZ A;  1IS3 A;  1W9Y A;  3POW A;  1H1M A;  1AX1 A;  4Y1V A;  1BMV 2;  1XU2 A;  5TSW A;  3H3Z A;  3NJZ A;  5EQU A;  3TRS B;  2K2S A;  3DV8 A;  2VQA A;  2O8O A;  1IPJ A;  2A70 A;  3DEM A;  3DKW A;  3OD0 A;  5EYX A;  3VBU C;  3CL1 A;  1UIK A;  2B39 A;  4E8C A;  3D8C A;  4MSV A;  1RVF 1;  2QQK A;  1DZQ A;  2Q8O A;  3U4S A;  4XF9 A;  1YFY A;  2BPA 2;  2RG4 A;  2JDN A;  1S4C A;  4UBH A;  1XQN A;  4OZO A;  5F6K A;  2UUR A;  1ODM A;  4YW4 A;  3ZSJ A;  2YC2 A;  4NII A;  2BWC A;  2D6K A;  5FPX A;  3GZA A;  4Q27 A;  2C5D A;  4BMB A;  1VBE 1;  3AZV A;  2XB6 C;  3ELN A;  3EB7 A;  2GME A;  2W47 A;  1PX3 A;  4IL7 A;  1RC6 A;  5LAT A;  1H2K A;  5FZK A;  4LBQ D;  5GJ6 A;  1ST8 A;  1WCK A;  1IS5 A;  2EIB A;  4ISQ A;  2MEV 1;  5JXG A;  4OHX A;  1PVC 3;  2Z2S B;  1CAW B;  2HWD 3;  3DGT A;  4M3C E;  2HWB 2;  1G9C A;  3WQ1 A;  1ND2 A;  5K0U C;  1POV 3;  3OGR A;  1UMH A;  2VZR A;  4XHX A;  1CD3 G;  1EAH 1;  3I3M A;  2G9G A;  1BMV 1;  3AXD A;  2A6Z A;  1IOA A;  3E5X A;  5DAQ A;  1PIV 1;  5JOZ A;  4PDW C;  4HBN A;  4L8Q A;  5C3P A;  1ZZ9 A;  3IIA A;  2ID4 A;  4QPI A;  2BYV E;  2JWP A;  4A6S A;  3WZ1 A;  5E1R A;  1FI2 A;  3ZFG B;  5I8S A;  3DEC A;  4JX0 A;  4BIS A;  1R09 2;  3SCG A;  4Y1U A;  1JOD A;  2E7Q A;  2VEC A;  3IPV A;  4IEW A;  4QM8 A;  2E51 A;  1N47 A;  1C1L A;  3OB8 A;  3PUR A;  2XLA A;  4XDP A;  3VD4 A;  4GWJ A;  1EPZ A;  2VOW A;  2WAB A;  4WM7 B;  1RIT A;  1N3O A;  5IWF A;  1LHO A;  3F2Z A;  4I0B A;  3T2T A;  3WQB A;  3DUI A;  4Y22 A;  2RVA A;  2WAA A;  3HMY A;  1QOO A;  5FY7 A;  4M0H A;  1ZZ7 A;  3SH4 A;  2Q4S A;  4UI9 L;  1WA4 A;  2R04 3;  1W9W A;  4KGG A;  3AP4 A;  1QH7 A;  4YPJ A;  1F4H A;  4BE3 A;  5BNP B;  3ACL A;  4FVV A;  2DV9 A;  3LCP A;  3RZZ A;  2ZAC A;  3GZU C;  5FYS A;  4IV1 A;  5KC6 A;  3UKT A;  2XUE A;  3GM8 A;  4CU8 A;  1W04 A;  3VHO A;  4ZXE A;  4PDW A;  3TN9 2;  2K0G A;  3RGB A;  3V56 A;  3VBR C;  1Q8O A;  5ACA 3;  1H2N A;  5FMO S;  1X7N A;  3VKL A;  4RQP C;  1UU5 A;  1IKP A;  1NZI A;  2NMO A;  1BZW A;  3UT0 A;  1JZ3 A;  3FX3 A;  4OHZ A;  1Z7S 2;  4LE3 A;  4CDX A;  4LMF A;  2V5Y A;  1CN1 A;  1P8J A;  4FP2 A;  1KFU L;  3ZFE C;  5JVV A;  4W6X A;  1JZ6 A;  2EXH A;  3NKG A;  4WVM B;  4AFC A;  3MDP A;  1W8N A;  5LA9 A;  3QH6 A;  2MHF A;  4YG3 A;  4BQ4 A;  4MGQ A;  4FBF A;  4L0P A;  4N7I A;  4GJY A;  4RHV 1;  1MS8 A;  5HBA A;  1X8E A;  3OUJ A;  2FCT A;  1RUJ 2;  1UY3 A;  2EXI A;  4FPY A;  4AI0 A;  1NLR A;  2ZBJ A;  1WCQ A;  1Y7B A;  3GAL A;  4A4A A;  5A32 B;  4PQQ A;  4QX1 A;  2HLE A;  2IXK A;  1MQT C;  3H8X A;  3BGA A;  2Y64 A;  4QXH A;  1O4Z A;  2DVG A;  2IZW A;  1CAV A;  1LU2 A;  5DG1 A;  2XOM A;  1YQ6 A;  2KD7 A;  2FMD A;  2D43 A;  1U0A A;  2VBP A;  1B35 B;  4K3U A;  5AVP A;  1ZA4 A;  2ZEX A;  2C24 A;  4IV3 C;  4QQH A;  5A3W A;  3WDX A;  1G9F A;  1WWY A;  2ZEY A;  1S1A A;  5FUP A;  1O4Y A;  4E2Q A;  3AP7 A;  1KJR A;  1CZV A;  2R06 3;  3O1T A;  1YNA A;  1QDC A;  3BCW A;  3ME2 A;  3PTY A;  4CDW C;  1XSQ A;  5DAB A;  4JV4 A;  3MF9 A;  1RUC 2;  3OEB A;  4OI4 A;  3WF1 A;  3AX4 A;  3KF3 A;  5A6Z A;  3RDI A;  2W1Q A;  1UPI A;  2DWR A;  1DZT A;  2NMN A;  1AF9 A;  2HEW F;  2BNM A;  5A7O A;  1YI9 A;  2VZV A;  3V65 A;  3IDB B;  4I0A A;  2FDH A;  1S0G A;  4IES A;  3TB0 A;  3HWJ A;  3KVB A;  5AC9 3;  1PNG A;  2X53 S;  1JMU B;  2PHL A;  1I5Z A;  1LTE A;  2ZML A;  3RFR A;  2HWE 1;  2NYY A;  4CUA A;  5CZK A;  1YWK A;  4NHM A;  1W8W A;  1XNK A;  3MHZ A;  4DPN A;  3HNB M;  3RZJ A;  4CE8 A;  3O1V A;  3WVJ A;  3H7Y A;  3O1M A;  4QX7 A;  4ZS3 A;  4GWM A;  2Y60 A;  1ZZ6 A;  4RL7 A;  1ULE A;  4CPB D;  1CAX A;  1SCS A;  5JWP A;  3B9C A;  4AE2 A;  5CAD A;  1V6O A;  1VBA 2;  2F4L A;  2O14 A;  4Q4V 1;  4Z2W A;  3K46 A;  3VD3 A;  4Y4Y A;  2JE9 A;  4N90 A;  2EAL A;  4QDQ A;  5H9Q A;  1SLI A;  1W8U A;  2CGP A;  2V09 A;  3AB0 A;  2PFW A;  3AMM A;  1VLN A;  2TUN A;  4B3N A;  3I7D A;  1G86 A;  1C5I A;  1W8H A;  3CHX A;  5CEH A;  1KGY A;  1TMF 1;  3Q8E A;  1LOA A;  4HL0 A;  5DAX A;  5FXZ A;  1GWK A;  3S0M A;  5KXC A;  2RS5 1;  5FP4 A;  3LEK A;  1Q3E A;  2J1S A;  2PLV 2;  3U11 A;  2EXJ A;  3GBF A;  3JD7 2;  3NQH A;  3OJB A;  3PUA A;  5HXM A;  1FOD 2;  1J3P A;  2ZX0 A;  1UOB A;  1QF3 A;  3RMX A;  4QX2 A;  2FZ1 A;  2BWA A;  4D7S A;  4TN7 A;  3VBU B;  1XSR A;  1VAK A;  2OA2 A;  3FWE A;  1GWM A;  5D2A A;  4COY A;  4EN9 B;  3DKQ A;  4Y1X A;  2W5F A;  2Y0O A;  3S7I A;  1C57 A;  2WZP P;  3ZIX A;  3EO6 A;  4Y1Z A;  5FP7 A;  5FV3 A;  4QPI B;  2LW8 A;  3POS A;  1WMX A;  4AQ6 A;  3AP5 A;  1UOF A;  2ETE A;  1ZYB A;  4BH9 A;  1RUG 2;  4AGR A;  1CGP A;  4Q5O A;  4NRQ A;  4MO3 M;  3IPV B;  2WJS A;  4C1W A;  2Z42 A;  3N36 A;  4XFF A;  5FY0 A;  4AEJ A;  3TNP B;  3B00 A;  1HJG A;  5F5Q A;  3H3U A;  1OUX A;  1DGR N;  1JOJ A;  1QNY A;  2E9Q A;  3AP9 A;  4IE6 A;  5FZ0 A;  2PHX A;  3L9J T;  4DZG A;  4Y22 B;  3P1I A;  2ZGQ A;  1S0F A;  3JQX A;  4MH0 E;  5BNO A;  4NRO A;  1J3R A;  1S0B A;  2HWB 3;  4UBG A;  2Y33 A;  5EFU A;  3PNA A;  1VBD 1;  1RUI 2;  5EWS A;  1H1A A;  3KHB A;  1GZW B;  1SFN A;  3RYP A;  4MGT A;  4OCT A;  2P5B A;  3DYM A;  4Q4W 1;  3LFM A;  1W6P A;  1S0C A;  1LEC A;  4XJ9 A;  2Q8E A;  5G05 L;  3IT8 A;  3TWI A;  3WG1 A;  4IV1 B;  1H9W A;  2MPF A;  1D4M 2;  1C8M 1;  1H6Y A;  2VOV A;  1K3I A;  4OLL A;  4BQ2 A;  2P1B A;  4PDW B;  1FMD 1;  3WG4 A;  1R09 3;  4CEW C;  4MZU A;  3IDC B;  3UJQ A;  2W3J A;  4Z1V A;  2OZ6 A;  3I97 A;  1XNA A;  2D98 A;  1LAJ A;  1NXD 1;  5F3C A;  1QU0 A;  3BIW E;  4ZKT B;  3N9N A;  1MZE A;  2VMC A;  4LUK A;  2R49 A;  4XAC A;  4AW7 A;  4BXF A;  3LZZ A;  4BWO A;  4DUX A;  2GNM A;  5DMY A;  3ITQ A;  3D0S A;  1T6B X;  4GMP 0;  4L9B A;  5FZB A;  1I3H A;  1MZ5 A;  2D6P A;  2R1B A;  2WWS A;  4QPG A;  4J1X A;  2RMU 1;  2YY1 A;  4DQA A;  1JTZ X;  4BHP A;  4N9I A;  3O7O A;  4QDR A;  1VBC 1;  3QAC A;  1K5J A;  5C3R A;  3ORJ A;  3QH7 A;  2DFB A;  3OYW B;  4JKM A;  4NHL A;  2QQL A;  1REE A;  4KU8 A;  5J36 A;  5A80 A;  2WZR 1;  5B4N A;  1WLD A;  3K4D A;  2W39 A;  1VMF A;  1RMU 2;  1NX9 A;  4UW4 A;  2YMZ A;  1V0A A;  3TN9 3;  3ZSM A;  1CAV B;  2RS1 2;  1UMZ A;  2OQ6 A;  4HG6 B;  4HT1 T;  3AFG A;  3MIB A;  4HPK B;  1LRH A;  2NQY A;  3IM0 A;  4OUL A;  1NLS A;  4KG8 A;  1PZ9 A;  3WEZ A;  1Z7S 3;  5FIX A;  4BQ3 A;  1RUN A;  2D3S A;  1NLQ A;  5LEJ A;  5K4L A;  3LA3 A;  3BAL A;  3TEY A;  3AL6 A;  4MGI E;  2JEM A;  1JU3 A;  5A6Y A;  4JAA A;  4ASK A;  1GZT A;  2ZS6 B;  3D0J A;  3VBF C;  1SDW A;  2R32 A;  5ABJ C;  3USU A;  4KU7 A;  2J22 A;  1YQ2 A;  1HQW A;  1AVB A;  1WLW A;  4UW6 A;  4XFA A;  5B4X A;  4UFI A;  3AVR A;  3ZFE B;  4YGC A;  1QIQ A;  2XLG A;  1OPM A;  1RUJ 3;  2HBT A;  1LHU A;  5GKA C;  4CCD A;  4YVS A;  1MVE A;  4GWI A;  5GZE A;  1PO1 1;  4UWD A;  2VMI A;  3T4V A;  3THP A;  4AEM A;  3NV1 A;  1NE6 A;  3RSJ A;  1F5J A;  1UOJ A;  3FL7 A;  1MEC 1;  3SNM A;  1JI6 A;  4HXC A;  3SIT A;  5C8C C;  2FZ2 A;  1AR9 1;  1DQ6 A;  2RE9 A;  3MIC A;  4ASL A;  1LOD A;  4QD2 A;  4V1P A;  3GNE A;  4W65 A;  4XHB A;  1MS0 A;  2AUY A;  4YVW C;  4O65 A;  1SG3 A;  3ENR A;  4YZ2 A;  1BVV A;  4Y5Z 0;  4KQ7 A;  1TZO A;  5F5C A;  4PF1 A;  1L7Q A;  5BPX A;  3ZN6 A;  4M01 A;  3THD A;  3AMP A;  5K9Y A;  1CIY A;  1YUD A;  4PF5 A;  3FHQ A;  3PL0 A;  5FYU A;  4AYU A;  3A7Q A;  2ZX2 A;  1K42 A;  1KS5 A;  2XJQ A;  1ZRI A;  2VZS A;  4JHT A;  4BXS V;  4LA3 A;  3HPN A;  5BNN A;  5LEK A;  3MIE A;  5DZE A;  3AVS A;  1PO2 1;  1VB2 A;  1CAX B;  2Y6H A;  5LRS A;  3C8X A;  3K77 A;  3VHP A;  3VBF A;  3ABZ A;  1RUC 3;  5ABJ A;  2VMH A;  2VAU A;  1DQ5 A;  4YW6 A;  3FLP A;  3KM5 A;  3ST7 A;  3A23 A;  1ZBA 2;  3RI8 A;  3ZSK A;  4R9D A;  3N7M A;  4TXW A;  3M3Q A;  4SBV A;  1R08 2;  5IVV A;  5GLT A;  4OQ9 A;  5E6H A;  1XNT A;  4Q0U A;  5T50 A;  4BA6 A;  3I2D A;  1PGL 2;  2HJI A;  4LUM A;  4LBL A;  4YW2 A;  4GMP 3;  3I59 A;  1XYO A;  1IGO A;  1W05 A;  1ZA7 A;  2A3W A;  2WNV C;  4GB3 2;  1NUK A;  1JZ5 A;  3LFI A;  5C8C A;  2ZGT A;  4Q0P A;  5I93 A;  2JKB A;  3EMR A;  4Z8B A;  2CDO A;  3BU7 A;  4QU1 A;  3U0Z A;  1O8S A;  2XL9 A;  1LUL A;  2NPI A;  4OHV A;  3BPS A;  1AX2 A;  4YVW A;  5EJ3 A;  1GU3 A;  1WA6 X;  4QX8 A;  5HV0 A;  3WNM A;  5FZD A;  5FUI A;  1W2T A;  1RUE 1;  4EWA A;  1HB1 A;  2WYF A;  1YCI A;  5FZ8 A;  1GP4 A;  3EXU A;  3M70 A;  1DP0 A;  4Q0Q A;  1VBA 3;  3ZYB A;  2QQP A;  1XPW A;  3VHN A;  3U78 A;  2J7M A;  1UZ0 A;  4XCB A;  1C4R A;  3AZX A;  2WFP A;  1IZ3 A;  1E5H A;  2BGO A;  4L2N A;  1OQ1 A;  3B3Q E;  3ZXL A;  5C4W C;  5FOB B;  2WZE A;  5LY1 A;  1VRB A;  2ZXQ A;  4Q1R A;  4N43 C;  4RFT 0;  3FLT A;  4X6R B;  4HN1 A;  5E88 A;  1NCR C;  4DXT A;  4QXK A;  4J6G A;  5FO9 B;  1ZBE 1;  4K8F A;  4MLO A;  4YZ3 A;  4BLJ A;  4IE4 A;  4DEV A;  5CFC A;  4LQR A;  1YXW A;  1YIF A;  5CU1 A;  5HXV A;  4BZ4 A;  4RA0 A;  3D3A A;  3D4K A;  1OSG A;  3HQX A;  5IVY A;  5BNO B;  4LR4 A;  1QJY 2;  2XVK A;  2YXS A;  2PLV 3;  3JD7 3;  1UD1 A;  1I5P A;  1FOD 3;  1BXH A;  1JYC A;  4Y4R A;  3T2O A;  5FZG A;  4OHY A;  4D69 A;  3V0B A;  3OY8 A;  4LIV A;  4RGA A;  4GB3 1;  4YG0 A;  2W87 A;  2G1M A;  2TBV A;  3IWZ A;  3MID A;  3MV1 1;  4MHR A;  3W5M A;  4KWL A;  4AED C;  1RXF A;  3WQ7 A;  4GAL A;  2WL1 A;  4QAW A;  3URF A;  1VE0 A;  4YYO A;  3H8O A;  4XCA A;  3S5A A;  3EHK A;  2BQP A;  1EY2 A;  3T1M A;  2B8M A;  1QJU 2;  1QQP 2;  1GQH A;  1RUG 3;  3VBH A;  3ZFF A;  2VVE A;  1EV1 2;  1DFQ A;  3LF7 A;  3KT1 A;  4JDN A;  2X5I C;  2VY0 A;  3AM2 A;  2VZ3 A;  3T1L A;  2RMU 3;  3LEM A;  1DYP A;  4YNI A;  1NCR A;  1O3Q A;  4M3C A;  4A42 A;  4S2F A;  1KS4 A;  5FYB A;  1SFP A;  4MX3 A;  5A33 A;  3AMH A;  4N53 A;  4AGG A;  3DN7 A;  1RUI 3;  1VAV A;  3CF6 E;  4BQ5 A;  3N7J A;  1PVC 1;  1WBF A;  2K9Z A;  2WUH A;  2E26 A;  2HWD 1;  3ZYR A;  3N9M A;  1Y9G A;  1OLR A;  2F17 A;  3T08 A;  3UGF A;  1IS4 A;  2VZ1 A;  4AHX A;  3POJ A;  1AJO A;  1OF3 A;  2A73 B;  4XQ4 A;  4I2O A;  1QJF A;  2E7A A;  1POV 1;  2NM1 A;  4QHO A;  1D4M 3;  4QKN A;  2P3K A;  1MZF A;  3I2F A;  1POQ A;  5FR3 A;  4P9Y A;  4NPR A;  1OKQ A;  3VV1 A;  5JPM B;  4QQO A;  4KNC A;  2Z4F A;  4Y5T A;  1LGN A;  3VBO C;  5IAX A;  1W3X A;  4CEW B;  5L9B A;  4TSV A;  2XKO A;  2XQX A;  3ZSE A;  2GP5 A;  2PAK A;  1XE7 A;  4IE0 A;  1XNB A;  4XQD A;  3ZSL A;  4CU6 A;  3U07 A;  4XBL A;  4AFA A;  4CP2 A;  1H4H A;  1O8P A;  2X5I A;  3N9Q A;  3AYC A;  1CWP A;  3OBT A;  2R07 2;  2DUO A;  4WV8 A;  2X05 A;  3H42 B;  3ZKU A;  4E4S A;  3NAP C;  3MW2 A;  3USU B;  4MHU A;  3GDB A;  3VZM A;  4XIK A;  5FZA A;  3C7G A;  3NJV A;  4YVS B;  2KXL A;  1UKR A;  3I49 A;  3H9A A;  3VDD A;  1VR3 A;  1TME 2;  5T5L A;  2XLF A;  3H1Y A;  1JYX A;  1NY7 1;  1ULC A;  1V9U 2;  2R04 1;  3FN9 A;  1HKD A;  4GA9 A;  4JGZ A;  1JUH A;  1RMU 3;  1V6K A;  1OPO A;  2RDN A;  5DDJ 2;  2WNU C;  2V72 A;  2RS1 3;  2WII B;  3E5Q A;  4LBN A;  4NMI A;  1UU6 A;  4P9G A;  4SLI A;  2YHJ A;  2QQJ A;  1UYP A;  4XFI A;  4GIQ A;  2D5F A;  3WW4 A;  2ZAH A;  3AYA A;  2PQS A;  2AEN A;  3ZN6 B;  1ZNP A;  1OOP A;  2BDR A;  4FXG B;  5EZW A;  2I45 A;  5A3P A;  1U12 A;  1V6J A;  5ACA 1;  3WT3 A;  3OSD A;  4QPY A;  1MS9 A;  4ZXK A;  2IXL A;  3ETQ A;  4OUM A;  4AI2 A;  1OH3 A;  2OUJ A;  1BHG A;  1GQP A;  2CHH A;  1NCQ C;  5DUW A;  2I07 B;  4OMC A;  4FTB A;  2W68 A;  2JKX A;  1JN2 P;  3ACI A;  3LPF A;  3AMN A;  2QE3 A;  1QY4 A;  3JBG 2;  2ZTN A;  3VBF B;  2JE8 A;  5ABJ B;  4H55 A;  3NAP A;  4I01 A;  4ZZ8 A;  4LHS A;  1OA3 A;  5FPU A;  3Q8C A;  2DF7 A;  2XVL A;  2VMD A;  4QXB A;  4WZC A;  4JQT A;  1C5H A;  1YC6 1;  4XAB A;  3BUC A;  3AZW A;  1DF0 A;  2WSV A;  3E97 A;  3O1P A;  2YBK A;  4LKE A;  1LHW A;  4CVU A;  2XHK A;  2YFU A;  1X82 A;  3B02 A;  1RUD 2;  5C8C B;  3GJB A;  4NWW A;  1O3S A;  3C7O A;  1I6X A;  1L7R A;  2WWU A;  3WNL A;  3FBM A;  2WNU A;  3JB4 C;  4QHB A;  3SC7 X;  2D6M A;  3KV5 A;  4YVW B;  2DDU A;  3IBM A;  3VZL A;  2EIE A;  4E4D X;  4WZF A;  4FFH A;  2RR1 2;  1D0H A;  2YDE A;  1NQJ A;  2P37 A;  4G4F A;  1TQ5 A;  3III A;  4JGY C;  4BK5 A;  2FMY A;  4OUS A;  5LAS A;  4G9S B;  1GOF A;  3ECQ A;  1OBN A;  3N9L A;  1G9D A;  1CX1 A;  5GZG A;  4EN7 B;  3ATG A;  1NCQ A;  2P6C A;  2Y38 A;  2R06 1;  1TVG A;  1RB8 G;  1C1F A;  1W3V A;  2E53 A;  1ZBA 3;  3FZ3 A;  1PMI A;  5DUU A;  3TEW A;  2D6N A;  3VZK A;  1R08 3;  3WY6 A;  2ARB A;  5IJR A;  2DVA A;  4BK4 A;  3BYW A;  1LU1 A;  5FJH A;  2OPW A;  1N3Q A;  4QXC A;  1UMI A;  2WDB A;  2WA4 A;  4GB3 3;  5FCC A;  1ND2 C;  4JRL A;  3T2Q A;  1KDM A;  4IEX A;  5CFC B;  5FQ0 A;  4V2W A;  2YV8 A;  4DB5 A;  1UIJ A;  4FPG A;  2PQQ A;  3ZDS A;  2ES3 A;  2JIG A;  2WNV B;  3B94 A;  5F37 A;  1SDD B;  2JEN A;  2ZEZ A;  4XTP A;  5AC9 1;  5HPO A;  3MLJ A;  4U36 A;  1VP6 A;  4QPI C;  2Y6J A;  2BRT A;  3ZM8 A;  3OY8 B;  3ILN A;  3VD7 A;  2WKK A;  5I0S A;  1JZ7 A;  3V0B B;  4QPW A;  3O1S A;  2WSU A;  4HMZ A;  5EIY B;  1EUT A;  1HB2 A;  4FOY A;  2Y6F A;  4JGY A;  4XUO A;  3HR9 A;  3TBD A;  4A44 A;  5CNA A;  4CCO A;  5I8Y A;  4ZHN A;  4BQ1 A;  4P9W A;  3B5L B;  2YC4 A;  4EN8 B;  4NPL A;  5LZ6 A;  1KRI A;  1D2Q A;  2GMP A;  3PME A;  3VBS A;  1OQE A;  1DG6 A;  2WQ8 A;  3R05 A;  3WG3 A;  2SLI A;  4MET A;  3VBH B;  4AF9 A;  1G6N A;  5GLU A;  1A8D A;  2WWJ A;  3OEA A;  1F15 A;  1FAY A;  2PMW B;  4XMA A;  4NOT A;  1I9R A;  1KJL A;  2CGN A;  2ZMN A;  1F9K A;  4XAE A;  5LW9 A;  1SBD A;  5C4W B;  2GAL A;  1GZ9 A;  3MW3 A;  3DL3 A;  3IDE A;  4ARY A;  1D7P M;  2DUP A;  3OOX A;  2Y6G A;  4FPK A;  4HVR A;  4N43 B;  4NWV A;  5FYI A;  3SKJ E;  3THT A;  1NCR B;  1SQ4 A;  1X8M A;  4M3C B;  5FPA A;  2UWC A;  3ZXG A;  2XWB B;  2VW2 A;  1W6O A;  1W90 A;  4COV A;  1QJY 3;  1BJQ A;  5A33 B;  1GOG A;  1AXZ A;  4IV1 C;  4N53 B;  5FZL A;  1PX4 A;  2LM3 A;  2NN8 A;  2B9V A;  2RJL A;  4DS0 A;  3AL5 A;  4FT8 A;  2ZGU A;  1VB4 A;  5FLJ A;  4A3X A;  1OQD A;  4EN0 A;  3UJO A;  4DXZ A;  1Q56 A;  2XPJ A;  5CVR A;  3HQR A;  1UOG A;  4AFB A;  4KWJ A;  2ZGK A;  4B8E A;  1D4V B;  4XOG A;  4AED B;  2RHP A;  3MF6 A;  1VAL A;  4CDX C;  4CDU C;  2MNG A;  2YGL A;  1RED A;  1QJU 3;  3LPG A;  5DAW A;  3WHU A;  1JYT A;  1QQP 3;  1SPP A;  1W2A X;  2EAA A;  3F95 A;  4B4P A;  5A3U A;  5L19 A;  4CA9 A;  4CCK A;  3VL8 A;  1XE0 A;  4TLF A;  1IQA A;  2VMG A;  4DRV A;  1BVP 1;  4TYS A;  2IVI B;  2GSY A;  4MAD A;  3M3C A;  3ZO0 B;  3JZV A;  3WLU A;  1AYM 2;  5FRE A;  3BB6 A;  1O91 A;  3POG A;  4HON A;  2X5I B;  2QNK A;  1I1E A;  3C7H A;  2DVB A;  2VZT A;  1LGB A;  1YJK A;  2Q8D A;  4F3J A;  3C3V A;  4FSJ A;  4UAP A;  1YO8 A;  4L99 A;  1YRZ A;  2P3J A;  5IT6 A;  4QMA A;  4XUN A;  4QQ2 A;  4JTN A;  1QOT A;  2ZGL A;  4ITC A;  1AXK A;  1S0J A;  1WCD J;  2HWB 1;  1MS3 A;  2RJ2 A;  4P00 B;  1FNZ A;  2PN5 A;  3WF3 A;  3N7L A;  3POE A;  1M06 G;  1LOB A;  2WFF 2;  4AVS A;  4Q0V A;  4D7Y A;  3LWC A;  3N3H A;  3WHT A;  4JGZ B;  1RUH 2;  2XON A;  4URT A;  4Q1P A;  1JZ4 A;  3R4S A;  5C5U A;  4GKY A;  3UL2 A;  1H6X A;  3I3E A;  2WNO A;  3MYX A;  1OUR A;  3P3P A;  5JDB A;  5A7W A;  2WC2 A;  1SMV A;  3ZR6 A;  4Z2A A;  5DXD A;  1A8M A;  2HWC 2;  4HKO A;  4CDU A;  1OOP B;  2ZEW A;  4FOW A;  1W2O A;  2DBN A;  1R09 1;  2GNB A;  2R7E B;  4GQ7 A;  3WSO A;  3WW1 A;  3NNF A;  4PBO A;  4C0B A;  2AR6 A;  3VBO B;  4YWA A;  2XXZ A;  2CDP A;  3N35 A;  2C9A A;  3NNL A;  4OI2 A;  1IG0 A;  4QGN A;  2Y6L A;  2R07 3;  4UFL A;  2LAL A;  4EV0 A;  1AJK A;  3S57 A;  1YQ8 A;  2VZU A;  5FYY A;  3SQO A;  1ZM1 A;  2R0F A;  4GZ9 A;  3WDV A;  3B01 A;  3NAP B;  1Q43 A;  4XQW A;  1TME 3;  4LBJ A;  4EZH A;  5IK7 A;  1AR8 2;  1OFN A;  4ET7 A;  3M3I A;  4QX3 A;  1V9U 3;  5FBJ A;  4NJ4 A;  5AVA A;  4LBM A;  1XU1 A;  2VCB A;  2XJT A;  4FTS A;  2IVJ A;  3MLL A;  4CCM A;  4OQ8 A;  1OVS A;  4LK7 A;  1BQP A;  3ZMN A;  3ETP A;  3ZN5 A;  1YYN A;  3H8R A;  3PUI A;  3J8F 2;  2XL7 A;  1UPS A;  2WNU B;  1SAC A;  5F32 A;  5GM0 A;  4FQ4 A;  4RS5 A;  3TN9 1;  1M4W A;  4R9B A;  4AI1 A;  1SLC A;  5FZ4 A;  2Q30 A;  2QCS B;  1K5M C;  4BPZ A;  4DMI A;  2D6L X;  4NN0 A;  2EID A;  3WP3 A;  4DIQ A;  2EAK A;  1BEV 2;  2J1U A;  3KV4 A;  4LHL A;  1Z7S 1;  4MGZ E;  1R1A 2;  1Y9Q A;  3C7E A;  5FY4 A;  3RI9 A;  3NST A;  4NUB A;  4M4R A;  4QKB A;  4AK3 A;  2IWG B;  3OGG A;  1DIW A;  5C9A A;  1CPN A;  3JBG 3;  5FYH A;  1NCQ B;  1COV 2;  4GKX A;  1YQ5 A;  2IXI A;  2ORX A;  3CJI A;  5DUX A;  5HCF A;  1GZC A;  1FYU A;  5CKN A;  5BYN A;  1GAN A;  3A4U A;  3GHN A;  5FO8 B;  4CXX A;  1RUJ 1;  5FYZ A;  4IET A;  3K3O A;  4BQW A;  2XBO 2;  3UNP A;  5JMC A;  2IXJ A;  5LK7 B;  2BFU L;  3ON7 A;  5A6X A;  1N1Y A;  1RUD 3;  2P2K A;  4RGK A;  5FQ0 B;  4XUR A;  2DVF A;  2FDJ A;  5CYY A;  1L3J A;  3ASI A;  1YLL A;  2I2S A;  2I74 A;  4I0W B;  4D3W A;  5SV8 A;  2RR1 3;  3I54 A;  2BUK A;  2W2I A;  4X8N A;  1OD5 A;  4KGQ A;  5KHI A;  3H1W A;  3IKW A;  4BME A;  3SCF A;  4W4Z A;  3BU0 A;  4JGY B;  2JDK A;  1K5M A;  3GZE A;  3ES4 A;  4LOS A;  3FLR A;  1ENR A;  5JSO A;  1LOC A;  2GN7 A;  1H0B A;  4LO6 B;  3VBS B;  1EYB A;  3Q8A A;  3LKJ A;  1UQX A;  4NRP A;  2J42 A;  1ZZC A;  4R4Z A;  5BNO C;  4AHW A;  1RUC 1;  4AQT A;  1SLL A;  1QJZ A;  4X8P A;  4XVH A;  4RD7 A;  2YZ4 A;  3H50 A;  2FD8 A;  2VUJ A;  4LTA A;  1W6M A;  2XML A;  4XAA A;  1RTV A;  1XE8 A;  4XUQ A;  2IXC A;  3I2O A;  4B7K A;  3PDQ A;  2XUM A;  2JE7 A;  3KT4 A;  3PHM A;  1ND2 B;  2DUQ A;  4GMP 1;  4CRQ A;  3MFC A;  4HLT A;  3J7H A;  3S7E A;  1RHI 2;  3K4Z A;  1JBC A;  5FMB A;  3FHI B;  1W06 A;  4QB1 A;  4B4Q A;  3BIE A;  4KBB A;  4OYU A;  1JHN A;  5IFT A;  1V6M A;  2NP0 A;  4A7K A;  2DTW A;  3WQ0 A;  3UYJ A;  2HYX A;  1HIX A;  3MGU A;  1HQL A;  2DCY A;  1YI7 A;  4E9K A;  5L9R A;  3NMB A;  2VTX A;  2Y34 A;  1W6Q A;  3Q8F A;  3ZXJ A;  3RPQ A;  4D7T A;  3N9P A;  1VRH 2;  3H7J A;  1A6C A;  4JTO A;  5FYV A;  1VBA 1;  3WR0 A;  3POI A;  3RJ2 X;  4AI3 A;  5LBF A;  2QKD A;  2BNN A;  2BER A;  1SLT A;  4N8M A;  4YRD A;  2CAV A;  2BTV C;  5FPB A;  1CON A;  2G9Z A;  3A0N A;  3RS6 A;  4QPG C;  1GLH A;  2X09 A;  1TNF A;  4CXY A;  1XYN A;  2J1V A;  3K3N A;  5DPN A;  5LA0 A;  3WUD A;  1YJL A;  2QQV A;  3K48 A;  1DQ4 A;  1UZV A;  3POF A;  3D5O A;  5ERL A;  3RZM A;  3WXP A;  4LLF A;  1QGL A;  3QOP A;  4FPC A;  4HSJ A;  4LOT A;  4YGD A;  2Q1M A;  1WW4 A;  2PEL A;  3ZN4 A;  5E8A A;  2PLV 1;  2R30 A;  3JD7 1;  1FOD 1;  1F35 A;  2K46 A;  1AL0 G;  3O14 A;  4O7X A;  3APB A;  4YGE A;  4IUG A;  5LA2 A;  4PCR A;  2AEY A;  1XB9 A;  4UYB A;  5IVF A;  2C0Z A;  4FPE A;  4AGV A;  4H14 A;  2GNT A;  2VCM A;  2ADD A;  3NJY A;  3MIG A;  4CZS A;  5JAX A;  4IDZ A;  4CDX B;  1UY1 A;  2ARE A;  1LOG A;  5F8P A;  1O3T A;  4CDU B;  1ONA A;  5FP9 A;  3TAY A;  5KC5 A;  3I3Q A;  5L7O C;  2VTX J;  2ZPX A;  3KMH A;  2R16 A;  2VVF A;  3M7A A;  3WNO A;  4Q4Y 2;  4C8D A;  1RUG 1;  2TEP A;  1AYM 3;  3MEP A;  3KQR A;  4IEO A;  2C6S A;  4YVS C;  4IGP A;  4PT6 A;  4R4X A;  5T5J A;  2YPD A;  2EXK A;  4BDV B;  4E27 A;  1N1V A;  4BCU A;  3SCH A;  3SLI A;  4E2S A;  2ZGO A;  3CZJ A;  1MAC A;  4EQV A;  5BY5 A;  3PU8 A;  2FCU A;  2VXR A;  4D6S A;  5LWB A;  3A22 A;  1QWR A;  3AKQ A;  4Q4X 2;  2PHR A;  3WDW A;  1RUI 1;  4QHZ A;  3SHR A;  3WCR A;  1QJE A;  2VJX A;  2W94 A;  2WFF 3;  3BOP A;  2E6V A;  3KWV A;  5FJK A;  4CCL A;  3BTX A;  3IAQ A;  3M4F A;  5FXX A;  4IER A;  1RUH 3;  1YFX A;  4B1L A;  1RJ8 A;  1SLA A;  2PYT A;  4CEY A;  5BV6 A;  4R9A A;  1PGW 2;  5BNN C;  1JOB A;  3IB3 A;  1CJP A;  3KSC A;  4FOQ A;  3VZJ A;  2QQI A;  2ZZQ A;  1D4M 1;  3OGJ A;  2HWC 3;  1Z78 A;  4FQZ A;  2A3Y A;  2YBS A;  4AG4 A;  2HKX A;  5JOY A;  3LQC A;  5FZ1 A;  2UWA A;  2UYA A;  5IUQ A;  4F7Z A;  3VN4 A;  1OMI A;  1SBE A;  2XHN A;  1US3 A;  5FMD A;  3ZVX A;  2VBB A;  3PJY A;  1WLC A;  4ERO A;  2ET1 A;  3VUO A;  4CTE A;  1RXG A;  3UET A;  1UN1 A;  1KXG A;  2JIJ A;  3BTZ A;  4LT5 A;  3J4U H;  2A71 A;  3CKH A;  1JS9 A;  4XUT A;  2PHW A;  2QUO A;  4MXV A;  4QQL A;  2FDF A;  4O9G A;  1OKO A;  3B7M A;  4DEQ A;  1AR8 3;  4WVV A;  2D40 A;  3HOB A;  1HB4 A;  1BCX A;  2DTY A;  2WQ4 A;  4CP1 A;  2FQP A;  5FZI A;  1W9F A;  4ONU A;  3VDA A;  4BB3 A;  2C9K A;  3LEG A;  2CWS A;  3O1R A;  1E5I A;  3TEZ A;  4UOJ A;  3W20 A;  3PIG A;  4MOA A;  2DU0 A;  2RM2 2;  3J8F 3;  2DVD A;  5AFB A;  4TZD A;  2JIC A;  1RMU 1;  3WDU A;  4CUC A;  3DPR C;  5FDB A;  2RS1 1;  4DY5 A;  5A1A A;  3AJZ A;  5FKB A;  5GLV A;  4CUB A;  3U10 A;  4LOR A;  5IAT A;  5EJZ B;  2YYO A;  2WAO A;  3QD6 A;  1BEV 3;  5FZO A;  4AFD A;  3LSD A;  2L9L A;  4Q8K A;  4LUL A;  5C8W A;  1R1A 3;  1LR5 A;  3MW4 A;  5FY1 A;  3U4X A;  3BKZ A;  1RIR A;  1K5M B;  5F39 A;  4XTM A;  1OD3 A;  1BYH A;  4B4R A;  1GSL A;  2RS3 2;  5LK5 A;  1COV 3;  2ZHK A;  5KHJ A;  3HEI A;  2CSG A;  5CFC C;  2JG9 A;  1C3H A;  1QMJ A;  3VZN A;  5IFP A;  2DYC A;  4UF0 A;  1W28 A;  2JEC A;  4CDQ C;  5C6C A;  5F3G A;  5I0U A;  3M3O A;  2PAM A;  2GC1 A;  2VUA A;  1V70 A;  1W6M B;  1OVP A;  5T3N A;  4XYX A;  4H7L A;  2WT1 A;  4IEV A;  1WW5 A;  3USS A;  4OHW A;  4LKS A;  4DXR A;  2F4P A;  5C3S A;  2D5H A;  3FE5 A;  4MYE A;  1W6N A;  4WVW A;  5GZF A;  5K7P A;  3DPR A;  4M3C F;  3PMS A;  3UKV A;  5H9P A;  3VBH C;  3ZFF C;  4NO4 A;  4TWT A;  2JJ6 A;  1S2E A;  3FC0 A;  5BNQ A;  1JYI A;  2FDG A;  2JB4 A;  2XWJ B;  5F5I A;  3P6B A;  1W6Q B;  5CG9 A;  2YBP A;  5J7M A;  2A75 A;  1NA1 A;  2QQO A;  1R1Z A;  2BVB A;  3BI3 A;  1L7L A;  2CY6 A;  5I0T A;  2UY8 A;  2GC2 A;  4N53 C;  1ZBA 1;  2ZHN A;  5ISL A;  1UCX A;  1R08 1;  1W03 A;  2CGO A;  1BBT 2;  5C7G A;  4RYD A;  4PJY A; 
#chains in the Genus database with same CATH homology
 1UOF A;  1OBN A;  2DBI A;  1BK0 A;  1E5S A;  2VBB A;  1HJG A;  1W3V A;  2BU9 A;  1ODM A;  1RXG A;  5C3Q A;  1QJF A;  1W2O A;  2DBN A;  1W06 A;  2VBP A;  1IPS A;  1E5R A;  1DCS A;  2VAU A;  1HJF A;  2JB8 A;  1HB4 A;  2VE1 A;  1W3X A;  1UO9 A;  1HB3 A;  4BB3 A;  1W2N A;  1UZW A;  1E5I A;  2WO7 A;  2BRT A;  1W05 A;  1HB2 A;  1OC1 A;  2Y6F A;  3ZKU A;  2IVJ A;  5C3P A;  1WA6 X;  2VBD A;  3ZKY A;  1HB1 A;  4XAE A;  1GP4 A;  3OOX A;  2CSG A;  1E5H A;  5C3R A;  1ODN A;  1W28 A;  5C3O A;  2Y60 A;  2VCM A;  1GP5 A;  1UOG A;  5C3S A;  3ON7 A;  1W04 A;  5APA A;  4RGK A;  2BJS A;  1W2A X;  1BLZ A;  1RXF A;  2JB4 A;  3ZOI A;  2IVI B;  1GP6 A;  1QIQ A;  1UOB A;  1QJE A;  1W9Y A;  1W03 A;  1UNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...