1HJFA

Alteration of the co-substrate selectivity of deacetoxycephalosporin c synthase: the role of arginine-258
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
309
structure length
273
Chain Sequence
MDTTVPTFSLAELQQGLHQDEFRRCLRDKGLFYLTDCGLTDTELKSAKDIVIDFFEHGSEAEKRAVTSPVPTMRRGFTGLETGSYSDYSMCYSMGTADNLFPSGDFERIWTQYFDRQYTASRAVAREVLRATGTEPDGGVEAFLDCEPLLRFRYFLRMAPHYDLSMVTLIQQTFVSLQAEVGGAFTDLPYRPDAVLVFCGAIATLVTGGQVKAPRHHVAASQTSSVFFLRPNADFTFSVPLARECGFDVSLDGETATFQDWIGGNYVNIRRTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Alteration of the 2-Oxoacid Cosubstrate Selectivity in Deacetoxycephalosporin C Synthase: The Role of Arginine-258
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Oxidoreductase
molecule keywords DEACETOXYCEPHALOSPORIN C SYNTHASE
total genus 80
structure length 273
sequence length 309
ec nomenclature ec 1.14.20.1: Deacetoxycephalosporin-C synthase.
pdb deposition date 2001-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
A PF14226 DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.330 Mainly Beta Sandwich Jelly Rolls B-lactam Antibiotic, Isopenicillin N Synthase; Chain 1hjfA00
1W3XA 1W2AX 1W2OA 2BJSA 1OC1A 1W06A 2DBIA 2VAUA 4RGKA 1ODMA 1UOFA 2Y60A 2VBDA 3ZKUA 3ON7A 1UOBA 1QJEA 1W3VA 1QIQA 2VBBA 1GP5A 3ZKYA 1UOGA 1BLZA 3OOXA 2DBNA 1HB3A 2Y6FA 2WO7A 1UZWA 3ZOIA 2JB8A 1W28A 1ODNA 2IVJA 1E5RA 1HJFA 1HB4A 1UO9A 1RXFA 2VE1A 4BB3A 1DCSA 5C3SA 1W03A 2IVIB 2JB4A 1W04A 1OBNA 1HB2A 2CSGA 2VBPA 4XAEA 1WA6X 5C3RA 1E5HA 1UNBA 5C3QA 1HJGA 1RXGA 2BU9A 1W2NA 5C3PA 1E5IA 1BK0A 1W9YA 5APAA 5C3OA 1E5SA 1QJFA 1W05A 2VCMA 2BRTA 1HB1A 1IPSA 1GP4A 1GP6A
chains in the Genus database with same CATH superfamily
2XQRA 2IXLA 5J7MA 1H8TA 1R093 2AH2A 3IMNA 4LK6A 2EICA 1MZEA 4AAPA 2VBDA 4HSLA 3ILRA 4XBNA 2EAAA 3KT7A 2VUAA 5FBJA 3AMHA 4XZUG 4IEOA 1PZ8A 1X8MA 4KG8A 2JE7A 5HBAA 4LE4A 1XE0A 2VE1A 1TMF1 4RYDA 5A7QA 4K7JA 5T50A 1LHOA 1ZX5A 1RJ8A 1YJLA 1IPKA 3PTRB 5I0UA 1ZBA1 4DXZA 3LFMA 1OKOA 1EV13 1YWKA 1LTEA 3E1F1 2D40A 2PN5A 3LEMA 1E5IA 1WD3A 5C3OA 5JCTA 1AXYA 3SLIA 4HG6B 5F8PA 3EYPA 5BNPA 1AXKA 2DBIA 2PLV2 3VKNA 3PIGA 3OGSA 4FFGA 2YU2A 1H1AA 3AKRA 1YLLA 3R0RA 1C5IA 1TZOA 2ARAA 2XDVA 3D82A 2F4LA 4NAOA 5FZDA 5CVRA 4IEPA 3N36A 1PO12 1QGLA 2F4PA 5CBLA 3AKTA 2G1MA 1QNWA 4ZZ8A 4HLTA 2TUNA 1ULPA 4O61A 4UF0B 1JZ2A 2I74A 3THPA 1BZWA 4EWAA 2K9ZA 3ACFA 1MVEA 3GALA 3GDBA 3H8UA 1FOD3 4QX0A 5GLTA 5BNOB 5F5IA 4MGIE 3W20A 3NW4A 1UNBA 1PMIA 1WBFA 1ZBE3 4W6XA 4OZOA 5IUQA 1H2MA 2AC1A 2JDYA 2YPJA 2UY9A 4URTA 3KVBA 4GJZA 4KU8A 4P5HA 4XCBA 3U11A 2VAUA 1OC1A 4J1WA 1CAUB 1J3PA 1EY2A 1K5MB 1HRV2 2FMDA 4IEXA 5BNQA 1QJY3 2WLQA 3INAA 4Y24A 1UAIA 3ATGA 1W6NA 5A3WA 1ZRFA 4Y20B 4AEDC 2ADDA 1UF2C 1ZA7A 4B1LA 5J09A 4WM8B 3ZSEA 2X5IB 2JIGA 2WNUA 4NE9A 4YM2A 2CY6A 3RYKA 1JODA 2E53A 4LKSA 4Y5TA 4DOUA 4QKDA 1H6YA 4LA2A 4DNYA 1RUD1 2RV9A 1TQ5A 2F17A 4ZU7A 2F6BA 1HQWA 2WWJA 3O14A 1OUSA 3B9CA 5FY7A 2CTVA 3ZSKA 1XU2A 5A3TA 2BWCA 4UW5A 1O4ZA 2VQAA 3SKJE 3WHTA 3FE5A 4HKWA 3VV1A 2LW8A 3IKWA 4N7UA 3OD0A 4D6QA 1TME2 3HEIA 3BB6A 4MGZE 3DYPA 4QM9A 1V6OA 3Q8EA 3Q9OA 1K12A 2JG8B 4XIOA 2VZPA 1NZCA 5A7SA 5CA6A 1CQ9A 1U5XA 3TEWA 3R4UA 1F35A 3EB7A 5CISA 4EQVA 3N7MA 1H2NA 3CQOA 3FLRA 1WUVA 3ECQA 2P34A 3HBKA 3ZYJB 5L7OC 2B39A 3AKQA 4FPKA 4ZHNA 5FYZA 4HPKB 4LPLA 3V0BA 3RZMA 1UYXA 4SBVA 4CCDA 1W06A 2WZR3 1RTVA 4DXRA 2FDJA 1BMV1 5BNNC 3ZSLA 4TZDA 1G86A 2R042 2OKXA 1W3VA 1KEXA 3LEGA 1O5LA 4XUOA 3AYDA 4N53A 3ZKYA 2PAMA 2P3YA 2YBKA 2AEYA 2H0VA 4UFLA 2W08A 4QHBA 4R4ZA 4UFKA 1GSLA 2A6XA 1ODNA 1VRBA 2W1UA 4JRLA 3UYJA 4IE4A 5F5AA 3U37A 4QPIB 4F3JA 3BTZA 2EALA 1GZWB 3NKTA 1AXZA 3B69A 4Q4W3 4IEQA 3HOBA 4NRMA 1ZBE1 2C0ZA 4FFHA 2QQLA 2OW4A 4I02A 1R081 1RC6A 1AYM3 2OZJA 4Q4X3 3MIEA 4UI9L 4XF4A 5JOZA 2J1VA 4PDWA 1VJ2A 3L2YA 5EP9A 5K4LA 1PNFA 1B35B 4JAAA 4B1MA 2QFEA 5FPXA 3JCIA 2PQSA 1A78A 4QGMA 1WBLA 1OOPC 1RUE2 1H9WA 2ATFA 2LTNA 3ZFGC 2QNKA 2WRAA 1IS4A 1W8ZA 2JG9A 5F9TA 1VRH1 3GXUA 3NAPC 3UETA 5CG9A 3BN6A 3H3LA 1MS8A 3WD5A 2XWJB 2ZMNA 2XHKA 1YEWA 1LHNA 3AK0A 5LBEA 3ROUA 4LOTA 3SCHA 4BU2A 1AL22 3OG2A 5CZKA 4BZ4A 3KB5A 4NVPA 4IEVA 5A6XA 3RMYA 3UV9A 3E6BA 1QXPA 5FK7A 5LY1A 2A6VA 1DDLA 4YYOA 3MIFA 3RZLA 2G9GA 4DY5A 1AYN3 5JUVA 2AGSA 2GH8A 2VTXJ 1W2OA 2CV6A 2WLPA 5BPXA 1PX3A 3I2GA 4CUBA 4BCUA 3H9AA 1CX4A 5I0RA 1XPWA 3AFKA 1NKGA 4M01A 3LOIA 3LEKA 3ACGA 4YG0A 1Y9QA 4N7IA 3LDBA 2PHXA 5E16A 1WCUA 1MS3A 5EXOA 1CESA 1RUE1 4LE3A 1HN0A 3V0AB 1AR73 2DU0A 4QXCA 3T2TA 3KCYA 5ABJC 1HV0A 1R091 5LA0A 2E7QA 4ASLA 3HT1A 4JC1A 2W5FA 4V2WA 2DCTA 5ISLA 3F95A 1XB9A 1CAXA 2PTMA 2WYFA 3LPFA 1GOHA 1V6KA 1G9AA 5FUPA 4ASMB 2E33A 4GIQA 2CGOA 2OA2A 2HLEA 3MI8A 3ZN5A 4D6SA 1H0BA 1M4WA 1WLTA 1N47A 3DV8A 5SV5A 2RG4A 2H6BA 1VBC2 4CU8A 4GH4C 5FTTC 4NIGA 1Q8OA 3LF7A 1UZYA 4QHZA 1YIFA 3H0OA 2O8OA 1XBFA 2J42A 4KWUA 2EVXA 3M3OA 4UW4A 3OBAA 5IVCA 5T52A 5A6ZA 3AXDA 1JHJA 5FY9A 3FFZA 3WCRA 1BMV2 4MZUA 2P3IA 1QQP3 1HJFA 3H1WA 1C8M2 3TYJA 3IPVA 2TBVA 4OI1A 1UZZA 2HH9A 5BYNA 1STMA 5FR3A 3ZYRA 4U36A 2MNGA 5I0SA 4OQ8A 1KQRA 2ZGMA 4XFBA 1MPXA 3APBA 2DVAA 5EJZB 3J4UH 2W3JA 1JZ6A 2EXJA 2XH6A 1UMZA 3H3UA 2RR11 3RRDA 4AR2A 2X10A 4C90A 2HBUA 3AJZA 1UKRA 2QKDA 2ZGTA 2CGPA 5EWSA 4COUA 1XYNA 2RS31 2R0HA 1DGLA 1TME1 5IVEA 5GALA 4BWOA 3DYMA 1JZ7A 4R9AA 2VH9A 4AI0A 1EAH1 2ZHKA 2UWBA 1VBB2 3PMEA 2RS12 2EXIA 3NNFA 1V00A 4CDWB 1LOGA 3ACLA 3S7IA 3PUSA 4CXWA 1OQ1A 3KCCA 4XFGA 1OLQA 3KMHA 1L7LA 3DYOA 2J1UA 1PO11 4M0NA 1S2EA 3ZVXA 1V9U2 2XONA 1W2NA 4ZXKA 4R4XA 2HWC2 3M3IA 1GNZA 1W0NA 3M7AA 5I93A 3M1HA 4IV3B 5D8AC 5FYTA 4OHVA 1UY3A 1GWKA 1K5MC 2ZHNA 3U1XA 4E4ZA 4BA6A 5LCWL 3ME2A 3WW3A 4Q29A 3KV6A 1MVQA 4NUBA 4OHXA 4UAPA 3BPZA 5L9VA 4EN9B 4Z82A 2D6KA 1UX7A 4JGYB 2ZEXA 3AZZA 2JDMA 4LO5B 3ZYGA 5AC91 1SLBA 5E89A 1RUC1 3RMXA 4DEQA 2QUOA 1PO23 2OUHA 4P14A 2VZ1A 1C57A 1JN2P 1UX6A 2IZWA 4W6YA 4AW7A 3LFIA 4CU6A 3SEPA 1S0BA 1IHMA 3VUOA 4BQ3A 1OA4A 2ZGKA 1W8FA 5KR7A 2KD7A 1VAMA 3A0KA 2MEV3 1GKBA 1YNAA 1GNYA 3ZXJA 1ULFA 1JOBA 2OIIA 4Y5SA 2D3PA 4F83A 4KU7A 1W2AX 5F6KA 4RGAA 3LSEA 1PNGA 3FJSA 1PMHX 1COV1 4CU9A 2ZAHA 4YG6A 2HWD2 5F5CA 1QOOA 1W6MA 1QNYA 4YVSB 1D4M1 1HN1A 3QCWA 2KR2A 5BNNA 1WW5A 1X36A 5JMOA 3KQ4B 4FPLA 1VB4A 1OHFA 1AR83 2XB6C 3JZVA 1RHI3 1ZZ9A 3AB0A 3BOPA 4Y1ZA 3WR0A 4PQ9A 2ARBA 4Q4V2 1CAXB 2R062 2E26A 2ZZJA 4I30A 4RR3B 1GNHA 4CUCA 4EN6B 1VBD1 1W9WA 4P08A 4Y26A 4DXTA 5A1LA 1PGW1 1RUJ2 3DKWA 2VZ3A 1F31A 1FNYA 2RDNA 2R1BA 5CIRA 5KBFA 3IAPA 2YUEA 1N1TA 2UURA 2JDPA 4LLFA 4PQQA 3DN7A 4QXKA 3VKLA 4BIOA 1GP5A 5EYXA 1ZM1A 1ENRA 3LA2A 4GWIA 5FZBA 2Y0IA 2WS91 4D7YA 1JH5A 2HWB1 3IIAA 3OJBA 1HB4A 4JQTA 4MXWA 3OGJA 4A44A 2IVIB 4QDSA 3N9MA 4CDUC 5JSOA 3ZXLA 3DPRC 1KITA 2CDOA 2VZOA 3LDKA 3OGVA 4Q0UA 4XF0A 3TN91 3WUCA 2WNUC 1NAEA 4DUWA 1LEMA 1G7YA 2R071 2VNOA 4FXKB 1IKPA 1NCRB 2GU9A 5T5LA 2XL7A 4PF1A 2JDZA 1F5JA 4JTOA 4M0HA 1DLLA 4LHLA 3KWVA 4AI8A 1D4M3 3M3EA 4G9SB 3KZ4C 2XJTA 3I2HA 2Q8CA 2BQPA 3VBHB 3SCGA 3FL7A 4AFMA 5CADA 1R1A3 5CKNA 4Q0PA 3BTAA 2ZX4A 5F2SA 1HB3A 4Q5OA 5CNAA 1JUIA 4A7KA 4YFWA 2ZCWA 4Z2AA 2C5DA 3HBZA 1ENSA 4N53C 5CB7A 4RHV1 3VL8A 2B45X 2ARXA 1NXD1 4YLZA 2JB4A 2EXHA 1V9U3 5SV8A 4CEYC 1GQGA 4Q4V1 1SEFA 1W8OA 4XDOA 1IS6A 4EE2A 1ZVFA 1A6CA 1UYYA 2B4KA 3KQRA 3TB0A 1YCIA 2GZWA 3IT8A 4X8NA 3ZYPA 2IFWA 4XQ4A 1O8SA 2R1DA 2X8KA 3NJVA 2Z79A 5LASA 1JMUB 4N53B 5A32B 4FSJA 4W50A 2RS52 5C7GA 2IXIA 2WSVA 5JLVA 2E7AA 4B4RA 2XJPA 4JDOA 3C8XA 5IYYA 1HQLA 3ZFEA 3KV5A 1CJDA 4HXCA 3WG2A 4CP9A 2XL9A 4KWJA 1KJRA 5DXDA 2W39A 2ZGOA 3D6EA 4YGEA 4CDWC 2QDNA 3H8OA 5FY8A 2ZGUA 1VBE1 2B9UA 2ILMA 1XSRA 2GSYA 2BGOA 3JQXA 3RPQA 4Q2FA 4MG2A 4XFCA 1DZQA 1TVGA 1ND2C 4FP3A 4ASKA 3I3EA 1KDKA 1RUC2 2I07B 2O0OA 1ND3C 3N9PA 5IK7A 3ZN4A 4MHUA 1O3RA 1MZ6A 4IV1A 4ZKTB 5IK5A 4H55A 5LEKA 4NRPA 4XACA 4S2DA 3NSTA 4YNIA 2R30A 5H9RA 1RUF1 2PHRA 4B3NA 3RJRA 5E88A 5FOJB 5JR2A 5DZEA 3NJXA 1WWYA 3RVHA 4EZHA 3I59B 4CXYA 1X82A 3UGFA 2I2SA 2HWF1 2PAKA 2BNNA 3SCFA 4BQXA 3A7QA 5FZHA 2GC2A 4ZU4A 2XHNA 3WP3A 4NO4A 1UKGA 1J3RA 1WCKA 3WNKA 2C9KA 4TXWA 5FP3A 1RMU2 1AR91 1QJU3 1Z7S3 2CAUA 2CDPA 2GN3A 1VIWB 3ES4A 3T30A 3SNMA 2J7MA 2FDKA 1IPSA 4YW3A 3C7OA 4P00B 4EV0A 3FZ3A 4JKMA 2IC1A 5FWJA 1X9TA 1VBB1 5K0UA 5DAPA 3VDDB 1T2XA 3P3PA 1PK6A 4AI1A 4C8DA 3H8XA 5T5PA 1SPPB 1QMJA 2RS32 5EJ3A 1VMJA 1WW4A 4U2AA 1W28A 2WT1A 5FMOL 4CP2A 2N7GA 5HCBA 3WQBA 4UBGA 4YW6A 4JHZA 1AR81 1GUIA 3QBQA 3AVSA 5DABA 1JOPA 1X50A 5EIYB 4GWJA 1ZZ6A 4CTEA 4MXWB 5C9AB 5A7OA 3OSDA 5IVVA 4FP2A 3G6JB 5LA9A 1GQHA 4LHKA 1AYM2 4Q4X2 3POYA 2XUMA 1H1MA 4XYXA 4DO0A 5A1FA 1URXA 2GNTA 3RSJA 2ZS6B 4QQOA 2W46A 1BJQA 2VL4A 4L0PA 4IESA 3WSOA 3USUA 2VUDA 3PUHA 3POGA 2HJIA 4N43A 1V6JA 2DFCA 1JW6A 3N35A 2AREA 1RUE3 1VP6A 3ZDSA 3WQ1A 4XMIA 3CIHA 3VZLA 5HPOA 4GAZA 2E7TA 2MEV1 1V0AA 3TEZA 2CU5A 2EIEA 5DDJ1 4XF1A 2RM21 5GKAC 3WP6A 2ZGQA 3FBMA 3L9JT 3WVJA 3A4UA 3AMPA 3I3DA 4CVUA 2BZDA 5IK4A 1QH6A 4P9XA 1NZIA 1JYNA 3HVDA 4QGLA 1O4YA 3EQEA 2RS51 2Y8KA 3QOPA 3J9SA 3IN9A 4FBFA 2OPKA 4YZ2A 2WFF1 3MO4A 3TOJA 1JYTA 3GBWA 3VBOB 1K45A 1V6MA 2YC4A 3LZZA 5L9RA 4CSWA 1O7FA 3I2IA 3P3NA 3UT0A 3EBRA 5C8CB 4BJ0A 4J6GA 2DV9A 4XUNA 4I0WB 4UFIA 5GLUA 1I9RA 5DDJ3 1QJEA 4EROA 5JXHA 4H7MA 2FDIA 1UIJA 5LA1A 4Z2WA 1XE8A 5HV0A 1VBA1 1Q3EA 3VHNA 1AR93 1QJU1 4YARA 2VOKA 4Y1YA 5CFDA 2V4AA 3MIHA 5LATA 1R083 2HWF3 3HPNA 3VLBB 4IV3A 4BXSV 3JXSA 3O1RA 3O1PA 2NLRA 4XUQA 1S4CA 4LO4B 2FCTA 3ZR6A 3UESA 3S0MA 4Y1UA 1IG0A 4X8PA 1K5JA 2R072 1GP6A 2VQTA 4ATEA 1OD3A 5C33A 4FTEA 3CKHA 3KCXA 4NHKA 4E8CA 3PVBB 4JQRA 2Q30A 2ZGLA 5H9QA 2BW8A 3ZFEC 3KHBA 1BLZA 2XR4A 2AR6A 2VXJA 2XBO2 1DYPA 2Q1FA 3MHZA 4GH4B 4YFZA 2DFBA 2EIDA 5G05L 1R1A2 3AMMA 2Z69A 1QDOA 2Q8EA 1Z7S1 2KM2A 5C5TA 4QX2A 2WA3A 4DS0A 1ZBE2 2D6PA 3D8CA 1E5SA 4N9HA 4QPGA 4Z8BA 4M3CB 5FPUA 5L36A 3WLUA 5FUIA 4I3PA 4IETA 3BODA 1VBD2 3RFRA 3NO8A 2GH2A 1NUKA 1W8TA 4RGKA 1YQ8A 3OUJA 1SZBA 2BUKA 2R061 1RUF3 1PK6B 4LT5A 2EXKA 4Y22B 1YFXA 5F6LB 4NPLA 1H2LA 5FCCA 2Z42A 1MEC1 2DVFA 3IBMA 3NWKA 4QPWA 1KJLA 4RQPB 3TAYA 3PLQA 2AENA 2UU8A 2XQXA 1DZRA 4UF0A 4DQAA 5IW0A 1RUG1 3H8RA 3NMBA 1H4GA 2PELA 4AYUA 1RVF1 1SCRA 3ZR5A 3PURA 4OULA 4WBBA 2UWCA 1JHNA 4R9DA 4QQHA 5FYBA 1CGPA 5A33A 4MGKE 1BVVA 4LBNA 2OQ7A 1GANA 5FLIA 1UD1A 2XJSA 3ST7A 4NAMA 1OPMA 4FTBA 3BVCA 3GHMA 5FK8A 5JOXA 2R6QA 2V5DA 1DQ2A 4DB5A 1REEA 1WMDA 3ZPYA 1RINA 4NJ4A 2E51A 2A6YA 1VRH3 4GWMA 3H42B 4GKYA 5DG2A 2VZVA 3J8F2 2ZEZA 2JKXA 1AR61 1DQ4A 1VMFA 2QQVA 3FHAA 2ID4A 4KWKA 4KH9A 3ZFFC 2BGPA 5I8YA 2OZ6A 4ZZ5A 5FZ4A 4QKFA 5FZEA 5DQ0A 4O9EA 2AZ5A 5JAXA 4D3WA 3FLTA 1X33A 3J8F1 3WNNA 1UOBA 4QWNA 1AR63 3P1IA 2EIBA 1LEDA 4LBOA 1P8JA 4LO7A 2MPFA 2WAOA 1GR3A 2VTXA 3MEPA 2XLFA 4HMZA 4LIUA 2HWD3 2DYCA 3WNOA 5JSRA 4AHYA 3VBUA 2SBAA 4BQ5A 5CFCA 3UL2A 4E2SA 3ZPOA 5CG8A 4QB6A 1W6OA 3PU3A 1XE7A 1R1ZA 3LE0A 4RA0A 5T54A 5FLHA 2DCKA 2YB7A 1XNDA 5L7OB 4KL1A 5FYVA 5DUWA 4L99A 4CDXB 2C9AA 1ZRCA 1KD7A 4FOQA 4OFGA 3VZOA 1S0CA 2PHWA 4AZZA 3M3CA 2YXSA 4OHZA 4GB31 4JHTA 1NA1C 1WGPA 3FC0A 3WY6A 5C8WA 3WOGA 1HXS2 1C8M1 2ENRA 5GZFA 1QH7A 4LTAA 3UJOA 4LEJA 4M3CF 2Y6LA 3HN1A 4CCEA 1LOFA 2VVFA 1ULDA 2XOMA 3LIGA 3J26N 2CSGA 3B3QE 2BBAA 1OQDA 4B8EA 4LHNA 3GJBA 4C1WA 1UU5A 3E97A 3OD4A 1ZNPA 2J1AA 2VNRA 3O1TA 4Y1XA 2JDNA 3MLKA 4PIXA 1DYKA 1VBC1 2QCSB 1N3PA 2WBKA 4XILA 4AQ6A 3N9NA 3I54A 4IV1B 3ZSMA 3OF1A 1DFQA 2E31A 2X5IC 4CU7A 4FXGB 4M3CE 5EV7A 4E2GA 1C1LA 2VMEA 5J48A 4XBLA 1DLCA 3O0WA 4GMP1 3NNGA 4BQ2A 2P37A 3DPRB 1W99A 1RUD3 4XW3A 4JVAA 3KT1A 2P2KA 4CDUB 3DF0A 3EO6A 4IEYA 1G8WA 1I5PA 5FY1A 3S5QA 4ES8A 5HXMA 4INDA 1CAVB 1WCQA 1U5IA 1B09A 2D3SA 2G9FA 3E5QA 4DIQA 1O91A 3I2OA 1RUG2 1W6NB 4QB1A 3IM0A 1NLSA 2VPVA 5T5JA 2ARCA 2E6VA 5HCAA 4AQSA 1CZTA 4K8FA 4XDPA 5K0UB 4Q27A 3RI8A 3ZMOA 3M8LA 4QXBA 4A3XA 2WNUB 3BALA 1DGRN 3O0VA 2PHFA 4CP0A 1L7QA 1TNRA 4RSUA 4XDQA 4C91A 1FNZA 2JDHA 4D7TA 1OVSA 5DUXA 3MFCA 1UPIA 4HT1T 2DURA 4X6RB 2V72A 3JD73 1D4VB 3OBTA 2YC0A 2QZ2A 1OA2A 1QJU2 2LUWA 1I6XA 2PLV3 2RJKA 3EHKA 1MQTC 3FFQA 4QD2A 5KXEA 3S30A 3TBDA 3VZNA 2NQYA 3MUY1 4XQWA 4Q4Y1 1WCSA 2JX9A 4YVSC 1LB2A 2ET1A 4XOGA 3BTXA 1UN1A 1RUH3 1MQTB 2ZGRA 3KS7A 4AEKA 5EYYA 3WHUA 5ANNA 3WDTA 2WL1A 2XBO1 1IPJA 3LCPA 3PUIA 4L9BA 5EQUA 1RL3A 1SG3A 3LD8A 1ZZ7A 1UOGA 1TE1B 2WJSA 1ZBA3 3K4AA 2D97A 1OUXA 1KXGA 5A7PA 2XG3A 3E5UA 3LWCA 2RR13 4RFT0 1YIPA 5FZAA 5JOWA 1S1AA 4LBQD 1O59A 1LOBA 1PO22 1UZ0A 1D2SA 3ORJA 4ZY9A 4QQPA 2VCCA 5HI0A 4OLLA 2R041 1WLCA 3K3OA 4FPCA 4XUTA 4PLMA 5C3PA 2RDSA 5J1XA 1YQ5A 4HSJA 2HEVF 2JE8A 4HONA 5BXXA 1JS9A 4A7YA 3CJIC 2GNMA 1D0GA 3JQWA 1D2QA 1XXNA 5IVJA 3IPVB 4PT6A 5FY5A 2HWC3 2VBBA 2TNFA 3KV4A 4JRAA 2EF6A 4DY3A 4QPYA 4FPYA 3U0ZA 1BCXA 5FP4A 1GMMA 3VDAA 1QHDA 2AUYA 3T0DA 1DIWA 3LA3A 4HANA 3SKVA 5K0UC 2RMU3 2FHRA 5LBCA 2YC2A 3GHNA 1NCQA 4FFIA 1LHUA 1U0AA 1WMFA 1HB2A 5FJKA 1YI9A 1YFYA 5FQ0A 3PMSA 4RFRB 2VD7A 1GV9A 3NV3A 3ASIA 2VCMA 2HWE1 1Q8SA 4KBZA 3THDA 1C1FA 4TYSA 4AVBA 5FZ3A 5AVAA 2ES3A 4CRQA 1EUTA 1HXS3 2EA7A 3ON7A 3GZAA 1TG7A 4MOAA 4XJWA 3MW3A 3CO2A 5JI7A 1RUI3 3HWJA 3WF1A 3LAGA 1NA1B 4IV1C 1IQAA 3BU7A 4GZ9A 2VZQA 4XJ8A 1SFYA 2R043 1CIWA 2VZSA 2YFZA 5DAWA 1F15A 2EAKA 2RVAA 3JD71 5LW9A 3URFA 4NHXA 5DZFA 5T55A 1FMD3 1QOTA 2WA4A 3RZZA 3VD7A 4BQ1A 4CDXC 3O1MA 4I0BA 3GJAA 2WFPA 3N3HA 4X6QB 5FAXA 1I5ZA 4CDWA 4FO9A 2ZGSA 5FREA 3POIA 3RZJA 2Z4FA 4ISQA 3CJXA 2BJSA 4FAGA 3I49A 4JGZB 4Y3OA 3U10A 4L97A 2ZACA 2XPJA 1REDA 3E6CC 1RYYA 4DEVA 1NQJA 1LGCA 2WO7A 1QQP1 2A3YA 4ET7A 3RQ0A 5JDBA 1LODA 2OT7A 4XJZA 2VU9A 2JDAA 2NM1A 3E6DA 5I0DA 5L19A 4HVOA 1AR92 2XKPA 1W9SA 2FCVA 4IEUA 4CUAA 5FZKA 4YRDA 4CZSA 5DUUA 3HJRA 2I45A 1UU6A 4BQYA 4I3GA 1R64A 2UYAA 4P9LA 1J84A 5FJHA 3CLPA 2Y0OA 2G4IA 2X53S 4XZPA 4GJYA 1QU0A 3DL3A 2D6NA 1ZRRA 1UOFA 5HV4A 2ZHMA 4DMIA 4XFIA 5GLVA 2BPA2 5LWBA 1G9FA 1ZBA2 1H9PA 3GZUC 2W47A 2WO3A 1K42A 4Q4V3 4L11A 2JWPA 2YV8A 3OTFA 5ABJB 1QJX1 5C4WB 5A70A 2A73B 3RZGA 4IGOA 1XOYA 2X09A 2GALA 3GGLA 4AFDA 2BFUL 5J36A 3K3NA 5CKQA 1ND3A 3AP9A 1VPHA 2PFWA 3ZFGB 4XABA 4IL7A 5JZGC 3NRUA 3O1SA 1C8NA 3DEMA 3BU0A 5G04L 2G19A 1YHFA 3AYCA 4J1XA 1B35C 4W8JA 3OUIA 4FOVA 2XJUA 3TN92 4CCOA 1US2A 5IWFA 1XJAA 2BERA 1OURA 2BDRA 1T6BX 1MS5A 2ZEWA 2D3RA 1W6OB 2JB8A 4IE5A 4KGQA 4OVEA 2HWB2 3T1MA 2VC9A 1W6PB 2JEMA 2O1QA 4WVVA 4K8RB 2W94A 3WNLA 4IDZA 4B4QA 2WS93 1CIYA 1NCRA 3WEZA 5ANQA 1OOPB 2W87A 3R05A 2GC1A 3K77A 1JZ4A 3PUAA 3ZSJA 4RHV3 1MS4A 3EMRA 3T0BA 1NY72 3POFA 4TLGA 5F5QA 3ZXDA 4ZONA 3TWIA 2D5HA 3C7GA 4AVAA 3TEXA 5JXGA 4D6RA 3DKQA 1U12A 1MZFA 1LOCA 1J1TA 4FT8A 4CEWA 1SFPA 3AKPA 3B01A 3AM2A 1QJZA 4YSFA 4QPIC 1NT0A 1PVXA 3ZXEA 1NA1A 2IFRA 5FY4A 3V64A 5T3NA 1US3A 3BOWA 3AJYA 3THTA 4GWNA 3O7OA 5F37A 4A6OA 2X05A 1TEIA 3N7KA 1UMHA 1HJGA 2HWD1 4ATFA 1KDMA 5BNNB 3A0NA 1F5FA 4FTSA 4E9KA 1JYCA 2VVEA 2WZR1 3NQHA 4UOJA 5KC6A 4BIFA 5A3PA 3QLQA 3KGZA 4QKNA 5FDBA 4FPFA 3V0BB 5JIUA 4BLIA 3HMYA 4MSVA 5JWPA 3ZFEB 2OXBA 1HIXA 1W90A 4FPGA 4CP9B 5A6YA 3TEYA 3AZXA 4NOTA 5BNPB 1NLRA 2YZ4A 1PIV1 3D0SA 3IZOA 4MYEA 3VBUC 2FZ2A 2DVDA 1CAVA 2BVBA 2Y6FA 2E63A 4IXLA 5FP8A 5A3OA 1KS4A 1UQXA 4TN7A 1UYZA 5FFOC 5FYHA 3B02A 5AC92 5LBBA 2BBVA 1XSQA 3PVNA 4WM8C 1W2TA 4HL0A 3KSCA 4QX8A 1OFNA 2VM9A 4Y4RA 5D8AA 2A3XA 3VBOC 2ZAAA 1OI6A 1XNKA 1ASJ1 1BK0A 1SLLA 2RS53 5LA2A 2RMU1 4GD4A 3CZUA 3VGIA 4BHPA 1FXZA 3MDPA 4H7LA 2D6MA 4LBLA 3HD8B 1M06G 1GLHA 2GC3A 3Q8BA 2HWC1 5DAQA 2DU1A 2P3JA 3HQRA 4XFHA 5DZGA 3T2QA 4AGVA 1D4M2 3MLLA 1RVF3 1FV2A 4NIHA 2VQUA 4Q0SA 1JYXA 5ERLA 1SBDA 1IQDC 1VAVA 2VMHA 3VDDA 3VBFB 2JKBA 1FOD2 1FYUA 4DPNA 3SEEA 2ZBJA 2PQQA 2OX0A 2HBTA 1WKYA 3VBHA 3FWEA 1MEC3 1XYOA 3R4DB 2Y6HA 2GN7A 2EIGA 1AL23 2BU9A 1DQ5A 2L9LA 3JBG2 3VKMA 1QJFA 1LHWA 2FBEA 3WZ1A 3THCA 5FPBA 1SDDB 4DZGA 5C9AA 1H6XA 2VMGA 1QOSA 1PMJX 4PBOA 1JZ3A 3MIGA 4JDMA 2XVKA 4EN0A 3H1MA 4YW2A 1DGWX 2D6LX 2WR9A 3VL9A 4H2AA 3MF6A 1REFA 2H6CA 1E5RA 4DUXA 1X7NA 1LECA 5F3CA 3DUIA 3AMQA 3AX4A 2DCYA 3AL5A 5C9AC 3DXUA 1POV1 5AVPA 4BM8A 2CAVA 5IVFA 2WO1A 4OYUA 5FZLA 3SXWA 1S2KA 3T3YA 5TSWA 2ERFA 4R8HA 4HOOA 2Y6GA 4LNVA 2RS11 2DTYA 2NYYA 4G3YC 3T4VA 3ZYIB 2RS33 3RZHA 5HCFA 1XNBA 4LR4A 5FMDA 5ABJA 3SC7X 3MYXA 3OY8B 1CJPA 3VDDC 4CEWB 2GMMA 2TEPA 4YGCA 2JE9A 1NCQB 3NJZA 3J7MA 4AG4A 4IQPA 4H3WA 4LORA 4WVWA 1RHI2 2P4EA 2IVJA 3KHCA 3T0AA 1JU3A 2PYTA 5F32A 3BTYA 4BH9A 5C8CA 5LY2A 1WW7A 1POV3 4XC9A 5FMBA 3SISA 2K46A 4HK9A 1VBA3 4RS5B 5J3UA 4QMAA 4NIDA 3M3QA 1CN1A 3BCWA 4I0AA 4EYUA 1LJ7A 1O3SA 1GP4A 1Q43A 4YWAA 2JD9A 4I2OA 3WDXA 4ES9A 4AXOA 2QQPA 2DCZA 5JPNB 3NAPA 3GZTB 1SMVA 1AX0A 4PJYA 3WG4A 1OOPA 3BGAA 3I3MA 4XIKA 5FZIA 1X9PA 3U78A 3EJKA 1QDCA 2RDRA 2ORZA 4OMCA 4P9WA 4NN0A 1UY0A 2QZ3A 3I2FA 4XAEA 5DN2A 1V6IA 2B5HA 1DQ6A 2BFUS 3P6BA 3OGRA 5JVVA 3VKOA 4L8QA 4AHWA 5C71A 2PXJA 4HETA 3E5XA 2W95A 2HEYF 1PIV3 3AP7A 4QB2A 4K9SA 1V6NA 3ACIA 4QAWA 1PVC3 4MGQA 4BPZA 4A2UA 5F3IA 1APNA 1GZ9A 3PNAA 4GB33 2R49A 2ZX2A 5FP7A 4AFCA 5ACA1 1FT9A 3WW1A 1DG6A 1GICA 1WD4A 1JU4A 1IOAA 1XNAA 3M70A 4HKOA 1JUHA 5A3UA 4W6WA 4EJRA 1SLIA 4G4FA 3VBHC 3LIHA 4CYDA 5A3LA 3MIDA 1DCSA 1ULGA 2VW0A 3VBFA 2DUPA 2R073 4CEYB 2P1BA 1S0JA 1ONAA 2ZMLA 3RDIA 3RWKX 1CAWB 3VZJA 2P3KA 1QJY2 1PHMA 2XJVA 4XEZA 2XBO3 1CWPA 2WABA 2QQMA 1W9YA 4H14A 4E4SA 1BEV1 4PIZA 3T1LA 1QKQA 1PVC2 4MX3A 3SQOA 2JECA 2YG0A 4OUMA 4XHBA 4WM8A 4Y33A 3OPWA 3RNSA 1XC6A 1HLCA 2BOIA 1YRZA 2BWAA 2OPWA 4UFMA 5FZ1A 4LKDA 3WG3A 3ZDVA 4AEMA 4D7SA 1YXWA 3IDEA 1Q5OA 1Q56A 2JG9C 5FPAA 1PZ9A 5CU1A 2QQIA 3AYEA 3O12A 2CWSA 3GBGA 1R082 1J83A 3HR9A 3KF5A 3CU7A 4M00A 1ZYBA 4Q4W1 4XPVA 2MHFA 5E8AA 5LZ6A 2Q8OA 4TTGA 4XXPA 1W6QA 2LS6A 4YZ1A 1F9KA 3TNPB 4CPBD 4MHRA 4LXLA 2XWBB 1J59A 4E27A 2RM22 4IERA 4CCMA 2D93A 1ODMA 2WINB 5GZDA 1MACA 5DDJ2 3WP4A 1HV1A 3PVOA 3WF4A 3ZKUA 3AZWA 1Y43B 4AEDA 4EN7B 2D7FA 1EYBA 1PGL1 1BK1A 1OLMA 2A70A 3AL6A 3OEAA 4RS5C 1NXMA 3KD4A 5H9PA 4OZXA 4OHWA 5DAXA 4HVQA 1AJOA 3M2MA 4RR3C 1OXCA 2IWGB 4LJHA 4UYBA 2QQJA 3VZKA 3S5AA 3SH4A 1RB8G 5CEHA 1ENXA 5FZ7A 3V65A 2BV4A 1ND2A 4NHYA 3PIJA 4TLFA 2VZRA 3GCWA 2DUOA 1H8VA 4P02B 1HRV1 1NX9A 4KGGA 3TRSB 4CEWC 2YPDA 1H4HA 4NIIA 2WAAA 1SHWB 2W0XA 5IVYA 2LRPA 3QH7A 2W91A 2WT0A 1SBFA 3HAGA 4MO3M 1VAKA 2JDUA 2D43A 2IXCA 3OGGA 1OKQA 5JSPA 3PVEA 3N9QA 3ZIWA 5HCHA 2WKKA 2HWB3 2WZ8A 4A42A 4A6SA 5IAXA 5KXBA 1CD3G 1GZWA 1V6LA 1FOD1 1KFXL 2B7YA 3CHXA 4LULA 4RN5A 4BB3A 4QX7A 2W1QA 1Z0HA 3B5LB 2Q1ZB 5IVBA 3NNLA 4OUSA 2A71A 2BP6A 3A21A 4UW3A 1E5HA 2O14A 3WDVA 3VD9A 1WZXA 1RUD2 2WQ8A 1EPWA 1RMU3 3AP4A 4K20A 4YW4A 5FO9B 4UWDA 4Q0QA 2VMIA 1B35A 3VBFC 1BKZA 3R4SA 1OVPA 1CX1A 2V5YA 3ILNA 5FWEA 2VECA 1W3XA 3C3VA 4RQPA 4JGYC 3S7EA 5B4NA 4LQRA 4O9GA 3S57A 2GC0A 4UXAA 5JZGA 5LRSA 2GDFA 2YROA 2DUQA 4LUKA 1ZRIA 1NLQA 4XFAA 4JKKA 4YM0A 5GZEA 3VZMA 2J1EA 1YYNA 4LHSA 4S2FA 4COZA 2NP0A 1LCLA 1KRIA 5L73A 2YDEA 4RS5A 4LA3A 4LBQA 1FAYA 4HK8A 1RXFA 5K8SA 4ZPIA 3EXUA 4QU1A 4FPOB 3HIFA 1QF3A 3U07A 1PIV2 4AVSA 3T2PA 1OH3A 3UGGA 1A8MA 2C26A 4AAXA 3UJQA 4KBBA 1RUI1 4AVTA 1GYKA 1PM7A 3DPRA 5FO7B 1HB1A 5KXCA 3MPBA 1VMHA 4CDUA 4N90A 1CR7A 1TNFA 1YI7A 2WZR2 3IB3A 3KLSA 1LU2A 5FZCA 2K2SA 1DF0A 2UWAA 4JDNA 1O5UA 4JX0A 3U4XA 3BI3A 5J98B 5GJ6A 5IATA 2CGNA 1BVP1 1PGSA 1UXXX 3U14A 4AHXA 3NNJA 4PI2A 5JXIA 3B93A 1UZWA 1O6UA 3D0JA 4M4PA 4UBHA 4YG3A 5I0TA 5AC93 1XYPA 1GQPA 3BPSA 2NMOA 1EV11 1NG0A 1S0FA 1WLWA 2RMU2 2WNVB 2A6ZA 3K75B 3MV01 4JTNA 4KQ7A 2VUJA 3MICA 4S2HA 1N1VA 3I3QA 5DG1A 3VBRA 4BOWA 5JOYA 4DXSA 5BNPC 4MGSA 5C8CC 3IWZA 4AOCA 1FMD1 5AFEA 5FUNA 4LITA 1W6QB 4LK7A 1RUOA 3I2DA 1COV3 2QE3A 3H50A 4PCRA 4PLNA 1IS5A 3GNEA 3ZXFA 4OQ9A 4DRVA 4EWEA 2QQUA 2W68A 2B9VA 3B9IA 1WMEA 1AR71 5F3GA 4QHOA 4CDXA 1SPPA 4HN0A 3FX3A 2VY0A 1OH4A 2W9XA 5A1AA 1AYN1 1G9DA 3DXTA 3JB8A 3WW4A 1UY2A 4I01A 4F7ZA 4XJ9A 1T6GC 5H9SA 4O65A 2DWRA 1N3QA 1OF3A 2R063 1W8HA 1H8TC 1AZDA 4QU2A 5A3MA 1HW5A 4YVWA 3VDBA 2NZ9A 4QX1A 5KHJA 4XCAA 4YZ4A 5F1RA 3OCPA 5BUVA 2JICA 4YW1A 1UOJA 1OT5A 1ZRDA 5FXVA 3NV2A 4BLJA 4NWVA 2R32A 5JXJA 1HDKA 4CDQA 4ZS2A 4COWA 1OA3A 3ILFA 3S6PA 4WVMA 2D44A 4Z07A 2G9ZA 4CXXA 3HNBM 4MGYE 1LU1A 2RE9A 3PUQA 5FY0A 4WM7A 3O1OA 4N9IA 5F7UA 3I2JA 2GAUA 1A8DA 1DHKB 1LENA 1K5MA 1SLTA 1S0GA 2IXKA 2WDBA 4ONUA 4QDRA 4AQ2A 1WCDJ 5GZCA 1XQNA 5C4WC 1SLAA 2UYBA 3RJ2X 2OQ6A 3K48A 4KI5M 4UFJA 2ZEYA 1OPOA 3HN3A 2O8QA 5F2WA 3WNXA 4YW5A 1H2KA 5FQ0B 2HEWF 4FPJA 3ZMNA 1AX1A 4AVVA 1XNCA 2WYSA 4ORFA 1AVBA 3CF6E 3SMHA 2BOJA 1MS0A 2WT2A 2VCBA 3LSDA 4RGGA 3AZYA 4AFAA 1G6NA 1NQDA 2BYVE 2GP3A 4Q1RA 3W59A 3OOXA 1QXRA 2Q0AA 2UY8A 5FZFA 4A41A 1QEXA 5FZ9A 4NROA 2D6OX 2VXRA 1RUH1 1L7RA 4XUPA 4D0QA 3N7JA 1W03A 4IW3A 4QM8A 1JBCA 4R52A 4A45A 1VBE3 2CHHA 3POBA 1DQ0A 4D8MA 2WQZC 4Y1VA 1HRI3 1H8TB 5C6CA 1CZSA 1FV3A 1HX6A 2PMWB 1ULOA 5J96B 1LRHA 4GMP3 1EUUA 3ZLIA 1RGSA 3PU8A 3OBRA 2VMCA 2YYOA 1NOVA 3UNPA 2BNOA 1KFUL 1W6MB 4YVSA 2WFF3 2IUWA 3ZN6A 1AJKA 2Q5TA 1WLDA 1POQA 4JGZC 4W65A 2P17A 2WNOA 4YW7A 1MQTA 1LOEA 4M4RA 3HQUA 4UFHA 5FMOS 3JD72 5FIXA 5L9BA 2DDUA 3VKFC 4NPRA 3ES1A 3IDCB 4XF9A 4MV2A 1W04A 1YQ2A 4HKLA 3DECA 4WV8A 1V9U1 3ZM8A 4AF9A 1JYVA 3VBSC 2ORXA 2VG9A 4WVZA 3U4SA 4AVCA 4NHLA 2R16A 1BBT2 4GULA 4Y4YA 3H3ZA 1Q8PA 1UZVA 3W58A 4A7ZA 2A75A 4M3CA 5BNOA 2HWE2 2VZTA 2DCJA 2VMFA 5FYCA 3R6SA 2XJRA 5HXVA 1J3QA 1QQP2 2VZUA 4QPIA 5M0TA 5CFCC 2QQKA 5FZOB 2GMEA 2XVLA 4COVA 4ZU5A 3FHIB 3NKGA 1GWMA 4AEJA 3CEWA 3KF3A 3AXEA 5EZWA 2W2IA 3AC0A 3CDZB 1UW8A 3JU9A 4ITCA 3WT3A 3SHRA 1VBC3 2WC2A 5FYMA 4TSVA 4UW6A 4YZ3A 3TNQA 1AL0G 3WX5A 3MFAA 1GBGA 1LGNA 3ZFFA 1S2BA 3RYRA 1CAUA 2VCAA 5AFBA 1NCRC 1VALA 3W5MA 4W4ZA 2X5IA 1VBB3 3W9AA 1YC61 2ZXQA 3MF9A 2WWSA 5F39A 4A3ZA 5FKBA 4K21A 4NHMA 3VBOA 1QWRA 2ETEA 5JIAA 1JI6A 2ZX0A 4OCTA 1VBE2 3CJIB 5KWRA 3J7HA 4WZCA 5LBFA 2OVUA 4PLOA 1LGBA 3ZFGA 1EP0A 2QQWA 1D7PM 3IDAA 4KNCA 1FI2A 1NE6A 3M4FA 4D94A 3ZXKA 4FCAA 3WP5A 3FHQA 2P5BA 2Y6JA 3N7LA 2PA7A 2VBPA 3MW2A 1ENQA 5BNOC 5F3EA 4O7XA 3WINE 1RUJ3 2WZEA 3MV11 2P6HA 3V0AA 3VBSA 1Y9MA 2QDRA 4AGRA 2WWUA 4AFBA 3T2OA 2JG8A 3C7EA 4Q4Y2 4CCJA 4C0BA 2VGDA 2FDFA 1QY4A 2HKXA 5DMYA 1U5ZA 4F8AA 1PVC1 2XMLA 3N9LA 4IE0A 2ZOEB 2ZPXA 4JGZA 4R9CA 2WQ4A 1XNTA 4YM3A 1ZZCA 4AHZA 4PF5A 1NYWA 1QJY1 2J1RA 2QVSB 1FX5A 1EPZA 2A3WA 4XFFA 3WUDA 5EFUA 3K2OA 1Y4WA 4MGTA 2VNVA 2A6WA 4XETA 3ABZA 1PO21 1WA4A 4GALA 3VHPA 3WF2A 3OEBA 1DZTA 3Q8AA 4XHXA 5D2AA 2BTVC 5L7OA 1DGRA 3JUUA 3PDQA 1W9TA 4XXAA 2WZPP 1GZTA 4HN1A 4E2QA 1VRH2 1DU3D 3MPPG 4QX5A 1PX4A 2BNMA 5FZ6A 4Z1VA 1RIRA 4E8DA 4WM7B 4LBQB 5DUVA 1ST8A 2RDQA 1AYN2 5A80A 3J7LA 2WNEA 5FZ0A 4K40A 3VHRA 2VR4A 2BVVA 4FI9A 1D0HA 2Y34A 3CBNA 4PDWB 1N1SA 3NNMA 1RUG3 3ALQA 4PI0A 4YGBA 5D1IA 4GQ7A 2OYZA 3RYPA 1Y3TA 4V2VA 3I2KA 3KGLA 4K6BA 2FMYA 1UIKA 4QDQA 4Q0VA 2PHDA 1N3OA 3MBWA 1AF9A 2HYXA 4IV3C 4LLOA 5D8AB 2BRTA 4CA9A 3RZKA 1PGW2 1RUJ1 3P5BA 1YQ6A 1FMD2 2DVGA 4GKXA 1W8WA 1WW6A 5C70A 3FLPA 4XURA 5IFPA 5FZOA 2A7AA 3MGUA 1FPN2 3KM5A 4NPMA 5A33B 2RS13 1XU1A 2VOVA 4Q1PA 5KXDA 1MZ5A 3VBRB 4EN8B 3CZJA 3UKTA 3T09A 1LULA 1JYIA 1UMIA 3I4IA 3J7NA 3WQ0A 4JKLA 5FXZA 3WV6A 2ZA9A 1UY1A 1W0PA 4GB32 5CAZA 1JXNA 1YO8A 4AGGA 1COV2 2ET7A 1W05A 3B94A 3B7MA 3T08A 5FYIA 3USUB 2GP5A 3QD6A 3OPZA 4LKEA 3OPTA 1RUI2 2HWE3 4IGPA 3WDUA 2GNDA 1UCXA 1DBNA 4Y5Z0 5A7WB 2FZ1A 5FP9A 2JDKA 5FPVA 1LAJA 3CJIA 1OLME 2YBSA 4RD7A 2P6CA 2YGLA 4Q26A 2ZGPA 3QACA 1O3QA 2LM3A 3VD3A 2Z2SB 3O0XA 3OUHA 1SFNA 4I09A 3KV9A 3ZYBA 4CP1A 5CFCB 4YVWB 1SCSA 1FPN3 2FCUA 4BMEA 4FOWA 3LPGA 3POEA 2JIJA 1BBT3 1ALYA 4L92A 3GCXA 3DGTA 3HQXA 5LK5A 4ARYA 3VBSB 4FQ4A 4ZXEA 1HXS1 4CCKA 1UU4A 1AR62 3O5SA 3RGBA 5J37A 1PM4A 4CDQB 2CWMA 4QQ2A 3WNMA 5FO8B 1QIQA 4DINB 3VDCA 5A7NA 2VUCA 1HRI2 2Q1MA 2A1XA 4NWWA 2RJ2A 3ZOIA 3N4MA 2JJ6A 3ZFFB 5E1RA 2J1SA 1BXHA 2KA3A 4QGNA 4EWDA 1EAH2 3W21A 4JV4A 2FD8A 2PAEA 3HNYM 4V1PA 5LK7B 3JB4C 5FOBB 1YUDA 2VTFA 3O1UA 2WSUA 1S0IA 3OY8A 3MW4A 4MUVA 2RHPA 2RR12 4J25A 4LBJA 2NN8A 2RM23 1A3KA 4FVVA 1ULCA 1F2NA 3HNMA 3I97A 3IDBB 3GZEA 5EPAA 1HRI1 2IXHA 3LKJA 3K51A 3UKNA 4Q4Y3 4XJAA 3VB9A 3X29B 4BK5A 1NCQC 2YHJA 2ZX3A 3CMGA 5IK8A 1PO13 2DVBA 4PHZA 5FYSA 3FMGA 3T4HB 1F4AA 2PLV1 5LRRA 1VB2A 3NAPB 3Q8FA 1OSGA 4NIAA 1OFSA 2RJLA 5B2GB 4KG0A 1FPN1 3BIWE 3D3AA 2ZGNA 1PGL2 3FUQA 3WCSA 1SQ4A 2WIIB 3OB8A 2WN3A 1UYPA 4JGYA 2VO5A 4OI2A 4RQPC 4QPGB 5FLJA 4P9JA 5C3QA 2Y64A 5FXWA 3LOBA 4QXHA 4IEWA 4P9GA 1POV0 2NPIA 1GFF2 2YGMA 4YGDA 5FPZA 3VN4A 1DQ1A 1Z78A 4MADA 1O4TA 3ZN6B 4BQWA 1UL9A 3UK9A 5EJ1B 2HYKA 1W8UA 2ZABA 5FZ8A 4BK4A 3AKSA 5E6HA 3OYWA 2OUJA 4JCKA 4Q4W2 1Z7S2 4BYYA 4LBKA 4ZS3A 2VJXA 5IAVA 4BISA 2XJQA 2V09A 4AI3A 2XLGA 1GWLA 2W52A 3LEIA 4MVTA 2XLAA 5GLWA 1R092 5LEJA 5FRAA 1RVF2 4K1ZA 5LB6A 3AYAA 1KGYA 1OBNA 5JMCA 4IGQA 1ACCA 5B4XA 1I3HA 2XGXA 4AK3A 2BGCA 5GZGA 2JD4A 5A32A 5KHKA 2LALA 3JBG3 1YJKA 5GLZA 1PK6C 3H7JA 2V4VA 3AZVA 1LOFC 4LOSA 4HFSA 2C6SA 2VW1A 3NV1A 1BEV2 1MEC2 4XVHA 4CEYA 4BXFA 3D5OA 2LROA 1V70A 3DCQA 3WF3A 1JOJA 4UT5A 2ZTNA 1JTZX 4RR3A 4OMDA 1G9CA 3WNPA 4AI9A 1VR3A 1H1IA 1Q8QA 1AL21 1Y7BA 2KXLA 2B42B 5IJRA 2J1TA 5A7WA 1CAWA 1C5HA 2ZX1A 2JG8C 3FUOA 3Q8CA 1F4HA 2WNVC 3UGHA 2YFUA 1UO9A 1W8NA 1UXZA 4XTMA 3IAQA 1C8M3 1NY71 4AE2A 1AUYA 4QT6A 1QXJA 3PL0A 5KC5A 1Y9GA 3LDRA 2GNBA 4DRRA 5JPMB 3ZXGA 1I1EA 2QBXA 5ACA2 3BUCA 1JZ5A 1R1A1 3GM8A 1UWWA 1KS5A 1CONA 2YY1A 5KHGA 1CZVA 1E57A 5I91A 4XQDA 3ZX7A 3WXPA 4YPJA 4DUVA 2WFF2 2VVDA 3GBFA 3NL1A 4FPHA 4XTPA 3OBZA 1C3HA 1IGOA 1OD5A 1L3JA 1U5YA 2D98A 4P5YA 3VBUB 3ZO0B 4B29A 2Q8DA 4AEDB 2Y6KA 5BY5A 5K7PA 1SBEA 2QTWB 4Q8LA 1PZ7A 3K4DA 4AWDA 1O3TA 3N9OA 4OHYA 2JXAA 2E9QA 3I7DA 1HRV3 2K0GA 2ZMKA 4IE7A 4L2NA 1OMIA 4ARXA 1YFUA 3J8F3 1W2UA 3K46A 5A3NA 1DYOA 1H30A 4NRQA 1YQCA 5DPNA 2V73A 3FN9A 4P9IA 4MXVA 1QJX2 1HQNA 4FQZA 3BKZA 1VBA2 3ELNA 1J58A 3B00A 1O8PA 1VLNA 4FAHA 1AYM1 1ZZ8A 4Q4X1 1A34A 4META 4IE6A 2CL2A 4BDVB 4WZFA 1JYWA 2FDHA 2XXZA 3ITQA 2VOXA 3VHOA 2D5FA 1NE4A 1AR82 3SH3A 1RHI1 4QKBA 1XRUA 1Q8VA 4LMFA 3WQ7A 2ZKNA 1LKNA 4YZ5A 5K9YA 3O1VA 1LHVA 2VOTA 3NVCA 3TN93 1WA6X 3NV4A 4B4PA 5C3RA 4GMP0 1RXGA 4KWLA 1ZZBA 2A5ZA 2AYHA 1ULEA 4MLOA 4XE9A 4Z92B 2B46X 3AMNA 3ZYHA 3C2UA 4CE8A 4LBMA 2WN2A 2Y26A 2VQ0A 2ZKLA 1RMU1 4AI2A 1IG3A 2Y60A 3D4KA 2AEZA 2MEV2 1S0DA 3OYWB 5KHIA 2WO2A 1BQPA 3ETPA 1SLCA 3PJYA 2W1WA 3MIBA 2XKOA 3VD4A 2QQNA 2R7EB 3MUZ1 5D21A 3WF0A 4XMAA 1SACA 2AACA 2FDGA 1VBD3 4LUMA 5C3SA 1CPMA 1SDWA 2JENA 4QPGC 1W0OA 1N1YA 1S0EA 5FZGA 4BE3A 5FMCA 4MH0E 5FKCA 4S2GA 3ZIXA 5IT6A 2QJVA 1YFWA 2ZZQA 3MLJA 4E4DX 4COYA 5JI9A 5JZGB 2YMZA 2ZJCA 1C4RA 3KVAA 1BYHA 4OI4A 1GOGA 3HT2A 5IHRA 3GF6A 4NR1A 1W9FA 2FQPA 4EZ4A 3FBYA 4XF3A 3BYWA 1CPNA 3LB9A 4LO8A 3JBG1 4RL7A 4URAA 2Y33A 2VW2A 2PHUA 3G7DA 1AX2A 3I59A 3POWA 3GYDA 2DBNA 1OQEA 3ENRA 4AQTA 1RUH2 3IIIA 5C5UA 2NMNA 5I8SA 1CVNA 3LA7A 4BQ4A 2JG9B 3QH6A 5CYYA 1QJX3 1BBT1 1RITA 1C28A 4NMIA 4SLIA 3WG1A 3PJQA 3ZXAC 5C4WA 1OF4A 1GZCA 3ETQA 5FXXA 1EAH3 4FOYA 3WDYA 1GU3A 1MS9A 4OI0A 5CFDC 1TME3 2VNGA 2HWF2 4CPBA 2IXJA 4PIYA 1ND3B 2PHLA 3IMMA 1RUC3 2C1FA 1ND2B 1GOFA 4XBQA 1ASJ2 1RUF2 4CDQC 5IFTA 3U75A 3LGRA 2WNVA 4BMBA 4FPEA 4AL9A 3USSA 3PTYA 5FYUA 1UY4A 1ZA4A 1TMF2 1G9BA 1FATA 3I8TA 2GMPA 3POJA 5FYYA 3W5NA 4N43B 4GA9A 1LNSA 2SLIA 4N8MA 2ADEA 2QQOA 4HZFA 2DTWA 1LOAA 3ACHA 1MR5A 4JZRA 4YM1A 4YVWC 3SH5A 5EHDA 4B7EA 4CCLA 4D69A 4E4HA 2CNAA 2Z5WA 3CNAA 5FBZA 1W39A 5FZMA 5DAVA 4R9BA 5CKMA 4OUEA 1MS1A 3C7FA 5KHHA 1DP0A 1BEV3 1RJ7A 3A23A 4Y22A 3AVRA 1IZ3A 5FPLA 1VE0A 3NJYA 3LQCA 4LIVA 2C4XA 2PHTA 5BV6A 2OS2A 4CCNA 1LR5A 3KT4A 3V56A 5A6QA 3AP6A 2R0FA 1K3IA 4Y20A 2DF7A 1DGWA 4N43C 3AFGA 2B8MA 4K1YA 1TMF3 4LO6B 4GXLA 2WS92 5GM0A 4ISRA 2Y38A 3F2ZA 3PHMA 2XVGA 1HKDA 2BEOA 2X29A 2H0BA 5FV3A 5JR7B 1OLRA 1X8EA 3C7HA 2VOWA 5I8TA 1AHSA 4PBPA 3H7YA 1AR72 4WVMB 3RI9A 5ACA3 3A22A 2YBPA 5APAA 3WDWA 3VBRC 2J22A 4P9YA 3BIEA 5CFDB 4RHV2 1UPSA 3H1YA 3K4ZA 3L2HA 4HVRA 1IKQA 1RUNA 4C1XA 2WUHA 3POSA 4QX3A 4B7KA 2VULA 1J1LA 4KMQA 2W1SA 4IUGA 2VMDA 1W6PA 4WM7C 4Q8KA 4IEZA 4TWTA 1EV12 1LESA 3VD5A 3WW2A 2E32A 2YU1A 2W92A 3AP5A 4LKFA 4CCCA 1ASJ3 3I3BA 4K3UA 1S55A 2C24A 2CYFA 3RWNA 3RG0A 3CL1A 1BHGA 3MZHA 1IS3A 4XJUA 4HBNA 4QQLA 3UKVA 4C0HA 4DFSA 1WMXA 2ZHLA 3ZYFA 1ZREA 4PDWC 3SITA 4CUGA 1JZ8A 5T5OA 4HPKA 4A4AA 2XUEA 4XAAA 4FFFA 3RS6A 1F8VA 4GH4A 2Q4SA
chains in the Genus database with same CATH topology
1W3XA 1W2AX 1W2OA 2BJSA 1OC1A 1W06A 2DBIA 2VAUA 4RGKA 1ODMA 1UOFA 2Y60A 2VBDA 3ZKUA 3ON7A 1UOBA 1QJEA 1W3VA 1QIQA 2VBBA 1GP5A 3ZKYA 1UOGA 1BLZA 3OOXA 2DBNA 1HB3A 2Y6FA 2WO7A 1UZWA 3ZOIA 2JB8A 1W28A 1ODNA 2IVJA 1E5RA 1HJFA 1HB4A 1UO9A 1RXFA 2VE1A 4BB3A 1DCSA 5C3SA 1W03A 2IVIB 2JB4A 1W04A 1OBNA 1HB2A 2CSGA 2VBPA 4XAEA 1WA6X 5C3RA 1E5HA 1UNBA 5C3QA 1HJGA 1RXGA 2BU9A 1W2NA 5C3PA 1E5IA 1BK0A 1W9YA 5APAA 5C3OA 1E5SA 1QJFA 1W05A 2VCMA 2BRTA 1HB1A 1IPSA 1GP4A 1GP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3X A;  1W2A X;  1W2O A;  2BJS A;  1OC1 A;  1W06 A;  2DBI A;  2VAU A;  4RGK A;  1ODM A;  1UOF A;  2Y60 A;  2VBD A;  3ZKU A;  3ON7 A;  1UOB A;  1QJE A;  1W3V A;  1QIQ A;  2VBB A;  1GP5 A;  3ZKY A;  1UOG A;  1BLZ A;  3OOX A;  2DBN A;  1HB3 A;  2Y6F A;  2WO7 A;  1UZW A;  3ZOI A;  2JB8 A;  1W28 A;  1ODN A;  2IVJ A;  1E5R A;  1HJF A;  1HB4 A;  1UO9 A;  1RXF A;  2VE1 A;  4BB3 A;  1DCS A;  5C3S A;  1W03 A;  2IVI B;  2JB4 A;  1W04 A;  1OBN A;  1HB2 A;  2CSG A;  2VBP A;  4XAE A;  1WA6 X;  5C3R A;  1E5H A;  1UNB A;  5C3Q A;  1HJG A;  1RXG A;  2BU9 A;  1W2N A;  5C3P A;  1E5I A;  1BK0 A;  1W9Y A;  5APA A;  5C3O A;  1E5S A;  1QJF A;  1W05 A;  2VCM A;  2BRT A;  1HB1 A;  1IPS A;  1GP4 A;  1GP6 A; 
#chains in the Genus database with same CATH topology
 2XQR A;  2IXL A;  5J7M A;  1H8T A;  1R09 3;  2AH2 A;  3IMN A;  4LK6 A;  2EIC A;  1MZE A;  4AAP A;  2VBD A;  4HSL A;  3ILR A;  4XBN A;  2EAA A;  3KT7 A;  2VUA A;  5FBJ A;  3AMH A;  4XZU G;  4IEO A;  1PZ8 A;  1X8M A;  4KG8 A;  2JE7 A;  5HBA A;  4LE4 A;  1XE0 A;  2VE1 A;  1TMF 1;  4RYD A;  5A7Q A;  4K7J A;  5T50 A;  1LHO A;  1ZX5 A;  1RJ8 A;  1YJL A;  1IPK A;  3PTR B;  5I0U A;  1ZBA 1;  4DXZ A;  3LFM A;  1OKO A;  1EV1 3;  1YWK A;  1LTE A;  3E1F 1;  2D40 A;  2PN5 A;  3LEM A;  1E5I A;  1WD3 A;  5C3O A;  5JCT A;  1AXY A;  3SLI A;  4HG6 B;  5F8P A;  3EYP A;  5BNP A;  1AXK A;  2DBI A;  2PLV 2;  3VKN A;  3PIG A;  3OGS A;  4FFG A;  2YU2 A;  1H1A A;  3AKR A;  1YLL A;  3R0R A;  1C5I A;  1TZO A;  2ARA A;  2XDV A;  3D82 A;  2F4L A;  4NAO A;  5FZD A;  5CVR A;  4IEP A;  3N36 A;  1PO1 2;  1QGL A;  2F4P A;  5CBL A;  3AKT A;  2G1M A;  1QNW A;  4ZZ8 A;  4HLT A;  2TUN A;  1ULP A;  4O61 A;  4UF0 B;  1JZ2 A;  2I74 A;  3THP A;  1BZW A;  4EWA A;  2K9Z A;  3ACF A;  1MVE A;  3GAL A;  3GDB A;  3H8U A;  1FOD 3;  4QX0 A;  5GLT A;  5BNO B;  5F5I A;  4MGI E;  3W20 A;  3NW4 A;  1UNB A;  1PMI A;  1WBF A;  1ZBE 3;  4W6X A;  4OZO A;  5IUQ A;  1H2M A;  2AC1 A;  2JDY A;  2YPJ A;  2UY9 A;  4URT A;  3KVB A;  4GJZ A;  4KU8 A;  4P5H A;  4XCB A;  3U11 A;  2VAU A;  1OC1 A;  4J1W A;  1CAU B;  1J3P A;  1EY2 A;  1K5M B;  1HRV 2;  2FMD A;  4IEX A;  5BNQ A;  1QJY 3;  2WLQ A;  3INA A;  4Y24 A;  1UAI A;  3ATG A;  1W6N A;  5A3W A;  1ZRF A;  4Y20 B;  4AED C;  2ADD A;  1UF2 C;  1ZA7 A;  4B1L A;  5J09 A;  4WM8 B;  3ZSE A;  2X5I B;  2JIG A;  2WNU A;  4NE9 A;  4YM2 A;  2CY6 A;  3RYK A;  1JOD A;  2E53 A;  4LKS A;  4Y5T A;  4DOU A;  4QKD A;  1H6Y A;  4LA2 A;  4DNY A;  1RUD 1;  2RV9 A;  1TQ5 A;  2F17 A;  4ZU7 A;  2F6B A;  1HQW A;  2WWJ A;  3O14 A;  1OUS A;  3B9C A;  5FY7 A;  2CTV A;  3ZSK A;  1XU2 A;  5A3T A;  2BWC A;  4UW5 A;  1O4Z A;  2VQA A;  3SKJ E;  3WHT A;  3FE5 A;  4HKW A;  3VV1 A;  2LW8 A;  3IKW A;  4N7U A;  3OD0 A;  4D6Q A;  1TME 2;  3HEI A;  3BB6 A;  4MGZ E;  3DYP A;  4QM9 A;  1V6O A;  3Q8E A;  3Q9O A;  1K12 A;  2JG8 B;  4XIO A;  2VZP A;  1NZC A;  5A7S A;  5CA6 A;  1CQ9 A;  1U5X A;  3TEW A;  3R4U A;  1F35 A;  3EB7 A;  5CIS A;  4EQV A;  3N7M A;  1H2N A;  3CQO A;  3FLR A;  1WUV A;  3ECQ A;  2P34 A;  3HBK A;  3ZYJ B;  5L7O C;  2B39 A;  3AKQ A;  4FPK A;  4ZHN A;  5FYZ A;  4HPK B;  4LPL A;  3V0B A;  3RZM A;  1UYX A;  4SBV A;  4CCD A;  1W06 A;  2WZR 3;  1RTV A;  4DXR A;  2FDJ A;  1BMV 1;  5BNN C;  3ZSL A;  4TZD A;  1G86 A;  2R04 2;  2OKX A;  1W3V A;  1KEX A;  3LEG A;  1O5L A;  4XUO A;  3AYD A;  4N53 A;  3ZKY A;  2PAM A;  2P3Y A;  2YBK A;  2AEY A;  2H0V A;  4UFL A;  2W08 A;  4QHB A;  4R4Z A;  4UFK A;  1GSL A;  2A6X A;  1ODN A;  1VRB A;  2W1U A;  4JRL A;  3UYJ A;  4IE4 A;  5F5A A;  3U37 A;  4QPI B;  4F3J A;  3BTZ A;  2EAL A;  1GZW B;  3NKT A;  1AXZ A;  3B69 A;  4Q4W 3;  4IEQ A;  3HOB A;  4NRM A;  1ZBE 1;  2C0Z A;  4FFH A;  2QQL A;  2OW4 A;  4I02 A;  1R08 1;  1RC6 A;  1AYM 3;  2OZJ A;  4Q4X 3;  3MIE A;  4UI9 L;  4XF4 A;  5JOZ A;  2J1V A;  4PDW A;  1VJ2 A;  3L2Y A;  5EP9 A;  5K4L A;  1PNF A;  1B35 B;  4JAA A;  4B1M A;  2QFE A;  5FPX A;  3JCI A;  2PQS A;  1A78 A;  4QGM A;  1WBL A;  1OOP C;  1RUE 2;  1H9W A;  2ATF A;  2LTN A;  3ZFG C;  2QNK A;  2WRA A;  1IS4 A;  1W8Z A;  2JG9 A;  5F9T A;  1VRH 1;  3GXU A;  3NAP C;  3UET A;  5CG9 A;  3BN6 A;  3H3L A;  1MS8 A;  3WD5 A;  2XWJ B;  2ZMN A;  2XHK A;  1YEW A;  1LHN A;  3AK0 A;  5LBE A;  3ROU A;  4LOT A;  3SCH A;  4BU2 A;  1AL2 2;  3OG2 A;  5CZK A;  4BZ4 A;  3KB5 A;  4NVP A;  4IEV A;  5A6X A;  3RMY A;  3UV9 A;  3E6B A;  1QXP A;  5FK7 A;  5LY1 A;  2A6V A;  1DDL A;  4YYO A;  3MIF A;  3RZL A;  2G9G A;  4DY5 A;  1AYN 3;  5JUV A;  2AGS A;  2GH8 A;  2VTX J;  1W2O A;  2CV6 A;  2WLP A;  5BPX A;  1PX3 A;  3I2G A;  4CUB A;  4BCU A;  3H9A A;  1CX4 A;  5I0R A;  1XPW A;  3AFK A;  1NKG A;  4M01 A;  3LOI A;  3LEK A;  3ACG A;  4YG0 A;  1Y9Q A;  4N7I A;  3LDB A;  2PHX A;  5E16 A;  1WCU A;  1MS3 A;  5EXO A;  1CES A;  1RUE 1;  4LE3 A;  1HN0 A;  3V0A B;  1AR7 3;  2DU0 A;  4QXC A;  3T2T A;  3KCY A;  5ABJ C;  1HV0 A;  1R09 1;  5LA0 A;  2E7Q A;  4ASL A;  3HT1 A;  4JC1 A;  2W5F A;  4V2W A;  2DCT A;  5ISL A;  3F95 A;  1XB9 A;  1CAX A;  2PTM A;  2WYF A;  3LPF A;  1GOH A;  1V6K A;  1G9A A;  5FUP A;  4ASM B;  2E33 A;  4GIQ A;  2CGO A;  2OA2 A;  2HLE A;  3MI8 A;  3ZN5 A;  4D6S A;  1H0B A;  1M4W A;  1WLT A;  1N47 A;  3DV8 A;  5SV5 A;  2RG4 A;  2H6B A;  1VBC 2;  4CU8 A;  4GH4 C;  5FTT C;  4NIG A;  1Q8O A;  3LF7 A;  1UZY A;  4QHZ A;  1YIF A;  3H0O A;  2O8O A;  1XBF A;  2J42 A;  4KWU A;  2EVX A;  3M3O A;  4UW4 A;  3OBA A;  5IVC A;  5T52 A;  5A6Z A;  3AXD A;  1JHJ A;  5FY9 A;  3FFZ A;  3WCR A;  1BMV 2;  4MZU A;  2P3I A;  1QQP 3;  1HJF A;  3H1W A;  1C8M 2;  3TYJ A;  3IPV A;  2TBV A;  4OI1 A;  1UZZ A;  2HH9 A;  5BYN A;  1STM A;  5FR3 A;  3ZYR A;  4U36 A;  2MNG A;  5I0S A;  4OQ8 A;  1KQR A;  2ZGM A;  4XFB A;  1MPX A;  3APB A;  2DVA A;  5EJZ B;  3J4U H;  2W3J A;  1JZ6 A;  2EXJ A;  2XH6 A;  1UMZ A;  3H3U A;  2RR1 1;  3RRD A;  4AR2 A;  2X10 A;  4C90 A;  2HBU A;  3AJZ A;  1UKR A;  2QKD A;  2ZGT A;  2CGP A;  5EWS A;  4COU A;  1XYN A;  2RS3 1;  2R0H A;  1DGL A;  1TME 1;  5IVE A;  5GAL A;  4BWO A;  3DYM A;  1JZ7 A;  4R9A A;  2VH9 A;  4AI0 A;  1EAH 1;  2ZHK A;  2UWB A;  1VBB 2;  3PME A;  2RS1 2;  2EXI A;  3NNF A;  1V00 A;  4CDW B;  1LOG A;  3ACL A;  3S7I A;  3PUS A;  4CXW A;  1OQ1 A;  3KCC A;  4XFG A;  1OLQ A;  3KMH A;  1L7L A;  3DYO A;  2J1U A;  1PO1 1;  4M0N A;  1S2E A;  3ZVX A;  1V9U 2;  2XON A;  1W2N A;  4ZXK A;  4R4X A;  2HWC 2;  3M3I A;  1GNZ A;  1W0N A;  3M7A A;  5I93 A;  3M1H A;  4IV3 B;  5D8A C;  5FYT A;  4OHV A;  1UY3 A;  1GWK A;  1K5M C;  2ZHN A;  3U1X A;  4E4Z A;  4BA6 A;  5LCW L;  3ME2 A;  3WW3 A;  4Q29 A;  3KV6 A;  1MVQ A;  4NUB A;  4OHX A;  4UAP A;  3BPZ A;  5L9V A;  4EN9 B;  4Z82 A;  2D6K A;  1UX7 A;  4JGY B;  2ZEX A;  3AZZ A;  2JDM A;  4LO5 B;  3ZYG A;  5AC9 1;  1SLB A;  5E89 A;  1RUC 1;  3RMX A;  4DEQ A;  2QUO A;  1PO2 3;  2OUH A;  4P14 A;  2VZ1 A;  1C57 A;  1JN2 P;  1UX6 A;  2IZW A;  4W6Y A;  4AW7 A;  3LFI A;  4CU6 A;  3SEP A;  1S0B A;  1IHM A;  3VUO A;  4BQ3 A;  1OA4 A;  2ZGK A;  1W8F A;  5KR7 A;  2KD7 A;  1VAM A;  3A0K A;  2MEV 3;  1GKB A;  1YNA A;  1GNY A;  3ZXJ A;  1ULF A;  1JOB A;  2OII A;  4Y5S A;  2D3P A;  4F83 A;  4KU7 A;  1W2A X;  5F6K A;  4RGA A;  3LSE A;  1PNG A;  3FJS A;  1PMH X;  1COV 1;  4CU9 A;  2ZAH A;  4YG6 A;  2HWD 2;  5F5C A;  1QOO A;  1W6M A;  1QNY A;  4YVS B;  1D4M 1;  1HN1 A;  3QCW A;  2KR2 A;  5BNN A;  1WW5 A;  1X36 A;  5JMO A;  3KQ4 B;  4FPL A;  1VB4 A;  1OHF A;  1AR8 3;  2XB6 C;  3JZV A;  1RHI 3;  1ZZ9 A;  3AB0 A;  3BOP A;  4Y1Z A;  3WR0 A;  4PQ9 A;  2ARB A;  4Q4V 2;  1CAX B;  2R06 2;  2E26 A;  2ZZJ A;  4I30 A;  4RR3 B;  1GNH A;  4CUC A;  4EN6 B;  1VBD 1;  1W9W A;  4P08 A;  4Y26 A;  4DXT A;  5A1L A;  1PGW 1;  1RUJ 2;  3DKW A;  2VZ3 A;  1F31 A;  1FNY A;  2RDN A;  2R1B A;  5CIR A;  5KBF A;  3IAP A;  2YUE A;  1N1T A;  2UUR A;  2JDP A;  4LLF A;  4PQQ A;  3DN7 A;  4QXK A;  3VKL A;  4BIO A;  1GP5 A;  5EYX A;  1ZM1 A;  1ENR A;  3LA2 A;  4GWI A;  5FZB A;  2Y0I A;  2WS9 1;  4D7Y A;  1JH5 A;  2HWB 1;  3IIA A;  3OJB A;  1HB4 A;  4JQT A;  4MXW A;  3OGJ A;  4A44 A;  2IVI B;  4QDS A;  3N9M A;  4CDU C;  5JSO A;  3ZXL A;  3DPR C;  1KIT A;  2CDO A;  2VZO A;  3LDK A;  3OGV A;  4Q0U A;  4XF0 A;  3TN9 1;  3WUC A;  2WNU C;  1NAE A;  4DUW A;  1LEM A;  1G7Y A;  2R07 1;  2VNO A;  4FXK B;  1IKP A;  1NCR B;  2GU9 A;  5T5L A;  2XL7 A;  4PF1 A;  2JDZ A;  1F5J A;  4JTO A;  4M0H A;  1DLL A;  4LHL A;  3KWV A;  4AI8 A;  1D4M 3;  3M3E A;  4G9S B;  3KZ4 C;  2XJT A;  3I2H A;  2Q8C A;  2BQP A;  3VBH B;  3SCG A;  3FL7 A;  4AFM A;  5CAD A;  1R1A 3;  5CKN A;  4Q0P A;  3BTA A;  2ZX4 A;  5F2S A;  1HB3 A;  4Q5O A;  5CNA A;  1JUI A;  4A7K A;  4YFW A;  2ZCW A;  4Z2A A;  2C5D A;  3HBZ A;  1ENS A;  4N53 C;  5CB7 A;  4RHV 1;  3VL8 A;  2B45 X;  2ARX A;  1NXD 1;  4YLZ A;  2JB4 A;  2EXH A;  1V9U 3;  5SV8 A;  4CEY C;  1GQG A;  4Q4V 1;  1SEF A;  1W8O A;  4XDO A;  1IS6 A;  4EE2 A;  1ZVF A;  1A6C A;  1UYY A;  2B4K A;  3KQR A;  3TB0 A;  1YCI A;  2GZW A;  3IT8 A;  4X8N A;  3ZYP A;  2IFW A;  4XQ4 A;  1O8S A;  2R1D A;  2X8K A;  3NJV A;  2Z79 A;  5LAS A;  1JMU B;  4N53 B;  5A32 B;  4FSJ A;  4W50 A;  2RS5 2;  5C7G A;  2IXI A;  2WSV A;  5JLV A;  2E7A A;  4B4R A;  2XJP A;  4JDO A;  3C8X A;  5IYY A;  1HQL A;  3ZFE A;  3KV5 A;  1CJD A;  4HXC A;  3WG2 A;  4CP9 A;  2XL9 A;  4KWJ A;  1KJR A;  5DXD A;  2W39 A;  2ZGO A;  3D6E A;  4YGE A;  4CDW C;  2QDN A;  3H8O A;  5FY8 A;  2ZGU A;  1VBE 1;  2B9U A;  2ILM A;  1XSR A;  2GSY A;  2BGO A;  3JQX A;  3RPQ A;  4Q2F A;  4MG2 A;  4XFC A;  1DZQ A;  1TVG A;  1ND2 C;  4FP3 A;  4ASK A;  3I3E A;  1KDK A;  1RUC 2;  2I07 B;  2O0O A;  1ND3 C;  3N9P A;  5IK7 A;  3ZN4 A;  4MHU A;  1O3R A;  1MZ6 A;  4IV1 A;  4ZKT B;  5IK5 A;  4H55 A;  5LEK A;  4NRP A;  4XAC A;  4S2D A;  3NST A;  4YNI A;  2R30 A;  5H9R A;  1RUF 1;  2PHR A;  4B3N A;  3RJR A;  5E88 A;  5FOJ B;  5JR2 A;  5DZE A;  3NJX A;  1WWY A;  3RVH A;  4EZH A;  3I59 B;  4CXY A;  1X82 A;  3UGF A;  2I2S A;  2HWF 1;  2PAK A;  2BNN A;  3SCF A;  4BQX A;  3A7Q A;  5FZH A;  2GC2 A;  4ZU4 A;  2XHN A;  3WP3 A;  4NO4 A;  1UKG A;  1J3R A;  1WCK A;  3WNK A;  2C9K A;  4TXW A;  5FP3 A;  1RMU 2;  1AR9 1;  1QJU 3;  1Z7S 3;  2CAU A;  2CDP A;  2GN3 A;  1VIW B;  3ES4 A;  3T30 A;  3SNM A;  2J7M A;  2FDK A;  1IPS A;  4YW3 A;  3C7O A;  4P00 B;  4EV0 A;  3FZ3 A;  4JKM A;  2IC1 A;  5FWJ A;  1X9T A;  1VBB 1;  5K0U A;  5DAP A;  3VDD B;  1T2X A;  3P3P A;  1PK6 A;  4AI1 A;  4C8D A;  3H8X A;  5T5P A;  1SPP B;  1QMJ A;  2RS3 2;  5EJ3 A;  1VMJ A;  1WW4 A;  4U2A A;  1W28 A;  2WT1 A;  5FMO L;  4CP2 A;  2N7G A;  5HCB A;  3WQB A;  4UBG A;  4YW6 A;  4JHZ A;  1AR8 1;  1GUI A;  3QBQ A;  3AVS A;  5DAB A;  1JOP A;  1X50 A;  5EIY B;  4GWJ A;  1ZZ6 A;  4CTE A;  4MXW B;  5C9A B;  5A7O A;  3OSD A;  5IVV A;  4FP2 A;  3G6J B;  5LA9 A;  1GQH A;  4LHK A;  1AYM 2;  4Q4X 2;  3POY A;  2XUM A;  1H1M A;  4XYX A;  4DO0 A;  5A1F A;  1URX A;  2GNT A;  3RSJ A;  2ZS6 B;  4QQO A;  2W46 A;  1BJQ A;  2VL4 A;  4L0P A;  4IES A;  3WSO A;  3USU A;  2VUD A;  3PUH A;  3POG A;  2HJI A;  4N43 A;  1V6J A;  2DFC A;  1JW6 A;  3N35 A;  2ARE A;  1RUE 3;  1VP6 A;  3ZDS A;  3WQ1 A;  4XMI A;  3CIH A;  3VZL A;  5HPO A;  4GAZ A;  2E7T A;  2MEV 1;  1V0A A;  3TEZ A;  2CU5 A;  2EIE A;  5DDJ 1;  4XF1 A;  2RM2 1;  5GKA C;  3WP6 A;  2ZGQ A;  3FBM A;  3L9J T;  3WVJ A;  3A4U A;  3AMP A;  3I3D A;  4CVU A;  2BZD A;  5IK4 A;  1QH6 A;  4P9X A;  1NZI A;  1JYN A;  3HVD A;  4QGL A;  1O4Y A;  3EQE A;  2RS5 1;  2Y8K A;  3QOP A;  3J9S A;  3IN9 A;  4FBF A;  2OPK A;  4YZ2 A;  2WFF 1;  3MO4 A;  3TOJ A;  1JYT A;  3GBW A;  3VBO B;  1K45 A;  1V6M A;  2YC4 A;  3LZZ A;  5L9R A;  4CSW A;  1O7F A;  3I2I A;  3P3N A;  3UT0 A;  3EBR A;  5C8C B;  4BJ0 A;  4J6G A;  2DV9 A;  4XUN A;  4I0W B;  4UFI A;  5GLU A;  1I9R A;  5DDJ 3;  1QJE A;  4ERO A;  5JXH A;  4H7M A;  2FDI A;  1UIJ A;  5LA1 A;  4Z2W A;  1XE8 A;  5HV0 A;  1VBA 1;  1Q3E A;  3VHN A;  1AR9 3;  1QJU 1;  4YAR A;  2VOK A;  4Y1Y A;  5CFD A;  2V4A A;  3MIH A;  5LAT A;  1R08 3;  2HWF 3;  3HPN A;  3VLB B;  4IV3 A;  4BXS V;  3JXS A;  3O1R A;  3O1P A;  2NLR A;  4XUQ A;  1S4C A;  4LO4 B;  2FCT A;  3ZR6 A;  3UES A;  3S0M A;  4Y1U A;  1IG0 A;  4X8P A;  1K5J A;  2R07 2;  1GP6 A;  2VQT A;  4ATE A;  1OD3 A;  5C33 A;  4FTE A;  3CKH A;  3KCX A;  4NHK A;  4E8C A;  3PVB B;  4JQR A;  2Q30 A;  2ZGL A;  5H9Q A;  2BW8 A;  3ZFE C;  3KHB A;  1BLZ A;  2XR4 A;  2AR6 A;  2VXJ A;  2XBO 2;  1DYP A;  2Q1F A;  3MHZ A;  4GH4 B;  4YFZ A;  2DFB A;  2EID A;  5G05 L;  1R1A 2;  3AMM A;  2Z69 A;  1QDO A;  2Q8E A;  1Z7S 1;  2KM2 A;  5C5T A;  4QX2 A;  2WA3 A;  4DS0 A;  1ZBE 2;  2D6P A;  3D8C A;  1E5S A;  4N9H A;  4QPG A;  4Z8B A;  4M3C B;  5FPU A;  5L36 A;  3WLU A;  5FUI A;  4I3P A;  4IET A;  3BOD A;  1VBD 2;  3RFR A;  3NO8 A;  2GH2 A;  1NUK A;  1W8T A;  4RGK A;  1YQ8 A;  3OUJ A;  1SZB A;  2BUK A;  2R06 1;  1RUF 3;  1PK6 B;  4LT5 A;  2EXK A;  4Y22 B;  1YFX A;  5F6L B;  4NPL A;  1H2L A;  5FCC A;  2Z42 A;  1MEC 1;  2DVF A;  3IBM A;  3NWK A;  4QPW A;  1KJL A;  4RQP B;  3TAY A;  3PLQ A;  2AEN A;  2UU8 A;  2XQX A;  1DZR A;  4UF0 A;  4DQA A;  5IW0 A;  1RUG 1;  3H8R A;  3NMB A;  1H4G A;  2PEL A;  4AYU A;  1RVF 1;  1SCR A;  3ZR5 A;  3PUR A;  4OUL A;  4WBB A;  2UWC A;  1JHN A;  4R9D A;  4QQH A;  5FYB A;  1CGP A;  5A33 A;  4MGK E;  1BVV A;  4LBN A;  2OQ7 A;  1GAN A;  5FLI A;  1UD1 A;  2XJS A;  3ST7 A;  4NAM A;  1OPM A;  4FTB A;  3BVC A;  3GHM A;  5FK8 A;  5JOX A;  2R6Q A;  2V5D A;  1DQ2 A;  4DB5 A;  1REE A;  1WMD A;  3ZPY A;  1RIN A;  4NJ4 A;  2E51 A;  2A6Y A;  1VRH 3;  4GWM A;  3H42 B;  4GKY A;  5DG2 A;  2VZV A;  3J8F 2;  2ZEZ A;  2JKX A;  1AR6 1;  1DQ4 A;  1VMF A;  2QQV A;  3FHA A;  2ID4 A;  4KWK A;  4KH9 A;  3ZFF C;  2BGP A;  5I8Y A;  2OZ6 A;  4ZZ5 A;  5FZ4 A;  4QKF A;  5FZE A;  5DQ0 A;  4O9E A;  2AZ5 A;  5JAX A;  4D3W A;  3FLT A;  1X33 A;  3J8F 1;  3WNN A;  1UOB A;  4QWN A;  1AR6 3;  3P1I A;  2EIB A;  1LED A;  4LBO A;  1P8J A;  4LO7 A;  2MPF A;  2WAO A;  1GR3 A;  2VTX A;  3MEP A;  2XLF A;  4HMZ A;  4LIU A;  2HWD 3;  2DYC A;  3WNO A;  5JSR A;  4AHY A;  3VBU A;  2SBA A;  4BQ5 A;  5CFC A;  3UL2 A;  4E2S A;  3ZPO A;  5CG8 A;  4QB6 A;  1W6O A;  3PU3 A;  1XE7 A;  1R1Z A;  3LE0 A;  4RA0 A;  5T54 A;  5FLH A;  2DCK A;  2YB7 A;  1XND A;  5L7O B;  4KL1 A;  5FYV A;  5DUW A;  4L99 A;  4CDX B;  2C9A A;  1ZRC A;  1KD7 A;  4FOQ A;  4OFG A;  3VZO A;  1S0C A;  2PHW A;  4AZZ A;  3M3C A;  2YXS A;  4OHZ A;  4GB3 1;  4JHT A;  1NA1 C;  1WGP A;  3FC0 A;  3WY6 A;  5C8W A;  3WOG A;  1HXS 2;  1C8M 1;  2ENR A;  5GZF A;  1QH7 A;  4LTA A;  3UJO A;  4LEJ A;  4M3C F;  2Y6L A;  3HN1 A;  4CCE A;  1LOF A;  2VVF A;  1ULD A;  2XOM A;  3LIG A;  3J26 N;  2CSG A;  3B3Q E;  2BBA A;  1OQD A;  4B8E A;  4LHN A;  3GJB A;  4C1W A;  1UU5 A;  3E97 A;  3OD4 A;  1ZNP A;  2J1A A;  2VNR A;  3O1T A;  4Y1X A;  2JDN A;  3MLK A;  4PIX A;  1DYK A;  1VBC 1;  2QCS B;  1N3P A;  2WBK A;  4XIL A;  4AQ6 A;  3N9N A;  3I54 A;  4IV1 B;  3ZSM A;  3OF1 A;  1DFQ A;  2E31 A;  2X5I C;  4CU7 A;  4FXG B;  4M3C E;  5EV7 A;  4E2G A;  1C1L A;  2VME A;  5J48 A;  4XBL A;  1DLC A;  3O0W A;  4GMP 1;  3NNG A;  4BQ2 A;  2P37 A;  3DPR B;  1W99 A;  1RUD 3;  4XW3 A;  4JVA A;  3KT1 A;  2P2K A;  4CDU B;  3DF0 A;  3EO6 A;  4IEY A;  1G8W A;  1I5P A;  5FY1 A;  3S5Q A;  4ES8 A;  5HXM A;  4IND A;  1CAV B;  1WCQ A;  1U5I A;  1B09 A;  2D3S A;  2G9F A;  3E5Q A;  4DIQ A;  1O91 A;  3I2O A;  1RUG 2;  1W6N B;  4QB1 A;  3IM0 A;  1NLS A;  2VPV A;  5T5J A;  2ARC A;  2E6V A;  5HCA A;  4AQS A;  1CZT A;  4K8F A;  4XDP A;  5K0U B;  4Q27 A;  3RI8 A;  3ZMO A;  3M8L A;  4QXB A;  4A3X A;  2WNU B;  3BAL A;  1DGR N;  3O0V A;  2PHF A;  4CP0 A;  1L7Q A;  1TNR A;  4RSU A;  4XDQ A;  4C91 A;  1FNZ A;  2JDH A;  4D7T A;  1OVS A;  5DUX A;  3MFC A;  1UPI A;  4HT1 T;  2DUR A;  4X6R B;  2V72 A;  3JD7 3;  1D4V B;  3OBT A;  2YC0 A;  2QZ2 A;  1OA2 A;  1QJU 2;  2LUW A;  1I6X A;  2PLV 3;  2RJK A;  3EHK A;  1MQT C;  3FFQ A;  4QD2 A;  5KXE A;  3S30 A;  3TBD A;  3VZN A;  2NQY A;  3MUY 1;  4XQW A;  4Q4Y 1;  1WCS A;  2JX9 A;  4YVS C;  1LB2 A;  2ET1 A;  4XOG A;  3BTX A;  1UN1 A;  1RUH 3;  1MQT B;  2ZGR A;  3KS7 A;  4AEK A;  5EYY A;  3WHU A;  5ANN A;  3WDT A;  2WL1 A;  2XBO 1;  1IPJ A;  3LCP A;  3PUI A;  4L9B A;  5EQU A;  1RL3 A;  1SG3 A;  3LD8 A;  1ZZ7 A;  1UOG A;  1TE1 B;  2WJS A;  1ZBA 3;  3K4A A;  2D97 A;  1OUX A;  1KXG A;  5A7P A;  2XG3 A;  3E5U A;  3LWC A;  2RR1 3;  4RFT 0;  1YIP A;  5FZA A;  5JOW A;  1S1A A;  4LBQ D;  1O59 A;  1LOB A;  1PO2 2;  1UZ0 A;  1D2S A;  3ORJ A;  4ZY9 A;  4QQP A;  2VCC A;  5HI0 A;  4OLL A;  2R04 1;  1WLC A;  3K3O A;  4FPC A;  4XUT A;  4PLM A;  5C3P A;  2RDS A;  5J1X A;  1YQ5 A;  4HSJ A;  2HEV F;  2JE8 A;  4HON A;  5BXX A;  1JS9 A;  4A7Y A;  3CJI C;  2GNM A;  1D0G A;  3JQW A;  1D2Q A;  1XXN A;  5IVJ A;  3IPV B;  4PT6 A;  5FY5 A;  2HWC 3;  2VBB A;  2TNF A;  3KV4 A;  4JRA A;  2EF6 A;  4DY3 A;  4QPY A;  4FPY A;  3U0Z A;  1BCX A;  5FP4 A;  1GMM A;  3VDA A;  1QHD A;  2AUY A;  3T0D A;  1DIW A;  3LA3 A;  4HAN A;  3SKV A;  5K0U C;  2RMU 3;  2FHR A;  5LBC A;  2YC2 A;  3GHN A;  1NCQ A;  4FFI A;  1LHU A;  1U0A A;  1WMF A;  1HB2 A;  5FJK A;  1YI9 A;  1YFY A;  5FQ0 A;  3PMS A;  4RFR B;  2VD7 A;  1GV9 A;  3NV3 A;  3ASI A;  2VCM A;  2HWE 1;  1Q8S A;  4KBZ A;  3THD A;  1C1F A;  4TYS A;  4AVB A;  5FZ3 A;  5AVA A;  2ES3 A;  4CRQ A;  1EUT A;  1HXS 3;  2EA7 A;  3ON7 A;  3GZA A;  1TG7 A;  4MOA A;  4XJW A;  3MW3 A;  3CO2 A;  5JI7 A;  1RUI 3;  3HWJ A;  3WF1 A;  3LAG A;  1NA1 B;  4IV1 C;  1IQA A;  3BU7 A;  4GZ9 A;  2VZQ A;  4XJ8 A;  1SFY A;  2R04 3;  1CIW A;  2VZS A;  2YFZ A;  5DAW A;  1F15 A;  2EAK A;  2RVA A;  3JD7 1;  5LW9 A;  3URF A;  4NHX A;  5DZF A;  5T55 A;  1FMD 3;  1QOT A;  2WA4 A;  3RZZ A;  3VD7 A;  4BQ1 A;  4CDX C;  3O1M A;  4I0B A;  3GJA A;  2WFP A;  3N3H A;  4X6Q B;  5FAX A;  1I5Z A;  4CDW A;  4FO9 A;  2ZGS A;  5FRE A;  3POI A;  3RZJ A;  2Z4F A;  4ISQ A;  3CJX A;  2BJS A;  4FAG A;  3I49 A;  4JGZ B;  4Y3O A;  3U10 A;  4L97 A;  2ZAC A;  2XPJ A;  1RED A;  3E6C C;  1RYY A;  4DEV A;  1NQJ A;  1LGC A;  2WO7 A;  1QQP 1;  2A3Y A;  4ET7 A;  3RQ0 A;  5JDB A;  1LOD A;  2OT7 A;  4XJZ A;  2VU9 A;  2JDA A;  2NM1 A;  3E6D A;  5I0D A;  5L19 A;  4HVO A;  1AR9 2;  2XKP A;  1W9S A;  2FCV A;  4IEU A;  4CUA A;  5FZK A;  4YRD A;  4CZS A;  5DUU A;  3HJR A;  2I45 A;  1UU6 A;  4BQY A;  4I3G A;  1R64 A;  2UYA A;  4P9L A;  1J84 A;  5FJH A;  3CLP A;  2Y0O A;  2G4I A;  2X53 S;  4XZP A;  4GJY A;  1QU0 A;  3DL3 A;  2D6N A;  1ZRR A;  1UOF A;  5HV4 A;  2ZHM A;  4DMI A;  4XFI A;  5GLV A;  2BPA 2;  5LWB A;  1G9F A;  1ZBA 2;  1H9P A;  3GZU C;  2W47 A;  2WO3 A;  1K42 A;  4Q4V 3;  4L11 A;  2JWP A;  2YV8 A;  3OTF A;  5ABJ B;  1QJX 1;  5C4W B;  5A70 A;  2A73 B;  3RZG A;  4IGO A;  1XOY A;  2X09 A;  2GAL A;  3GGL A;  4AFD A;  2BFU L;  5J36 A;  3K3N A;  5CKQ A;  1ND3 A;  3AP9 A;  1VPH A;  2PFW A;  3ZFG B;  4XAB A;  4IL7 A;  5JZG C;  3NRU A;  3O1S A;  1C8N A;  3DEM A;  3BU0 A;  5G04 L;  2G19 A;  1YHF A;  3AYC A;  4J1X A;  1B35 C;  4W8J A;  3OUI A;  4FOV A;  2XJU A;  3TN9 2;  4CCO A;  1US2 A;  5IWF A;  1XJA A;  2BER A;  1OUR A;  2BDR A;  1T6B X;  1MS5 A;  2ZEW A;  2D3R A;  1W6O B;  2JB8 A;  4IE5 A;  4KGQ A;  4OVE A;  2HWB 2;  3T1M A;  2VC9 A;  1W6P B;  2JEM A;  2O1Q A;  4WVV A;  4K8R B;  2W94 A;  3WNL A;  4IDZ A;  4B4Q A;  2WS9 3;  1CIY A;  1NCR A;  3WEZ A;  5ANQ A;  1OOP B;  2W87 A;  3R05 A;  2GC1 A;  3K77 A;  1JZ4 A;  3PUA A;  3ZSJ A;  4RHV 3;  1MS4 A;  3EMR A;  3T0B A;  1NY7 2;  3POF A;  4TLG A;  5F5Q A;  3ZXD A;  4ZON A;  3TWI A;  2D5H A;  3C7G A;  4AVA A;  3TEX A;  5JXG A;  4D6R A;  3DKQ A;  1U12 A;  1MZF A;  1LOC A;  1J1T A;  4FT8 A;  4CEW A;  1SFP A;  3AKP A;  3B01 A;  3AM2 A;  1QJZ A;  4YSF A;  4QPI C;  1NT0 A;  1PVX A;  3ZXE A;  1NA1 A;  2IFR A;  5FY4 A;  3V64 A;  5T3N A;  1US3 A;  3BOW A;  3AJY A;  3THT A;  4GWN A;  3O7O A;  5F37 A;  4A6O A;  2X05 A;  1TEI A;  3N7K A;  1UMH A;  1HJG A;  2HWD 1;  4ATF A;  1KDM A;  5BNN B;  3A0N A;  1F5F A;  4FTS A;  4E9K A;  1JYC A;  2VVE A;  2WZR 1;  3NQH A;  4UOJ A;  5KC6 A;  4BIF A;  5A3P A;  3QLQ A;  3KGZ A;  4QKN A;  5FDB A;  4FPF A;  3V0B B;  5JIU A;  4BLI A;  3HMY A;  4MSV A;  5JWP A;  3ZFE B;  2OXB A;  1HIX A;  1W90 A;  4FPG A;  4CP9 B;  5A6Y A;  3TEY A;  3AZX A;  4NOT A;  5BNP B;  1NLR A;  2YZ4 A;  1PIV 1;  3D0S A;  3IZO A;  4MYE A;  3VBU C;  2FZ2 A;  2DVD A;  1CAV A;  2BVB A;  2Y6F A;  2E63 A;  4IXL A;  5FP8 A;  5A3O A;  1KS4 A;  1UQX A;  4TN7 A;  1UYZ A;  5FFO C;  5FYH A;  3B02 A;  5AC9 2;  5LBB A;  2BBV A;  1XSQ A;  3PVN A;  4WM8 C;  1W2T A;  4HL0 A;  3KSC A;  4QX8 A;  1OFN A;  2VM9 A;  4Y4R A;  5D8A A;  2A3X A;  3VBO C;  2ZAA A;  1OI6 A;  1XNK A;  1ASJ 1;  1BK0 A;  1SLL A;  2RS5 3;  5LA2 A;  2RMU 1;  4GD4 A;  3CZU A;  3VGI A;  4BHP A;  1FXZ A;  3MDP A;  4H7L A;  2D6M A;  4LBL A;  3HD8 B;  1M06 G;  1GLH A;  2GC3 A;  3Q8B A;  2HWC 1;  5DAQ A;  2DU1 A;  2P3J A;  3HQR A;  4XFH A;  5DZG A;  3T2Q A;  4AGV A;  1D4M 2;  3MLL A;  1RVF 3;  1FV2 A;  4NIH A;  2VQU A;  4Q0S A;  1JYX A;  5ERL A;  1SBD A;  1IQD C;  1VAV A;  2VMH A;  3VDD A;  3VBF B;  2JKB A;  1FOD 2;  1FYU A;  4DPN A;  3SEE A;  2ZBJ A;  2PQQ A;  2OX0 A;  2HBT A;  1WKY A;  3VBH A;  3FWE A;  1MEC 3;  1XYO A;  3R4D B;  2Y6H A;  2GN7 A;  2EIG A;  1AL2 3;  2BU9 A;  1DQ5 A;  2L9L A;  3JBG 2;  3VKM A;  1QJF A;  1LHW A;  2FBE A;  3WZ1 A;  3THC A;  5FPB A;  1SDD B;  4DZG A;  5C9A A;  1H6X A;  2VMG A;  1QOS A;  1PMJ X;  4PBO A;  1JZ3 A;  3MIG A;  4JDM A;  2XVK A;  4EN0 A;  3H1M A;  4YW2 A;  1DGW X;  2D6L X;  2WR9 A;  3VL9 A;  4H2A A;  3MF6 A;  1REF A;  2H6C A;  1E5R A;  4DUX A;  1X7N A;  1LEC A;  5F3C A;  3DUI A;  3AMQ A;  3AX4 A;  2DCY A;  3AL5 A;  5C9A C;  3DXU A;  1POV 1;  5AVP A;  4BM8 A;  2CAV A;  5IVF A;  2WO1 A;  4OYU A;  5FZL A;  3SXW A;  1S2K A;  3T3Y A;  5TSW A;  2ERF A;  4R8H A;  4HOO A;  2Y6G A;  4LNV A;  2RS1 1;  2DTY A;  2NYY A;  4G3Y C;  3T4V A;  3ZYI B;  2RS3 3;  3RZH A;  5HCF A;  1XNB A;  4LR4 A;  5FMD A;  5ABJ A;  3SC7 X;  3MYX A;  3OY8 B;  1CJP A;  3VDD C;  4CEW B;  2GMM A;  2TEP A;  4YGC A;  2JE9 A;  1NCQ B;  3NJZ A;  3J7M A;  4AG4 A;  4IQP A;  4H3W A;  4LOR A;  4WVW A;  1RHI 2;  2P4E A;  2IVJ A;  3KHC A;  3T0A A;  1JU3 A;  2PYT A;  5F32 A;  3BTY A;  4BH9 A;  5C8C A;  5LY2 A;  1WW7 A;  1POV 3;  4XC9 A;  5FMB A;  3SIS A;  2K46 A;  4HK9 A;  1VBA 3;  4RS5 B;  5J3U A;  4QMA A;  4NID A;  3M3Q A;  1CN1 A;  3BCW A;  4I0A A;  4EYU A;  1LJ7 A;  1O3S A;  1GP4 A;  1Q43 A;  4YWA A;  2JD9 A;  4I2O A;  3WDX A;  4ES9 A;  4AXO A;  2QQP A;  2DCZ A;  5JPN B;  3NAP A;  3GZT B;  1SMV A;  1AX0 A;  4PJY A;  3WG4 A;  1OOP A;  3BGA A;  3I3M A;  4XIK A;  5FZI A;  1X9P A;  3U78 A;  3EJK A;  1QDC A;  2RDR A;  2ORZ A;  4OMC A;  4P9W A;  4NN0 A;  1UY0 A;  2QZ3 A;  3I2F A;  4XAE A;  5DN2 A;  1V6I A;  2B5H A;  1DQ6 A;  2BFU S;  3P6B A;  3OGR A;  5JVV A;  3VKO A;  4L8Q A;  4AHW A;  5C71 A;  2PXJ A;  4HET A;  3E5X A;  2W95 A;  2HEY F;  1PIV 3;  3AP7 A;  4QB2 A;  4K9S A;  1V6N A;  3ACI A;  4QAW A;  1PVC 3;  4MGQ A;  4BPZ A;  4A2U A;  5F3I A;  1APN A;  1GZ9 A;  3PNA A;  4GB3 3;  2R49 A;  2ZX2 A;  5FP7 A;  4AFC A;  5ACA 1;  1FT9 A;  3WW1 A;  1DG6 A;  1GIC A;  1WD4 A;  1JU4 A;  1IOA A;  1XNA A;  3M70 A;  4HKO A;  1JUH A;  5A3U A;  4W6W A;  4EJR A;  1SLI A;  4G4F A;  3VBH C;  3LIH A;  4CYD A;  5A3L A;  3MID A;  1DCS A;  1ULG A;  2VW0 A;  3VBF A;  2DUP A;  2R07 3;  4CEY B;  2P1B A;  1S0J A;  1ONA A;  2ZML A;  3RDI A;  3RWK X;  1CAW B;  3VZJ A;  2P3K A;  1QJY 2;  1PHM A;  2XJV A;  4XEZ A;  2XBO 3;  1CWP A;  2WAB A;  2QQM A;  1W9Y A;  4H14 A;  4E4S A;  1BEV 1;  4PIZ A;  3T1L A;  1QKQ A;  1PVC 2;  4MX3 A;  3SQO A;  2JEC A;  2YG0 A;  4OUM A;  4XHB A;  4WM8 A;  4Y33 A;  3OPW A;  3RNS A;  1XC6 A;  1HLC A;  2BOI A;  1YRZ A;  2BWA A;  2OPW A;  4UFM A;  5FZ1 A;  4LKD A;  3WG3 A;  3ZDV A;  4AEM A;  4D7S A;  1YXW A;  3IDE A;  1Q5O A;  1Q56 A;  2JG9 C;  5FPA A;  1PZ9 A;  5CU1 A;  2QQI A;  3AYE A;  3O12 A;  2CWS A;  3GBG A;  1R08 2;  1J83 A;  3HR9 A;  3KF5 A;  3CU7 A;  4M00 A;  1ZYB A;  4Q4W 1;  4XPV A;  2MHF A;  5E8A A;  5LZ6 A;  2Q8O A;  4TTG A;  4XXP A;  1W6Q A;  2LS6 A;  4YZ1 A;  1F9K A;  3TNP B;  4CPB D;  4MHR A;  4LXL A;  2XWB B;  1J59 A;  4E27 A;  2RM2 2;  4IER A;  4CCM A;  2D93 A;  1ODM A;  2WIN B;  5GZD A;  1MAC A;  5DDJ 2;  3WP4 A;  1HV1 A;  3PVO A;  3WF4 A;  3ZKU A;  3AZW A;  1Y43 B;  4AED A;  4EN7 B;  2D7F A;  1EYB A;  1PGL 1;  1BK1 A;  1OLM A;  2A70 A;  3AL6 A;  3OEA A;  4RS5 C;  1NXM A;  3KD4 A;  5H9P A;  4OZX A;  4OHW A;  5DAX A;  4HVQ A;  1AJO A;  3M2M A;  4RR3 C;  1OXC A;  2IWG B;  4LJH A;  4UYB A;  2QQJ A;  3VZK A;  3S5A A;  3SH4 A;  1RB8 G;  5CEH A;  1ENX A;  5FZ7 A;  3V65 A;  2BV4 A;  1ND2 A;  4NHY A;  3PIJ A;  4TLF A;  2VZR A;  3GCW A;  2DUO A;  1H8V A;  4P02 B;  1HRV 1;  1NX9 A;  4KGG A;  3TRS B;  4CEW C;  2YPD A;  1H4H A;  4NII A;  2WAA A;  1SHW B;  2W0X A;  5IVY A;  2LRP A;  3QH7 A;  2W91 A;  2WT0 A;  1SBF A;  3HAG A;  4MO3 M;  1VAK A;  2JDU A;  2D43 A;  2IXC A;  3OGG A;  1OKQ A;  5JSP A;  3PVE A;  3N9Q A;  3ZIW A;  5HCH A;  2WKK A;  2HWB 3;  2WZ8 A;  4A42 A;  4A6S A;  5IAX A;  5KXB A;  1CD3 G;  1GZW A;  1V6L A;  1FOD 1;  1KFX L;  2B7Y A;  3CHX A;  4LUL A;  4RN5 A;  4BB3 A;  4QX7 A;  2W1Q A;  1Z0H A;  3B5L B;  2Q1Z B;  5IVB A;  3NNL A;  4OUS A;  2A71 A;  2BP6 A;  3A21 A;  4UW3 A;  1E5H A;  2O14 A;  3WDV A;  3VD9 A;  1WZX A;  1RUD 2;  2WQ8 A;  1EPW A;  1RMU 3;  3AP4 A;  4K20 A;  4YW4 A;  5FO9 B;  4UWD A;  4Q0Q A;  2VMI A;  1B35 A;  3VBF C;  1BKZ A;  3R4S A;  1OVP A;  1CX1 A;  2V5Y A;  3ILN A;  5FWE A;  2VEC A;  1W3X A;  3C3V A;  4RQP A;  4JGY C;  3S7E A;  5B4N A;  4LQR A;  4O9G A;  3S57 A;  2GC0 A;  4UXA A;  5JZG A;  5LRS A;  2GDF A;  2YRO A;  2DUQ A;  4LUK A;  1ZRI A;  1NLQ A;  4XFA A;  4JKK A;  4YM0 A;  5GZE A;  3VZM A;  2J1E A;  1YYN A;  4LHS A;  4S2F A;  4COZ A;  2NP0 A;  1LCL A;  1KRI A;  5L73 A;  2YDE A;  4RS5 A;  4LA3 A;  4LBQ A;  1FAY A;  4HK8 A;  1RXF A;  5K8S A;  4ZPI A;  3EXU A;  4QU1 A;  4FPO B;  3HIF A;  1QF3 A;  3U07 A;  1PIV 2;  4AVS A;  3T2P A;  1OH3 A;  3UGG A;  1A8M A;  2C26 A;  4AAX A;  3UJQ A;  4KBB A;  1RUI 1;  4AVT A;  1GYK A;  1PM7 A;  3DPR A;  5FO7 B;  1HB1 A;  5KXC A;  3MPB A;  1VMH A;  4CDU A;  4N90 A;  1CR7 A;  1TNF A;  1YI7 A;  2WZR 2;  3IB3 A;  3KLS A;  1LU2 A;  5FZC A;  2K2S A;  1DF0 A;  2UWA A;  4JDN A;  1O5U A;  4JX0 A;  3U4X A;  3BI3 A;  5J98 B;  5GJ6 A;  5IAT A;  2CGN A;  1BVP 1;  1PGS A;  1UXX X;  3U14 A;  4AHX A;  3NNJ A;  4PI2 A;  5JXI A;  3B93 A;  1UZW A;  1O6U A;  3D0J A;  4M4P A;  4UBH A;  4YG3 A;  5I0T A;  5AC9 3;  1XYP A;  1GQP A;  3BPS A;  2NMO A;  1EV1 1;  1NG0 A;  1S0F A;  1WLW A;  2RMU 2;  2WNV B;  2A6Z A;  3K75 B;  3MV0 1;  4JTN A;  4KQ7 A;  2VUJ A;  3MIC A;  4S2H A;  1N1V A;  3I3Q A;  5DG1 A;  3VBR A;  4BOW A;  5JOY A;  4DXS A;  5BNP C;  4MGS A;  5C8C C;  3IWZ A;  4AOC A;  1FMD 1;  5AFE A;  5FUN A;  4LIT A;  1W6Q B;  4LK7 A;  1RUO A;  3I2D A;  1COV 3;  2QE3 A;  3H50 A;  4PCR A;  4PLN A;  1IS5 A;  3GNE A;  3ZXF A;  4OQ9 A;  4DRV A;  4EWE A;  2QQU A;  2W68 A;  2B9V A;  3B9I A;  1WME A;  1AR7 1;  5F3G A;  4QHO A;  4CDX A;  1SPP A;  4HN0 A;  3FX3 A;  2VY0 A;  1OH4 A;  2W9X A;  5A1A A;  1AYN 1;  1G9D A;  3DXT A;  3JB8 A;  3WW4 A;  1UY2 A;  4I01 A;  4F7Z A;  4XJ9 A;  1T6G C;  5H9S A;  4O65 A;  2DWR A;  1N3Q A;  1OF3 A;  2R06 3;  1W8H A;  1H8T C;  1AZD A;  4QU2 A;  5A3M A;  1HW5 A;  4YVW A;  3VDB A;  2NZ9 A;  4QX1 A;  5KHJ A;  4XCA A;  4YZ4 A;  5F1R A;  3OCP A;  5BUV A;  2JIC A;  4YW1 A;  1UOJ A;  1OT5 A;  1ZRD A;  5FXV A;  3NV2 A;  4BLJ A;  4NWV A;  2R32 A;  5JXJ A;  1HDK A;  4CDQ A;  4ZS2 A;  4COW A;  1OA3 A;  3ILF A;  3S6P A;  4WVM A;  2D44 A;  4Z07 A;  2G9Z A;  4CXX A;  3HNB M;  4MGY E;  1LU1 A;  2RE9 A;  3PUQ A;  5FY0 A;  4WM7 A;  3O1O A;  4N9I A;  5F7U A;  3I2J A;  2GAU A;  1A8D A;  1DHK B;  1LEN A;  1K5M A;  1SLT A;  1S0G A;  2IXK A;  2WDB A;  4ONU A;  4QDR A;  4AQ2 A;  1WCD J;  5GZC A;  1XQN A;  5C4W C;  1SLA A;  2UYB A;  3RJ2 X;  2OQ6 A;  3K48 A;  4KI5 M;  4UFJ A;  2ZEY A;  1OPO A;  3HN3 A;  2O8Q A;  5F2W A;  3WNX A;  4YW5 A;  1H2K A;  5FQ0 B;  2HEW F;  4FPJ A;  3ZMN A;  1AX1 A;  4AVV A;  1XNC A;  2WYS A;  4ORF A;  1AVB A;  3CF6 E;  3SMH A;  2BOJ A;  1MS0 A;  2WT2 A;  2VCB A;  3LSD A;  4RGG A;  3AZY A;  4AFA A;  1G6N A;  1NQD A;  2BYV E;  2GP3 A;  4Q1R A;  3W59 A;  3OOX A;  1QXR A;  2Q0A A;  2UY8 A;  5FZF A;  4A41 A;  1QEX A;  5FZ9 A;  4NRO A;  2D6O X;  2VXR A;  1RUH 1;  1L7R A;  4XUP A;  4D0Q A;  3N7J A;  1W03 A;  4IW3 A;  4QM8 A;  1JBC A;  4R52 A;  4A45 A;  1VBE 3;  2CHH A;  3POB A;  1DQ0 A;  4D8M A;  2WQZ C;  4Y1V A;  1HRI 3;  1H8T B;  5C6C A;  1CZS A;  1FV3 A;  1HX6 A;  2PMW B;  1ULO A;  5J96 B;  1LRH A;  4GMP 3;  1EUU A;  3ZLI A;  1RGS A;  3PU8 A;  3OBR A;  2VMC A;  2YYO A;  1NOV A;  3UNP A;  2BNO A;  1KFU L;  1W6M B;  4YVS A;  2WFF 3;  2IUW A;  3ZN6 A;  1AJK A;  2Q5T A;  1WLD A;  1POQ A;  4JGZ C;  4W65 A;  2P17 A;  2WNO A;  4YW7 A;  1MQT A;  1LOE A;  4M4R A;  3HQU A;  4UFH A;  5FMO S;  3JD7 2;  5FIX A;  5L9B A;  2DDU A;  3VKF C;  4NPR A;  3ES1 A;  3IDC B;  4XF9 A;  4MV2 A;  1W04 A;  1YQ2 A;  4HKL A;  3DEC A;  4WV8 A;  1V9U 1;  3ZM8 A;  4AF9 A;  1JYV A;  3VBS C;  2ORX A;  2VG9 A;  4WVZ A;  3U4S A;  4AVC A;  4NHL A;  2R16 A;  1BBT 2;  4GUL A;  4Y4Y A;  3H3Z A;  1Q8P A;  1UZV A;  3W58 A;  4A7Z A;  2A75 A;  4M3C A;  5BNO A;  2HWE 2;  2VZT A;  2DCJ A;  2VMF A;  5FYC A;  3R6S A;  2XJR A;  5HXV A;  1J3Q A;  1QQP 2;  2VZU A;  4QPI A;  5M0T A;  5CFC C;  2QQK A;  5FZO B;  2GME A;  2XVL A;  4COV A;  4ZU5 A;  3FHI B;  3NKG A;  1GWM A;  4AEJ A;  3CEW A;  3KF3 A;  3AXE A;  5EZW A;  2W2I A;  3AC0 A;  3CDZ B;  1UW8 A;  3JU9 A;  4ITC A;  3WT3 A;  3SHR A;  1VBC 3;  2WC2 A;  5FYM A;  4TSV A;  4UW6 A;  4YZ3 A;  3TNQ A;  1AL0 G;  3WX5 A;  3MFA A;  1GBG A;  1LGN A;  3ZFF A;  1S2B A;  3RYR A;  1CAU A;  2VCA A;  5AFB A;  1NCR C;  1VAL A;  3W5M A;  4W4Z A;  2X5I A;  1VBB 3;  3W9A A;  1YC6 1;  2ZXQ A;  3MF9 A;  2WWS A;  5F39 A;  4A3Z A;  5FKB A;  4K21 A;  4NHM A;  3VBO A;  1QWR A;  2ETE A;  5JIA A;  1JI6 A;  2ZX0 A;  4OCT A;  1VBE 2;  3CJI B;  5KWR A;  3J7H A;  4WZC A;  5LBF A;  2OVU A;  4PLO A;  1LGB A;  3ZFG A;  1EP0 A;  2QQW A;  1D7P M;  3IDA A;  4KNC A;  1FI2 A;  1NE6 A;  3M4F A;  4D94 A;  3ZXK A;  4FCA A;  3WP5 A;  3FHQ A;  2P5B A;  2Y6J A;  3N7L A;  2PA7 A;  2VBP A;  3MW2 A;  1ENQ A;  5BNO C;  5F3E A;  4O7X A;  3WIN E;  1RUJ 3;  2WZE A;  3MV1 1;  2P6H A;  3V0A A;  3VBS A;  1Y9M A;  2QDR A;  4AGR A;  2WWU A;  4AFB A;  3T2O A;  2JG8 A;  3C7E A;  4Q4Y 2;  4CCJ A;  4C0B A;  2VGD A;  2FDF A;  1QY4 A;  2HKX A;  5DMY A;  1U5Z A;  4F8A A;  1PVC 1;  2XML A;  3N9L A;  4IE0 A;  2ZOE B;  2ZPX A;  4JGZ A;  4R9C A;  2WQ4 A;  1XNT A;  4YM3 A;  1ZZC A;  4AHZ A;  4PF5 A;  1NYW A;  1QJY 1;  2J1R A;  2QVS B;  1FX5 A;  1EPZ A;  2A3W A;  4XFF A;  3WUD A;  5EFU A;  3K2O A;  1Y4W A;  4MGT A;  2VNV A;  2A6W A;  4XET A;  3ABZ A;  1PO2 1;  1WA4 A;  4GAL A;  3VHP A;  3WF2 A;  3OEB A;  1DZT A;  3Q8A A;  4XHX A;  5D2A A;  2BTV C;  5L7O A;  1DGR A;  3JUU A;  3PDQ A;  1W9T A;  4XXA A;  2WZP P;  1GZT A;  4HN1 A;  4E2Q A;  1VRH 2;  1DU3 D;  3MPP G;  4QX5 A;  1PX4 A;  2BNM A;  5FZ6 A;  4Z1V A;  1RIR A;  4E8D A;  4WM7 B;  4LBQ B;  5DUV A;  1ST8 A;  2RDQ A;  1AYN 2;  5A80 A;  3J7L A;  2WNE A;  5FZ0 A;  4K40 A;  3VHR A;  2VR4 A;  2BVV A;  4FI9 A;  1D0H A;  2Y34 A;  3CBN A;  4PDW B;  1N1S A;  3NNM A;  1RUG 3;  3ALQ A;  4PI0 A;  4YGB A;  5D1I A;  4GQ7 A;  2OYZ A;  3RYP A;  1Y3T A;  4V2V A;  3I2K A;  3KGL A;  4K6B A;  2FMY A;  1UIK A;  4QDQ A;  4Q0V A;  2PHD A;  1N3O A;  3MBW A;  1AF9 A;  2HYX A;  4IV3 C;  4LLO A;  5D8A B;  2BRT A;  4CA9 A;  3RZK A;  1PGW 2;  1RUJ 1;  3P5B A;  1YQ6 A;  1FMD 2;  2DVG A;  4GKX A;  1W8W A;  1WW6 A;  5C70 A;  3FLP A;  4XUR A;  5IFP A;  5FZO A;  2A7A A;  3MGU A;  1FPN 2;  3KM5 A;  4NPM A;  5A33 B;  2RS1 3;  1XU1 A;  2VOV A;  4Q1P A;  5KXD A;  1MZ5 A;  3VBR B;  4EN8 B;  3CZJ A;  3UKT A;  3T09 A;  1LUL A;  1JYI A;  1UMI A;  3I4I A;  3J7N A;  3WQ0 A;  4JKL A;  5FXZ A;  3WV6 A;  2ZA9 A;  1UY1 A;  1W0P A;  4GB3 2;  5CAZ A;  1JXN A;  1YO8 A;  4AGG A;  1COV 2;  2ET7 A;  1W05 A;  3B94 A;  3B7M A;  3T08 A;  5FYI A;  3USU B;  2GP5 A;  3QD6 A;  3OPZ A;  4LKE A;  3OPT A;  1RUI 2;  2HWE 3;  4IGP A;  3WDU A;  2GND A;  1UCX A;  1DBN A;  4Y5Z 0;  5A7W B;  2FZ1 A;  5FP9 A;  2JDK A;  5FPV A;  1LAJ A;  3CJI A;  1OLM E;  2YBS A;  4RD7 A;  2P6C A;  2YGL A;  4Q26 A;  2ZGP A;  3QAC A;  1O3Q A;  2LM3 A;  3VD3 A;  2Z2S B;  3O0X A;  3OUH A;  1SFN A;  4I09 A;  3KV9 A;  3ZYB A;  4CP1 A;  5CFC B;  4YVW B;  1SCS A;  1FPN 3;  2FCU A;  4BME A;  4FOW A;  3LPG A;  3POE A;  2JIJ A;  1BBT 3;  1ALY A;  4L92 A;  3GCX A;  3DGT A;  3HQX A;  5LK5 A;  4ARY A;  3VBS B;  4FQ4 A;  4ZXE A;  1HXS 1;  4CCK A;  1UU4 A;  1AR6 2;  3O5S A;  3RGB A;  5J37 A;  1PM4 A;  4CDQ B;  2CWM A;  4QQ2 A;  3WNM A;  5FO8 B;  1QIQ A;  4DIN B;  3VDC A;  5A7N A;  2VUC A;  1HRI 2;  2Q1M A;  2A1X A;  4NWW A;  2RJ2 A;  3ZOI A;  3N4M A;  2JJ6 A;  3ZFF B;  5E1R A;  2J1S A;  1BXH A;  2KA3 A;  4QGN A;  4EWD A;  1EAH 2;  3W21 A;  4JV4 A;  2FD8 A;  2PAE A;  3HNY M;  4V1P A;  5LK7 B;  3JB4 C;  5FOB B;  1YUD A;  2VTF A;  3O1U A;  2WSU A;  1S0I A;  3OY8 A;  3MW4 A;  4MUV A;  2RHP A;  2RR1 2;  4J25 A;  4LBJ A;  2NN8 A;  2RM2 3;  1A3K A;  4FVV A;  1ULC A;  1F2N A;  3HNM A;  3I97 A;  3IDB B;  3GZE A;  5EPA A;  1HRI 1;  2IXH A;  3LKJ A;  3K51 A;  3UKN A;  4Q4Y 3;  4XJA A;  3VB9 A;  3X29 B;  4BK5 A;  1NCQ C;  2YHJ A;  2ZX3 A;  3CMG A;  5IK8 A;  1PO1 3;  2DVB A;  4PHZ A;  5FYS A;  3FMG A;  3T4H B;  1F4A A;  2PLV 1;  5LRR A;  1VB2 A;  3NAP B;  3Q8F A;  1OSG A;  4NIA A;  1OFS A;  2RJL A;  5B2G B;  4KG0 A;  1FPN 1;  3BIW E;  3D3A A;  2ZGN A;  1PGL 2;  3FUQ A;  3WCS A;  1SQ4 A;  2WII B;  3OB8 A;  2WN3 A;  1UYP A;  4JGY A;  2VO5 A;  4OI2 A;  4RQP C;  4QPG B;  5FLJ A;  4P9J A;  5C3Q A;  2Y64 A;  5FXW A;  3LOB A;  4QXH A;  4IEW A;  4P9G A;  1POV 0;  2NPI A;  1GFF 2;  2YGM A;  4YGD A;  5FPZ A;  3VN4 A;  1DQ1 A;  1Z78 A;  4MAD A;  1O4T A;  3ZN6 B;  4BQW A;  1UL9 A;  3UK9 A;  5EJ1 B;  2HYK A;  1W8U A;  2ZAB A;  5FZ8 A;  4BK4 A;  3AKS A;  5E6H A;  3OYW A;  2OUJ A;  4JCK A;  4Q4W 2;  1Z7S 2;  4BYY A;  4LBK A;  4ZS3 A;  2VJX A;  5IAV A;  4BIS A;  2XJQ A;  2V09 A;  4AI3 A;  2XLG A;  1GWL A;  2W52 A;  3LEI A;  4MVT A;  2XLA A;  5GLW A;  1R09 2;  5LEJ A;  5FRA A;  1RVF 2;  4K1Z A;  5LB6 A;  3AYA A;  1KGY A;  1OBN A;  5JMC A;  4IGQ A;  1ACC A;  5B4X A;  1I3H A;  2XGX A;  4AK3 A;  2BGC A;  5GZG A;  2JD4 A;  5A32 A;  5KHK A;  2LAL A;  3JBG 3;  1YJK A;  5GLZ A;  1PK6 C;  3H7J A;  2V4V A;  3AZV A;  1LOF C;  4LOS A;  4HFS A;  2C6S A;  2VW1 A;  3NV1 A;  1BEV 2;  1MEC 2;  4XVH A;  4CEY A;  4BXF A;  3D5O A;  2LRO A;  1V70 A;  3DCQ A;  3WF3 A;  1JOJ A;  4UT5 A;  2ZTN A;  1JTZ X;  4RR3 A;  4OMD A;  1G9C A;  3WNP A;  4AI9 A;  1VR3 A;  1H1I A;  1Q8Q A;  1AL2 1;  1Y7B A;  2KXL A;  2B42 B;  5IJR A;  2J1T A;  5A7W A;  1CAW A;  1C5H A;  2ZX1 A;  2JG8 C;  3FUO A;  3Q8C A;  1F4H A;  2WNV C;  3UGH A;  2YFU A;  1UO9 A;  1W8N A;  1UXZ A;  4XTM A;  3IAQ A;  1C8M 3;  1NY7 1;  4AE2 A;  1AUY A;  4QT6 A;  1QXJ A;  3PL0 A;  5KC5 A;  1Y9G A;  3LDR A;  2GNB A;  4DRR A;  5JPM B;  3ZXG A;  1I1E A;  2QBX A;  5ACA 2;  3BUC A;  1JZ5 A;  1R1A 1;  3GM8 A;  1UWW A;  1KS5 A;  1CON A;  2YY1 A;  5KHG A;  1CZV A;  1E57 A;  5I91 A;  4XQD A;  3ZX7 A;  3WXP A;  4YPJ A;  4DUV A;  2WFF 2;  2VVD A;  3GBF A;  3NL1 A;  4FPH A;  4XTP A;  3OBZ A;  1C3H A;  1IGO A;  1OD5 A;  1L3J A;  1U5Y A;  2D98 A;  4P5Y A;  3VBU B;  3ZO0 B;  4B29 A;  2Q8D A;  4AED B;  2Y6K A;  5BY5 A;  5K7P A;  1SBE A;  2QTW B;  4Q8L A;  1PZ7 A;  3K4D A;  4AWD A;  1O3T A;  3N9O A;  4OHY A;  2JXA A;  2E9Q A;  3I7D A;  1HRV 3;  2K0G A;  2ZMK A;  4IE7 A;  4L2N A;  1OMI A;  4ARX A;  1YFU A;  3J8F 3;  1W2U A;  3K46 A;  5A3N A;  1DYO A;  1H30 A;  4NRQ A;  1YQC A;  5DPN A;  2V73 A;  3FN9 A;  4P9I A;  4MXV A;  1QJX 2;  1HQN A;  4FQZ A;  3BKZ A;  1VBA 2;  3ELN A;  1J58 A;  3B00 A;  1O8P A;  1VLN A;  4FAH A;  1AYM 1;  1ZZ8 A;  4Q4X 1;  1A34 A;  4MET A;  4IE6 A;  2CL2 A;  4BDV B;  4WZF A;  1JYW A;  2FDH A;  2XXZ A;  3ITQ A;  2VOX A;  3VHO A;  2D5F A;  1NE4 A;  1AR8 2;  3SH3 A;  1RHI 1;  4QKB A;  1XRU A;  1Q8V A;  4LMF A;  3WQ7 A;  2ZKN A;  1LKN A;  4YZ5 A;  5K9Y A;  3O1V A;  1LHV A;  2VOT A;  3NVC A;  3TN9 3;  1WA6 X;  3NV4 A;  4B4P A;  5C3R A;  4GMP 0;  1RXG A;  4KWL A;  1ZZB A;  2A5Z A;  2AYH A;  1ULE A;  4MLO A;  4XE9 A;  4Z92 B;  2B46 X;  3AMN A;  3ZYH A;  3C2U A;  4CE8 A;  4LBM A;  2WN2 A;  2Y26 A;  2VQ0 A;  2ZKL A;  1RMU 1;  4AI2 A;  1IG3 A;  2Y60 A;  3D4K A;  2AEZ A;  2MEV 2;  1S0D A;  3OYW B;  5KHI A;  2WO2 A;  1BQP A;  3ETP A;  1SLC A;  3PJY A;  2W1W A;  3MIB A;  2XKO A;  3VD4 A;  2QQN A;  2R7E B;  3MUZ 1;  5D21 A;  3WF0 A;  4XMA A;  1SAC A;  2AAC A;  2FDG A;  1VBD 3;  4LUM A;  5C3S A;  1CPM A;  1SDW A;  2JEN A;  4QPG C;  1W0O A;  1N1Y A;  1S0E A;  5FZG A;  4BE3 A;  5FMC A;  4MH0 E;  5FKC A;  4S2G A;  3ZIX A;  5IT6 A;  2QJV A;  1YFW A;  2ZZQ A;  3MLJ A;  4E4D X;  4COY A;  5JI9 A;  5JZG B;  2YMZ A;  2ZJC A;  1C4R A;  3KVA A;  1BYH A;  4OI4 A;  1GOG A;  3HT2 A;  5IHR A;  3GF6 A;  4NR1 A;  1W9F A;  2FQP A;  4EZ4 A;  3FBY A;  4XF3 A;  3BYW A;  1CPN A;  3LB9 A;  4LO8 A;  3JBG 1;  4RL7 A;  4URA A;  2Y33 A;  2VW2 A;  2PHU A;  3G7D A;  1AX2 A;  3I59 A;  3POW A;  3GYD A;  2DBN A;  1OQE A;  3ENR A;  4AQT A;  1RUH 2;  3III A;  5C5U A;  2NMN A;  5I8S A;  1CVN A;  3LA7 A;  4BQ4 A;  2JG9 B;  3QH6 A;  5CYY A;  1QJX 3;  1BBT 1;  1RIT A;  1C28 A;  4NMI A;  4SLI A;  3WG1 A;  3PJQ A;  3ZXA C;  5C4W A;  1OF4 A;  1GZC A;  3ETQ A;  5FXX A;  1EAH 3;  4FOY A;  3WDY A;  1GU3 A;  1MS9 A;  4OI0 A;  5CFD C;  1TME 3;  2VNG A;  2HWF 2;  4CPB A;  2IXJ A;  4PIY A;  1ND3 B;  2PHL A;  3IMM A;  1RUC 3;  2C1F A;  1ND2 B;  1GOF A;  4XBQ A;  1ASJ 2;  1RUF 2;  4CDQ C;  5IFT A;  3U75 A;  3LGR A;  2WNV A;  4BMB A;  4FPE A;  4AL9 A;  3USS A;  3PTY A;  5FYU A;  1UY4 A;  1ZA4 A;  1TMF 2;  1G9B A;  1FAT A;  3I8T A;  2GMP A;  3POJ A;  5FYY A;  3W5N A;  4N43 B;  4GA9 A;  1LNS A;  2SLI A;  4N8M A;  2ADE A;  2QQO A;  4HZF A;  2DTW A;  1LOA A;  3ACH A;  1MR5 A;  4JZR A;  4YM1 A;  4YVW C;  3SH5 A;  5EHD A;  4B7E A;  4CCL A;  4D69 A;  4E4H A;  2CNA A;  2Z5W A;  3CNA A;  5FBZ A;  1W39 A;  5FZM A;  5DAV A;  4R9B A;  5CKM A;  4OUE A;  1MS1 A;  3C7F A;  5KHH A;  1DP0 A;  1BEV 3;  1RJ7 A;  3A23 A;  4Y22 A;  3AVR A;  1IZ3 A;  5FPL A;  1VE0 A;  3NJY A;  3LQC A;  4LIV A;  2C4X A;  2PHT A;  5BV6 A;  2OS2 A;  4CCN A;  1LR5 A;  3KT4 A;  3V56 A;  5A6Q A;  3AP6 A;  2R0F A;  1K3I A;  4Y20 A;  2DF7 A;  1DGW A;  4N43 C;  3AFG A;  2B8M A;  4K1Y A;  1TMF 3;  4LO6 B;  4GXL A;  2WS9 2;  5GM0 A;  4ISR A;  2Y38 A;  3F2Z A;  3PHM A;  2XVG A;  1HKD A;  2BEO A;  2X29 A;  2H0B A;  5FV3 A;  5JR7 B;  1OLR A;  1X8E A;  3C7H A;  2VOW A;  5I8T A;  1AHS A;  4PBP A;  3H7Y A;  1AR7 2;  4WVM B;  3RI9 A;  5ACA 3;  3A22 A;  2YBP A;  5APA A;  3WDW A;  3VBR C;  2J22 A;  4P9Y A;  3BIE A;  5CFD B;  4RHV 2;  1UPS A;  3H1Y A;  3K4Z A;  3L2H A;  4HVR A;  1IKQ A;  1RUN A;  4C1X A;  2WUH A;  3POS A;  4QX3 A;  4B7K A;  2VUL A;  1J1L A;  4KMQ A;  2W1S A;  4IUG A;  2VMD A;  1W6P A;  4WM7 C;  4Q8K A;  4IEZ A;  4TWT A;  1EV1 2;  1LES A;  3VD5 A;  3WW2 A;  2E32 A;  2YU1 A;  2W92 A;  3AP5 A;  4LKF A;  4CCC A;  1ASJ 3;  3I3B A;  4K3U A;  1S55 A;  2C24 A;  2CYF A;  3RWN A;  3RG0 A;  3CL1 A;  1BHG A;  3MZH A;  1IS3 A;  4XJU A;  4HBN A;  4QQL A;  3UKV A;  4C0H A;  4DFS A;  1WMX A;  2ZHL A;  3ZYF A;  1ZRE A;  4PDW C;  3SIT A;  4CUG A;  1JZ8 A;  5T5O A;  4HPK A;  4A4A A;  2XUE A;  4XAA A;  4FFF A;  3RS6 A;  1F8V A;  4GH4 A;  2Q4S A; 
#chains in the Genus database with same CATH homology
 1W3X A;  1W2A X;  1W2O A;  2BJS A;  1OC1 A;  1W06 A;  2DBI A;  2VAU A;  4RGK A;  1ODM A;  1UOF A;  2Y60 A;  2VBD A;  3ZKU A;  3ON7 A;  1UOB A;  1QJE A;  1W3V A;  1QIQ A;  2VBB A;  1GP5 A;  3ZKY A;  1UOG A;  1BLZ A;  3OOX A;  2DBN A;  1HB3 A;  2Y6F A;  2WO7 A;  1UZW A;  3ZOI A;  2JB8 A;  1W28 A;  1ODN A;  2IVJ A;  1E5R A;  1HJF A;  1HB4 A;  1UO9 A;  1RXF A;  2VE1 A;  4BB3 A;  1DCS A;  5C3S A;  1W03 A;  2IVI B;  2JB4 A;  1W04 A;  1OBN A;  1HB2 A;  2CSG A;  2VBP A;  4XAE A;  1WA6 X;  5C3R A;  1E5H A;  1UNB A;  5C3Q A;  1HJG A;  1RXG A;  2BU9 A;  1W2N A;  5C3P A;  1E5I A;  1BK0 A;  1W9Y A;  5APA A;  5C3O A;  1E5S A;  1QJF A;  1W05 A;  2VCM A;  2BRT A;  1HB1 A;  1IPS A;  1GP4 A;  1GP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...