1HKFA

The three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
SKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NK CELL ACTIVATING RECEPTOR
publication title The Three-Dimensional Structure of the Human Nk Cell Receptor Nkp44, a Triggering Partner in Natural Cytotoxicity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hkfA00
4ZTOH 1IQWH 1BX2A 1G9MC 3CFDA 3DECA 5DJ8A 2IANE 1MAKA 3OKOB 4FG6D 5IHUH 2C1OA 5GS0L 1BD2A 3MLTB 2F53E 4GOSA 1MHCB 2CRIA 3LKQB 4TVPH 4WVRA 5EUOE 2FGWH 4JFDA 1MFNA 4JRXD 4YZFF 3UBXB 2DQEL 3CFKB 5EOTB 3I84A 1KEMH 2P8MB 3FQUB 1Q9LB 1D9KC 1MOEA 3FQTB 4U3CA 4YUEH 4IIQA 3PDOB 3MOAH 1EGJH 3HN3A 3DMMC 5LGKA 4JR9H 4AT6A 4BUGA 1JFQH 1V7NL 3CXHK 2AJSH 3IAQA 5GGUB 3QO1B 4BQCA 4WFED 4YC2B 5I9QC 4GLRI 1OW0C 1PEWA 3MRKA 4M7JH 4PJEA 2E9JA 4ELME 2G5RA 3BW9B 4XP5H 3VMNA 1WC7B 3BP4A 3UTTE 3VXPB 5K59E 4IBLT 4OIIL 1IC5H 2WBJA 5F71A 1N5AA 4PGBA 5T1DL 4D0BA 1E4XH 2NY3B 5E0QA 1QSEA 5K93A 4BZ2L 3T2OA 2XTJB 3ARFC 4KU1A 5KTEH 3LV3A 2F8OA 1YEGH 2O93L 3SQBA 3E6FB 4YHIB 3NACH 5BVJA 2R2EA 1FZMA 5CMAA 4RIRA 3MRRB 1XIWD 1IAIH 3DSNA 4XWOC 5TQ2H 4XMPL 2J2ZA 3GBMH 3CZFB 3NPSB 4L3AA 4R0LC 5IBTH 3MRLB 4ZO6A 1DBBL 4MVBD 4WI2A 1U42A 1X5AA 2HFGL 5CBAB 4NGHL 1NMCC 1S9VB 4XNXL 3IFLH 1F2XK 2X4PB 3ZMRA 3O2DA 3T65B 2AABH 5HYQB 3DVGB 2MPAL 4LLWA 3T1FB 1KN2L 4EZMA 5SWQB 4N1CA 3T77B 5J06A 4F2MB 3CVIL 3SDAB 2ID5A 3IVKA 4M6AA 4GXVH 3LN5A 3CFEA 1G0DA 4IIQC 3QH3B 1Z3GL 4X5WA 2AXFB 3GMMA 4Y7MA 1SJXA 2X4UA 4X8JA 25C8L 1NLDL 4OZFB 2NLJB 43C9B 2KZ1B 3HNTH 4P3WA 1IM3A 4TN9A 3MLRH 1UM5H 5E94B 3OKKB 1U8LA 3HI6H 15C8H 3O6KH 1MRFL 3T0EA 1R3IL 3FT2A 3GK8H 4KUZL 1Y18A 5DD6A 1N59A 5CHNB 1RZGA 4LVNB 3O9WA 4QHUB 1Q9WA 3A67L 2HTKD 4I0PB 1XGRA 1FVDA 3S3JA 3HI1A 2WBJC 4XWGL 3CSYB 1JZ6A 4R26L 4JCLA 1BBJA 5C0GB 1Q1JL 1MCRA 2BERA 1NPUA 3GI8L 4GRWH 5JOPE 1EVTC 3ZDYF 3MNZB 3TJHD 4DOHB 3SDDC 2WIIA 3LEVL 1NGXB 1RMFL 2C9AA 3QP3A 4HXBL 4OB5L 4Y4FA 1YNLL 4XVTH 4K7PY 5J13B 5GZNC 2B0SH 3HTLX 1TJIH 2NTFA 2NY6B 4HBCL 5CEZE 4UT9L 3WFCH 1F5WA 4OCMC 3LPFA 2ILLA 5F7DB 1ZA6B 4XVUC 4WO4D 1H3WM 1S9WA 2GFBA 3B5GA 2ZNWA 2HT2D 3QPXH 3T3PF 5HGDB 3RPIA 3GM8A 3BGMB 1I9IL 5C0BD 4WFFD 4OLXH 3VE0A 2GSIA 1LDPH 3IDJA 3LKSA 1JN6B 3GHBH 2VSCA 1KPVA 4L1DA 1IGTA 1NGWB 4QGTA 5JLZA 4Z8FL 1CS6A 1T89A 3LQZB 4L9DA 1RZ7H 4F37K 1TJGH 1WIOA 3QIUC 5EU5A 4LNRB 4L8SC 4Q6IB 5LWYL 2X70B 4M02A 2CK2A 3GBNL 3CDGB 5FHBH 1LO0L 5KW9H 3D0VA 2CGRH 3UC0L 3K1DA 1GC1L 4M6OL 4Y19D 2OYPA 5IB4A 5IT2L 2LU7A 2EYRB 3DXAD 3MJGX 3U4EA 3LKPB 5IM7B 3BP5B 4U1KA 2J88H 1PZ5B 2C5DC 3TT3L 2DAVA 3B5HA 5L9DH 3F12A 1L0YA 4NM8L 1GZQB 1FORH 3BP7B 3VFWB 2X9WA 4L3CA 4NRXB 2XWJB 5IHBA 1YJDL 5DR5H 3CNKA 3MBXH 2BMKA 2DQJL 1OP5H 1AP2A 3PP3H 1J8HD 3CCHB 2F74B 4JQVA 2YD2A 4Y8DC 1O0VA 2H2SC 1J1OH 4Y4FC 5DRWB 2X4RA 3P9LB 3PWLB 4LFHG 3IJYB 1JTOA 2B5IB 5C0CA 1OTUD 3DHJA 2IPTL 3ZKXC 1D5ZA 3HZKA 4BSVB 4ODSH 4PRAB 3KYOA 4U0QB 5CEZH 2VLKA 3MGTB 4WEBH 3BZ4B 4ZOAA 2NTSP 4HWZB 2D3VA 5HHME 4R8WH 2CXKA 4MAUH 1H8NA 1RZJL 4YAQA 1SEBA 1FRGH 4LPVA 2JJTA 3E3QC 3UMTA 3P4OA 1IGJA 1RFDH 2WLYA 5D6DC 3FQNB 2EEBA 4P2QB 3HNVH 4OCWH 4OGAD 5T3XL 5EUOF 3RGVA 4UBDC 4XBGA 3VXMB 2KQNA 3S9DB 3SBWA 4WGWB 2Y07L 1MF2L 4DFIA 3EYQC 1P6FA 2A73B 5H37G 2BSTB 4U3XA 1C8PA 5FIEA 5IB1B 4YDVB 3X3GL 4AMKL 3BGFB 2EO1A 3KXFE 4I9WE 4U1IB 1H3PH 5D7LA 3SOBH 3G6AB 3KPRB 3SEPA 3M07A 3LRGA 1CYGA 3DJ9A 1NBYA 2EDYA 1AKJB 4IRSA 4LCUA 4NKMB 3WFBL 2VIRB 3TBWB 1JVKA 1AO7E 1L7TH 3D3VA 3VFOB 4Y16C 5TJWK 4X0KA 2FJFA 1HI6B 3IKCB 3V7AE 2ZUWA 4ZUUB 3MRIB 1QA9A 4ELMF 1FG9C 4ZXBD 3TIDA 7FABL 2C7UB 3DX8A 1MCEA 3EDDA 3Q0HA 2EECA 4FQLL 5K59F 4GG6B 3EYUL 4HIJA 2F15A 4IRJB 3V52H 3HG1B 5FYJE 1QSFE 5EWIH 3UJJH 2AK4B 4RMRA 4P23B 1YUHB 5ITBH 2DD8L 4QRPB 5D7JA 5IFAH 4HIEA 4WHCA 3HLAB 1KTLB 1MY7A 4KFZC 1HNGA 3TVMC 2J8UA 1CDYA 1VFBA 4XCFH 1NGQH 5HGHB 3PF2A 2NY1D 1AGCA 3MMEA 2P8PA 4TSCL 4LP4A 2KUTA 4OSUH 4GMTH 3ARGA 5HDQH 3ES6A 3U7YL 3BH8A 5DK0A 3U2SB 3B3IB 3RKPA 3VA2C 4FXGB 3SQOL 4D0CA 3QEQE 4NFBA 2XTJE 4Y4KD 5AD0A 3SBWC 1KLUA 3WUWB 1KSRA 1S9YB 4I48A 4ZFGH 2GTZB 1LEKA 3VWKB 4XCCL 4ZUWA 5CJXC 2LE9A 3RL2A 4P2RD 5C7XL 4P59H 5BXFB 3QR2A 1R3HB 5FA4A 1B2WL 4PJ5B 3TGXA 4ONFH 1MPAL 2FD6H 3AAZB 1OM3H 2DI8A 4HK3J 3V6OC 5EZOL 1Y6MR 1Q9KA 4W4NA 2ZP0T 5L0QC 3QULA 1OVZA 2NY4D 3KS0H 1FSKC 3QXTA 3RY4A 1KN4L 5F1NB 3AS0A 5FUCC 3EOTH 1VGKB 5L8LB 3MLTA 2YA2A 3DX9B 3TA3A 1TETL 5BQ7B 3QO0B 1BZ7A 5SX5H 5D2NA 3MNWA 1DUZB 1FQ9C 2CMRL 2VXQH 5IBLC 4W70A 4K23H 1S7UB 3C8HA 1I8KA 4ZNEA 1AHWC 5F9OH 4OT1L 2HT3C 1H3VA 2DOCA 1JYVA 2YMXH 2XFXA 4NQCA 1LO2L 1XH3A 3MACL 4JFEA 1ZVHA 2I24N 3TZVC 5T3ZE 5JXAH 2AP2A 2VZTA 5FYJH 2X4NA 5I66B 2CUIA 5ID0A 4RA0C 5DRXB 4DKFH 4LHUB 4O2FB 3QDMA 4RRPA 3QRFM 5D7JC 1FBIL 4LEOB 3IDYB 5B21A 4RISL 5DD0H 4JFXB 3FO1A 3VMPA 4NOFA 3OG4B 1KEGH 4LPTA 4YXKL 3BWAA 4ODVL 4X6DA 3VI3F 3MJ9A 2A0LD 5JA9A 4K3HA 3MJ9H 4TYUA 2LVCA 3HMWH 1YDPA 4Y2DD 1EUTA 4Q9QL 4BFGA 5EBWA 1RUPH 5ISZA 1ZT1B 4ALAH 1WC7A 4NUJB 2OTPA 3M1BB 2Q7YA 4AIZA 1QBLH 4HJJL 4PGJA 1RAMA 1UH2A 3U0PB 2ENSA 2OJZH 1XF4B 4G8GB 3ZT5A 3BAEH 3CZJA 5F9JA 1LEGB 4ZODA 1HHIB 1E27A 4U0RC 2P42B 2ZUQB 3V9FA 4DOHE 3UTQA 4JN2A 3MRRA 3FFCB 4GAYB 3OXRA 2WUCH 2WINA 3IFOA 1D7FA 3W2DH 3D9AL 3QAZC 5C07D 4WHTB 1EA9C 3F8UB 1F4HA 1BQSA 4XAWL 1II4E 3IDUA 3BN9C 1J5OH 1Q94A 3DSFH 3TA3C 4L4TB 1S7QA 1QR1A 4HWEL 4L9LA 1OP5K 5I74C 3G5YA 3T1FA 3PP3K 2VXSL 3KYMB 3LMJL 3JVGC 1CD9B 2KZWA 2I25N 3E6HB 3TN0B 4ZQKA 2EDJA 1JWUB 4JREC 4F33B 2ESVA 3QNXA 4AH2B 1JYWA 2DQGL 5FF6A 2GTWB 4OZFA 5T3ZH 3MFFB 5CP3A 3UX9B 1I7ZA 1IKNC 3BN3B 4D2NA 3ARDB 2V6HA 2ARWA 4FFZH 1NJ9B 5GRJL 4U6HB 5K9KA 3HR5A 4NIKB 2C4FT 2E8YA 1JGUL 1OGTB 3CU7A 1U2HA 1VHPA 3ZKND 2HFTA 4KROB 4I0PA 5JTWA 2XWBB 4N5ED 3NCJL 4KTEL 2Y6SC 1DZBA 4TUJA 4GKSB 3WKNA 1FVCB 3T4YB 2WBKA 1UB5B 3N1GC 4XT1C 1MRDH 4IRZL 5F96L 1LO3H 4H88L 5GS0C 1ADQL 2GJZB 1WFOA 2KKQA 2ADJB 1DBJL 3S4SG 1IAIM 5C0AE 2R1YA 1DSFL 3QQ3A 5HGBB 4KPHH 4MA7L 4LLMB 5B3JF 1KNOA 1IGFL 1Q0YL 1UWXH 2YA1A 4YK4B 1P4LB 3MLZH 5ADPL 1OAUL 3KLHD 4RAUA 4WTWA 4QOKD 3H0TB 4QTIL 1FFOB 3QEUA 2FEDC 4ZG1A 1A22B 1CE1L 2XXMB 6CGTA 1CICD 2QADD 1FFPB 5DRZA 1JJUA 1ZXQA 3U48A 5CD3A 1FP5A 5EU7C 2P44B 3CSPA 4NYLB 4FQQB 4L9LC 5I8CB 4M3KB 2IGFL 3KLDA 4P2QE 4ETYA 3U7WH 1FL5B 1HHKB 3VXME 1NGWA 3QUYD 2NXZC 4RGOH 4WFHD 3MV7D 5AUMB 1F11B 4HWUA 3FZUC 4QKXB 2B8OT 2BFVH 4LNRA 4EDWH 3STZA 3A67H 3C5SA 1SBSH 3D48R 4GKZB 4BQ8A 2X70A 2PN5A 1DDHA 2ZSVB 3KPRE 5CZXC 5F3HA 5EOQL 1A1MA 3I6KA 3ZYOA 3NA4A 4P5TD 1GIGH 3OR6A 4MJ6B 4N0CD 4FTVD 2CJUL 1YEJH 2QHRL 3D69B 3V79C 5E2VH 3AC0A 5C2BL 1YNKL 2JJSA 2ED7A 3MRQB 3LKNA 5HJ3A 2HMIC 2B4CL 1INQB 4XVSH 4KAQL 1PZ5A 2ZNXA 3BWUC 3CDYA 1FNGB 4I77H 3INUL 4HS3A 1GZQA 3ARFB 3OJ2C 4Z0XB 1I1RA 1HIMH 2YD4A 3B5TA 1U8MA 3AM8C 5DQDH 3VG9C 4CU8A 2BOCB 1ACZA 3A6CH 4FN0A 5EPMB 5MP6L 1DEEA 1NFDA 2PYEB 2AK4E 5IEKA 4U6YA 4O4YH 4DQOH 4R0LB 3QDGD 4H0GA 2VXUL 4LSSH 3DV4B 3O6ML 1T83A 4MDJB 2A6JB 3T8XA 4OM1H 3MGTA 3U9UB 1P7KB 2EE9A 1A4KB 4NQDB 3OR7A 3L1OH 4WI7A 2D7MA 5SX5K 3BYYA 1JYXA 4GLRH 1UXSB 2C3WA 4R4FL 3ARED 2IAMB 4XPGH 1JZ5A 4QXGH 1MCSA 1UADC 1FC1A 3QEGH 2DS4A 3ROLA 5KZCD 1ACYH 3QJHB 4PRIB 1BQLH 2NXYB 3UZEA 3QUKA 2AJ3B 4ESKA 4F3FA 3N9GL 3O8XD 4I4WA 1MCDA 3UYRL 1BOYA 1F00I 5KG9B 1FN4B 1R5IA 3SCMC 4DGYL 4JZNB 3GFUA 2CO7B 5IB1A 4DN4L 1RHFA 2DQDH 4Y1AE 2ATKB 2BSRB 4G3YL 4WI8A 4G6JL 4N0YH 5LQBH 1PD6A 2GCYB 1NC4B 2ZCKL 1IGYA 3C6LC 3GIVB 3QQNA 3VH8A 5I1DB 4LLUA 1UH3A 4U1NA 3DRTA 1AKJA 1CL7I 1DLFH 5E6IC 2JJSC 3SJVB 5C3LD 4B50A 5CGYC 2VDKL 4JKPL 3ZHLA 4I0CC 4JE4B 5DUML 4PFEA 3VJ6B 3PDGA 3MRIA 4Q9RL 1DQJA 1Q0XH 2V5RA 3MFGB 4H8WL 4L4VD 3ZLQC 2IFFH 1MVUB 3R8BB 3V6ZB 4TNVK 1WBZB 3SDDB 3VXSB 4PJDA 2QR0B 2JK5A 4LRIC 1T2QL 1MY5A 1QYGH 1R6VA 2Q76A 3DWTA 2VUYA 1P4IH 4O2CA 1QRND 1OOAA 1VADA 2FLBT 4P23A 4K3DL 1Q8MA 2N4IA 2W9DL 2FRGP 3LY6A 1T83C 4QRPA 2WP3T 3MRJB 3G5ZB 4H25B 1M71B 4YHKH 2YPLA 4M5YH 2EDRA 4CJ1A 1U8NB 3OTTA 3MJ8B 4P46A 3BD3A 4NQTA 3ZSTA 3RP1A 3VXRA 5JIPA 4APQD 4PJHE 2FL5B 4EOWH 1I1AC 3QQ4B 1RI8A 2FIKA 3L7FB 1JMXA 4FXGA 4OF7A 4D8PA 1KF9B 4G8GE 1XR8A 3QIUB 4G7VH 4X80H 1CE6B 1S9YA 4L8SB 3UO1H 3WLWC 1S3KH 4JRYB 2GTZA 4M5ZL 3O0RH 5JW5B 4JO1H 4WU5A 1I7RA 4L3EA 3HB3C 3FO2A 3K46A 4HUMB 1LO5B 1FLTX 4LCIH 1DQDL 4MB4A 3WXWH 2VQ1A 4Q2ZB 3OB0H 2CLZB 4OCSL 2XOTA 4J3TA 4MWFA 2R0LH 4YDIL 2UZIH 3QYCA 1IAOA 3WHE1 5MEQA 4WW1A 1RK0B 2HTLD 2ZCLH 4ETQB 4YR6A 2F5BH 3BKYH 4OQTL 1IC7H 1IBGH 2BVPA 3MNVA 4OGXL 4Y0GA 1DVFC 5DVKA 5FHAH 2NY7H 2AV1A 2WW8A 3V5HA 3GMRB 4Q0XH 4OZIB 1FFNA 1NCDH 4J3OC 1KYOJ 5AAMA 1RZJC 5C0RH 1UWXK 3KHQA 3EGSA 3F5WA 4OUUA 1V3KA 3MBEA 4HUKB 1A3LL 1CTNA 3QB7C 5ENWB 5BOPA 4XCNB 3O3AB 4OUOA 2VDOL 1F6FB 3MLPA 1J05B 3JV0A 4P46C 5KSAB 5FUZL 2OK0L 4OF8A 5IVOA 2FGZA 3I50L 3RY6A 3G9VA 4YDLB 2J4WH 4DGIH 1G1YA 3VDBA 3HPJA 1XAUA 3K2UH 5I1JH 2FZ3A 4CW1B 2GKIA 4XAKE 2BHUA 1XGPA 5EZOH 1WBYB 3PWVB 3BIAX 3VW3L 1BAFH 3SE4A 4XCEB 4BA8A 2Z93A 4NWUL 1WFNA 1KPUA 4GAYA 4PGDA 4E41D 4LSPH 4GSDH 4ZO9A 3EOBB 4M43H 5HHOD 4D9QD 1FO0B 4KQ3L 4JO2L 3W5MA 1E6OL 2L7JA 1VFAA 5DJAB 4ZAKA 2R9HD 5E9DA 5GIRB 4Y16B 4IHOB 3HMXH 4AIOA 2OR9L 2D2OA 2VDMH 2JB6A 4GKOA 2HRPL 3ULVD 3C2AL 3R1GL 1LK3H 1ZVSB 2P43B 4N9OB 4MQXC 5ANMA 5CIPB 3MLWL 1KXQE 2AJZA 1U9KA 4MJ2A 4YXLH 12E8H 4ERSL 1NEUA 2P4AB 3QDJA 2IBBA 4QHLB 3AB0C 4YBQC 2BCKB 4JY4B 4F33A 1N5YH 1GGIH 2YHGA 4BH7A 1S9XB 1IGCL 3TFKC 1A6AA 3IYLW 3QT2A 4LPXA 3MC0A 5C9KA 4FABH 4U1JA 1AFVL 2AEPL 2X4SB 3TVMB 5HDBF 3QI9C 4OLUL 3DARA 2YN3A 3MZTA 2B1AH 1RIUH 4FXKA 1CXIA 3B9AA 4NJAH 1C5DB 1HN1A 3RVUC 1P2CA 1B0GA 1FZJA 5HI3C 3L5XL 4JM2F 5F88B 3VCLB 5TDNB 3MODL 1KPRA 1KULA 2GUOB 1PFCA 5DFTA 5L2KA 3RQ3A 4C57C 3QBTB 2OTWA 4CVZA 2IFGA 3TBYA 5CINL 1HXYA 4S1RH 3VRJB 4HDIA 2I5YH 4X4ZA 3O11B 3RU8L 4ZUTA 2ZJSH 1IGIL 2PYEE 4M3JA 2EIEA 5L0QB 3GMQB 5DVLA 5JZ7D 4PJFA 5I76B 2AJXL 4KK9C 4HV8A 3SE3A 3PQYD 4HWEH 1XGUA 5HVWA 1P5VA 4XTRC 1G9MH 5IMLA 3L3JB 4YEEA 1CD0A 4LASH 4NQDE 4QCIA 5A2IH 5HHNB 2LTQC 3FO0H 4HKZA 1DBAH 3BEVB 5KSBA 1OAKL 3NIGF 3HNSL 4RAHA 3DURA 3THML 3QCVL 2R69L 1S7XB 1CLYL 1A6VL 1WVZA 2WUBL 4FQQA 4GO6B 5H37H 5I8CA 4K7FB 1OGAB 4HPOH 2AV7B 2H32A 4PRIE 5D7KE 2FBJL 2DLFH 4M1CC 4HKJB 1AD0A 3TZVB 4X4YB 4GRMA 3VD5A 1QBBA 3BKMH 3Q5OA 1W72L 3EZJB 5FK9B 2JIXD 4OI8A 2XZAL 3BZFB 3BP6B 4HMEA 1AIFB 4PJEE 2DDQH 1PAMA 4JG0H 1UJ3C 3HZYB 4UIMA 5C0EB 4I1NB 3MOQA 1ADQA 2VDPH 3OAUL 4P3DB 4C83A 1CDIA 5DA0B 1I8MB 1M7DB 1P4BL 4YFLI 5FYLE 4J4PA 3RTQD 1JGEB 3HCVB 3SPVA 1JTTA 1NCAH 4K9EC 2FYYA 4HAFA 4ZUVA 4PRHD 4WUUD 3TBSA 1IGFH 2MJWA 5I73C 1ZHBA 1I9RH 4Z0XA 1U2CA 4PJHF 2XQYG 4U0RB 3VXSE 2DQUH 2J6EH 4NFCA 3RBGA 4DFHA 4QEGA 3O3UN 1GJIA 5FYKH 2HH0L 1PSKH 3O4LB 1LK2A 3RIFK 1GYAA 5DWUL 4HX1A 3MV8B 4FXLA 2Z4QA 3DV4A 4S2SB 2B2XL 2A6KB 4NSKA 2X44D 3I3DA 1A4JA 1TNNA 4E5XB 1A4KA 4G9FD 3L3DA 5IIEA 1L7IH 1QSVA 2CKBB 3DGGB 1RIHH 4OD1H 5CKAA 4PRDB 3VFMB 2PCPB 4XPFH 3RA7H 4EKXA 1CGXA 3KR3L 1PX3A 2W60B 2P24B 2F58L 1HKLL 4JREB 1EDQA 5FB8B 4U05A 4NNPL 1TVBB 1NMAH 3CX5K 5I16B 2OL3B 5CWSB 2YD9A 4YWGL 2EYSA 5I17A 2X10A 2XI9A 2EDOA 4FZ8H 3FQRA 4DGVL 3I9GH 5DJYA 5IFHH 4OFPA 1WICA 2BSRA 3P30H 3UTSD 1IGMH 4YX2L 3U4BL 1G7IA 1IVLA 2YUXA 2IH3A 3LDBC 4WWID 5JHDD 1K6QH 1NC4A 1DANT 1ZT7B 1KOAA 1K4DB 2W65A 1E4JA 3QIWA 2XA8L 4JPIA 1NC2B 4JZOB 1TZIA 1QLRA 2Z35B 1KFAL 4Y4HA 2JELL 3GSQB 5DEGB 5E24E 5FYLH 3BMVA 4ISVA 4YDKH 2FB4L 1CWVA 2LABA 2GI7A 1VGEL 2NX5D 5GXBB 3O6MH 4XPBL 1K3IA 3O3BA 4CAGA 3V6ZA 3ULUD 2X4OB 4OZIE 5J3HD 2X09A 3ALWA 4HF5H 4NP4L 5EC1B 3G9AB 1W0VB 2YC1B 4CVXB 1RURL 3CXDL 5CLWA 2IJ0C 4YNYB 2A9ML 5D70L 3CK0H 5JORA 4P2YA 3MROB 1YEEH 2DQTL 4PG9A 4EIZC 4IOFC 2DM3A 3HUJA 1EAJA 3MRJA 4JQIH 3B9KB 4KI5D 4M1DL 2YBRA 4LF3A 3PJSA 4PJCB 2HFFB 3E3QE 4MD0B 5DFWH 1OHQA 5T1KD 1BM3H 3VXOB 3GSXB 5IBUB 4N8VA 1DE4B 4PJIB 5HVHB 3L3OA 5GS2D 1MIEH 3KAAA 3U0TB 3RY5A 3LRSB 4EUPA 5MEPA 4U1SA 3C9NB 1ONQB 2VAAB 4ELKB 3IDXH 1BD2D 5EBMA 4JRYA 2AK1H 3M17B 1J87A 2B4CC 5F1IB 1IQDB 4ODXA 5D1XA 4MJ5B 5EG6C 1MHEA 4DTGH 3T0WA 2BNRB 5BMFH 3EYFA 1ES0B 5E1AB 5JQHC 4P9ML 4L29A 3QHZL 4Q2ZA 3B2UC 2GIYA 2VISA 4HKBB 3QIWC 3MLVH 4NZRL 2YEZB 1A6WH 4U1MB 4PLJD 1F97A 4G8FB 2YUVA 3QPQD 4ETQA 4N90D 5FCSH 4TSBL 5CILL 4GBXB 1ZT4A 4JANA 1QFWL 3VGFA 5TE6H 3U4AA 5DQJB 2H26B 4P49A 1LE5B 4JHAH 3ZYJA 3V0VB 2E6QA 3UTPD 2BC4A 3VI4E 5C0CE 4TTGA 1WIPA 3AXLB 5HPMA 2NW3B 1DL7L 3WN5C 2CLVA 3PWJB 2YOCA 1T7YA 4LCCA 3BO8A 4OCRH 1BVKA 1QSED 5HGAB 3V0AC 1RUMH 4XCNA 1WWWX 1I85A 4K8RC 5DJ2A 2OZ4L 2V7HA 3EOAA 2V9QA 5CSBA 1I4FA 2DYPA 3VGHA 2YSSB 4QXWA 4CADA 2GW5A 2K9UA 3GKWH 3NBNA 3MTRA 2J5LC 2JF1A 1WWBX 1EIBA 4DUXA 3T2QA 5FYJU 1IE5A 1YEHH 4JAMA 3JZ7A 4X8XA 5DUBB 3LCYA 2CK0L 2HVKA 5GPRA 3SCMB 3MGOB 2O5ZH 4NHCL 3ABZA 5IV2B 5B39A 1MFDH 1QLFA 3CU1A 5D1XC 2BHZA 3SE9H 3V6OE 4HK0B 3OKNB 4OQTA 1A7PL 2IMMA 4RWHA 3WIHH 1G7HA 1KJ2H 1FC2D 2X89D 2CR6A 2JKXA 2D31B 3D3VE 3RKDC 1I7TA 5FUCE 5E6IB 1BOGB 1FO0H 2XACC 4N0FB 4KJPC 4QYOA 3QXAB 5I19L 4R96B 4PJEF 4ZFFB 4W6WB 1U8QB 2DWEB 2EZ0C 3IU4L 4MNHB 3BFOA 1S7VB 1FIGH 3RDTD 2V5TA 2XWTA 1AGEB 3UTZA 1EAPB 3T0ED 1OAZH 4QRTB 5CIPH 4A6YL 4Y5YB 3EDEA 1YMHB 1RJLB 3D39B 3O9WD 2VMFA 3TO2B 2HLFC 4KGJA 4ZTPH 4BH8B 1MJJA 2V5MA 1NANI 1YQ2A 5BVPL 4RFNC 4LCCC 1HYSD 4MLSA 1I85C 4U31A 1DFBL 3IDIA 3PWUA 2XICA 1SEQL 4AJ0A 4HS8L 1KCUL 3HHRB 1JBJA 1IFHL 4MNQB 2MCPL 1A6ZB 1CG9B 3VXNB 1ED3B 1I1AB 2MCG1 3WJLA 1CL7H 3W0WA 3TEUA 1U95B 3EJYC 5TDNA 5IVXB 5E2JA 5D7IA 4LPCA 2ICWA 3O2WL 1PY4A 5EFIA 3A6OA 5GISH 1WZ1H 3D25A 5JXEC 1DTUA 4S0SD 1M05A 4Q74A 3RHWK 1VCAA 1QD0A 2XRAH 3WNLA 7CGTA 5ICZA 1WEJH 3O4LE 4PRBB 5F1OB 5IB5A 2HA1A 1UJTA 3KPQB 4MYWB 5DUPL 3WIIL 5I76A 5IFJA 1OTTD 2WMPA 3BJ91 5D6CA 4A6YB 1KIPB 1SM3H 2PO6B 3FMGH 3MLWH 2PUQT 4FZEL 1G7JA 2HJKA 2DIJA 2LQRA 2VLJB 3UCRA 5HHNA 2DWDB 1DVFB 4LOUD 4MXQC 2QQLH 2VR9A 2JE8A 4FQXC 5AWNL 2FJGB 3FONB 1BVLA 1FZOA 2JJWA 5EIIB 4M7LL 4OFDA 4K7FA 1WCBA 3QFJB 5LAXB 2BSSB 4PP1D 1P5UA 4DVRL 2CSPA 3NZHL 1LQSR 1YYLL 4MA1B 4OLUH 3ARSA 4NN6B 5GGQL 4XPHL 5C08D 5JO5A 4WV1A 5FKAA 4Z78A 4RAVB 4PJ7A 3BKJH 5JPNB 2VDRL 4OZIF 2DBLL 3BQUB 4G6KL 1F4YL 2VQUA 4NJ9L 4X6DE 1MCWM 4AEEA 3Q1SH 1U3HA 5MENA 3LN4B 3Q6GH 1N6QH 3O6LL 4IS6B 32C2A 3MLUL 2AJVL 4EBQL 3L7EB 1JTPA 1TFHA 3KWWA 4ZDHB 3WJLC 3WS6A 1XGQB 3FT3A 3O3EA 3RU8H 5J8OA 2P49B 3ARBB 5I1AB 3HCVA 2HLAB 1L4IA 3S88H 3UPRA 2VLKD 3IFPB 4WW2A 4DZBB 3TCLB 4YHPB 3IFNL 4GRLA 2FH8A 4JPKL 1YY9C 5HYIA 1RIVL 4FFYL 1X5GA 5GGVH 3NFPB 1BF2A 1CK0L 1OAQH 1MFAH 5JA8B 4NZTH 2UYLB 4NQSA 2R4SL 3X3FH 2VJXA 3CFJB 1MWAL 5MHSD 1LP9A 3ILPA 4FQ2L 5ITFB 1MEXH 4DW2H 3RNQB 3ZKMD 1MHPL 5IB2B 3UJTL 2RIKA 4JO4L 5GHWL 5TFSL 4R2GC 5DJDB 5EU7E 1UWGH 1QP1A 1DBKL 2WBWB 1W72A 4F7MB 3G5VB 3GGWA 4PJIE 1C5CH 4F58L 5BV7C 5MEOA 4IMLB 2CKBH 3V4VL 2L0DA 1BGXL 2R2BA 2XQBH 2AXHA 5TDPB 1V5JA 2ESVE 1FYTA 1JPTL 4IRSD 4PJGB 1AGDA 4WY7L 2W9EH 5FB8A 4KHTH 1X44A 3D2UB 3ZDZF 4EI6B 2NYYD 2OL3H 2RQ8A 2HAZA 4ZD3H 3X13A 4D9RD 3H7LA 2BNRE 3QI9B 3VI4F 3E8UL 3FHQA 4UB0L 2R56L 2X7LA 3GJEA 4LMQI 2BRRL 1N7ML 2ITDB 2APVA 1RY7B 1X5LA 2HT4C 5IESL 4XNZB 2R0WL 3GZKA 1A7NL 5IJVA 1KJMA 5D5MB 1ZLVH 5E99L 4P2OA 1Q72L 4P57A 2EIZA 1G9NL 1U93A 3VFGL 5D71L 2G2RA 4Y5XA 5INDB 1FGVL 3SKUD 4LPYA 1I8IA 3GSQA 3B6SA 5IMOB 5IG7A 4KQ4L 4OKVB 2ORBH 5ESVB 3CJJA 4GRLC 1MLBA 4MX7A 5EC2A 4JRXA 3RVXD 2X4OA 2OTUB 1OAYH 3MRCA 3T08A 2O61B 3ARGD 4G8IA 4UV7L 3BUYA 3GSNL 1LD9A 4GH7B 2QKIA 2I9TA 3VGGA 1WSST 5C6PB 5C6TH 3P9MA 2MQ0A 4OV5A 5C71A 4GQ9H 4PY7B 1CR9H 1A5FL 1NMBL 3MREB 1U8JB 4Z0BH 4I3SL 3B9KA 1C1EH 2ADGB 5CJQH 4Z7WA 1MAJA 2YD7A 1R3KB 4PRPB 5IKCA 1KIRA 5AZ2H 3FTGB 2NCMA 5A1AA 1AY1L 3KPLB 3IJHA 4I0KA 3RBSA 5DO2C 4KVNH 1MLCB 3QHFH 5DFVD 3UPAA 3IXTA 3VFNB 1S7RA 4D3CL 4PJAA 1EXUA 5GS1C 4M8QA 2OM5A 1T21A 1LWRA 4M4PA 5LJYH 3I3BA 4K3JL 5I75C 2P5WB 5CUSH 2XA8H 5F1IA 1EEYB 4OCYL 1CF8L 3U30B 1YEDB 5D1ZC 2O5YH 5SWSA 1LO4H 1RUAH 5IMKA 1XIWA 4LVHB 1MFBH 2P45B 2HVJA 4GKNB 5E5RB 3NN8B 3QA3A 2J8UF 3NPZB 5TF1H 5FYJD 4XP1L 4JFED 1UT9A 3VGEA 5IHZA 4GJTB 3GSNB 1CGVA 3QDMD 4FG6C 3LEXB 5BJTA 3WL9A 3BDXA 4GBXA 3WFDL 1KB5B 5D70H 1QBAA 3V5DA 5I18L 2ITCB 4JPWL 5JIKA 1VEPA 3EDKA 2NY0B 2MQ3A 5IROC 2K1MA 5IW6B 5HHVL 3O3DA 3W9EA 1TZGL 2IPKB 3EO1A 4YIQB 1IC4H 2A83A 5HSFA 1CVSC 3KLAA 4Z5RA 1D5MB 1KENH 2FECI 5B39G 4NC0B 3BHBB 1T4KA 3BD5A 3ZE0E 3H9SB 1NGZA 4LBEA 1I9JL 3NABH 1C12B 1D6VL 4NOBA 1KLFA 4L8DB 2YSSA 5KVEL 4QXUH 5GGVY 3FN9A 5F89B 3H9HA 2YPKA 4MNQE 1AQKL 3V4UL 3QIBA 4LKXB 5FKPB 5TDOB 2YR3A 4A2MA 3WEXB 5E2TH 3CSGA 1U3ZA 3ARWA 2DMKA 4FQ1H 5IVXE 3T2NL 4ORGB 3QUXB 1TENA 2FHFA 3VFRB 5F1SA 1ZLSH 5ALBL 1MH5B 1YPZB 3RNKB 2P46B 4QRQB 5E56A 1QEWA 4J3XA 4J1UA 5GRZA 3JWOH 3LDBB 3KLSA 5IJKC 2FHBA 4HZLB 1N3NA 4H1LG 4OD2A 3U83A 2D31A 2IQ9H 4R7NB 4X6DF 2N1KA 1T1WB 3LS4H 4LLQA 4JKWA 1CFNA 3WNPA 4PJ9C 2YPVL 4MVBC 2VLJE 4QWWD 4F57L 2E27L 2P8LB 3JV4B 4U6TA 4WO4A 1YN6B 2VRAA 5I0ZA 1EEUA 1NCBH 4HGWA 1KCSH 1UWEL 4HFWB 1EJOL 3QFJE 2OZ4A 3KPPA 5EU3A 2Z92A 2JCCA 3NH7L 3BX7C 4DK3A 4I0PD 2R0ZH 1T04A 5E8DL 2FR4A 1UC6A 4ZPTA 5E8EA 3OXSA 3MJ7A 5T5FH 1ZWIA 2ADIA 5B38A 5TPWH 1TZHA 3PGCB 1WITA 1MCWW 1EHAA 4DAGL 3EYVB 4Y19A 4ZYKB 3WLBB 3QG7H 1T1YA 1PKOA 1RHHA 2BNUB 2QSQA 1QFOA 2HTKC 2NY6D 3IAGC 1A7PH 2XZQL 4G6FB 3DVFA 5CEYA 4PJIF 1V3LA 2VUOA 4X7SL 2A74A 5FM5M 3S37H 4UQ3B 3RWDA 1QR4A 1EZVX 1F8TL 4WTZG 4E42B 3UPCA 1REIA 1X5HA 1JGLL 1I3VA 1ZGLP 2FX8L 1ZK9A 1P53A 1ZGLA 3HFMH 2HG5A 1WT5C 4C56B 2YRLA 1P84K 4MQ7B 3FJTA 4KHXH 1ZLVK 1J1XH 3LZFH 4MSWB 4A6YA 2IALA 2JJVA 3RRQA 5BZWA 1ZHLB 3R0NA 5CP7B 3GKZA 4TRPH 2AEWA 1S9KC 1TVDA 3MA9L 3MQIA 5TGBA 3BIKA 4P4KB 5HYJB 3SDCA 1EO5A 3CLFL 3HE6B 4UU9A 5IQ7L 1A7QH 5HYSA 3MXWL 2FECL 3H42H 4PJGE 3OKEB 5C70A 3W9DA 3K0WA 5DXWA 1BWMA 3T2PA 2H6PB 4KVCL 1FYHB 2DLHA 5JPNA 3TJEH 1XF2A 2GT9A 2DMBA 1VEOA 3U82B 3H8NA 3HC0A 3NGBC 2VN4A 2UV3A 1T1XA 1AJ7H 1JZ2A 5BS0A 1TJHL 1R0AH 2B1HH 3LHPH 5JMOC 3QCUL 2I07A 4PGCA 5D5ME 5D93C 4XB7A 1JGVL 4HUVB 5H2BB 4HC1L 3M45A 1INDL 1XGQA 4OF5A 3I75A 5ESQB 1KELH 4I5BA 3WIIH 4Z77A 1JUFA 3IFPA 4LCWB 1FFRA 1E4WH 3F65A 1T20A 4YFLF 4ZXBA 4O02L 4LSDA 5KN5B 1GHFH 1B4JH 3UXFA 5JQ6H 5FGSA 3IS1X 4PP2B 2C3GA 4YGAB 1EFXA 3FHAA 3WD5L 5IVNA 5GGSB 4MD5A 3G6JB 3ZTNH 1KCVL 3MUY1 4GW1A 4HUXB 4GMSH 3DX7A 1CZ8L 3X14A 4WNQA 1BQHB 3PV6B 1WWCA 5I1GH 5I1CL 1VKXA 4LQFL 4PTTA 3RUGA 4N0RA 4PRPE 5DJDA 4JHWL 4XPHH 5ANME 2A1WL 1K5NA 5HY9B 2BY3A 3HC3L 8FABB 1A1OB 1NEZG 2YK1L 4ZS6D 3THMH 4Z7UB 3I02B 1KT2A 1AKJD 2P5EB 5HD8D 4EI5A 4OGAC 3HE7B 3TV3L 4RFNB 4NO3B 4CRPA 2P5WE 1NFDF 3F7VB 1EEQA 4KKAD 1PG7H 3JUZA 5E4EB 3SKOA 2FATH 4DCQB 2QSCL 1B0RB 1ZTXL 2AEQL 3ZE0F 1GAFL 2XNAA 1A7RH 2DI9A 2HJFB 3HG1D 1DQQA 4JPKH 4F80A 4MXWH 2OLDA 1WFTA 4P23D 4R4ND 4GG8A 5KVDH 3P3YA 1YZZA 4FQHA 4PGZA 4G8EB 5F7EH 1LNUA 4QRPD 1MWAA 2R8SH 3P4LA 1X7QB 4U6VL 4AG4H 2HP4A 4ZXBC 1WZLA 1A6TA 3L3IB 3QXWA 2NZIA 1UCBL 4K71C 4OM0L 1N6UA 4YHZH 5IVXF 2OTUA 4U33A 1N0XH 1XGYH 4XPTH 5I8EB 3IAPA 5LGJB 2X4TB 4JFFB 3V0WH 1DLHA 5IW1B 4F58H 1SJHB 1A21A 2CIIA 5D7SL 4RFOH 3BDYL 3EFFA 3ULVL 5DVMA 3OAYK 3IJSA 1NANH 3F7YA 1BFTA 4HH8A 1FAIL 2CQVA 2XKNB 4TOYH 2YRZA 3VWKD 1UVQA 2DM7A 4V1DB 1OQXA 2Q87A 4R97B 3GMLA 4L3ED 1JZ8A 1R3KA 1A8JH 4FQXB 1T6VN 4UIKL 3OGCB 4BFIB 3SKNB 1C16B 3FTGA 4CN1A 4PJ5D 2NY1C 2VE6B 1DN0A 4KMTH 4Y2DA 4QRSA 2F19L 3OF6D 1ZEAL 1F6AB 3D85B 5TQ0L 2VC2L 1CLCA 1FE8H 3GO1H 3FN0H 5FGBC 5GQBA 1R5WB 1YYMH 4U2ZA 3ECBA 3PWNB 2AKRA 4XCYA 1U3JA 4H1LB 1NAMB 3U9PH 4DVBA 3F7QA 4Y4KC 1YPZE 3ME0A 1HHHA 2DQHH 3B8YA 3MO1A 4JFPA 1JE6A 2EE3A 1NBQA 4ZUSA 2AERT 5DMKB 3LQMA 3WFHB 2XKSA 1TQBC 4FQCL 3C60B 1AE6H 3KDMB 4GKNA 5C07A 4WUKH 4I2XE 4MCYB 2NY4C 2E5EA 3GMNA 4EDXA 4R6UA 2Z31A 2I60H 1BEYH 4AIXA 3GSNA 3GIZH 4U6XB 3VD4A 4LHUD 4GQPH 1FJ1A 2VZVA 2FJHA 2Q86A 1F4XH 1OTSD 3VD7A 3WV0A 1SYVA 4X7FC 1KB5H 4G6ML 4PJXB 2ITCA 4WHDA 1D6EB 1HH9A 5DK2B 4JY6A 4UDUA 3EYSL 4OZGB 5KVGL 1IKFL 1FZKA 2ICCA 2EYTB 4OF3A 2IPKA 3Q6FB 2DQFB 4W4OA 1BLNB 4Z9KB 3MGAA 4OFIA 1OWRM 2BK8A 3PHOB 2A38A 2YXMA 4M48L 1ZA3B 1GGBH 3BHBA 4JY5H 5J11B 4B7IA 1HQRA 2D4DA 1FL6B 1F4WH 1HDMB 1GGCH 3FB6B 4LMQE 4O51B 4F9PA 5ADOL 2F9BT 1FLRL 5FECA 2R4RH 4LVEA 4AM0A 4ONOA 5A40E 5DJCB 5ESAA 3ARZA 1C5BH 3TBTB 5BV7B 1G7LB 2A0LC 4YDJB 3FFCD 3GRWL 1K4CA 3I85A 1BREA 4Y5VC 3VXUB 4Y2DC 5DD1H 5JNYA 3VDCA 5DT1L 5IOPB 1A2YA 4OZ4A 1CFTA 2FCBA 3Q3GA 5E9DD 5J4MA 1QQDA 2I26N 4ZOBA 3GB7B 4HH9B 5FM5O 4YQXL 3NIFE 4DWHA 4OZHB 4P9HL 1CXKA 1XR9B 4L4TD 4QRQA 1FGNL 3M8OL 4ZFZA 1IZKA 4XNYH 5F72S 3SDYH 2G60L 3QXDA 4FQJL 3V6BR 1JZ4A 1AQDA 4R7NA 2GSGB 2F5AH 5GSVB 1CBVL 4JFOB 4MGXA 4I8DA 1BBDH 1DQLL 1F58L 1QG3A 4QOKA 5HI5D 3BE1L 4GW5A 5D5MF 5FCUL 3WCYA 3CX2A 5DJ0A 3IF1A 5KS9A 2CRYA 2QQKH 4M6MH 3RWIB 5L7XH 1RZ8B 1I9EA 2Y5EA 1KB9K 1JPGA 1OAXH 1OQOA 1AXTL 5HI4D 4WDIA 2BOBA 5BRZA 3QWOA 4W4OC 4X6CA 3BH9A 4UOW0 1GGUA 3MV9B 4KDVA 1XF1A 3EO0B 3EZ8A 3L3KB 2EDTA 3ZTJG 1DBMH 1MAML 1FL3B 3H3KA 3HUJE 3MV7A 5DQ9B 4RZCA 1T3FB 5DMIH 4O9HH 4JQXA 3EOYG 5L2KD 4NQEE 4F9PC 2DTSA 1MCKA 5MERB 5H35A 5E00A 2D4FA 3L3HA 1R3JA 4NT6A 4S1QH 4P5TA 3WO4B 4KZDH 2NW2B 4KZEH 4FTVA 4PBXA 1KJ3H 4M00A 3TYFA 5F6HI 5GS1B 2OSLA 2W91A 2H3NA 2FO4A 4QRRB 4N5EC 1SBBA 2VLRB 3VWJB 5DHVA 4OFYA 1VA9A 3S5LA 2OP4L 5I1HL 3AMLA 3FQXB 5LGHH 2NY2C 5EZJB 4I18C 4ZO7A 1ZSDA 2QQNH 1U8KA 1WJ3A 5D1ZB 3MJ6A 3P4MA 3P73B 2ZCHL 3O81A 4PRNA 3DO7B 4O58L 3G6JE 3C5JA 1R3LA 5FV1L 1NEZB 5HHXH 1QTYT 2IQAA 1M7IA 3P4NA 1I3RA 3QDGA 5E08L 4MSWA 4N8CH 4OFVA 3KLHC 4PR5B 5ILTL 5E8OB 4M7ZB 3PXHA 4TQEH 1IT9L 1F3RB 4FFVD 3DUUB 2A6IA 4XXDA 1CICC 5B22A 2ZKHL 4LSTH 5HYJA 4OGYL 1K3ZA 3RWCA 1MREH 1I75A 3HE6A 4Z7UE 2IPUK 4K7PL 3BKCH 5DJ6B 5J6HA 3AREA 2I9LB 3P11H 4PY8J 2H8PB 1SMAA 5GRUH 4ODWA 3TBVA 4LRNH 3S34L 4U1LB 3MYJA 4J4PD 3MUGA 3QUYC 4K3EL 1G6RL 5F7UA 1G7PB 1JGDA 3FRPG 3TC9A 2ZPKH 35C8L 4JQXC 4PJFF 1YECL 4ZTOL 4K8RH 1CDHA 1IQWL 3MRFB 3S7GA 3K81A 1A9BB 2EH7H 2BVUA 5FYKD 5IHUL 4J12A 4MDIA 4P5TC 4N0CC 5KSBF 2OR7A 4IDLA 4K7PX 4TVPL 1MI5B 2VDNH 3FFDB 4Z18A 3AU1A 4FP8H 2FGWL 3IGAB 3HZMB 3L95B 3QWQB 2XKUA 5ERWA 3RWHB 5E8PA 2GQHA 4LCWA 1KEML 4QY8B 6FABH 3QCTH 4NQDD 4HUWB 3DLQR 3WUZA 4YUEL 5K9JH 4NNYA 1D5BB 2HRLA 1VDGA 2BNQB 3MOAL 1EGJL 1ZGLM 1JCKA 2IAMD 2PF6A 4JR9L 1K8IA 5KSVA 3B43A 2ICEA 1GPOH 1QRNA 1JFQL 5L8KB 1M6OB 1XF3A 5JIIA 1JRHI 1HWGB 3C08L 3VRIA 2AJSL 2NXYD 4HJGA 4PJ9B 2OJEB 4V1DE 3PL6C 3PV6A 5ETUA 1YEFH 3KYKH 4M7JL 1LEIA 2R2HA 2V2XA 4H5SB 2V2WA 3KPNB 4XP5L 4C59B 4KVCH 3OJDB 4PGEB 5D1QB 5D9SA 5JW4R 1MRCH 3KPTA 4NKIL 4QHNB 1IC5L 3DUSB 1E4XL 1KG0B 3AREC 1NC4D 4O2EB 4APQA 5F3BB 1CFQA 1AXSA 1T7ZA 1UB6B 3RIAK 1T1ZA 5KTEL 3BPCB 1YEGL 3SJVD 3S97C 1J0KA 1JGVH 5F7NC 4Y4HD 4UTBH 3NACL 4HULB 3O8XC 4H20H 4HC1A 4X9GA 4WFGD 5I1KH 3MZGB 1IAIL 1SY6H 1CFSA 5IF0B 4G6AD 5TQ2L 1FNEA 3GBML 4L5FH 4OKDA 1NAKH 1B0RA 1NCCH 2DBJA 5C0JB 3VXSD 5IBTL 3G6DH 5DHYA 4MJIB 1B6UA 3QUMB 3W0WE 1K8DB 3IFLL 1KXVC 4EVNA 1V7MH 2AABL 3FOMA 2V17H 4YLQT 3IETA 4JN1H 4MNGE 4YO0A 1PKQB 3L6FB 2XA3A 2COQA 2VITB 4OJFH 4XVUD 4PJXE 3SDXB 3TNNA 4NRYB 4WI5A 1CD8A 4JVPA 4JKMA 1A3QA 4GXVL 4OZGE 1JHTB 1OSZA 2N7BA 5DSCB 2XN9B 3NFNA 2F54B 2VNCA 2MNUA 3NIFF 4X99B 4J3SA 1AGBA 2R0KH 4JFFA 3ROOB 1RUKH 3EYOB 2V9RA 1YMMA 3HNTL 2OQJA 3MLRL 1UM5L 5JOFA 4LGSB 3HI6L 3O4OC 15C8L 3O6KL 3QIUD 4P5KA 2R1WB 3SE8H 3GK8L 3H3BC 4E0RB 5EO1B 2R23A 4JRYD 1IILE 1NDGB 5KAQG 2QEJA 1H15A 4QT5B 4K2UH 2Q6WB 4QTHB 1R24B 2PKDA 3X12B 1ZHNA 5AEAA 5KANG 2PW2A 2APBA 4HKXB 4APQC 1GVIA 5ID1B 4PJ7E 2AGJH 3FQWB 1UGNA 4OZHE 2CRZA 1WGOA 4PPTA 5DGQA 1UM4H 2V9TA 3WXVH 5C0DA 3CFCH 4H1LH 1NAMH 1U58B 4NCDA 1T0MA 3NGBB 4JGMA 1UACH 3E2HC 1EVUA 2F53B 4XVTL 3FB7A 4HW6A 5HHQB 2AQ1A 2B0SL 1Q9OA 1TJIL 2XPGB 5EUOB 5D93B 1EEZB 3HUJF 2G9HB 3AMKA 3WFCL 3MOBH 4E41A 5IK3A 2EE6A 5HHOA 1CGYA 3GJFB 4NQXB 3DXAB 1UCBH 4OM0H 3QPXL 2X6MA 1RJZA 5EO0A 1I1FA 3IRZA 3C5ZC 2HTLC 2UWEA 5ACZA 1VB9A 1LDPL 1MCOH 2A77H 2GJ6B 4G7YH 5GRVK 1XCTB 1X5JA 5EO9B 3TO4B 3GHBL 4DKEH 1G84A 1DUYB 5DK2A 1ETZB 4HQQH 5KSAD 1HHJB 1J8HB 1RZ7L 4JDZB 1SJEB 1TJGL 1HH6B 3MV9E 5CJOH 4UV4H 5E5MB 4P2CG 3FT4A 4ELMB 4CMMB 5I71B 4NPYA 5FHBL 5KW9L 4JDVA 2CGRL 2CUMA 4LHJB 1RZIB 5AZEH 3CC5B 1EO8H 3L5WA 5EZIH 5CEXA 5FV2A 4NO0B 2GAZA 1CI5A 5C09A 3HS0B 2C3XA 4XP6H 4PV9A 2J88L 5BV7H 4C54A 3RZCA 4N8PA 4UILL 1H8SA 5L9DL 5EBLA 1FORL 4KKLC 5JW3H 2ERJB 5A16B 4XMLH 2CDEA 4NNXA 4AL8H 2VLRE 3OQ3B 5DR5L 3SY0A 3MBXL 3MRBA 4Y16D 2M8XA 4HMDA 4Z7UF 4NO2A 3D1MC 1QACA 5IR1A 2AXJA 3WKMH 1CDGA 1KUMA 2VLME 4NKDA 2BDNH 4ONGH 1J1OL 5J12C 3V5KB 3CPLA 1D3CA 2DI7A 4KI1A 2HN7B 1ZMYA 2PR4H 4ODSL 4JM2C 4UUJA 2FX9H 1SHMA 5DTFA 5CEZL 3IDNB 4O5LH 1P7QA 4WEBL 2FSEA 3PQYA 3VDAA 4R8WL 2R9HC 4HIIB 4MAUL 5B4MD 1HEZB 3WE6A 1FRGL 5DJXB 1RFDL 1MIMH 1UZ6E 3C8KB 4K71B 4PJ8C 1H5BC 1KTDA 3VFPA 3ULVC 3HNVL 4OCWL 4X6BB 3AY4A 4LLDA 3BZEA 5DDHB 4D0DB 3KJ4C 1W8NA 3GSWB 2XG5A 4X4XA 4M7LT 3GRWA 4AEIH 1U92A 3KYAA 5DMJB 4GW4B 1MCHA 3TT1H 2VL5B 1T3FA 4G9DB 3GUTA 3KNBB 1JZ7A 1H3PL 4P0DA 3BIBX 4Z7WE 4K94C 3SOBL 4WFEE 1N8ZA 2W9LA 3S96A 1MCQA 1L7TL 4YHYC 2MHAB 3OPZH 1FG2B 3DPBA 2Q8BH 5CJ8A 3H7BA 4PJAE 4MA3B 4CGTA 3RTQA 3WO3B 2HKHH 3D0LB 5FO7B 2ZOKA 1CXFA 1AGFB 4JZJC 4QRRA 4Y4KB 4IMKA 3IU3A 4IOIB 1D5XB 4PRHA 4O00A 2X40A 3QXUA 3V52L 4P2RB 4OAWB 1KCLA 2GK0A 2PXYB 5D96C 5D8JH 5EWIL 5JPMB 4PYGA 3UJJL 1UKSA 3G5XA 5HHPB 5B3NA 5ITBL 1N26A 1TQBB 2Y23A 1PYWB 1OGAD 5IFAL 3A0OA 1A7OH 5JZ7C 3T4AB 2SEBA 5F9WB 3TZVD 4YE4H 5I2IB 3DRQA 3ZDYE 1BJ1H 1HSBA 5K9OA 4XCFL 1NGQL 1T66D 2Y9RT 1TCRB 4GMTL 4ZSOB 2DKSA 1YNTA 5HDQL 1U3HD 4G9FA 5MEND 2Z9TA 2HFEA 1UEYA 3AY4C 2CO6B 3KJ6H 1G7QA 2PYFA 3L9RA 3AS1A 4ZFGL 2H8PA 4AENB 3G04A 5DD5H 5IB3A 1AD9A 3REVB 4JKKA 3EJZD 4XRCA 1JHKH 1S7SA 4P59L 4QHKJ 4LLVA 4ZOEA 4ONFL 2FD6L 1OM3L 4HWBH 4ONHA 1UXWA 4LCYA 3PGDA 1AXIB 1O7VA 3RVTD 3VXQB 4MD4B 4L8CA 3ZO0A 1S8DA 1FH5H 2C3VB 1S7TB 3IB4A 1OLZA 4MJIE 2R29H 5CCKH 2DQIH 4XNMA 5EZLB 4R4BB 3EOTL 4Y5VB 5JHDA 3DX6B 4I13B 4AYFA 4HUNB 5EU4B 5TE7H 3WDIA 1PKQE 3MV8D 4UNVA 3FFDA 3FCTB 4UAOB 5C92A 3HZMA 3SDXE 1RZKC 5DYOA 2VXQL 4KRNA 3UDWA 1HE7A 4K23L 2Y1VA 4LARH 3SGJC 4NO5B 5F9OL 3HAEA 2NX5A 2YMXL 4F7TA 4PJ7F 1QBMH 3T1WA 5AG9A 5HHMB 5JXAL 5FYJL 4XBPA 2PTUA 4DKFL 3LQAC 2QBWA 4MCZB 1CFBA 1FYTD 5SWZB 1WF5A 5DD0L 5L2JB 3BPLB 5F9AC 1FDLH 1QRKA 3RWGA 1OB1B 1X6LA 3CFBB 4P5MB 3GSOB 1T2JA 3KPSB 4RMVA 3HMWL 3U46B 4GUPA 3GSUB 2VXTH 3HZVB 1G6RA 5F9DC 5C0BE 1RUPL 4WFFE 3KPNA 4ALAL 5T1KA 3P77B 2NNAA 1CT8A 2WWKO 3G08A 1XF5A 4WW2F 5I1EH 1F42A 1QBLL 2EKSA 2JCCE 3K8KA 4UDTB 4F7PA 2R15A 5F3BA 2OJZL 5DS8A 4P2OD 1OPGH 3BAEL 4G80A 5E7BA 1MQKH 2E7LA 4W81A 4MAYA 2D03H 1JF1B 1FPTH 4MMXC 1RJYA 4Y88A 1AO7B 4LU5H 1RUQH 1VACB 3GSRA 1UM6H 2WUCL 4XGZB 4YXHH 1RV6X 4U1HB 5A3ID 2YA0A 3CIQA 3W2DL 1S78D 3DETD 4Y19E 1UEMA 1KBGH 1CIUA 4MJ4A 2VLLB 1SYSA 3DXAE 4M61A 3MRPA 4NC1C 4TULH 1CXEA 1J5OL 5I15H 3DSFL 3QUMH 4U7MA 3FB5B 1EGJA 2NMSA 1QSFB 4GT7A 1NSNH 3U6RA 3MCKB 3LSOB 1MJ7H 1JV5A 2DF3A 4BYHA 2GJ6E 2FEDD 1KJVB 3T3ME 3UDWC 3JTSA 5C3TA 4Q9CA 3B9KD 4HUUB 1BIHA 2NY2B 3C08H 3CH1A 3EAKA 4I18B 5ICXA 3TWCH 1NGYA 1IEAB 4S1DD 2D9QB 1J8HE 4RQQB 3ULUC 3U36B 3AFLA 3CGTA 5J3HC 3CVHB 1U91A 5LG1A 3FAWA 3TIEB 4F8TA 3TPUA 5T3ZL 3PWPB 1OSPH 1F3DJ 1N0LA 1OF2B 3EYOA 5EUKA 1RK1A 4M62H 4NKIH 3V7MA 4FFZL 4DKDC 2J8HA 5E7FA 3KPMA 1Z0NA 4KRLB 1DQMH 4N9GB 3QEQB 3NTCH 1T5WB 1CICB 5EN2A 2W59A 4KI5C 4QT5A 1QFUH 2WANA 3KPOA 3QUZB 4Y8AA 2BNRD 3GSVB 1R24A 3RI5F 3C8DA 1UQSB 4B0MM 2A9NH 3P0YH 5LBSH 5SWSD 1EPFA 4PJBA 4POUB 3RWJB 3X11B 4CVWA 1CVRA 3VFUA 2V5YA 1BZQK 1BFOA 1U8HB 3VGAC 1UZ6F 3GMOB 1MRDL 3QUYB 1B90A 2CDGB 1LO3L 2VZ1A 4M1GH 1HILA 2IANA 3DTXB 4GBXD 3RVVD 4YHMH 1UH4A 5TE4H 4KPHL 1HXMB 3OKLB 5J6GB 1JPSH 2L7UA 1I1YB 3MLZL 4NZUH 3FO9A 4YPGA 5JHLH 2X89A 3ZL4H 3DHMA 4Z7WF 4Z7NE 1IL1B 3GJFH 3LEYH 2PW1A 4XZUB 5D2LA 3VGDA 2EDBA 4KRMB 4PLJC 5DF0A 2KL6A 3QPQC 1TITA 3RDTA 3U7WL 2WQRA 3BVNB 3UJIH 3ZTJH 4PJAF 1ETZA 4X9HA 2ZUXA 4RGOL 3QIBD 3VFSB 2Y5TB 5T1MA 1SJEA 5JDSA 1T5XA 2BFVL 1E28A 4EDWL 1SBSL 4PB9H 2FNBA 5INCA 4CMMA 5CGTA 2JB5L 1CTOA 2UUDH 1N4XH 3UTTA 3PL6B 3STLB 3SCMD 2NY5C 5GJSH 3H3PH 1GIGL 4X6FB 1XGTB 2E7HA 1YEJL 5E2VL 1HNFA 3RWEB 4R3SA 4NO0A 3W39B 2B39A 4XVSL 1KIQB 3PNWA 4I77L 3GI9H 5LCVH 3MRGA 4WTXA 3DROA 2EXWD 3VI3E 2Q3AA 4LP5A 1FNHA 1HIML 3N1PC 2GITA 4X5XB 5DQDL 5IQ9B 5EIVA 4BKLB 1WBXA 3QZWG 3DIFA 3SKMB 1A7BA 1IAKB 3A6CL 4P2RE 2G75B 3EHBD 4XNQB 4JJ5A 5ICYB 2VKXA 5F7YC 4OLZH 9CGTA 4O4YL 3LB6C 4DQOL 2K7QA 4LSSL 5C8JB 3QG6B 3S5LG 1CU4H 2VQTA 4QHMB 4OCXH 2JLLA 3D39D 4OM1L 2EEAA 3HRZA 4JVWA 4TUOA 5CBEA 4OGZA 3RWFB 1JRHH 3L1OL 2DLTA 1MCFA 4UI2A 1BFVH 2YD3A 4IOSD 4ZSOE 4HAGA 1W0WA 3TM6A 2ATPA 1F2QA 3I6LD 4XPGL 5FOBB 4QXGL 5DMGC 5B8CA 1P1ZB 1LE9A 3QEGL 4L4VB 2Z8RA 3C8KA 1UZ8A 3L3GB 1ACYL 3S8WA 4LDOB 1BQLL 2ZG3A 3SDXF 3T0EC 1GOGA 3Q5TA 4BUHA 2R1XA 5DDHA 4MNQD 1RQ5A 4ODUA 3O41B 3O9WC 1MUJA 4KKNA 5C08A 3CLEH 2DQDL 3O4OB 2X1OA 2IH1A 4UILH 2YWZA 3BXNB 2CRMA 4N0YL 5C0ND 1YN7B 5LQBL 1CD1B 3O6FA 4WWKB 5I0DA 2WWMD 5EU6B 1FNFA 1DLFL 4M93C 1XCQA 1X5XA 4NQVB 3MA7B 3NCYS 3QNZB 5C0AB 2F8XC 1B88A 4TNWF 4FQPA 2ZSWB 1Q0XL 2PO6D 2IFFL 2W0PA 1WK0A 3IDMB 4IOIA 3WHXA 3MLSH 2JCCF 1QYGL 5ACLA 4NN5C 3TNMB 1XZ0A 1P4IL 1TVHA 4ZS7H 3SDCD 4JFQB 5TH2A 1NDMB 4QRUB 4JCMA 3MRNB 5J1AA 5SWZE 1U8IA 4UOJA 4X83A 1BZ9B 2RFXA 2AI0H 1OTTC 2P7TA 4YHKL 1NCWH 3KPSE 5J9PA 4M5YL 4M7KH 1H0DB 1T89C 4YFDB 3C5ZB 3BSZH 5I1LB 3BQUD 3QFDB 3MRMA 4GAGH 4TTDD 5B3JE 3IDGB 3PP4H 1ORQA 5DRNB 5FUOH 4XNUH 3ALPA 3QRGH 5B8CC 5BS0D 4EOWL 1ZHKB 1UCTA 2ICWJ 3OBAA 2WZPD 5E8NB 2UVEA 4G7VL 4X80L 3HPLA 4YHNA 3T3MF 3UO1L 1S3KL 3O0RL 4PP1C 1I7UB 5T5NF 4JO1L 3HAEG 1J88A 5T1LA 3FOLA 3ARBD 4CNIA 2VZ3A 4HS6B 4LCIL 3LKOA 3DBXA 5FO8A 1NQBA 5HVGB 3WXWL 3TCXA 2O5XH 1A02N 2R0LL 3GNMH 3O45B 2UZIL 2HJLB 1J0IA 3QEHA 4YGVB 1JWMB 1M4KA 1WIUA 2CLRA 2ZCLL 2CDFB 3DV6B 4X6EB 1KLGB 4JQVC 2F5BL 5DEFA 3BKYL 1H8OA 1IC7L 1IBGL 3SN6N 4WJ5A 1EFXD 4Z7OF 3JTTA 2A6DB 4HIHA 5FHAL 2NY7L 1MCLA 3MRHB 3FRUA 4HK3N 4NRZB 3ILQC 1EJ6A 2JTDA 2L4OA 4Q0XL 4OD3H 4HZAA 1NCDL 4DZ8B 5J12B 3ULSA 2Q1EA 2BVOB 5C0RL 2B20A 3FB8B 4JM2B 3PWPE 2JJTC 4X7DC 1AR1D 5E1HB 1C08A 3C6SB 5LXGH 3AUVA 5D72H 2YD5A 1FVEB 4WHYG 4UOW1 3GJFK 3OHXB 4EI5D 2V2TB 3RGVC 2Z8VC 1OB1A 2C26A 3CFBA 3SGKA 2VABA 3PABB 1X9QA 5KS9E 3ZKMC 5CGMA 3VXTA 3NCFB 4ZFOB 1Z5LA 1CDCA 1SVZA 5C0FB 4PJ8B 1H5BB 4Z7NF 5FA3B 2J4WL 4DGIL 1HOCA 2QJDA 1HSAA 1ND0B 5JW4Q 4Y1AB 3K2UL 5I1JL 3KXFA 1S7WB 3KJ4B 4OBRA 3RVUD 1R5VB 4IRSC 4WFHE 5C0IB 1Y0LB 1J10A 1BAFL 3D18B 4OLYH 5DMYA 5CD5C 1J1PH 5FDYA 3OKOA 2W0FB 2UUDK 1NUFA 4Q97A 1AO7A 2NYYC 3OZ9H 1F90H 1MHCA 3MYZA 3LKQA 4LSPL 4GSDL 2C3HA 4M43L 1IM9B 4YHYB 3UBXA 3MCLH 1JNLH 4ACPA 3CFKA 3HMXL 5EOTA 3QDHA 2P8MA 3FQUA 2H1PH 2VDML 1Q9LA 3FQTA 4MXVF 3PDOA 1LK3L 1C7TA 4JZJB 3QISA 1KJVA 3LKRB 4S1SH 4OLWH 1MCPH 4YXLL 12E8L 1LGVA 5GGUA 3QO1A 5D96B 2EICA 5JMRA 4FOMA 2EEDA 1N5YL 1BJ8A 4PV8B 3RVXC 1GGIL 1IAMA 1K2DB 5GRXG 3LH2H 3CMOH 1KACB 1Z9SA 3CVHH 3BW9A 4WI3A 3ARGC 4FABL 2KQMA 1OF2A 4LL9A 4QXTB 2IF7A 3VXPA 5MI0C 3OKMB 4PJHB 4CMHC 1MHHB 2Y36H 2B1AL 4V2CB 1RIUL 1BJ1J 3VFVB 3I3EA 1HZHH 1WUNT 3WIFB 4UT6H 5FGCE 4NJAL 3GSVA 3QZWB 3E6FA 4XP4H 4YHIA 4AQOA 4HG4J 1CXLA 3ZZ1A 3VD3A 2VXVH 5ELIA 4H26B 3NAAH 4HPYH 4DUWA 1AI1H 4NZDA 2D7PA 3OKYA 2CIKB 4M9OA 1A14H 3CZFA 3NOIA 4BZ1H 5DFVC 4FS0A 1QNZH 1RULH 2Z31D 3MRLA 4S1RL 4YHLL 2I5YL 5CBAA 2ZJSL 1S9VA 2X4PA 4X4MA 1BIIB 4KJYB 3T65A 2VZOA 5HYQA 3DVGA 1HXMA 5D2NC 1NFIB 2NY0D 2X2YA 5SWQA 2C1PB 4R7DB 1G9ML 3I2CL 3T77A 4F2MA 4LASL 1KYOK 3SDAA 1DR9A 1QOKA 5BO1H 1KGCD 1MFCH 5FDWB 1J0ZA 3FO0L 2AJYH 1DBAL 3QH3A 2AXFA 1JK8B 2XV6B 3H9SD 4BSWB 3LS5H 2X4QB 5DZOA 1T22B 4WUUB 5FXCH 4L4VE 2NLJA 43C9A 2MFNA 4HPOL 5SX4I 2DLFL 3NA9H 3DVNB 5E94A 3OWEA 4KJQD 2UZYB 4JLRB 3OKKA 1RD6A 2E8ZA 5CHNA 2Y5TA 4NKQB 3BKML 4KTYA 4PTUB 3TH3T 5IVZB 4EN3B 4QHUA 2OX5A 5H94B 1I3GH 2BXZA 4G5ZH 1MCJA 5DJZB 4X7CC 4KRPB 3CSYA 3QUXD 5KAQF 2DDQL 3STLA 5HYFA 4JG0L 3QWRA 1GZPB 1XGTA 5C0GA 5EU6E 4RGNC 3ARYA 2VDPL 3RFZC 4M6NH 4LKCB 2IMNA 3MNZA 1WISA 1PDKA 4LDLB 1NGXA 1NCAL 3WBDA 1YY8B 3KYNB 1N64H 2BVQB 2OCFD 3QJFB 1I9RL 1U8OB 2OS7A 3JWDH 4XVJL 3NPSC 2DQUL 2J6EL 4FNLH 1UA6H 3EO9H 1MJUH 5IEHB 5F7DA 1ZA6A 4XX1G 1FV1B 5FYKL 3BOVA 1PSKL 4HCRL 5HGDA 3ZYZA 3T0XA 3BGMA 4UINH 3UTSB 5C8JA 4Z7VE 4HIXH 1D9KB 5BRZD 3F58H 1JN6A 1JPFB 3WYRA 3WSQH 3DMMB 1L7IL 3LQZA 3DYOA 1RIHL 4OD1L 4Q6IA 4XP9H 4XPFL 3RA7L 1QO3B 1PQZB 1Y6NR 2JB5H 1NCTA 3CDGA 2IC2A 5I9QB 3MR9B 4YHOH 3PGFH 1U3YA 1NMAL 4HT1H 5E70A 1I8LA 4N0UB 1PLGH 4F9LA 1QVOB 4JFYB 3EUUA 2EYRA 5F7LB 4FZ8L 3QNYB 3LKPA 3I9GL 5IM7A 4HMCA 1YEIL 3BP5A 4I0PC 4G6FD 5IFHL 5GGTH 3P30L 1IGML 3PIQB 2BP3A 4OFYD 1TLKA 1K6QL 3BP7A 3VFWA 1T0NB 2D0FA 4NRXA 2XWJA 3PG2A 4WWKA 1MNUH 5GGRB 3S36H 2RAMA 4PLNC 4RMWA 4UQ2B 4G42B 4NFDA 3CCHA 2F74A 1A1NB 5KS9F 4C56D 5EIQA 5HDBE 4XC1H 5FYLL 5DRWA 3P9LA 3PWLA 1OL0A 4YDKL 3IJYA 3VGAB 5J13C 1BX2B 2NY6C 5DVNA 3CFDB 4BSVA 5DJ8B 3K80A 5EORH 4LSQH 1FAKT 2C1OB 1X6NA 4PRAA 1NMCB 5F6HJ 1LMKA 2ZZUT 4HF5L 4WI6A 3BZ4A 4HWZA 4I3GA 4P4KD 5HYJD 4JFDB 3CK0L 3HE6D 5L8JB 1YEEL 4E41E 4PLOB 5HHOE 1JP5A 2D7TH 3UYOD 1GOHA 1RVFH 3FQNA 1P9MA 4IIQB 4JQIL 4P2QA 3VXMA 1VENA 3P0VH 2A73A 1BM3L 3QFDA 2BSTA 4AT6B 4YDVA 1MIEL 4ZO8A 4NN7C 2Z8WC 5GJTH 4DEPC 4B5EA 1ZHKA 4U1IA 4XC3H 3G6AA 3KPRA 4PJEB 4X7TB 4R90L 3IDXL 2AK1L 3LIZH 3NIGE 4NKMA 3TF7C 1ODAA 2VIRA 3BP4B 3TBWA 2WBJB 3VFOA 4PGBB 4FQIH 4D0BB 4DTGL 1O5DT 3MLYH 1WLHA 5IWLA 4J8RB 5BMFL 1J0HA 1QSEB 4KKBD 5E2UH 3S3PA 1HI6A 2DL2A 2FEEI 3IKCA 4ZUUA 4LCWD 3RAJH 2C7UA 4AZ8A 1TDQA 1YEKH 5BVJB 4GG6A 4P3CH 2R2EB 1FZMB 3MLVL 5CMAB 1A6WL 4IRJA 2XXCB 1ITCA 3HG1A 3RKDD 2I27N 2DRUA 2RCSH 3HKFA 5TE6L 2AK4A 1FNSH 5DURD 1YUHA 2B5IC 5C9JB 1DP0A 4JHAL 2EZ0D 4CL7A 5IMMB 3HLAA 1KTLA 1L9NA 4LLWB 4AEFA 5HGHA 3B9DA 3VU2A 4OCRL 4D9LL 3PQYE 3IVKB 1RUML 3LN5B 3CFEB 2P5ED 1P9MC 1FVEA 1GC1C 3U2SA 3B3IA 3HE7D 4X5WB 4B7LA 4JB9H 2X4UB 3WUWA 2Q8AH 2FBOJ 3GKWL 3EDFA 3VWKA 3E0GA 1A6UH 4BK5A 5FA3A 4CN4A 1U8LB 5BXFA 1YEHL 4KJWD 1R3HA 2XY1A 3T0EB 4Y1AA 4PJ5A 3FT2B 4ZS6C 3AAZA 1Y18B 5DD6B 1N59B 3OF6A 1YJDC 1RZGB 2X9YA 2O5ZL 4RRPG 3O9WB 1Q9WB 5HD8C 1MFDL 3D18A 1XGRB 1FVDB 5I8OH 4NCC2 2F8VA 5F1NA 3HI1B 4LNVA 4Z7QF 3SE9L 2W0FA 1VGKA 2APTA 3U7AA 1BBJB 1VPOH 2FH6A 3DX9A 5BQ7A 4KKAC 3WIHL 3QO0A 1KJ2L 5HDOA 1DUZA 4M93B 1FO0L 5J89A 4JPVH 1S7UA 4UMGA 2X05A 2WIIB 4JHBA 1JHLH 4Y4FB 1BWWA 4JFFD 2VB5A 1OT1A 4NM4H 1I1CA 1FIGL 2Y7QB 1YMMD 2NTFB 3ZKXB 4P23C 5I66A 4R4NC 5DRXA 4PRHE 4WUUE 4LHUA 4O2FA 4LIQE 1X5IA 1OAZL 4LEOA 1S9WB 2GFBB 4JFXA 4NN5B 1IRAY 4MXQD 3IS0X 1TTFA 1S5IH 1YQVH 3SO5A 1OD9A 3RPIB 3VE0B 4ZTPL 1U36A 2GSIB 3NCBB 5J7CC 4RCAA 3IDJB 4FA8A 3LKSB 1JI1A 1ZT1A 1OP9A 2FX7L 1KPVB 2EDWA 3OKMA 3S4SB 1IGTB 1MHHA 4NUJA 3M1BA 2KH2B 1O7SA 3U0PA 1XF4A 1CLZH 4G8GA 5L6YH 4Z7VF 2NR6D 4G9FE 3VWKC 1LEGA 5L88H 1HHIA 1CL7L 3D0VB 1MCIA 2DM4A 1KJ2B 3FFCA 5IB4B 2HKFH 4B41A 3C60D 4PIRF 3RVWD 2FIRT 4OZFG 4WHTA 3U4EB 1YA5A 5GISL 5GRWA 1WZ1L 3HMXA 2BX5A 2XRAL 2MKWA 3F12B 1WEJL 2M1KA 1CDUA 3ZKSD 1PW3A 3B8SA 3UTSE 4L4TA 2BMKB 1AP2B 2YD8A 4NC1E 3KYMA 1SM3L 3FMGL 1Z0MA 4OF0A 3E6HA 3TN0A 4LLAA 2M2DA 2X4RB 1JWUA 3U1SH 4AH2A 5C0CB 1URLA 5A2LH 1D5ZB 3HZKB 2QQLL 2DJSA 2GTWA 1RZKH 1EK3A 3MBEC 2BHYA 3KYOB 2NX5E 2X4QA 3MXVH 4MB3A 4U49A 5FAAA 3MFFA 2VLKB 3IDYC 1OTSC 5CZVH 3ULUE 3ARDA 4LIQH 4LPUA 4JLRA 4N0UE 1NJ9A 3GHEH 4U6HA 1QKZH 5C09D 4YAQB 3W11D 1SEBB 3RZCD 1OGTA 3BKJL 1JL8A 1OARH 3P4OB 1IGJB 4PB0H 3VXUD 3LQAH 3RY6C 2YUWA 4EN3A 3RGVB 3Q1SL 2XWBA 4XBGB 1F4AA 3Q6GL 1N6QL 1MJ8H 4OF6A 3HI5H 4KI5E 4GKSA 1FVCA 3T4YA 1Z2KA 3PXJA 1UB5A 1OY3B 4Z95H 1A3RH 4KMLB 4N5UA 4LAQH 4YHLH 2GJZA 3SE4C 5M95B 2VDQH 2ADJA 5KBNC 4U1GC 5D7LB 3S88L 5HGBA 4W6YB 3ULVF 1NBYB 4IRSB 4KK6D 4LLMA 3ET9F 1HCFX 1P7QD 1FSKB 1P4LA 4ZAKC 4JO3H 3D3VB 1BD2E 4J6RL 3I2CH 3H0TA 1FFOA 5GGVL 4X0KB 1CGSH 2FJFB 2PNDA 1OAQL 4JFDE 1LHZA 1MFAL 1QA9B 4UT7H 4XBEH 4ODHH 3TIDB 4NZTL 3DX8B 3X3FL 1FFPA 4PY8I 1E4KA 1X4YA 2AVGA 4NYLA 4HIJB 1E6JH 4JDTH 1MEXL 4LEXH 4RX4D 4DW2L 1AHWB 3P9WB 2WLZA 1VSCA 3R0MA 4J3WA 1FL5A 1HHKA 1JPFA 3MV9D 3W5NA 1UWGL 4N90E 5AUMA 1F11A 4KY1H 1C5CL 5HI5C 5D7JB 4PBWD 2CKBL 4HJ0D 4PS4H 4HIEB 1T03H 2AJUH 4GKZA 2XQBL 1NL0H 1KC5H 3Q2CA 1RZFH 2J8UB 1VFBB 2ZSVA 2W9EL 4OBSA 4KHTL 1AGCB 3UTPE 3ULUH 3MMEB 4MJ6A 3O2VH 4RNRB 2OL3L 3ARGB 3D69A 5HI4C 4ZD3L 3ES6B 5MI0B 1VERA 1G1CA 4RWYH 3BH8B 1EERB 5DK3A 5DK0B 4CMHB 3MRQA 5KVMC 1QSEE 1INQA 1KIUA 4D0CB 2J7LA 5AD0B 4QRRD 1FNGA 4J23A 3VWJD 1KLUB 3ARTA 4I48B 5F6IC 3ARFA 3WFEH 1LEKB 4ZUWB 2J6EA 4XVJH 3RL2B 1A0QH 1NKRA 5D1ZD 4PJBE 2BOCA 5FA4B 5EPMA 5I30H 4HCRA 1Q9KB 3QAZB 2PYEA 3QULB 4HCRH 3OB0K 5DD3H 5GS2H 3SE3C 4R0LA 4YK4C 2ORBL 4BQ6A 4TPRH 4MDJA 2A6JA 2VZUA 1OAYL 3TA3B 3U9UA 1P7KA 1BZ7B 5E95B 4YEFA 4WHYH 4NQDA 3VH8G 5D2NB 3MNWB 4UNUA 2XY2A 5I74B 1E4KC 1UXSA 3IRPX 5C6TL 1I8KB 2IAMA 5I8KH 1WZKA 2ARJQ 4GQ9L 1EHLH 5D2LE 3S6CA 1CR9L 4OLVH 2XFXB 4NQCB 4Z0BL 5DEZA 1C1EL 1XH3B 3QJHA 4JFEB 4PRIA 5CJQL 5ID0B 2X4NB 2AJ3A 1KCRH 3P40A 5AZ2L 3QDMB 5ALCH 5KG9A 1FN4A 3SKJH 4JZNA 3AVEA 2YZ8A 4JG1H 4FFVC 3FO1B 5JUEH 5IGXH 1YEIH 3BWAB 3T0EE 2ATKA 4KVNL 4X6DB 3QHFL 4LSVH 4Z76B 1YDPB 4X7TA 2GCYA 3GIVA 5I1DA 3OGOE 5EBWB 5ISZB 1MI5D 5CUSL 3SJVA 4FFWD 4J4PC 2Q7YB 4AIZB 4J8RA 4JGJA 1YC8A 2O5YL 4LAJH 1LO4L 2X42A 1RUAL 2AEIT 4GRWE 3VJ6A 2NY5H 5F9JB 1MFBL 4RGNB 1E27B 1I3UA 1X5ZA 3KHOA 5TF1L 4KGLA 1MVUA 2QTEA 3UTQB 4KK5D 2A2QT 5C2UB 2BNQD 4JN2B 1WBZA 2ZG1A 3SDDA 3VXSA 2QR0A 3B2VH 3OXRB 3ZE2E 4C4KT 2WINB 3IFOB 2VDLH 1OT2A 3WUWG 3K4DA 4JKLA 2DTMH 4PJ9D 5C9JA 4NUGL 5IMMA 4J3VA 1Q94B 5EA0H 3HRPA 3G5ZA 4H25A 3U0WL 1M71A 1S7QB 5SX4H 1QR1B 1IC4L 3O2DH 5D1QD 4LLYB 4WIQA 1NGPH 1U8NA 2QL1A 2VR5A 3MJ8A 4F7CB 1KENL 2YKLH 4L9LB 3G5YB 2E9WA 2IAMC 2P47B 3HC4H 3QXVA 2XG4A 4ZQKB 3NABL 2FL5A 3QQ4A 4MAYD 4WENB 2ESVB 2NXZB 3QNXB 3L7FA 2NPLX 5FF6B 2NXYC 4QXUL 3QIUA 4R90H 1CE6A 4HXAH 4L8SA 1UYWH 4KTDH 4TVPD 3AGVA 5E6ZA 2VYRE 4F37F 1I7ZB 5JW5A 5E2TL 4XX1E 5F7KC 5K9KB 1LO5A 4FQ1L 3HR5B 1G0YR 4MJID 1NLBH 1EMTH 1ZANH 4LHUG 5C08E 2CLZA 1ZLSL 3K3QA 3ULUF 1LILA 2VWEC 4XI5D 1RK0A 1JNJA 4Y4HC 1IJ9A 1X5YA 4G43B 4TUJB 5D4QA 3JWOL 1D5IH 3WDHA 1U6AH 4POZD 3TYGH 3BRGC 3ZDZE 2Y72A 2IQ9L 4G6AC 3VG9B 3LS4L 1ROWA 3NCEB 2XN9D 2ZUVA 4LQ1A 2F54D 3LVEA 3V4PH 3GMRA 2R1YB 4OZIA 4KI5F 3H9ZA 1J9CT 2VKWA 3QQ3B 4KC3B 2ZWLT 3STBA 1KNOB 2Y7QA 3EFDH 4ZNCD 3SO3C 3T0VA 1NCBL 4RAUB 1KCSL 4AY0A 2VLKE 4D9LH 3QEUB 5ENWA 1SQ2N 3O3AA 5DRZB 2BY0A 5CD3B 1MCCA 2R0ZL 1J05A 5GGRY 1JIBA 3MLXH 5KSAA 1P7HL 4KDTA 5D6DA 4KK8D 3D87B 5F7HA 5T5FL 5MHSE 3T09A 3VG0H 5TPWL 4LGRB 1L0XA 3EJJX 3S4SA 1RU9H 1NBVL 2EH8H 1K85A 4CW1A 1WBYA 3PWVA 2IAND 3QG7L 3STZB 3T04D 3C5SB 2AQ3A 3VGBA 2F53D 4NN7B 1DDHB 4DEPB 4XCEA 2IG2H 5D7LE 5F3HB 3WIHA 1A1MB 3I6KB 1KJ2A 4IDJH 3C6LB 3OR6B 4JRWA 3EOBA 4I3RH 4C4KO 4H8WC 1CFVH 1FO0A 2J1KA 3S37L 2E7BA 5DJAA 3WJJA 4JFHE 1E0OB 1VFUA 3LKNB 4TUKH 5HJ3B 5GIRA 4Y16A 4IHOA 1EH9A 2H2PD 4D9RE 3HFML 4HS3B 2HWZH 5F7FA 4GAJH 2GJ6D 5EOCH 3CFIC 4KHXL 3TO4D 1L0QA 4MQTB 1U8MB 1ZVSA 1J1XL 3LZFL 3ZDXE 4UTAH 5CIPA 5DZNA 1INEH 2K3TA 43CAB 5T33H 4WCYH 1DEEB 1NFDB 5IEKB 4U6YB 4QHLA 4TRPL 2BCKA 4JY4A 3QHTC 2Y06H 1S9XA 3UTTD 4PJBF 3S37X 1UKQA 1A7QL 3H42L 3T8XB 2J8UE 2EO9A 2X4SA 2MOVA 2FX7H 3TVMA 3OR7B 1A47A 2CD0A 4NO0D 2WNGA 4EXKA 3BESR 4ODTH 5KVFH 5F93C 5KSAC 3TJEL 4KDTC 3S3SA 4YDLC 1BHGA 1C5DA 4MLIA 3ROLB 3MSPA 4MS8D 2BJMH 1AJ7L 3QUKB 4F3FB 2B1HL 1R0AL 3LHPL 5F88A 4I4WB 3VCLA 2GUOA 4YH6A 1R5IB 5CJXA 4IEFB 4JM4H 1P6AB 5D2LF 1V3MA 3VRJA 3O11A 1X5FA 3S35H 3V6OA 1KELL 1IGYB 3VH8B 3GMQA 4LLUB 4U1NB 3DRTB 4LSUH 1B6DA 1E4WL 3WJJC 5DLMH 4BQ9A 2DJ4A 3L3JA 1GHFL 1B4JL 4OIAA 1CQKA 4L8BB 4U4BA 5D2NE 5JQ6L 3ESUF 1DQJB 3BEVA 1V05A 1HINH 4ZNEE 3ZTNL 1S7XA 4LSRH 4PJDB 4GMSL 2JK5B 1AHWA 1GRWA 1OGAA 2IWGA 5KJRH 4NQCE 2ADFH 2Q76B 2AV7A 4JFEE 5I1GL 4GRWF 4O2CB 4HKJA 4QHKI 1VADB 3TZVA 3QDME 4X4YA 4ENED 5I1IH 2AS5M 5B4MC 5FK9A 3ZE2F 2DQCH 4OTXH 3BZFA 3BP6A 1HCVA 1CGTA 2RGSA 3O6FD 1AIFA 2YPLB 3CXHJ 4P46B 3HZYA 5KOMC 4RNRA 5C0EA 5JOPD 5ISZE 3VXRB 1PG7L 4P3DA 1SVCP 1I8MA 3BPNC 1M7DA 2FIKB 4NWTH 2FATL 4RMUA 4D8PB 4DN3H 1JGEA 3TH4T 1XR8B 5CEZD 4XH2B 4RGNE 3OV6A 1BF8A 5SV4A 2ICES 1A7RL 3GBLA 4WU5B 1I7RB 2PXYD 4L3EB 4MXWL 4J6RH 2MTPA 3FO2B 3H6JA 5GZOD 5KVDL 2X41A 4L4JA 5F7EL 1OCWH 2VQ1B 3O4LA 4J7RA 2R8SL 4MWFB 3MV8A 1IAOB 4AG4L 3BRDA 5MEQB 4S2SA 4YHZL 4WW1B 4XMKH 4NKOB 1PG7X 3ESVF 2A6KA 4X4ME 5F8RC 5ABDE 4YR6B 1S5HB 1N0XL 1XGYL 4XPTL 2BVPB 3MNVB 4E5XA 4HSQA 1JNNH 3V0WL 3MV11 4HFUH 2CKBA 2AV1B 3DGGA 1MFEH 2LVEA 3JVGA 4PRDA 3VFMA 2OXHA 2PCPA 4RFOL 3V5HB 3N85H 1FFNB 2P24A 2W60A 3LOWA 3AB0B 4TOYL 3UAJD 4PUBH 1QSZA 1TVBA 5T1LD 4WV1C 1T7WA 3EGSB 5I16A 3F5WB 2OL3A 4OUUB 3GMPB 5CWSA 3MBEB 2W0LA 1T66C 2VH5H 1QLEH 1ZOXA 5FOJA 4CU6A 4KMTL 8CGTA 1IKNA 1GSMA 5AYUH 4GS7C 2IBZY 1U3HC 1FE8L 3GO1L 3FN0L 4Z76A 3NFSH 1YYML 3ARUA 4TSAH 3U9PL 1ZT7A 1K4DA 2DQHL 1NC2A 3WS6C 3HPJB 4JZOA 3EJZC 2Z35A 1X4ZA 2FZ3B 2VOTA 1XGPB 5DEGA 1SJVA </