1HKFA

The three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
SKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-Dimensional Structure of the Human Nk Cell Receptor Nkp44, a Triggering Partner in Natural Cytotoxicity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
molecule keywords NK CELL ACTIVATING RECEPTOR
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hkfA00
4PG2C 1AGFB 2IF7A 4G8GE 5HPOA 3LMJL 1RY7B 1RVFL 3S9DB 3IAGC 1SYVB 1ZVSB 4M7KL 5LWYL 1ZGLP 4AIXA 1I9IL 1SJEA 2WMPA 3DGCR 4JY6A 1EFXB 3F7PC 2R0ZH 4QOKA 2XFXA 3QSKB 5F6IB 1X5YA 2RCSH 4LPYA 2CR3A 4O02L 1XH3A 1KJVA 2F5AL 1RUPH 3HC4H 1QFPA 1JWSB 4LCWE 4KROD 3PQYB 1OT1A 1U36A 1EAPB 1WCQA 4F37K 5DGRA 4LPCA 4X6CF 4UNTA 3SQBA 4NKIH 5DUPL 2Q7YB 5ELIA 5E0QA 2OS7A 3MRPB 2BMKB 3BJ91 1KN2L 1N8ZA 4NZRH 3S35L 1WGOA 4FG6C 1IEAB 2J2ZA 4N0FB 4JHWH 1A4KA 4LLQA 3NCBB 1G7JB 1I7RA 4NT6A 4O00A 4R2GC 2VLJD 1ERNA 5E6ZA 1FG2B 4N90D 5EH1A 3SGEH 1YPZA 4YHNA 4PJBE 3MV9D 5JOFB 3TH3T 3QO1B 3AAZB 5I1GH 4JPWH 5DMYA 3BEVB 5EZIL 3ZYOA 1KCUL 3ARWA 5C9JB 5I16A 4RFNC 1J11A 1D5MA 4HG4K 1LEKA 1A6WH 3IYLW 2EH8H 4LSSH 3L7FA 3V2AR 5J6HA 4WFFD 4PRHA 2NXZC 5TDNA 1AXSA 4LSUL 4DTGL 3MRQB 4LCWD 4NZTH 1ZT7A 4C59B 4J23A 4Y5XB 5IESL 3U0TA 2B5IB 1QZ1A 3MACH 1DQQB 3QQ3A 3HUJA 5HYFA 1F13A 1FLRH 5CJXA 1G7HA 4FQHA 5DFVC 5CGMA 1MWAL 4XHJC 4Z76A 3P9LA 2GSIB 2C1PB 3WHE1 5LBSH 4YO0B 1V7NH 1U8KA 2CDGA 3UBXA 2AJVL 4R26H 1UWXH 1JP5A 2COQA 3JV0A 4L8SC 3WNMA 1F4HA 2XWTB 3AREC 1NC4A 3MUJA 3DURB 3OXRB 5KS9A 5TDPA 3FRUA 4Y16C 4AENB 2C3VB 2Y4SA 2BNUB 4KY1H 3VE0A 2NNAB 1QVOB 1F58H 1KJ2H 4XP6L 1G7IB 3TNMA 4MDJA 1NJ9B 4GUPB 4ZFGH 2ED8A 4MD5B 4Y88A 5JW4M 1PG7H 3LKSB 1U91B 1W0WB 3PWPA 3DI3B 3P4NB 2OL3H 1D6VL 3IRZA 5EZLA 3QUZD 1KPUB 1VKXB 2CXGA 4AQOA 1JK8A 3H3BC 3D25A 5DVNA 9CGTA 4FQJH 3QUMA 3P73A 4GAJL 4Y89A 3T0BA 2R2HB 4C57C 5DJZA 1I3VA 3QXAA 2QQLL 3PHQB 5JW4Q 3IAQA 3FZUC 5FO9B 1WSST 3GGWA 1HDMB 1C12A 1IQWL 1XZ0B 3SKOB 1T1XB 4EI6B 5I9QC 4NYLA 1QBMH 3GEWB 2AK4A 4ZFGL 2IALA 4F8TA 3QWOB 4P4RB 1KBGL 5ERWB 3VXMB 2R39A 1WVZA 1IGJB 3IT8D 1KT2B 2NW3B 4JFDE 1Y0LA 3FB5B 4JKLA 4KRLB 5DJAB 1U93A 2OTPA 3QG6B 3IU3A 3EYFB 1XIWB 4F7CB 4TNVK 5DMIL 3M1BB 1OPGH 4GAFB 1TTUA 4JCMA 4LSRL 5T1KA 4L9DA 3FOMA 1OTSD 1RD6A 4OQ1A 5L2KA 2X4TB 3G6JF 3WS3A 3P40A 1HQ4B 1YY8A 1IAMA 3KPRE 4DUVA 1DE4A 3HR6A 1S9VB 4NFCA 1CF8L 1T22B 2OP4H 4PJ8D 2P42B 1ZT1A 1JF5A 4QYOA 3MGTB 3SKMB 3TP4A 3MV7D 1BOYA 2DQIL 4JR9L 4QT5A 2BXZA 2N4IA 3IFPA 1ZV5A 2CDGB 5DVKA 1KTLA 1JVKA 1VFAA 4YHPA 3UTQA 3HNVH 1T89C 4X6EA 3LHPL 4RAVA 1S7XA 4H1LA 3FL7A 5J57B 4XP5L 2B1HL 4TPRL 3HMXL 3D18A 4LVOB 1F2XK 4HWBA 3G6AB 3MUHL 2XTJE 1UWEL 4LKCB 3B2VH 2XQBL 1BQLH 5LGHH 5GRVL 1VFBA 3WKNA 4U1LA 2PUQT 1F2QA 3AROA 4LLYA 2R1WA 2V7HB 3DMMB 3NN8B 5D1ZC 2ADGA 1D6VH 4XCNA 4WUUB 4U6HB 2IH1A 4LNVA 1S7QA 1SEBA 3FT3B 1DBJL 2A1WH 4XP6H 3MMEB 4KHTH 3TPKA 2ADFH 4J3UA 5JXEC 4B7IA 4ZS7L 1GXEA 3FAXA 3IU4H 4DFHA 5K9OA 4FN0A 3IB4A 3KG5A 1N6QL 2E7LA 1K4CA 4GOSA 4QO1A 4N0RA 3QDMB 3C8KA 4ZTPL 1FNGA 1A7OL 3D1MC 1HH9B 2D7TL 2CH8A 2P5EB 5HTSA 1E6JL 4DQOH 1FVDB 5KVEL 4JPVL 5FECA 1H5BB 3S97C 4DZBB 3LMJH 3CCHB 1J0KA 1EUTA 3BGFC 4NPYA 4I1NB 1HWGB 5D1QA 4HUWB 1HQRB 2VE6A 5E56A 4DOHB 4Y2DA 3GHEH 2P24B 4NKQB 4WUUD 2D2OA 2WWKT 3G9AB 4POUB 3QQ9C 5TF0A 4NQCE 4POZD 3C2AH 3O45B 1EEQA 2YD7A 3MRDB 2DJSA 3D69B 1JPTH 3OGCA 4YPJA 1IZKA 1N5AB 3I6KB 4JQXC 1MCWW 4GKSB 4F9LA 3VMPA 2OZ4H 5D7KD 1KENH 1LO0L 5FYKL 1OGAA 4I77H 2D03L 4P2OD 4NJAL 3OB8A 4NNPL 5FM5O 4F2MB 4D0DA 4ESKA 1T1ZB 4WEUD 1A6ZB 3P4MA 4CJ0A 5FM5M 3BRDA 5JIIA 3TBSA 3SBWC 5C0AB 1G6RH 3MLTA 1CF8H 5JDSB 3CX5J 5FHBL 2AEWA 5GS1B 5EBWB 3U6RB 2FLRT 5DVMA 5GISL 3MNZA 2IPKA 1HQ4A 1OCWH 3VFWB 5GRVK 4CMMB 4W4OC 4JO1L 3L5WB 1UCBL 2OR7A 4OBSA 3C8HA 2DDQL 3V7AE 1TQBB 5JIPA 3HAEB 1NMAH 3HI5H 5DJ6B 2X1WL 4X80L 4ONHA 2AKRA 4KU1A 4WHDA 4IOIA 5BZWA 1DQLL 4DAGL 2Q3AA 3A6BL 1KV3A 2FL5B 3HZMB 4YHMH 2JCCB 2GAZB 2X4QA 2JJUA 3LIZH 2BJML 3MOAL 5F1SA 3UTSA 4P59L 2GJ6D 4XXCC 4Y5YB 4YHZL 2RFXA 4MCYA 2DLHA 5F7DA 1T20B 4JJHA 4PJGE 4YHIB 1ES0B 4FMKA 4PJIA 5DT1H 1UJTA 3QWOA 5DA4A 4ZYKB 3MLYH 3ARBC 4N0UA 2VAAB 3ZE1E 3BVNA 4EBQH 3BZ4A 5EORL 4D94A 3MFFB 4MXVE 4YHKL 2G75A 1N64L 3MV11 1BIIA 1T04B 3QEUB 5FKPA 4M6OH 3TCLB 2XI9A 3TV3H 2MPAL 1HZHH 3GDBA 1CCZA 4PB0L 5C0CA 3S5LG 1OW0A 3QEGL 3CLEH 5E5MB 2BJMH 3QWQB 4P4KB 1QFWM 4HF5L 2Q20A 4LVHB 1AO7B 4OZFA 2ZCKH 3EOBA 1C16A 3MRMA 4JHZA 4ETQA 3VXTA 3MLSL 3TNMB 2E7CA 4ALAH 1U3YA 1T5WA 4NNYB 3P4OA 1RUQL 2FJFB 5FB8A 1WZ1H 1A1MB 1HH9A 4LKCA 2ARJA 4NBYB 1BD2E 4EI5D 5DQDL 1D3CA 1AP2A 3GSNB 3HCVA 4PY7A 1MCWM 3GIZL 4R7DB 3SE9H 5A40E 3KYNA 1BGXH 4RA3A 2GFBB 4X99B 4Y1AA 5C0IB 4D0BB 1YEJH 32C2B 2IQAB 4HXBH 4RIRA 4L3AA 3IDIA 3LAFA 4M1DL 4AG4L 2BVTA 2NXYB 2WANA 3EIFA 4E5XA 5MENB 2MQCA 4LPVA 4XAWL 5H35A 3I6LE 1FH5L 1DSFL 2V9TA 4U1JB 4BK4A 3ZDZF 3LPWA 2YRZA 1G1YA 1QRNE 3I75A 5D7JA 4XPGL 1DE4B 1K9TA 4FQLH 2CKBL 3WYRA 1MRCH 1D5ZA 1H3PL 2DQJL 1YA5A 2AVGA 3G08B 4TVPE 2IQ9L 2X70A 1MCKA 3QULA 5E7FA 3GRWL 4FXGA 1NCWL 3GMRA 3U36A 1CGUA 1GGCH 1TZIA 1U8MA 1XF3B 3WEXB 1R0AH 1VFOA 1G0YR 2IFFL 1KTLB 3UROR 1QFWH 4JHWL 3UJIL 4PGZA 3IDYC 4ZUTA 5CHNA 4OCRL 3LEXB 3QPQD 5GXBB 5KVEH 1CDHA 5EOCJ 1NDMA 3TFKD 4M7ZC 4XZUB 2VZ3A 3ARFA 3UBXI 4MD0B 1PY4A 4XGZA 1GGIL 2VLRE 1QHOA 1CQKA 3D3VE 1MAMH 2Z31C 1YZZA 3SDYH 1QRNA 4PV8A 2ADIA 2CSPA 5CP7A 4CADA 1RK1B 1RZFH 1KCSH 1NGWB 4S1QH 3IKCA 4XH2A 3TF7C 4YWGH 3BPCB 1FL3A 2DYPB 3RJQB 3ZDYE 2VDRH 4JFDD 2MNUA 3H3KA 1P4IH 5I1KH 4JFFA 2ILLA 1DBJH 1B9ZA 3OKEB 1BJ1J 1J1XL 3RP1A 3K74B 5CEXB 2P5WD 4G9DB 1ONQA 2NX5A 3GBMH 3L7EA 3U7YL 3MYJB 2A6DB 2C1OB 2DKUA 4MJ5A 4PJIB 2YZ8A 4WEBH 4YDIH 5DJ0A 2A73B 1F3RB 4ELKB 1VGKB 5IKCB 3UJJH 3VDAA 2YMXH 2AV1B 3BSZL 3C6SB 4GXUM 2ZG1A 1UCTA 1ZSDB 2YRPA 5IJKA 1WICA 1N26A 5TF1H 2R29H 3NPZB 4G5ZL 1NANI 3VW3H 1RZJL 4RQQA 5HHQB 1F45A 5L9DH 3DO7B 3QCUH 3MNZB 3ULUL 3PXJA 4JQIL 4X4ME 4PJAF 1H8OA 2F74A 4JFDB 2EKSB 4PYGA 1MUJA 1FYTD 3IFNL 4OCWL 4OD3L 5HDBE 4RGOL 1U42A 2P46B 3GRWA 3VFTB 1AD0B 4BM7A 3LPGA 5E6ID 3HC3H 1IAIH 4QNPE 2ENYA 4X6EB 5EIIB 1BM3L 4B41A 2FHCA 3TO2A 4OI8A 4X6DF 4OZ4B 3VXPB 1M05B 3SQOL 3VWKB 1MAKA 3NFPB 2JB5L 2R8SH 4QWWD 3OGCB 3H0TA 4OLUL 3MLSH 4YX2L 4U1HB 1IZJA 1U2CA 4QXTB 4JFQA 4PJEF 2AK1L 3RWHB 4WCYL 1P4BH 1MJJA 5E70A 4XHQA 5F7NC 1IT9H 5K9JH 3W0WB 3HZYA 2NYYD 4MQXD 4PJ9D 4F8QA 5KSBA 3VWJA 4TTDD 1QP1A 1MFCL 1VENA 4M7LH 4WFFE 3VFRB 4DN3H 4RWYL 2AEPH 2D0FA 3LD8B 5C71A 4LOUC 5ISZB 1WWCA 2JK5A 5ACZA 5KSUA 5BRZA 3WL9A 3IJHB 1DBAL 5EZOH 3N0PB 1ZE3C 3B5HA 1UACL 1FFRA 2XT1B 3E3QE 4TUKH 3IXTA 3U4BL 2XKSA 3L5XL 1FAKT 4X9IA 3DROB 1CG9A 5J7CC 4X6DB 5B4MC 1TCRB 2ED7A 3GSXB 5C0JA 4A6YA 2EDNA 3AC0A 4WW2C 2FYYB 3D69A 4HFUH 2R0KH 1VDGA 3MLWH 4LQFH 4JFEA 3VDCA 1EERB 4Y5YC 5AZ2L 1QR1B 1T5XB 3BPOC 2YD8A 4IDJH 1UGNA 2CLZB 5C09B 6CGTA 2D0GA 1B4JL 1TZGL 2VZOA 3O3AB 2GAZA 5J13B 4QF1B 1JRHI 3F7YA 4M03A 4JCLA 4Y2DB 3FQXA 4ZUWA 4BKLA 3HPLB 4M8QB 3VRLF 1RV6X 4KJWD 4WO4A 3IKCB 4XH2B 1TZIB 1U8MB 5E2UH 5I1AA 3LQAC 4YNYA 4MQXC 1LO5A 4AT6A 5F88A 5BS0A 2MWCA 5D7JD 5IB3B 2RBLA 3X14A 1UH3A 3KDMB 1S9WB 1AHWB 1JGEA 3ORJA 3DVGB 4J4PC 2FBJL 4Y4FD 1YJDL 4RA0C 3DVNA 3K80A 5DVLA 4OKDA 3SGDI 1Q0YH 1EFXA 4I18A 1A6UL 1LK3H 4E41E 1U8QB 3QUZC 2XY2A 5F89A 6FABL 4Z7WE 3KLAA 3ZTJG 1MCCA 4NJAH 5IEKA 1NQBA 1AC6A 4N8PA 2FL5A 4JY5H 2BCKA 2X41A 1SHMA 5EZIH 2ZPKH 1A7QL 2JE8A 3FZUD 1BF2A 4ZXBA 2VABB 3MOBH 1I8IA 5DK0B 3NTCH 4QRQA 4PGJA 4JKPL 1YECH 1H3XA 2ED9A 1DQDH 4LGPB 2XTJC 2DWDB 4LL9A 3FQTB 4TN9A 2RAMA 5T3XD 3B9AA 4FOMA 1WF5A 4GAGH 4WTWA 4Y4FB 4NZRL 4OB5L 2GUOA 2YKLL 3VMNA 2VZVA 5DFVD 5IGXH 5DD1H 1GIGH 2FIKB 1JPSL 1IGJA 4JLRB 4DGVH 5D2NB 4ZD3H 5D5MF 1EUUA 2WBKA 35C8H 4MSWA 3RWEB 4PLJD 1F8TL 2NY2D 1A6PA 3NCYP 5MEQB 4LEOB 1ZS8B 1ULVA 3VXSE 2NCMA 2XZAH 3UPCA 1X5JA 4ELKA 3K4DA 1HXYA 4OUOA 2DIBA 3P4OB 2O5YL 3BN9C 4P9MH 1GPOH 4RDQG 1ZEAH 5EC1A 4LRNH 4GXVH 4NQDB 3ZMRA 1VESA 2ICWA 5CSBA 4HC1H 4AL8H 5IB2A 4WUKH 4QRTB 2FRGP 1JPFA 3WJLC 4L9LA 4X4XB 1VKXA 5C92A 1FG9C 4XXDA 5ACZB 4BKLB 1W0WA 3V4UL 2ESVD 1NEUA 2DTML 2BHYA 1BQLL 4NQXA 2W0KA 4XNUH 1X6LA 2JJSA 3G04B 4Z7OE 4N0CD 4ZMAT 1I7TB 2CLRA 2C3VA 2MCPL 4HCRL 3TIEA 5CJXC 3LN5B 3MRFA 3QP3A 4PV9A 4K2UL 1M7IB 2VSDA 4GXVL 4JFQB 1PKQA 1SJEB 2EECA 4TRPH 2FNBA 4RAUA 3JZ7A 3S96A 1I9EA 3O4LB 3PWJB 5FXCH 3QUZA 1C5CH 2EC9U 4FQXA 2VNCA 4XVTL 2ITCA 2YD5A 4GRMA 2FGWH 5AD0B 2VO5A 2R2EA 1N2RA 4PP1C 4OGYH 2Y7QA 5E1AB 1M7DA 4NQUA 4K3HA 4NZUL 3QUYB 1VB9A 3MRLB 4KI5E 5I74B 3Q5OA 4H0IA 3AS2A 1DZBA 3G5XB 3MLRL 1DQMH 3C9NA 4PRAA 3DX6B 5IMOA 3ROLA 5IK3B 5H94B 1NGQH 2GT9B 5F1NA 3T1FA 3B9KD 2YOCA 3CIQA 3RGVA 2EDBA 4Q6IA 3AS1A 4HPOL 3P11L 4JKPH 4NO5A 5SX5H 1NBYA 4C4KO 1ZGLB 4XBPB 2VR4A 4NZJA 1AHWC 3GHBH 4QRRE 3HR5A 1R24A 1D9KC 4WI4A 1BD2D 3BP5B 4CU7A 1QBML 3JTTB 5D5ME 2CKBH 2F19H 2I25N 2X9WA 1WIOA 1Z5LA 3S37H 3X3FL 3S34H 1A4KB 4LLQB 1SJVA 2ZUQC 5GS2H 1S9VA 3CFEA 2LTQB 3ZKMC 4XAWH 5EZJA 4RFOL 1TJHH 3RZCA 1P84J 1KIRA 1UJ3B 4NQTA 3MRDA 5EOQH 4JDVA 3HE6B 3MRBB 1Q94A 4WO4B 1GGBH 1Z2KA 4HUUB 5FGBC 4XP9H 3PQYD 4NWTL 5BS0D 4YJZL 1R3LB 3BZFB 2QADB 3EZJB 4X4XA 3VFMA 4K3JH 4F80A 5BVJA 1QKZH 1DBMH 2HVJB 3B5TA 4XPTL 3I3DA 4P46D 1JBJA 3TPUB 3DSFL 3GSVB 1LE5A 5C09E 4HIJB 4HHAA 1UZ8B 3LKQB 3GSXA 4U1HA 4PJGA 1DANU 3C08H 2P5EA 4L4VD 3HB3C 4JB9L 5AAWA 1JV5A 3TBVA 5ESAA 4FRWA 4PJ5B 4WRLA 1A7PH 4UUJA 3RNKB 4NJ9H 2GK2A 5DEGB 1MLBA 2X4SB 4G8IA 3ZYJA 4Z7OF 4PB0H 5GQBA 1S7VA 5BRZB 4S1SL 3QT2A 1QACA 3F8UB 1NCAH 2FB4L 4MGXA 3QZWA 1I1AA 2BNQD 3BH8B 4OUUA 2GTZA 4U6VH 3MGOA 4LCYA 4I5BB 2QADD 2AEPL 3V4VL 4Q2ZB 1WWBX 3VXRA 4ZS6C 3D85D 4G7YL 1MFCH 1EO5A 1HCFX 2EO9A 5CKGA 4HS3A 2CRMA 4OZHE 4GG6A 1FVCB 3HC0A 4PJDE 1QSFD 1RIUL 4YHML 4MA3A 2D7PA 2DAVA 3HI6L 3UEZA 4Y5VC 3AREB 3IFPB 3QG6A 3O0RH 4XRCB 4P2OC 5DRNA 3SDCC 1C8PA 4D0DB 2NY3C 4QT5B 1MI5E 4JZNA 35C8L 1IQDB 1AGBA 1CLZL 2G5BA 1ZOXA 3NPSB 4Z77A 3KGRA 1CDJA 1IEBA 5TDOA 1IM9A 4M8VA 1K6QL 5ITFA 1CD0A 4KRPC 3V6BR 3ILQD 5IGXL 1XFPA 2Q76A 4OZGB 1N5AA 3I6KA 3WS3B 2H26A 3QEQA 1JN6B 5F9JB 3MRIA 1CE6B 1H15B 1RZGA 2D4DA 3WD5L 4XWGH 3GSWB 3PGDA 4YHYC 4FTVE 2FO4A 2Y36L 3OHXA 3D3VA 3SDAD 1L0XA 4NCDA 4KGLA 4PYHA 1DUZB 2EDKA 1T80A 3EYFA 2NXZB 4PJDA 2FH6A 2HLAA 3BQUA 1KIPB 2VXTH 4JGMA 2R0ZL 2G60H 3RWJB 2AI0L 1PDKA 2F54D 4YFEA 4Y4HB 2APWA 3X11A 1JGUH 3KR3L 1FSKB 3TNNA 5FYKH 4FXLA 5ID0B 4F9PA 1MREL 4M43H 5K9KB 3MCKA 1YEIL 3AVEA 3KPPA 4GG8B 2DN7A 4Z7WF 4HAGA 1HH6A 1HXYB 4H0HB 4XB8A 3WJLA 5HPMA 3AXLB 2EDFA 1ES0A 4QRSB 3SDXB 1NGZA 1YEGL 5KSAB 4M61B 3MBEB 1Q0YL 2IPUK 4GW5A 1UM4H 1ADQL 2Z4QB 5D2NA 5JW5B 3ECBA 2QQKL 3J7HA 5ECJE 5BZWB 2CK0L 1ZGLA 4HC1L 4AL8L 3ESVF 3TH4T 1G9MC 3NH7H 3EOTH 1E27B 1L6ZA 3VMOA 1TCMA 4ENEC 4KJQD 3QWRD 4R96A 3TO4B 5EC2A 5CEZL 3WHXA 5IMOB 4UMGA 3NIFE 2VR5A 4NWUH 4X6FA 4I5BA 4F7EA 1EGJA 1I85C 2VSCA 3DVFA 2AJUH 4W70A 1LEIB 4LASH 1A4JB 4HWBL 4O5LL 5I0DA 5H37H 1UVQB 4YBQD 2HT2D 3ES6B 2HKHH 1RZ8A 4PP1D 5F9OL 3VFOB 4OSUH 4PLOB 1KCVL 4XXCA 5IW3A 1PEWA 1A7RH 3OZ9H 2ZUYA 5EU5B 2M26A 3RTQB 3N1FC 5KSAD 4UINH 1QSVA 4JG0H 3MLZL 4BH7A 5E2WH 3O8XD 1OHQA 4LRIC 3T4YA 3T8XB 2Z8VC 1PKQB 4L3ED 5FCUH 1UWEH 4U1GB 4U1JA 3B9KC 1JZ4A 4Y7MA 3RGHA 1S7TB 3C9NB 4KKCD 2BRRH 4PRAB 4NN6B 5EUOF 5CIPH 4UT6H 1S9XA 3GMQB 3TO4D 2BERA 2BVQA 5DO2D 2F58L 5KOVC 5T3ZH 5ADPH 4JGUA 3MFGB 2R2EB 1G7LA 3PP3K 3RNKA 5MERA 2QLVB 1FP5A 5A2LH 2X4SA 3FN9A 4LVHC 4K7PX 4CDHA 4LSTH 1U41A 4FXKB 4PTTB 5INCA 2HFFB 3RQ3A 5DQ9B 4NRXA 5K33A 3VXSD 2DLGA 3V6OC 2PR4H 2X1XR 1FNGB 1G9NL 3PABA 3DRQA 4H25A 1AC0A 3GIZH 5GGSA 2V5RA 1X6NA 1UZ6E 1T7ZA 1QPXA 1V7MH 3B2UC 3MRMB 4KK8C 1MRFL 1ZHKA 3G5VB 3WUWA 5TQ2H 5DRWA 3PIQA 5HJ3B 4OLZL 1RUQH 1V8HA 3QDJA 4NC0B 4GG6F 3K7UA 4M9PA 4BQ6A 4LCCC 4G6FB 3D3VB 2AKRB 2VUYA 1YNKH 3PWNA 3HA0A 4MNQA 2OTWB 4GS7B 3IGAB 4D9QE 1F4WL 4ELME 2BHZA 5CEYB 1NLDH 5J1TC 1HILA 4R4NC 2DLFH 3VD3A 3ARDD 4WHYG 1CLYL 3O9WA 2A6IB 5K59E 2P7TB 1KCKA 3E2HC 3TV3L 3WLBA 3BVNB 4M6OL 4YHIA 4KMTH 1PZUB 3SKUD 1N64H 1QLFA 3GJEA 3JWOH 2AJZA 3EFFA 2FJGB 4YBLC 4M5YL 5AD0A 1EJ6A 3DUSA 5D7LD 4DCQB 3VFVA 3NA9H 2CIIA 4WI7A 1G1CA 1MHCB 3TT3L 4ZO9A 3SGJA 5LKNA 3U0WL 1IEHA 5HHNB 2OL3L 3BPNC 1NBVH 2R2CA 4U2YA 1TETH 3KR3H 4XNMA 4YAQA 3VRIB 1A7NH 3SCMB 1CTNA 4LRIA 2DMCA 5DFTA 1OTUD 4FTVD 1P7QB 3OXSA 4P2RA 1KJMA 3AS0A 3OX8B 4YX2H 1DJSA 2WBWB 3KPSE 1JGVH 4Y5XA 5C3LD 4UDTA 1RZFL 3SDAA 3GKZA 2DBJA 5D7IB 4OLXH 1UZ6F 3MJ7B 3SKNA 2HN7B 5FGCB 4NRZA 1MLBB 1LP9E 3RVVC 4K9EL 4JVUA 2D7NA 2PXYD 3TBTB 5HGBB 1S7VB 4GRWB 2AJVH 3MR9B 1RZ8B 1AFVH 4HKJB 1J0YA 4HBCL 3CFBA 1YQVL 1FL6B 2HT3C 5IIEB 2K3TA 5SV3A 4RGMB 4HJJL 1UXSA 3MSPA 4OCWH 5CIPB 1EHLH 5EN2A 1H8NA 1OTUC 4MQ7B 2E9JA 5D6DC 3WSQH 4OQTH 4K55A 5EC2B 5DWUL 2WAHA 1JZ5A 3PHQA 2OQJA 4GBXA 2Y07H 4ISVA 5HI5D 4XBGB 4DTGH 3K46A 3NFNA 2PYEA 2G2RA 5EIQA 3AU1B 1A6WL 4LSSL 4MJ4A 4NNXA 3NA4A 3ZKXC 4UILL 1NGWA 1J1OL 5GS0H 4LLWB 5TGBB 1G7LB 2JK5B 2DYPA 3OJMB 1KSRA 4G6JH 3VH8B 3BHBA 5EU7E 5F70A 3QB7C 4PJCA 4R7NA 5AAMA 2VLJA 3V5KB 1CD8A 1XGPB 1S5HA 2Y5EA 4P5KA 2XXMB 2YSSA 2NR6D 3Q6GL 5F1IB 2XN9D 5I75C 4MLIA 3QDGB 1IEBB 5TDOB 4IIQB 3OXRA 1L9MA 4UV4H 1JWMB 5KS9B 4LHUB 2NTSP 3W39B 4MNHA 4HIHA 5L88L 3S37X 1UQSB 4R4FL 4UV7L 2EDRA 1F6LL 2CKBA 4RFEA 5D1XB 1HKLH 2H8PA 1FE8L 3O9WC 5C0NC 1EHNA 1QHPA 3MRHB 1YMME 2BK8A 1KPUA 2JB6A 2Z92A 2DLIA 4Z7VF 1BREA 3L95A 4XI5C 1C5BH 4LSVH 2A1WL 1KELH 4B5EA 1ZAGA 3BKYL 3W81A 1S7SB 4OI7A 3FMGH 1KPRB 4M00A 3F58L 4V2BA 4F3FB 1AHWA 1NCTA 2ZZUT 4K7FA 4RQQB 4WHYH 1P7QA 3OXSB 4P2RB 4AENA 3H0TB 3H3PH 5F1KC 4Q9RL 1PEZA 1IC7H 2R23B 2XACC 5JPNA 2A74B 5GGSY 3W82A 1NC4B 2NY3B 3B2VL 5JW5A 2F15A 4K94H 4QGTA 4KQ3H 4LU5H 3C6SA 3W9EB 3FQXB 5CFHA 1YEHL 5EIIA 1JMXA 4IJ3B 2AJXL 4F58H 1XMWA 1E4XH 1KT2A 5F89B 1U8KB 1AD0A 4ZUVA 4ZFZB 2Y9RT 4KKCC 4X5WB 4ODUB 4YPGB 2Z31D 3GSQA 4KWUA 2IG2H 3MYJA 8CGTA 4ZDHA 1PGRB 5CLTA 3A6BH 3DV4B 5J0BA 2EKSA 3HFML 3QAZB 4XVJH 4D0CA 3J8F7 5CD5C 2W07A 2YRLA 3ARBA 1PD6A 3C5ZB 4M02A 1K2DA 3I6GB 3L3HA 2O61A 2DKSA 5IQ9A 1KGCE 1P69B 2Z4QA 1DQML 2WWKO 4XWOD 4J1UB 1RSFA 3BEVA 3GMOB 1GGYA 4FQIL 3GMPA 4EQ3A 4P5MA 2ZSVA 4GFTB 4EN3C 5I1IL 1BIHA 2H2SC 2D31A 5GJSH 2I9TB 3FFDA 1CVRA 4A6YB 1WEJL 4LSTL 4M4PA 2W9EH 5FCSH 1YY9D 4LPUA 3S37L 4D8PA 1AQDA 3VFPA 4OQTA 4UI2A 1TCRA 1YYLL 4PRNA 3CNKA 5BV7L 3UYRL 3BAEL 4UOW1 5T3ZL 5IHZB 2OZ4L 1RJYA 5GZNC 4NKDA 2XPGB 4BK5A 3MCLH 3QA3B 4QHNB 5E5RB 1NMBH 2FD6H 1WV7T 4OGZA 3HE6C 4TOYL 3LCYA 1MWAA 4PJ8A 4F7PB 4IMLB 3S4SB 2V9QA 5ACLA 4BZ2L 1MVUB 5BVPL 1NCCH 3NGBB 2XA8H 4JQVC 3UZVB 3T4YB 4QRPD 3RPIB 5F9AC 4PLKD 2V5TA 4PS4H 1CFTA 5GS1A 2WUCH 3Q1SH 5DK0A 4I0CC 3ESUF 4HK3N 3BP6B 3KYMA 5GGRY 1ND0B 1KJ2L 5MHSD 5GSVA 1GPOL 2FZ3B 1B6DA 3UTZA 1I9JH 1F02I 3VFVB 2XZAL 2BXYA 1CIUA 1KNOA 4XVTH 1A9EB 3QFJB 5HHVL 1NGPL 2X4NA 3IJYA 2XTLA 4HJGA 3LZFH 2IBZY 3BQUC 3HI1A 3WN5A 3H9YA 1BQSA 1JPSH 4ZPVB 1XGQB 5JLZA 5DJCB 5T3XE 4KPHH 1T2XA 2HMID 1AGCA 3ZT6A 3D39A 1CT8B 1UXWB 5ISZE 4QRPB 1OP3K 15C8L 4QF1A 2D7OA 1JHKH 2D9CA 5C3TA 1PSKL 1RZJC 2YBRA 4IMKA 1KACB 5E03A 4NZTL 1FFPB 2P5WB 1X4XA 3VFGH 3VXUA 4U1IB 3M8OH 4IRSA 4OKVB 1LK2B 3H2WA 3QIWB 3T0EE 5EO0A 2X89A 4PGEA 1LEGA 2GITB 5BXFA 3RVTD 1MI5D 1B0RA 3G5YB 1Y6NR 4X6DA 3CSBA 3JUYA 4ODUA 4F33A 1BBJB 1PG7X 1K8DB 1O5DT 4P3CL 3A6CL 3P3YA 3IDJB 5IM7A 4OQTL 3WE6A 5I76B 5C0RH 1VCAA 1YPZE 4ZFOA 3FQWB 3SKJL 5EU6A 1CD1A 1K2DB 3I6GA 3HS0A 2ICWJ 2KZWA 3TBTA 5D72L 2PYFA 1B0WA 4C54A 1ODAA 4HGMA 1I1AC 1T0PB 2AABL 1SEBB 3CDGB 4RAHA 3WFHB 2BOCA 2X44D 3Q0HA 43C9A 3VRLE 4QCIB 3T77A 1R5VB 4C56A 1AKJA 2VMFA 2BY3A 3GSNH 3ZTNL 4YGVA 3QRGH 3BO8A 3MJ8B 4XPBL 3WXWL 5EBGA 1C1EL 2FWOA 3ZE0E 2EYSA 3MRLA 2WWMC 1MCLA 1CXIA 5DSCA 3KVQA 1ZLUK 1RHFA 3P9MA 5J11C 1NL0L 3UTPE 5JNYB 1MHCA 5DMGC 2V7NB 5BMFL 2BSED 2YN3A 2R4RL 4LOUD 4L4VE 5I8KH 2M2DA 4XI5D 3RIAK 4XBPA 4KQ4H 1Z9LA 1GYAA 1OAZH 4R7DA 4MJIA 5ESVA 1WAAA 5DJ6A 1A6ZA 3T4AA 1MQKL 3FO1A 4GAYA 1EMTH 3SDXE 2FJHB 4PP2B 1P84K 4OCYL 3JWOL 2DQTH 2BNRE 3LVEA 1PKOA 1AD9A 1R6VA 5D93B 2OJZL 5D70H 2B1HH 2QR0A 2P44B 4TPRH 4BQ9A 3VXRB 2FD6L 3IDUA 1KXVC 5IG7A 3HLAA 3ARRA 1F3JA 3BESR 1RZIA 2DLFL 3V6ZB 1G6VK 4ZNEA 3FO0H 3QR2A 4KDTA 3HE7D 1S9YB 5DQJA 4YFLI 1X44A 2CD0A 5DK3A 5H37G 2WV3A 4HCRA 5JR1H 2P49B 3N1PC 1EFXD 5D1XA 4G8IB 5E7BA 2HJLB 4WV1B 1NGYA 4OLUH 4KI5F 3TIDA 1T04A 3QEUA 5D7LE 3KYKH 2DM3A 5F7EL 1T0MA 2AXGA 2OP4L 5E1HB 5E9DA 2VDKH 3CZFA 4BELD 1SMAA 1KN4L 4ODTH 3GSQB 4J4PD 3FFCA 3TIEB 2EDLA 1MCDA 3OQ3B 1ETZB 4K3JL 2WUCL 4Z7UE 2YPKB 2NX5B 3CUPA 2NPLX 3EO9L 4JFEE 4LIQL 4XP9L 1GGBL 1MHEB 5AYUH 3O6MH 3E6FA 2XWBA 3MA7A 5BVPH 4Z7VE 1GZQB 1F6AA 3RNQA 2J8OA 3L3HB 1OAKL 1TJHL 2ZUQB 7FABL 5JW3L 1CE6A 3UYOD 3QG7L 1RK1A 1OVZA 3LB6D 2R4SH 4GRLA 3P0GB 1VADA 3CFDB 1CGVA 3QH3B 5HHMB 1Q38A 5B8CB 5TF1L 4Z77B 1DEEA 1QBLL 2Y23A 2EH7H 5E2JA 4ZAKD 1P4BL 3NIGE 3WN5B 3WDHA 4NN6C 4UB0L 2VLKB 1G9MH 1T6WA 1YEHH 5D1QD 4PD4J 5SWSA 1VPOL 5GGRA 4KTDH 2UUDH 4LVNB 2W91A 4KAQH 1B6UA 4GMSL 4BQCA 4FZEH 4ONGL 1KCVH 2W0LA 4R0LB 1UYWL 4N9GB 2P5WE 3G08A 4URTB 4WHCA 4GG6B 2WLZA 1RZKC 5TH2A 5FUZH 4G6ML 5KAQF 1O7SA 3MZTA 2EYTA 2Z93A 1QR4A 4YO0A 3QYCA 2P45B 2VC2H 5F44A 4RNRA 4X6CE 2X4RA 4HWBH 2ATKB 4N68A 4DKFL 1IAKA 1QFOA 1WISA 3DPBA 4HEME 2VLRD 3BH8A 2QV2A 2A83B 4KDWA 1AXSB 1XR8B 2OK0H 4WI9A 5F97E 4HAFA 4PY8J 2V7NA 4OZGE 5C6WH 1RJYB 4M48L 4J3OC 2GFBA 4X99A 1S7RB 1WFNA 1PG7W 3L3IB 3OR7A 4WW1A 4K3EH 3REWA 3DIFB 4UQ3B 2IMMA 3DUHA 2IFFH 1K8DA 4AQ1B 3FONB 4U6XA 1MHHA 2Y5TB 5GGQL 2XXCB 3LKQA 3CDYA 4OF6A 1GGCL 4MCZA 5J9PB 2BY1A 4FQ1L 3STLA 2Z0BA 3ZSTA 3QUXB 3IDGB 4G42B 5ABDE 2W0FB 4KVCL 2GK0B 3OAZK 5IHLB 4NN5B 3TYFA 1DVFD 3FMGL 3P77A 3TN0B 4Z18A 1Q94B 2G60L 3U48A 3QEQB 1YUHB 4IRJD 4PJEB 5F9JA 4J8RA 1ZHBB 4S1DD 1S9XB 2ZUXA 3RNQB 3UTTD 3DHMA 5FKAB 4XCFH 3EJZC 2XG5A 4RISH 4U1MB 1I1YB 5T1MB 4EDWL 3MV9A 5IFHH 1OB1B 1AGBB 1NGXB 3RAJH 4AG4H 4DKFH 2F5BH 4V2CB 5C6TH 4NHCL 5T1DH 4MA7H 4OZIA 5C0CD 3DRQB 1OTTC 4NQCB 1IQDA 2JTDA 4JRYA 4TQEL 1BP3B 4XC3L 2E9WA 4CMHC 5TDPB 1XF5A 4P23B 2DKMA 3QUMH 3BRGC 2A6JB 3B6SA 3T3ME 1JIBA 3MROA 3KPQA 4ELMF 3R8BB 5CINL 3PGDB 2UYLB 1JGDA 1JFQL 3ZZ1A 1HHJB 1RIUH 2V7HA 3DMMA 5FUOH 3T04D 2DI9A 3N85L 2GSIA 4NKMB 1XF2B 3NZHL 2EH7L 1UA6L 4PGBA 3DUUA 4QCIA 3T77B 1OGTA 3CSYA 4E0RA 4RNRB 4FZ8L 1ZLWH 1JRHL 1TQCB 2IGFL 5TDNB 5KANG 3V0AC 1NCBL 4M93C 3NCMA 3DURA 4TVPH 3JSSA 4I3SH 4RGND 4P5TB 4M61A 3DUSB 3RZWA 1MCRA 2UUDK 5DD6A 4JGJA 3RUGA 5GGTH 1FG2A 5KBNC 1BGXL 3QO1A 4OFKA 2NY0C 4U1NB 1DBBL 4R97C 4QXGH 3TESA 4OIBA 3MA9L 2HTLC 4J3TA 4YGVB 2Q8BL 2X4TA 4I0KA 4D9RD 4PUBL 1KUMA 1XGPA 1S9WA 1UADC 5CLWA 2UZYB 5DEFA 1X5ZA 2ZUWA 2H1PH 4Z5RB 3LS4L 1FBIL 5D7LA 3EDKA 2R1YB 4AEIH 3UPRA 3VGAB 1J9CT 3QIBD 3L1OL 1MRFH 2FLBT 4NQDA 3NIFF 4Z7QE 3FO0L 1V7ML 2BVQB 2B1AL 3MLWL 3VXMA 4NHUA 1FCGA 1QR1A 3ULVC 4J3SA 2XYCA 2CLVA 1JF1A 4LHUG 5IM7B 2C7UA 3QDAA 4FQ2H 1GOGA 5EO1A 4DK3A 1UB6A 5FO9A 4FFZH 4BH7B 1T1XA 5C0JB 5C0DA 2B2XL 2F53E 4I77L 5E5UB 2AV7A 4PTUB 4X9FA 1RMFH 1IRAY 3CX5K 5SX5K 4JRXB 3VFTA 1QYGH 4LAQL 3CVHH 4PRIA 5INDA 1SY6A 3LKSA 4I2XE 1YNKL 3EKCA 3O3BB 3WDIA 3DOSA 5BO1H 1UCBH 2CO6B 3LKRA 5CGYC 4JZOA 3ILQC 1A7RL 3QUYA 5SWSE 1BWMA 3ARGB 2DICA 4QXTA 5JDSA 1MRDL 1S7XB 3FT4B 1TQCC 3HC3L 4ODTL 3ZHKA 1IGML 4UOJA 1T66C 4Z7NF 1OL0A 3CVHA 2GY5A 4HPYH 4W81A 43CAA 2CIIB 2ESVA 1MOEA 2CDEB 2JCCF 1XGYL 3SKMA 3QO0B 5HYJB 4FP8L 5FGCE 4P3CH 3OAUL 4N8CH 1JL8A 1QFUH 1NGXA 2A6IA 3MLXH 3WO4C 2VYRE 1DDHB 5GS1C 1X5IA 3RWGA 2VISB 2IADB 2OJZH 5E8DH 5KVGL 4KVCH 3IS0X 4FNLH 2XTJD 1N0XL 1UKSA 1F11A 1YUHA 4PJEA 5GRWA 3V8OA 3E6FB 4OCYH 5EUOA 4Z5RA 15C8H 4HH9B 4BZYA 3OF6A 1Y18A 2P1YA 1GZPB 1Y0LB 3FB5A 2G75B 3HMXH 1T0NB 1Q1JH 3CPLA 1QRKA 1H0DB 3EYUH 4DW2H 5DTFA 4PREA 2ZUVA 2PNDA 3WDJA 4X7DC 4O51A 5IIEA 4H25B 1GSMA 3JTTA 1KPVB 4IBLT 4EOWL 4CVUA 3VDBA 4W6XB 1UXSB 2VXUH 5ALBH 1LO3H 1D6EB 4L4TA 2V2WA 1AO7A 2AJ3B 1T20A 4Y5VB 1I3GH 3L6FB 2DBLL 2I26N 5CSZB 1EBPA 2WSKA 5K9QI 4ZS7H 3TN0A 2R1YA 3ARDC 2RQ8A 3UPRB 5DD1L 4NRZB 2VC2L 3L5WA 4EI5B 2YA2A 1G0XA 1CDYA 4KC3B 4JO4H 1TXKA 4PGCA 1BLNB 2P8MB 4JY6B 2FECI 4C55A 1KCLA 4GKZA 5JPMA 1MPAL 4U1NA 1NAML 5C0BD 2X4RB 3BD4A 4NO3A 3FT2B 3U7WL 4ZDHB 1ZS8A 4D3CH 2XRAH 5JXEA 1BZQK 1H3WM 3C5JB 5MENA 4ELMB 3CVHL 5HVWA 3BP4A 3MRCB 2BHUA 5DDHA 5I1LA 4XPFL 2E7LC 1B0GB 4EUPA 1WFTA 5DD6B 3HNVL 5D6CB 4XCCL 4F2MA 1UWXK 3UYRH 4MJ2A 1QBLH 3P0VL 4L1DA 1Z6JT 3LN9A 2FR4A 3P4MB 2AI0H 3WNNA 4OLYL 4OCMC 2GHWB 3BZEB 3JWOC 1P53A 3FO9A 4OZIB 3LDBC 4X7CC 4ZPTA 4R4BB 4KK5D 4OGAD 3F6IA 5D7SL 3B9KA 1S5HB 4PRBA 3MV9B 5DR5H 4MNQD 5FYJU 4F3FA 4XNYL 3GI9L 3DUUB 3PL6A 3WFCL 4LVOC 1ITBB 5SWQB 4JY4B 1PKQE 1LP9B 4JJ5A 4MAYB 4HKXB 2JIXB 4HX1B 1XT5A 5H35B 5C0BB 1CYGA 1A3LL 4HW6A 1D5XA 4OD2B 2PXYB 1D7FA 3KPSB 5KS9F 2AV7B 4ODBD 2H8PB 4M3JA 4HIHB 3MROB 1INDL 5SWZE 1NBZA 4JDVB 5BRZE 4KXZI 4FQXB 4LPTA 4HJ0C 1CZ8L 4HLZH 3E3QC 1X5KA 3JBG7 2OMNA 5CUSL 5DJXB 3CPLB 5EO1B 2DMKA 3BPOB 4OT1L 1DBBH 2R0KL 3QDGA 2NY6C 1LHZA 3X11B 1LE9A 4PBVC 4G8EA 1P4LA 2ZSVB 1KB9J 2DIAA 2LVCA 4OF3A 5IVZB 2RFXB 1UWGL 5F7DB 2YPLB 4MAUH 5EIVA 3ARTA 1CFNA 3VJ6A 2C3GA 1ED3A 3B3IB 4KK9D 2FO1A 3MRNB 4U7MA 4BZ2H 5C0FB 3C6LD 1XGUA 5D7IE 4PJAA 3RGVB 3ARBB 3MNVB 4X8JB 4BYHA 4QGYA 4PJFB 3AMKA 5DJ2B 1FL5B 3MLYL 3H9SB 2ZOLB 1SVCP 3V0VA 3EUUA 3LD8C 4P2QE 4QTHA 4GW1B 4X5WA 2EH8L 5DTFB 5FM8A 4HIEA 5E99L 2EDXA 1CTOA 1YPZF 4XNXH 1A0QL 2DQFA 3T0EC 1I1FB 4Y5YA 3TM6A 2HWZL 4NKOA 1S9KC 3EHBC 3NFSH 3HI5L 4UBDD 3ET9F 3SE8L 5K93A 1NAMH 3BP7B 4JO1H 4E42B 1FZJB 5D7IF 3AM8C 5IQ7H 3F7RA 2V2TB 4PGBB 2WBJD 4EZMA 4YE4L 2WIMA 2AABH 2OMBA 3O2DH 3BUYB 1LO2H 1EDQA 1AE6L 4X7SL 1E28B 3DX7B 4EI5C 5JOPD 3GZKA 1RURL 2MJWA 3E1F1 2Q3ZA 3H9SD 5MP6L 5DI8A 3VFNA 4JHAL 2HT4C 1AGDB 2DM7A 4G9FB 4O2CB 5I8OH 2CIKA 4NO2A 2ZG3A 2DTSA 2NMSA 1LO4L 4OD1L 4ZFOB 2PN5A 3U79A 2NY3D 3VW3L 3KYOB 3A6CH 3U9UA 1KLUB 5JOEA 4APQC 3V95A 3OAZH 2FX7L 3P0VH 1RUMH 1U8LB 1T1YA 3TJHC 5I66A 1IGIL 1KCUH 3DTXB 2YA0A 3GM0A 4PY7B 5ENWB 1I8MA 1LP9F 3ARSA 5DJXA 3GUTB 4M1CD 1B0RB 1C16B 1VADB 2CJUH 2KPNA 5IF0A 4OZFG 3QCTH 5KZCB 4YNYB 3QH3A 3GBNH 5D2NC 2X1QA 4HMDA 4JFFD 2H41A 5F88B 1U3HD 1JTPA 4RMVA 3MLRH 4N0CC 4WIQA 4JO2L 4KTYA 1P4IL 1ADQA 1BOGA 3RWCA 3LEVL 1CWVA 1PBYA 3D39B 1LNUB 4NKIL 3S36X 3S7GA 1SM3H 2QHRH 3MRKA 1U58B 4N8CL 4AZ8A 1HINH 1QTYT 2R9HC 1NGPH 1KCSL 1ORSB 3LY6A 2B39A 2F9BT 4LLDA 3P4NA 2AJYL 4EVNA 1FZKB 3LN4A 2F5AH 1WJ3A 1HXMA 2OXHA 4HSQA 2GYSA 3EGSA 1RJZB 2GJ6B 4HMCA 4R4BA 3ARVA 4UAOB 3OAYK 4HMEA 3TIDB 3T0DA 4HPYL 3QFJA 4KZEH 3SJVA 1TETL 3MREA 2X89D 2VN7A 5LWYH 3K8MA 2EDYA 1EEUA 1U3HC 3FCTB 1CI5A 2W60A 1ZT4B 5JNYA 3ARGC 2DRUA 2ZCLL 4JFOB 3PG2A 2RIKA 5GJTH 1MCFA 4NUGL 5GGVY 3ROOB 1ZLSL 2VN4A 2DQGL 4XP4L 1YMMA 2C1PA 5CZVH 2P5ED 4L4VA 4GUPA 3PL6B 3IFLH 3BT2H 4FQLL 4JFXB 5ANMB 3PGCA 1G0DA 2GSGA 4WWKC 2Y07L 1FO0A 4Y4KD 3R1GH 5DHYA 4C56D 5F3BA 1F90L 1J5OL 1CFQA 1VHPA 1N7MH 5I73B 2C4XA 2FZ3A 3NGBC 2DB8A 3GJEB 4WGVB 2VLME 3LH2L 1NAMA 2FJGA 5F3HB 4PJIF 4LIQH 2RJMA 5I1HL 3AY4C 4WGWB 3STZA 1KC5L 2I9LB 2FBJH 1T03L 2ERJB 1WBYA 2EC9T 4LP5A 2IFGA 2VKWA 5FOBB 5JUEH 4PREB 5J6GA 3BIAX 1JNHA 1OTTD 3BO8B 4B7LA 5C08B 3REVA 1OPGL 4GRWH 4OLXL 2MKWA 1OLZA 5LGKA 2R2BA 1JGVL 3RI5F 3IXTB 1ZT7B 1L6XA 1DQDL 2VH5H 3RL1B 4R8WH 2M8XA 4X5XB 3I6LD 1TZGH 5IFAL 3RA7L 4QRPA 1MCJA 3CGTA 4N0YL 3L3OA 5GGTA 5JORA 4O4YH 1IM9D 4K71C 5EU3B 3VFRA 4BA8A 3DYMA 3PDDA 1KBGH 3S36L 1FIGL 2J8UA 1A1NB 3I2CL 5HYIA 3QIWD 1S5IL 3IDXH 4PFEA 5DRZA 5JHDA 5D70L 5DMKA 3I9GL 4M7LT 3FFCE 1ZKAA 4LLUA 5EULV 3ULUF 5JHLH 3MV8A 1NGYB 3DROA 2ZUUA 5DQ9A 1UACH 4KMTL 3QXAB 4QY8B 3OZ9L 4PJAE 2WP3T 3D6GA 4MSWB 3IAPA 4X7TA 1SYSA 1A5FH 4Q9BA 1J88A 1MLCB 4CU6A 2SEBA 5A2IH 3VD9A 2F54E 5BOPA 4F9PC 1PQZA 5BMFH 3M07A 3VGFA 3PNWA 4D9LL 3D0LB 2W0FA 4NP4H 3UZEA 2UWEE 1IT9L 1AR1C 4Y4FA 1QPPA 1MSPA 1U91A 4HUVA 3P9LB 5KSBB 3NVQA 4NC2B 2V9RA 3O4LD 3I02B 5A43C 3CZJA 4IJ3C 1J12A 3PXHA 1N59B 3FO9B 4YXHL 1TQBC 4ODVL 3ZTNH 4IDJL 3DV6B 3W2DL 4I18C 4R97B 3CMOL 3RKPA 3QHFH 1GOHA 1OP3H 1VEOA 3BJLA 1KLUA 1T21A 4TQEH 5TFSH 1KIQB 4IRZH 5IVXE 1CFQB 3LH2H 3MODL 4EIZC 3O3EB 1XR8A 2AV1A 4HK0A 2VQUA 3ARQA 3KLAB 4KHXL 4Z7QF 1FLRL 1ZANL 3PWUB 5EU7C 1U8QA 3MGTA 4KKLD 1HHIA 1HEZA 3KXFB 3A6OA 2UWEA 2B4CL 1KENL 5GS0L 4P2QD 2Q6WB 4M62L 3V9FA 1UH2A 4NSKA 4QHLA 5D8JH 2BVOA 3QCVH 3UP1A 5HYSB 3PDOB 3C2AL 2DQCL 5J89A 4PJ7F 4JPIB 5CZVL 3OKMB 4FG6D 3MA7B 3VJ6B 4CN6A 4PJEE 5M94B 3WSQL 5IMKB 4X7FC 2EXWC 1F6FB 4R2GD 3ZKND 3F7YB 4HZLB 4G6AC 4JM4H 4JZJC 4RRPG 1Q9KB 5CBEB 1K8IB 1G6RB 4L8DB 1QA9B 4XC3H 5E9DB 5D5MB 3IDYB 1MNUH 2D7TH 3V5KA 3QNXB 5GS0D 1FDLL 2HVJA 1NEZA 4K7PL 4LFHD 3MMEA 4MA1B 3BEWB 2CGRL 4EDWH 5SWZD 5C07E 3WLWC 4ODVH 1SJHB 1FV1A 1CICB 5CJOL 4PJ9B 3MJ7A 3E8UH 1PZ5A 5IROC 5KOMC 4Z7WB 1RQ5A 5EA0H 4NQVA 4KHTL 1DEDA 3DBXA 4JO2H 5H94A 1DL7L 3UTTE 5ISZD 3SGEI 1RU9H 4K3DL 2VZSA 1UJ3A 1U8IA 1RIHH 3PWLA 3GBNL 5ENWA 3DO3A 3NCJH 4OFPA 4BFIA 3DMMC 5LGHL 2XQBH 3ULVD 1QUNA 4JE4B 4XRCA 4V1DD 2NXYC 1HSBA 3WIFB 5C0EA 3BKCH 1QLEH 3GSRA 1NFDA 5E9DD 5C2BL 3GRWH 4X7EC 4HLZG 4RBPK 3QIBA 3QCVL 1ZT1B 3JWDL 4O9HH 1FNSH 2AAVA 3S36H 5IHUH 4HS3B 2Q7NA 4XPAH 1QFUL 2OSLA 3BPNB 1E28A 4CNIA 2L7UA 2OK0L 4Z6AT 5HGGS 5ILTH 4S1QL 3DRTA 1NH6A 5IFAH 5FF6A 4NO0B 1QBBA 1YY9C 1OB1A 4NQSB 1MWAB 2BFVH 2DQHH 2VLJB 1GVIA 2VH5L 4NOFA 5KSBF 3WNKA 4M1DH 1GGIH 3FHAA 1N2RB 4PJ7E 1AE6H 4X7SH 2BVEA 4XMLL 5DHXB 1QSEE 4KTEH 2OTUA 4XAKD 3VXNA 5TFSL 2QKIB 5C0AA 4M4RA 3JUZA 3ZKQD 4JAMA 1IGFL 3B6SB 4MS8C 2AXJA 3HG1E 4L5FL 1QQDB 4U2ZA 2AQ2A 5B38G 3CMOH 1FVDA 1E4WH 1JV5B 1AGEA 2PCPB 3WS6C 1SBSL 5FGBA 4MJIE 3WN5C 1A6AB 2NTFB 4NBZB 4U6YA 4WV1C 1NDGA 2VLLB 1EVTC 3G04A 1NLBH 3MV01 2R15A 1CLOL 2F19L 2VOTA 2ADJB 2I5YH 2F54B 5FM4A 2K9UA 2NZIA 3JTSA 1ZA6B 3LEYH 4G80A 4IHOB 2ESVE 3ZHLA 3HUJF 2BVPA 3FN0L 3OB0K 4EN3D 5AEAA 4X6BB 4PB9H 1QG3A 1OP5H 1NGQL 3LPFA 5BJTB 2ZCLH 2D0HA 2VQ1B 3TBWA 4XWOC 3IF1B 3QI9B 4YGAB 1DBKH 3VGEA 2HMIC 3K4AA 5FOBA 1UFUA 1NKOA 1AJ7L 1N4XL 2K7PA 4WWID 1OSZA 4LLAA 3RTQA 1NFKA 1FVEA 1R3KA 2BX5A 4B0MM 3OPZL 4HH8A 2FGWL 3LDBB 4H8WL 1NMAL 4PJBB 2D9QB 1OM3H 4C83B 4PUBH 3OBAA 2J4WL 2NYYC 1I3RB 5D2LE 1IBGH 5IEHA 1X5XA 1BFVL 1U8IB 4PGCB 3WJJA 1OARH 5FHBH 4JQXA 3QWRA 3QZWB 3B2UD 4YUEL 1UB5A 4DKEH 4OTXL 4JREC 5E8EB 5C9KA 4ENED 3BKML 3TLRA 3KJ6L 3C5SB 1DQTA 2UVFA 4M6NH 1NSNH 4KMQA 4RDQF 3MRCA 4D8PB 1PW3A 1T21B 5HY9B 1SYSB 4JM2B 3UX9B 3TVMD 5I76A 4WUKL 4Z7UB 2F53D 5I17A 1J05B 2MCG1 3VA2C 1MREH 5I8KL 2C26A 5CEZE 4PBXA 4TVSa 1G7JA 1I7RB 1NGZB 3BN3B 1A4JA 3MQIA 4KK5C 3UC0L 1JPTL 4D2NA 1QA9A 3IKKA 1A6VH 4U1KA 4BZ1H 2KKQA 4X5LA 3GMOA 5DMKB 5HXMA 1C1EH 2WIIA 3PWLB 1PSKH 2UVEA 4NUGH 4XPBH 5KSAC 2YHGA 4L3EA 1Z9OA 2BOCB 1KIPA 1NAKH 1MCOL 4OZHF 5J4MA 3NCYS 4ZD3L 1GCFA 4AM0A 5F9WB 3QIUA 5L8JB 3NCCB 4DEPC 3SDXF 5CSZA 3OKLA 4G6KL 1DDHA 3V6ZA 3MCG1 4APQA 2FCBA 3OHXB 5DD5H 2BNQE 4OV5A 1MHEA 4JM2F 3MRIB 4P57A 3SDDB 3SDXA 3BYTA 4DVRL 3JWNC 3PIQB 5HJ3A 4JFZH 3RY5A 5IBLC 5EFIA 3TVMB 1OM3L 5HYJA 3TVMC 3LV3B 4WW2A 3MV9E 5EOCL 1G6RA 4EOWH 5F6IC 5DRNB 3RVTC 3ZE0F 1MCSA 3ALPA 1DLFL 5BOZG 4UZGA 4XNXL 1NBQA 3OV6A 3EYUL 2HH0L 5IMKA 3PP4L 4MB5A 4Z0BL 4KRPB 1UEYA 4UTBH 4FQCH 1J8KA 1ZVYA 1YEKH 1AKJD 1RZIB 1A6UH 1LK3L 8FABA 5LXGH 4MDJB 5L8KB 3SDCB 4NQSA 5L0QC 3O3BA 1HHIB 3KXFA 1OARL 4J4PA 5D96C 1S3KH 1E4JA 2MQ3A 4NQDD 3CFJA 4OIIL 3PHOB 3KPMB 1VFMA 2M1KA 3SDDD 5C7XL 2X4NB 5DMGD 4K8RH 1ZEAL 3UYPA 5CILL 2J6EL 1EO8H 2EDTA 5GRXG 4P5TD 3HRPA 4FP8H 3B4NA 4ODWA 4GSDH 3UTQB 3B9EA 2AJSL 3U4EB 2GJZB 4HC1A 3SCMD 5DF0A 5T3ZE 4JVWA 1B0GA 4ZTPH 5ESAB 4FTVB 5FA3A 2YUZA 4AEEA 4I8DA 4UUJB 4OLZH 1YJDC 5FV1L 5D7JC 3AB0B 5HPMB 1RURH 1BZ7A 4WU5B 1INQA 3IXAA 3V0VB 1II4E 1I9RH 2DL2A 4XHJD 2QSVA 2PF6A 3BWAB 3LRSB 4PRHD 1FCCA 1FYTE 3GI8H 5A3ID 3CSGA 4OUUB 4LLWA 1R5VA 3VGBA 5IP4A 2H3NB 3GI9H 5L2JA 2PW1A 3RDTB 3M1BA 4NM8H 2R2HA 4QRPE 5FYJH 1Q0XL 1JMZA 4KAQL 4TOYH 5E94B 5ILTL 3ILPB 1QSFB 1YQ2A 4G3YL 3P9WB 3FRPA 5IW6A 1CFSA 4P48A 4Y19D 2YPKA 4KK6D 2LFGA 2R56L 5L6YL 1JGLL 4HKBA 4EXPX 1A6TB 5EFIB 2CXKA 5INCB 6FABH 5C2BH 5IV2B 1KTKE 1J8HE 4HKJA 3QG7H 3WV0A 3OKEA 3BHBB 4HPOH 4PLNC 1N3NA 3BIKB 4PTTA 3MV7E 3U30B 2VLMD 4FQJL 4GBXD 1PX4A 2IMNA 3OJDB 5GRUH 5AYUL 1RJCA 3QXTA 1T3FA 3QIUB 3MXWL 1UKQA 3QDGD 2GKIA 1E6OH 2YXMA 4PJ5E 3GSWA 2BSSB 4HT1H 3MRRB 4LHUD 2XA3A 4M5ZH 3KPLB 4Q7DA 3SDAB 1FZOA 1XCQB 2W65B 1KN4H 2E8YA 3LQZA 1P7KA 2FX9L 2NXZD 3V6FA 2R0WL 5A16A 4TSAL 2P43B 4UQ2A 5J12C 4U1KB 4E42A 3W11D 1XF4B 5E8OA 1JGDB 4L3EE 4I0PD 3BH9A 3OR7B 4WW1B 4CU8A 1YYMH 2BDNL 1QOKA 3MRHA 4JO3H 4E41A 1FL6A 5ALBL 1ACYL 4LKXB 4LSQH 5F21B 4AEHH 3TBSB 3OKDB 1BEYH 1GRWA 5KSVB 3F6LA 1JUFB 4ODWB 4JFHD 3EJYC 4P4KD 1CR9L 1UM5H 5D96B 2HRPH 2RB8A 4OIIH 3WLBB 4W4NA 2MCPH 4O2CA 3QBTB 2YWYA 3NCFB 1IM3A 1NMCC 3Q6GH 4K8RD 4YHOH 5E95B 3UJJL 1AO7D 4N5ED 4JG1L 1HHKB 1NC4D 5D7SH 25C8L 2IAMA 3S88L 1FL5A 2FEDC 3SDCA 4G6JL 3RHWF 1YEIH 3IS1X 4QTHB 3KLSA 4X8JA 3ROOA 5DRXA 4Y2OA 3F58H 1LO5B 4AT6B 5J8OA 5DC9B 5I30H 3ULVL 4CVXB 3D2UA 3QNYA 4YK4C 3CLFH 5EWIH 5JA8B 4ZNCD 1WFOA 5T1KB 2OL3A 4I0PB 5CAYB 1FLTX 1FRGH 1BFTA 4G42A 4JFFE 5BV7C 1V3LA 1PLGH 1LGVA 5GGVH 3R06B 5GZOD 3LRHA 5IOPA 5MEND 1OAXH 1YMMD 4P4RA 4AJ0A 5IHBA 3MUGA 1V5JA 1IAIL 4HDIA 1ORQB 4TTDC 3LN4B 4LHJB 3IF1A 4H26B 1DVFA 1CFVH 2NY7H 4XCEA 1AFVL 3ZLQC 1EZVX 2YKLH 3UPAA 4K9EH 3RU8H 3EOAB 5HHXL 1C5DB 2WLYA 2YPLD 1KLGA 2XN9E 4HV8A 3OJ2C 1UM6H 1NC2D 1DLHA 3BE1L 3QRFM 3AU1A 3L5HA 1KJ2A 3H9SE 4D0CB 4RBPH 5E08H 1R5IB 3GMMA 2ICEA 5IFJB 4YEFA 4Z8FL 3CSPA 2ATPA 2R0LH 3KHOA 4JM2C 3BW9B 3V5DB 3SO5A 3L3IA 4RRPA 3FB7B 3ETBF 4JKWA 2ZKHH 1ROWA 3DIFA 3I85A 4G8FB 4J7RA 3WIHA 1K4CB 2BOBA 3QJHB 4M5YH 3RWEA 1B2WH 4RMQA 2X4QB 1SBBA 4LKXA 5FA3B 2NLJA 1N0XH 3KNBA 4XCYB 1NEZG 3RWIB 3GBML 4U3HA 2YA1A 2YK1L 4P3DB 3CX2A 1IKNA 2VDQL 3ZKNC 4OF8A 1GGUA 3CU1A 1V3JA 3PHSA 3F5WB 3KYMB 3EAKA 4Y1AD 3C08L 5JPNB 5M95B 5EBLA 4U1SA 4FFVC 1HHKA 2LU3A 2QSQA 3P2TA 1IGTB 5FAAA 5BCAA 2H1PL 4R8WL 2GTWA 2ZNXA 2YWZA 5L8LB 3SCMC 4GW5B 3FAWA 3AMLA 2H45A 3L95B 1I4FA 3HAEH 3L3DB 3KPSD 3RY6C 3IETB 3MO1B 3WJJC 4HF5H 3V7AG 1SJXA 5JUEL 3RKDC 3M45A 1IGMH 1TNNA 4OLWH 2L0DA 4KK9C 3BYYA 1OGAD 1BVKA 4L1HA 3QI9C 3LQAL 3QIUC 1TJGH 5HSFA 4WI2A 5F7WC 1DUYA 1HZHL 5EC1B 1EPFA 3WE6B 5HD8C 3O4LA 3PWJA 1EEYA 3L5XH 1JWUB 2ARJB 1Q9WB 1C08A 1P7KB 4HLJA 1HXMB 4NFDA 3PJSA 4WTZA 1JPGA 1T83A 4DWHA 4U0RB 1QYGL 4LAQH 3GNMH 3K8LA 4OKVA 3I2CH 4ODXA 5E2VH 3EYSH 4YHZH 1FIGH 3O11A 3Q48A 3QHTC 4AMKL 4DUXA 2DWEB 3VXMD 3RDTA 4N0YH 5GHWH 4QHLB 2C3WA 5FYJL 1LD9A 4ZODA 1BQUA 4XP4H 4A2MA 1MFNA 4BFBD 1AGCB 3S35X 4P9HH 5D1QC 4NDMA 5FEBA 3MFFA 4S1RH 5I1DA 3T3PE 3N1GC 3SEPA 1OCWL 4WU5A 1KNOB 4RWHA 5CBEA 3DECA 5DD0L 4PJ7A 4FQIH 3O6LL 2J8UB 3WIHL 1CGXA 1R24B 5EN2B 4OCSL 2NY4C 4OD3H 3D2UB 5F3BB 4QRRD 3WUZA 3ARGA 2UWEF 3H42H 4HWZA 1N7ML 1RHHA 3BMWA 1WIUA 3CDCA 2AXHA 2IADA 5MHSE 3K2MC 2HJKB 1WBXA 4JQIH 1H9VA 3EDEA 2VXSL 3VWKC 5C0ND 2OCFD 3MA9H 4PG9B 3HLAB 4HG4J 1I7ZA 4X4ZA 3O2VH 3I02A 5D2LA 5IFJA 3O41A 5I15H 2Q86B 3W5NA 2RR3A 4HFWA 1F97A 1N5YH 3FB8B 4Z0XA 2BRRL 2Y6SC 4QHNA 1GJIA 1ADQH 4ORGB 3MOQA 5CD3B 5CZXD 3WIIH 4YHKH 3D3VD 3HNTL 4G6FD 1CXFA 1YEGH 1KB5H 4KQ3L 4LU5L 3T08A 5I16B 4Y4KB 3DMMD 4QHMA 1NFDB 2E8ZA 3HPJA 1DTUA 1MLCA 4PJCE 3LS5L 1U8PB 2FECL 4L4TB 5C0DB 3SJVD 4M43L 1FC2D 1FHGA 1JRHH 2ZCHL 1RPQA 5C0GB 4BQ8A 4HWNA 2P7TA 4Q74A 3PWPD 2O5YH 1JYWA 5A1AA 4EI6A 5I1KL 1Q9KA 3V6OE 2VDRL 4MDIA 3PDGA 5EA0L 2DQEL 3CDGA 5D2NE 1CICC 4AYFA 1CL7I 4NIKB 4JFFB 1FYHB 1OTSC 1MFEL 1IAIM 1HNGA 4IRSD 3TT1L 1HYSD 1EAPA 2JJTC 4UV7H 5CP3H 1SEQH 3FQNB 4L29A 2W9DL 4YQXH 2UZXB 2SEBB 4X5XA 2H2PD 3TEUA 4MZ3A 5HYSA 4S2SB 1MY7A 2VITA 5EZJB 4EDXB 1KPVA 5IKCA 4AEFA 3UJIH 4NHCH 3KPOB 4K23H 1NJ9A 5T1DL 1F42A 2FYYA 2XFXB 3MJ9H 1EEYB 4L4TD 5IFHL 3MRJB 1T7VA 3G6JB 1JI1A 2W59A 1F4XL 3VXUB 3SE3C 5B39B 2VDLL 2Z31B 2HJLA 1FSKC 2YUXA 3S6CA 2A0LD 3MR9A 1MCNA 4Q6YA 3GSUB 1K3ZA 3EDDA 4OM0L 3BQUB 3GK8L 3UBXB 4JPIA 4JKMA 1UB5B 2YC1B 3BGMA 3RWGB 3RX5A 3VFGL 3PDOA 5KVDL 3FTGA 4MXWL 1UM6L 2QEJA 3EO0B 1CT8A 4IRSC 5JTWA 1MUJB 4QOKB 4G9FE 4YUEH 3TWCH 1EHLL 3HUJB 3E6HB 2EXYC 5DEZA 3GKWH 1G7IA 3MODH 4FFYH 4WY7L 1FZJA 1BFVH 3IJYB 4GXUN 4Y16A 1UWGH 3VXPA 1TVBB 3NPSC 3NOIA 1V3MA 1HYRC 5IQ7L 1Z9SA 1D9KD 1MEXL 3LZFL 5J6HB 4LSRH 4PRID 3L3JA 4LK4A 1KULA 2XWTA 4RMSA 4KUCF 3FQRA 1OAXL 4UT7H 1URLA 4HWEH 4H8WH 3VFNB 4EN3A 4ELMA 2VLRB 5FHAH 2EIZA 4R9HA 2ATPB 1INDH 2GJ6E 1UVQA 5C8JA 5FGRA 5FYKE 5JR1L 4LQFL 3H8NA 3QDJE 3O2WL 4LF3B 4F7TB 3D0VA 5E99H 5IEHB 4ORZC 2YD4A 2EE2A 3GMNB 1MCIA 2HFEB 3U0WH 1JJUA 1TPXC 3V4VH 2CUHA 5D1XD 4YC2B 3HPLA 4M8QA 4O2EB 3WFCH 1E27A 1W8NA 1MJ7L 2X4PA 2DS4A 1WIPA 5DJ8B 5IW1A 2WQ8A 5EZOL 1OSPH 2KQMA 3BGAA 3JTSB 1O0VA 1BJ8A 2DQTL 1CICA 3IU3B 5JZ7C 1LEKB 3S3SA 5IF0B 1RJLB 4A2LA 4XPHL 2WK2A 1I1FA 4BSVB 5J1AB 3BDYH 3LHPH 5CBAB 1JN6A 3QUXA 5C09A 4JRYB 4MQ7A 3BPLC 5HVHC 3ARDA 3QPXH 2ITDB 1C12B 1DVFB 4N8VG 1VGKA 4WCYH 2R4RH 1EJOL 1NLBL 4K71B 4X6CB 2VQ1A 3HAEG 4JB9H 12E8L 1K8IA 1NLDL 2EE3A 1FFOA 1W72A 3MLUH 4ZQKB 4WFHD 3QEQD 4IRJB 3U9PL 5E24E 1QLRB 1OQXA 1T0MB 1F4WH 2AXGB 2JB5H 3GIVA 2YEZB 1XGUB 1K4DA 3QAZC 1QNZH 5E00B 5I1EL 3OF6D 2Q7YA 3DWTA 4KJYA 2HLFC 3CVIL 2A77H 5TE7H 3U7WH 2XNAA 1OWWA 1TDQA 2E9BA 1XGTA 1BM3H 5JIKA 5DVOA 1YEEH 3T65B 3FN3A 4QKXB 4ZOEA 3S3JA 3UCRA 1UXWA 4F57H 2F54A 2LABA 3CH1B 3W0WA 4HT1L 4NQCD 2FH8A 2VIRA 4J3VA 5IB4A 1N0LA 1HK6A 5DHVB 3GO1L 5AWNL 1F3JB 1VFBB 1U95A 1KJMB 3OX8A 5F72S 1L7IH 2NXYD 4I2XA 4O2FA 5GGUB 3NABH 2O5XH 1QVOA 3I50L 4OV6F 5DC4B 3DVIA 4YDLB 3HFMH 4N9GA 4WU7B 3EYVB 3TCXA 1S7RA 2AJSH 1RZ7H 4QHMB 1VFAB 4YHPB 2ZOKB 3GK8H 3O6FA 5ACMA 4XCCH 4CL7A 1OAUL 3MO1A 2GJJA 4BUGA 1X5GA 2DQFB 3PL6C 2YS4A 4JJ5B 2FIRT 4NKOB 4JFYB 3GJFK 5D7IA 4KJPD 5HHOB 1ZWIA 2A9ML 1IGTA 3CMGA 4NM4L 2VXVH 2KUTA 4NGHL 3GHEL 3SDDC 4RGNB 5E8NA 1LVEA 1CFBA 3V52L 4TULH 4L4VB 4Z0BH 2XQYK 2E9IA 5EB9A 2J7LA 5HHNA 5B21A 1EHAA 3QUYC 5JMRA 1CBVL 4GBXC 3V6OA 4DK6A 1WZLA 5DJAA 3U2SB 3ULUC 3GSUA 4I48B 3QQNA 1JE6A 4HKZA 5HYEA 4HWEL 4WI3A 3VXQA 1FGVH 1QO3A 1WC7A 2EEAA 5ICZB 4MA1C 4R4FH 4WVRA 5DJDB 1JWMA 1HINL 4PJXB 4NNYA 5CILH 1TJIL 3QI9A 5DD5L 3C09B 1NFIA 2XZQH 2ADFL 2FSEB 1HHGA 1ORSA 1U3HA 4MZ2A 2PW2A 1GIGL 3CFDA 5DJ2A 2BC4B 4NUJA 4F9LC 4TNVF 4YLQT 5C07A 4GAGL 2E6PA 2IANE 1R3LA 3BZFA 4NQEA 2XA8L 4ZXBC 5DC0A 3C5SA 2DTMH 3JV4B 1AGDA 3HNTH 1Q72L 3KPRD 2YPVL 3VGGA 3AM8A 3MJ6A 3ZYIA 4K8RC 2KQNA 4UDTB 1H3PH 2DQJH 3IDGA 4XBGA 1U92B 3V4PL 4OM0H 4LLYB 1A7QH 3G6AA 3NCEB 3ULUD 2AGJH 2CR6A 1BIIB 2XICA 1ZLVK 2UY7A 1JGUL 2EYTB 1INEL 4Z7VB 4XMPH 5EPMA 5B3NA 1WBYB 2Z8SA 3Q3GB 4B50A 1S7WB 3RWFA 2DQIH 4DOHE 1WK0A 1JHKL 1FORH 4JFZL 4K23L 2D7QA 1A2YA 3HUJE 1P5UA 2X4OB 5FYLD 2JCCA 4JHBA 3QNZB 5ANMA 4OF7A 2V2XA 4YDKH 3HRZA 4YIQB 3O6LH 4Y19A 5D2LB 3WIHH 2W9DH 4RCAA 4TVPD 1M7IA 2Q86A 3O9WD 3O3DA 2DWDA 2W65A 3PF2A 4AEIL 5IK3A 1UEMA 4YBLB 1X7QB 4CN4A 1IAOB 5DJYB 1HHHA 3PP3H 1JHLH 3SPVA 1JZ3A 3HZKA 3UZQA 4Z78A 1HQRA 2VE6B 1U8NA 1A6VL 3CCHA 1MCEA 2ZOKA 1EHXA 5IBTL 2IPTH 4XX1G 4QRUA 4O51B 1IKNC 2B2XH 4R3SB 3WFZA 3ARFD 1VFUA 1A1MA 2NY5H 1IE5A 3QUZB 2FATH 4KROC 1NCCL 4N8VA 2EO1A 4MJ5B 4XTRC 3TA3D 2FJFA 1OSPL 2NY2C 5FB8B 4IEFB 1A1NA 2BZDA 4LCUA 1CFSB 3JV6A 4IDLA 3DI2B 1J0ZA 3MLVL 4J1UA 4JRXA 4LEXL 4E41D 1OQOA 3VXOB 3QDGE 3GSVA 4IRJC 3MCLL 4L29B 4MAUL 4PJDB 1RULL 2V5YA 4NQXB 4ZS6D 5C70A 5I8EB 1A7PL 3K0WA 5C08A 4P4KA 3REVB 1OWRM 1VERA 3O2WH 4NQEB 2OR8A 4QY8A 4LSVL 2R2BB 1N3NB 1R5WB 3BIKA 3V5HB 5JW4R 5DJCA 2NY0D 3K3QA 1IFHH 4Y2DD 5KVFH 1I8KB 4F37F 1JZ6A 3BZ4B 5FHAL 4XNQB 5HI3C 5E6IC 4CDGC 1INQB 1M71B 2ITDA 3EJZD 5HDOA 5GISH 1Y6KR 1AH1A 4HDIB 5IOPB 4NHUB 2J5LC 3SE4A 3UJTH 1JZ7A 2JELL 3KJ4C 1QKZL 4N9OB 1IARB 1G9NH 5CJBA 2LE9A 5E4EB 3HZMA 5I1HH 4WFEE 2CDFB 3RZCC 1B90A 1CGSL 1OT2A 3OKDA 4GO6B 2GJZA 1A22B 1TENA 2X4PB 5IVXB 2BVOB 4E41B 1U8JA 2H3NA 3IRPX 3P30L 4J6RL 3RTQC 3RUGF 5ITBL 5T33L 4HS8L 4KKBC 4Y0GA 3FKUS 3TN0D 5I19L 1INEH 3ZT7A 4KI1A 4DN3L 1XGQA 3O6KL 3UTTB 3O3DB 2NY0B 2MMXA 1IM3B 3KPLA 4I3RH 1KTRL 2DIJA 3ARPA 3WNPA 4WI6A 5DURD 5E2TH 1DCLA 2BSTB 1QLEL 3RX7A 4NQEE 4JM2D 4DFIA 3ALWA 3U36B 4KJYB 2APXA 1JYNA 3U4EA 1HI6A 1D5MB 3NAAH 5F96H 4ZUUB 2OZ4A 4H8WC 2V2WB 1HSBB 4WEBL 3WIFA 3FT4A 4P23D 1UB6B 2UZIL 3F12A 2FWOB 5HHMD 5BQ7A 1IKFL 2LVEA 3RL2B 3RY4A 5F9OH 3F7VA 3CU7A 4CRPA 4GG8A 4P2QA 2XZQL 4G8GD 1Q9OB 3VXTB 4ZAKB 1R5IA 4ZSOB 4NFBA 1KN2H 3V0WL 3ZTJH 4MNGE 4TTGA 3ARDB 1MFDL 2VLKD 2F5BL 4MB4A 5TE4H 4KJWC 4UAOC 4LCWA 3IFNH 4Z7NE 1MIMH 1G7MB 1ZA3B 2G5RA 2P8MA 5CJOH 3T0ED 1FGNH 1I3GL 1EXUA 5INDB 3QDMD 1S7UA 3ECBB 2PETA 3VFMB 1HKLL 1MAML 1CVSC 3WFBL 4WUUE 1C5CL 4ZUWB 1C5DA 1CD9B 3NMEA 3PQYE 1ZSDA 5GSRB 2VISA 4P23C 1I9IH 3GJFH 4FQPA 3PQYA 5LVEA 1CDUA 3JV5A 2I60H 3SE3A 3UO1L 4OJFH 4M7KH 1UM4L 4XZUA 1RVFH 1D6EA 3RVXD 4P46A 1MJJB 1E4KA 3FFCB 1HH6B 2D4FA 2YMXL 4U4BA 4XNQA 5GS0C 1B2WL 4OLEA 4KDVA 4NM4H 3K1KC 1MF2L 2VZ1A 4I9WE 1AY1H 1X3DA 4YHOL 4X8XA 1SQ2N 4G8GB 1Y18B 1NCWH 5DUMH 3ARBD 3V4UH 3QFDA 3VFSA 2AEQH 3AREA 5DK2B 5GRYA 4KRPD 5C6PB 3SPVB 1RIHL 1JYXA 1I4FB 5ISZA 1BEYL 3ARYA 4HGKC 4ORGA 2YD3A 4NN5C 5ID1A 2BDNH 4JO3L 4ZSOE 1CFTB 4GLRH 4YWGL 4P2OB 2F8XC 4WJ5B 4JY4A 4PRDA 3VA6A 2A6KA 3GSOA 3TJEH 2E3VA 1S7TA 4XGZB 3F62A 1ZWIB 5HHXH 2ZG2A 4Y4KC 2F74B 1C7SA 1I1AD 2BNQA 3D48R 1CGWA 1NUGA 4MD4A 1NPUA 3O6ML 5I71C 1CGSH 3U0TB 1U8OB 5CJQL 3TZVA 3T4AB 3LKPB 1R3JA 4RIRB 4X0KA 1HYSC 5A2KH 5DD0H 3EFDH 1M7XA 1QFWL 3MLPA 1R3HB 1JHTA 3GB7B 5D9SA 5JHDE 4X4YB 5F7MC 1A1OA 3MXVL 1FQ9C 2YR3A 1IFHL 5KVFL 4PLKC 4G9FD 1I3UA 2E27H 1A0QH 4HQQH 5DZNA 4JRXD 1MRCL 3DXAD 4HUNB 4Y8AA 5I1DB 5T5NF 1BD2B 3WBDA 5J56B 4IM8A 1S8DB 5JQHC 4AMKH 4ZFOL 1JTTA 2P8PB 2Y06H 5TH2B 4JY5L 3JXAA 1QFHA 5EU4B 2R4SL 3Q2CA 3EYOA 4NUJB 3BZDA 1YMHA 1KGCD 2UY6A 5FYKU 4QHUB 4JANA 1QRND 2XKNB 3EOAA 4NN7C 4GAJH 3ARGD 4U6TA 1LWRA 1ZTXH 1OP5K 4Q58C 4WO4D 4QTIL 1HOCA 5E4EC 3I9GH 1PG7L 1OAZL 3VXRE 1S5IH 3IDXL 2DQDL 2EZ0D 5J3HC 4JFEB 3SKOA 3V8CA 3UJTL 4ZAKA 2ID5A 1EGJH 4P46B 3X17A 1Q9WA 1GH7A 1UJ3C 5JMOC 3D39D 1WZ1L 3R0NA 2OXGA 3OL2A 4M6ML 4NRYB 3TYGH 2VXQL 3JVGA 2VDNH 4ZOCA 1JK8B 4UNUA 2GUOB 4R26L 4P99A 5SV4A 2F53A 3EJYD 4P4KC 4NP4L 4ODXB 4AM0B 3DXAE 3QZWG 4G8EB 2GSGB 2DLTA 2VERN 4HFUL 4JQVA 4FABH 3VD4A 3VD7A 1MHPL 3OMZA 5D72H 3MLVH 2H2PC 3RVUD 4DKDC 5K9QG 2YK1H 3LOWA 1Q9OA 3ULVF 3RWHA 2VLRA 3SBWA 2PCPA 1D5IL 4KROB 3NIDF 3BP7A 4QEGA 1BQHA 4C83A 1YDPA 1NBZB 4GG6E 1NAMB 5HYSG 2HFGL 3IDMA 1JNNL 3C6LC 3ULUE 3C5ZD 5FA4B 1CL7L 1MH5B 2D03H 2N1KA 2CDFA 5ADPL 4M7LL 4HKXA 5C08E 5DD3L 3ELAT 2A0LC 1NUFA 4ZO7A 1RIVL 2VLKA 5B8CA 1I1CA 4ERSL 2H6PB 2MKLC 3C60D 3MRFB 4PV9B 1NCUA 3EO0A 1IL1B 4UTAH 1I7TA 4GJTB 1ZLSH 3WHE0 3INUL 4NDMB 1JGEB 5EBLB 7CGTA 2HRLA 1B4RA 2IPKB 3RBSA 3U1SH 1I3RA 3QPQC 2DM2A 1WBXB 4YHLL 1OAQL 4JRYE 2AERT 4MJIB 5ESVB 3VFUB 3MRKB 2X1PA 3S35H 5AZEH 3BGFB 4PTUA 3O3AA 1EVUA 5EG6C 1U8JB 4QRTA 4WFGD 4IRJA 4UIMB 3D5OF 4M7JL 2ADJA 5GRZA 5HYQB 2A38A 4S0TD 3MV8B 1DR9A 2JJTA 1A7OH 4L8CA 4UDUA 4O02H 4ODHL 4QXWA 5TE6H 4GSDL 3W39A 4KVNH 4NYLB 2QSTA 4ZYKA 3IU4L 3SGKA 3B9VA 2AQ1A 3UC0H 4P57B 3SDDA 5C7XH 2QQQA 2HP4A 5BJTA 1KJ3H 2PO6D 3C60B 3LKOA 4XX1E 4WDIB 3RVVD 1BPVA 1BAFH 3RIFK 4APQB 4R7NB 4XXDB 5FKAA 5I8EA 2MSPA 4MNQB 4JN2B 3JVGC 1HIML 1U93B 4IOIB 5E5MA 4NPYB 1LP9A 2CJUL 2DWEA 1YN6B 2BY0A 3BKMH 3KHQA 2JIXD 2VLKE 1AY1L 3G6JE 4YDJA 5HYJD 3MBED 4LCCA 3STLB 1WQVT 4LIQE 2PKDA 1FFNA 5HHME 2ZP0T 5J9PA 5C8JB 3MLXL 4LHQB 4X83A 4L9LC 4KXZH 4ZSOA 3STZB 3UTSD 1E6JH 4W6WB 3RWDB 2V2TA 3QXUA 1IGYA 2FX7H 5LAXA 2VXSH 1KB5A 1X5HA 1BZ9A 1OGAE 1RZ7L 2XTJB 3QIWC 2MFNA 5CCKL 1ACYH 2VWEC 4LSQL 4AEHL 5IB1B 4JR9H 2BSTA 3IDMB 3VG0H 4YDLC 5GJSL 2X10A 1T4KB 4G9FA 4GQPH 5TE4L 5CMAA 3PGCB 5IJVA 3DSFH 1SVZA 1WAAF 2A83A 3LKRB 3C6LB 4PG9A 2PTVA 3V52H 4OCRH 3G5XA 1TIUA 4HXAH 4CMMA 3PV6B 4LSPH 2EIZB 1CN4A 1AR1D 1TZHA 1PQZB 1PJ9A 3O8XB 4NGHH 2EYRA 4PB9L 1VA9A 2AEIT 4FZEL 5KN5A 3T0AA 1VEPA 1T1WA 4XVJL 4L3CB 5C0AE 2XN9A 3QFDB 4RMTA 2DI7A 3MLUL 1G9ML 1K3IA 4X0KB 1MH5A 3T2QA 2IQ9H 3MUZ1 5B39A 3K8KA 5L6YH 4LHUA 4KJPC 3DETC 3W0WD 4D0BA 3QPXL 5AUMB 3W9DB 3WXVL 2CLVB 3ISWA 4LPWA 4G3YH 4PJHB 1EH9A 3VG9B 3GHBL 3MRGB 1OD9A 2BNRB 2HFGH 4FFZL 1A8JH 4WTZG 1CQYA 2W9EL 5I8OL 3O4LE 4U6VL 3G9VA 4LBEB 4N1HB 1ZVHA 3O2DA 4Q0XL 1DFBL 3WUWG 1X9QA 1XCQA 2FB4H 3L3OB 4EVNB 4J8RB 2WBJB 4JDZB 1WUNT 1PZ5B 1U92A 4Z7WA 5I1IH 1IC7L 1QFWI 4U3CA 4YDVA 1FFPA 2P5WA 4OLWL 4O2EA 1YNLL 1Z0MA 2JCCE 2XNAB 3SE9L 1L4IA 4HUWA 1JNHB 4JN1L 5E00A 4OT1H 4MCZB 3VGAC 1CLCA 4KK8D 3TYGL 5CUSH 3UTOA 5C2UB 4P2RE 3QQ4A 1CXLA 5CHNB 2Q76B 3SOBH 5FK9B 2Q8BH 5IMMB 1QO3B 1WC7B 5ICZA 5ITFB 1A3RH 5DA0B 3ARUA 2EXWD 4MX7A 1DVFC 1SYVA 4HEPG 1DN0B 4JEGB 4XPTH 5HHPA 1MEXH 3VCLB 1CIDA 4ZOBA 3UTZB 3ULSA 3D2UD 4QRRB 1F4AA 1F00I 5GGTL 3QXWA 5EBMB 4TUJB 4FFYL 4WY7H 2QTEA 4MA3B 4FQXD 2E7BA 4QHUA 5SWZA 2MPAH 4PV8B 1IAII 4I3GA 4KKAD 4PRPE 3QNYB 2B7DT 3BP6A 1FZMB 3MJ8A 1JI2A 3NCJL 1QBAA 2GTZB 4XP1L 2X05A 1YEKL 2Y06L 3U6RA 4XTRD 3TA3C 4FZ8H 5HGDA 4YXLH 3L3GB 3VFWA 2Z35B 5KTEH 1R3IH 1RU9L 1X5AA 4K3DH 1MY5A 2MHAA 4P59H 3CFKA