1HKFA

The three dimensional structure of nk cell receptor nkp44, a triggering partner in natural cytotoxicity
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
108
structure length
108
Chain Sequence
SKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Three-Dimensional Structure of the Human Nk Cell Receptor Nkp44, a Triggering Partner in Natural Cytotoxicity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
molecule keywords NK CELL ACTIVATING RECEPTOR
total genus 26
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1hkfA00
1IBGH 1VENA 4TOYL 4JO2H 3QIUA 4DUVA 1RZ8A 4PTTB 3RVWD 5HHVH 5FO8A 1DBML 2D7QA 5E94B 3V4PH 1XGTB 1XCQB 2VLKA 1KN4H 4UV7H 3RPIA 2EH7L 1J8HB 2DLIA 3MOAL 1IGFL 1FNGA 2XXCB 2ZUYA 5F9WC 3TEUA 4ZSOA 3D3VD 2DLFH 4U6YA 3SDCA 3IS0X 1FFPA 2V9QA 4ONFL 2HYMA 1NDMB 5CS7A 3WFBL 2YKLH 1SVCP 4CNIA 1L6XA 4ZQKB 4JZJB 4HWBH 5FO9B 3IJHB 1HHGA 3WXWL 4NRXA 1JTOA 5ITBL 2HT3D 4BSVB 3X14B 3ME0A 4J12A 4XPBH 4ODTL 1JUFB 4Z7NF 3DV4A 3STZB 4NC1C 4CADB 1JTTA 2EC9T 4CMHC 4TNVF 1QKZL 2DQIH 3MRGA 5DRZB 2C9AA 5FDYA 5I0DA 2XACC 2GY7B 3CMOL 1CFVL 3GMRA 1BBJB 2G75B 3IETA 3GDBA 5DVNA 3V79C 1MF2L 2M26A 4YDJA 1R5VA 3WJLA 1BVLA 1RZKH 4L3EA 2R69H 4L3EB 1X6LA 1JHLL 1UM5H 3WJJC 4JHZA 4XBGA 4LQFH 4F9PC 5E24E 4XMLL 3V4PL 2AK4D 2R56L 1AD0B 3C60A 1DVFB 2VL4A 3NGBC 3GMOA 5HHOE 3QCUL 4KJYA 4OTXL 2DJ4A 1KIPA 2UY6A 4LNRB 1LO3L 3JWOH 2ED7A 1DVFD 3U0WL 2NY5H 5GRVL 2ICES 3LIZH 2YA1A 5IB4A 2BVOB 1S7TA 4MWFB 5ECJE 2IQAB 2X5PA 5C0CB 4HW6A 1FAIL 3CUPA 4M48L 2X2YA 3VFGL 2V2WB 4JG0L 4F33A 3PQYB 4TUOB 3PQYA 5EU6A 4DGVH 1SEQH 1YEKH 3UP1A 1CZ8L 4CBPA 3EDFA 1H3PL 2Y6SD 1UXSA 1MIEH 3KXFB 4APQC 2P49B 5I15H 4X7TA 2CR6A 3LKOA 3GSRB 1MH5B 2VSCA 2ZOLA 2WINB 4PLKD 5I0ZA 3EYQC 5ITFA 4GBXC 2YSSB 4ZUSB 1T66D 1V7NH 3PABA 3LRSB 4P2QD 5EO1A 5BO1L 5CBEA 3WJJA 1MLBA 5IJVA 2JELH 3DVNA 1BX2A 5C0AE 5C0AB 3L6FB 3PL6A 3AU1B 1KCLA 1XGYL 3BVNB 3KDMB 4NO0B 2Z31C 3FOLA 3NPSC 5FYJD 5JOEA 4DWHA 1G7HA 4R4ND 1W72H 2R4SL 3Q1SH 3INUL 4JVUA 3DMMA 3ULVL 3VRJB 4NKIH 1A14L 3H9HA 4U2YA 2VZSA 4K23L 3ULVD 3AMLA 1MJ8H 4J4PC 1IAIH 4HUWB 4PV8A 1S7UA 2R0WH 3MRKB 4XP1L 4XVJL 3T2NH 1S7UB 2V5TA 3BJLA 3MRKA 1AR2A 4JQVA 2AQ1A 3KJ4C 3DUHA 5E6ID 1X5KA 3BUYA 4GUPA 4KK6D 2A6JA 4OGYL 3RWEB 4UNVA 2A6JB 3U9UA 3QP3A 2YD3A 3P4OB 4OCNC 1KJVB 4P3DA 1KSRA 5TFSH 1OB1A 4XB7A 3GBLA 3K1KC 1I9RH 1JPFB 3S3SA 3VXUA 1A1OA 4O02H 3FFDB 2JCCE 1QBMH 3DV6B 3U79A 4L3AA 3EBAA 4HXAL 4OFKA 5HYFA 4Z0XA 5J6HA 3ULUC 2R1WA 4LHUB 1N3NA 3LVEA 3U2SB 1U8NA 2PUQT 1N6VA 4X6CF 1BIIB 3CMOH 5F7WC 4AM0A 1M7IA 4OLYH 1MCEA 1KCRL 3UTSB 1AHWB 4OKVB 3O45A 5I8KL 5KOVC 4OD1H 4AH2A 2J8UF 2I60L 3HC0A 4ODUB 2X4RA 5GS3A 5F44A 5LBSH 1UCBH 4P2QA 5DR5L 4GQ9L 1FL6B 4YC2B 2CKBB 1Y6MR 1FV1A 2ZCLH 1AGFB 1GOHA 4NDMB 4MJID 3S8WA 3CSBA 3DURB 1QSEA 2VQTA 2ERJB 4X83A 3BRFA 4GAFB 1GZQA 4YXKH 3RDTC 3MLUL 5T1LB 5T3ZL 3ORJA 3BT2L 3VFUA 3EAKA 4ZXBC 2UZIH 4FXLA 4WEBH 2GT9B 5FCSH 3HRZA 3UTQA 3C9NB 5EPMA 2C1PA 1ZLSH 1QLFA 3QQ9D 3D0LB 1LP9F 4JM2A 1NQBA 2VAJA 1CGWA 1CFQB 4OCSH 1F6AB 1TQCC 1KULA 3MRGB 5DRZA 3P40A 4RZCA 3T0AA 4RZCB 3QXTA 4OZGF 3V7MA 1HWGB 1XGUB 4GRMA 1F02I 5CFHA 2DKUA 3FO9B 4M6ML 1B6UA 2DD8L 4F2MB 3AVEA 3RWGA 4UI2A 3C5SA 5IVZB 1H3TA 5E2VL 4OLXH 2Q6WB 3ZE1F 1DE4A 3JZ7A 1FZOA 3EW3B 1OAXL 3MNVA 1DL7L 1KXQE 2W59A 1FORL 2F53D 3V7AE 3KYNA 3N1PC 3ZE1E 2RAMA 3GSWA 1J10A 5IBTH 1P4BH 2YD4A 1A4JB 2EC9U 3MRCA 2HLFD 1P6AB 2DI7A 2VDRH 4P5MA 3LMJH 5F72S 3UTTB 3BISA 5GS0L 4TTDC 2IBBA 5HYJE 5DJ0B 2UVFA 1K2DA 3ARXA 5KW9H 5CMAB 3T2OA 1FFNA 3QFJA 4ALAL 1FFNB 1AGBA 3BQUC 3IDIA 3R4DA 3UO1L 4LVHC 3ESVF 5ERWA 2QEJA 4H20H 1RK1B 1MEXH 3U7WL 1EXUA 4JFED 2DDQL 3QEGH 4WV1A 5EU5A 1JRHL 2DLHA 3TZVC 4Y5YB 4E42B 4Y4FA 4OI8A 1FNEB 5E0QA 5FGCB 2BNRD 4U7MA 1A6ZB 3V6FA 4KI1A 5DUBA 1KUMA 3RGVB 1SMOA 1ND0A 2EYRA 5BXFB 5EA0L 2EYRB 5BXFA 2GAZA 1OTTC 2NY5L 1DLFH 3GUTB 4BJLA 1MHCA 1QBLL 1UACL 4U1HB 2R2BA 4EI5B 2F5AH 4LOUD 3RNQB 5C09B 2J4WH 2XKUA 3GHEH 3MV8A 1X7QA 4UDTA 5IEKB 5HDLA 4MD0B 1ZLSL 4UIKL 2W0KA 3HNTL 3TJEH 2HH0H 3VWKA 2EEBA 1XT5A 1BZ7A 2VXSL 2FB4H 5C07E 5D1ZB 4OD3L 4K23H 1P7KB 4LAQH 1GAFH 3QG7H 5EZIL 2IQ9L 5FM8A 4NKIL 3I6KB 5GGTL 3PWLB 2NY1D 3IXTA 5B4MD 2V17L 1OARH 3HZKA 3KYOB 1DLHA 3CIQA 5IVXB 5HI5D 3V5KA 4YX2L 1EBAA 3DO7A 2YPLD 2O5XL 5JPNA 1MCCA 3S5LG 2MCPH 4QRRB 2JELL 2NY6B 4G8EB 4I18B 2NNAB 2FR4B 2L7JA 4H88H 4B7IA 2X9YA 4FRWA 2UZYB 5F9OH 3E6HA 3LRHA 4YDKL 3HE6B 2XTLA 3BPLC 4XBEL 4Z0XB 5HDBF 1G6RA 2DMKA 4PLJC 4WIQA 1UGNA 1MY5A 4UV7L 1A6AA 5EOCJ 5C0IB 3KPMB 1MFAH 2FO4A 4PJGB 5LCVL 4UBDD 4ZDHA 4JKPL 5DQDH 3HC3L 3OXRA 4F8TA 1NFDE 3TBSB 3SDAC 1OSPL 3MLYL 4G8IA 2BY1A 4FQ2L 2LQRA 4JREB 4K3DL 3D9AH 1MCHA 3QCVL 5F1OB 5IQ9B 4JR9H 1I7UB 2B2XH 4HKXA 3WIHA 2G2RA 1QRNA 4NHUA 2GY5A 4Z7VE 3UTQB 1FYTD 1MRDL 1G9NC 3NA9H 4WENB 3PV6B 2WLZA 4TSBL 3CSGA 2CLZB 4B50A 3SDXB 1GGTA 2CK0L 2R2CA 1F6AA 3O2VL 5TQ0H 2X40A 4WI8A 5HDBE 3NPZB 1ROWA 3IAPA 5DK0B 1VFBA 3BD4A 2ORBL 1J0IA 1KEMH 2IBZX 5DEGA 5BQ7A 5JXEC 4Y5XA 1T1WA 2IF7A 5F8QC 3U7YL 3RUGA 4KHTL 4KZDL 4RAUA 3S36L 4HF5H 4UTBH 2DM3A 2ZJSH 4ESKA 1GVIA 4HFUH 1QD0A 2X4QB 5DJ8B 4XMKH 2DQTH 4OZ4B 4AIXA 4DKFL 4N8PA 4YO0B 4AIZA 1HNFA 3QUXB 2G9HB 4ORGB 4K7PL 3LKSA 1BQHA 2BY2A 4FQHA 5DFVC 5HDQL 5IMOA 1J11A 1NBZB 5DVOA 1A6WH 4YEEA 1U8PA 5C0BB 2HLFC 2VZOA 2AXGA 4HS3A 4JO2L 5GGSB 2F53A 3H3BC 5JDSA 2ATKA 1JGDB 3WLBB 1MFCH 3QRGL 4LRNL 4FP8H 4H0IA 1RUQL 2EECA 3NAAL 5T33H 5C0RL 1ZS8A 4JFFB 3LN9A 1EMTL 2RB8A 1D5IL 3QR2A 1T7YA 2I9TA 1RPQA 5ID1B 1C5CL 1CXKA 12E8L 2DRUA 3TT3H 4LPTA 1CTOA 4ODXA 5E6YA 3MYZA 4GO6B 5KSVB 4PJFA 2NY6C 3WS3B 2C1OB 4Z78A 3DRTB 2BVUA 4HG4K 3BO8B 5FK9A 1UM4L 1XZ0A 3HAEH 3VXRE 2HTKD 3EIFA 4EOWL 2O5ZH 3IDJA 4I2XB 1F6FB 4IS6A 3STZA 4IRSA 4Y16A 1PJ9A 2HN7A 5TH2A 2ZZUT 2VXSH 3TBYA 2ICWI 5KBNC 4YR6A 1LE9A 1JVKA 1R24B 4KPHL 5D93B 1NCWL 2DLEA 3TBTB 1YEJL 1N4XH 2F8OA 2FX8H 1MWAL 2EE6A 1YJDH 3HI5H 4U49A 3C8KA 3MRJA 4GKZB 4XCEB 1R3HB 1HKFA 4BFEA 4JQIH 4RA3A 2XWJA 5J3HC 1A0QH 3SE3A 3ZHLA 3LN5B 5SX4H 5C3LD 2A1WH 1JYXA 3TN0A 4QTHB 1EFXB 3EFFB 3KR3H 4M62H 5JQ6H 1XH3B 3FCTA 5JZ7D 1S5HB 2B5IB 3QDGD 4LSPL 5SV4A 1DBJL 4LDEB 5C0CA 2SEBA 4R7NA 4NYLB 4RIRA 3U7YH 5I1IL 1X5XA 2UYLB 3HPLA 4JPVH 4OQTH 2W9DH 3GSVB 2VQUA 5I8EB 3IGAA 1RZGA 4JFHD 4MQTB 1V3KA 4ZNEA 1LEIB 2BSTB 1T7ZA 2YPVL 4OCMC 4LGSB 4BZ2L 5KVEH 3MJ7B 4GAGH 3O6KH 4QXTB 1ZHBA 4D2NA 1ZHBB 2QSQA 1BPVA 4H26B 1YEEL 2CO7B 2XZAH 3UXFA 3TVMA 7CGTA 1S3KL 4JRXB 1Q94B 1WCQA 2BHUA 1YEIH 3NFNA 3GI9H 2EO1A 3C2SA 5HGGS 1OP9A 3ES6B 1WF5A 3VDCA 3WSQL 1JIBA 1T6WA 1T04B 4K71B 1FL6A 5EC1B 1TTGA 1CD1B 2ZSWA 5CZVL 3HPJA 2DS4A 2NX5D 4MAYD 3O4LB 1F3DJ 1KYOJ 1T21A 2V9TA 4YK4B 2ZUTA 3BPNB 3MUY1 2YEZA 2AJVH 2M1KA 15C8H 3TWCH 1HIML 1KJ2L 4PY7A 5GGTA 3EYFB 5FECA 4Y5VA 4JY5H 4TUKH 4AJ0A 3S35H 1EHAA 4U33A 5F9WB 1JHKH 1ACYL 4JO3H 2EDWA 3ULUD 1J1OL 2W0PA 1ADQA 3BHBA 4X6CE 1IQWH 4Q9CA 4P5TA 4X9GA 4N0YL 1A0QL 1ZEAL 3QXVA 4MCZB 5HI4C 2P44B 3DX7B 4N1CA 3ZYJA 2CDFA 2Z8RA 3WEXA 4OFYD 5FCUH 3IDNB 4LEXH 3O9WD 1ZT7B 4WFGE 4QXUH 2DQJH 1A3LL 2Q86A 1KCRH 2PR4L 4YE4H 4YAQA 2ICEA 2AABL 2ICEB 1NH6A 4RGOL 3L3OA 4G6MH 1V7ML 4U0QB 3SQOH 4QWWD 2Z93A 1SJEA 1VKXA 3QPXL 3LPGA 1KB5B 4WUUA 4XNUH 3BP7B 3FQNB 4OZFB 4XC1L 1SEBB 4PLOB 2AAVA 2NTSP 2PYEE 2PYEB 4OCYL 4D8PA 5J8OA 4U6YB 2MFNA 3SDCB 1N5YH 1J7VR 5E95B 1HCVA 2J8UA 1OPGL 4IOIA 4V1DA 4U4BA 5ABDE 2GT9A 4XGZA 3EYVA 4M61A 5JPNB 2Z9TA 5EU3B 1C08A 2R0WL 4XVJH 1S9VA 5MEOA 3BVNA 3KDMA 4NO0A 2BRRH 1A8JH 1IC5L 1AP2A 4HS8L 3THMH 3L5HA 3UEZA 3EYQD 4Y16B 2QADC 5E2TH 3GSNB 3ARWA 1AR1D 3QZWG 1PG7X 4GOSA 4M7KL 3CLEH 4UIMB 4OIBA 3IVKA 2PKDA 4YR6B 4H1LG 2NXYC 5HHPB 5F7KC 2WP3O 3TP4A 4B41A 1NBVH 4H20L 2H32B 1DUZA 2VAAA 3U4BL 5GS1B 3LEVL 4NRZA 1CE1H 2X4NA 3GSXA 4KJQC 2CRMA 2ZUQC 4H25A 4ONOA 4MMXC 3FN0L 3KYMB 1S7XA 1BLNA 1XR9B 5I1JH 4YPGB 2R8SH 5D7IB 5DHYA 3FO1B 4H5SB 35C8H 4G9DA 4PJ5D 1P4BL 4FFZH 5D1ZA 4JZOA 4PJCB 3O6FC 4XAKD 2BVOA 4Z0BL 4OZIB 5LWYL 2JE8A 3TBVB 1MJJB 2VQ1A 2X09A 1KELL 3QDHA 1EAJA 4CJ0A 4ZPVA 4ELMB 4LSUH 3SDXA 4JFDB 4MSWB 5C70A 2DJUA 1EAPB 3VJ6A 3N85L 1N0XH 3QA3B 4XCNB 5J89A 1T0MA 3WFHA 4PRPD 4BFBD 1A6ZA 1IJ9A 5ACZA 3TCXA 5FGCE 3H3KA 8FABA 3MJGX 4ZOBA 4PGEB 1CXFA 3W5NA 5CZXC 3S7GA 4JFOB 4EDWL 1IAMA 2FL5A 5IT2L 3K4AA 4PJEF 4XPAH 4JGMA 4QRPA 1X4XA 3S3JA 4NWTL 4UT7L 4ZDHB 1EUTA 4OZGA 2X4UA 5GISH 3G6JB 3RL1B 2BRRL 5D5MA 2AV1B 4TSCL 5HVWA 5F9JA 1IM9D 2I07A 4PJ5B 3EJZD 3K8MA 1K8DA 1F4HA 4LCIH 2A6DA 2EKSB 2E9IA 5LCVH 2YRLA 3VGAB 3PGFL 3VWJC 5EFIA 2YD7A 1JGLL 3F6IA 1MCLA 3GFUA 4HD9A 1U41A 1NUFA 5JZ7C 1IVLA 1V3LA 2HJFA 4P2OB 5DJZA 4HJ0D 1F90H 4AEHL 3ARFD 1G6RL 5IHUH 2K7PA 4BUHA 2MKWA 4HX1B 3BH9A 4RRPG 5F3HB 3FONB 4P23A 3D5OF 3QUKA 4P46D 3IDGB 4PJBB 4HAFA 1T22A 1QRNE 1DQTA 4HEME 4M9OA 1JNHB 3HS0B 4I18C 3RBGA 2XPGB 4KUZL 2KQMA 5DRXA 3OR6B 4JRYA 4OF0A 1A4KB 4A6YH 1R5WA 4HCRL 3BDYH 4XC3L 1FBIH 3AY4C 3MXVH 4XNYL 1AQDA 4HKJA 1VHPA 1ADQL 3G08A 2OZ4L 3IDIB 2X4RB 1PG7L 3SKNA 4XT1C 1KIQA 2P8LA 3OSKA 1A14H 1U8QB 2IQ9H 4LHUD 3UJJH 1QSEB 1W0VB 1T1ZA 2VDNL 3RKPA 5T3XL 4DJMA 5SWZE 4HG4J 3HTLX 2X70B 3B43A 1HIMH 4L9LB 4DGYL 5CEZD 4KUZH 1VB9A 5T3XE 1XGRB 2AXGB 2A6IB 1KPUB 5FDWB 1C12A 1RUML 3MODL 5ALCL 3NCFB 2CDGB 1DQQB 5I1GH 1WC7B 2FO1A 1E28B 2D4FA 2EYSB 4M43L 4X6CB 3RNKA 3TZVA 4UOW1 4WHYG 5DEGB 4WV1C 4YDIL 3C5SB 1YECL 4PRNA 2C4FU 2ADGB 1YEFH 2BNUA 5HI4D 3L7EB 4HV8B 1MHEB 4D3CH 4YHLL 5SWQA 5A43C 4ZAKC 2FHBA 3RTQA 1EH9A 3MRIA 5D7IA 2EDQA 5IV2A 4EEEA 1BVZA 4N90D 4RMVA 4P4KC 3OGCA 4KV5E 2ZWLT 1JE6A 4NQTA 4PRHE 5JIKA 5B38G 2E27H 2EZ0D 3VD3A 4HPYL 4JAMB 4OJFH 4XP5H 3C5JB 1CFSB 5JOFB 1CD9B 2IADA 3UPRA 2X1OA 3MQIA 2QBWA 4YDJB 2UUDK 3MOQA 3U6RB 4ZPVB 5C0AA 5C0BA 4DZ8A 2I24N 4KRNA 5A16A 4HS6A 2OP4H 2DTSA 3R8BB 3FB8A 2H6PB 1J5OH 4LLWA 3O3EA 1YY9C 1JGDA 2H3NB 3PWNA 1OW0C 4KTDL 3QIUD 1P4IH 2AJYH 1Q38A 4Z7QE 3OKKB 4WTZA 4I4WB 1OCWH 1BBDH 2AEWA 1LDPH 3BZEA 2IMNA 2NW2B 5ESAA 4ZD3H 4RQQA 3MPCA 2DQUH 5JIPA 3SJVA 3MA9H 2VJXA 3C87A 1EFXA 2XN9A 4Y7MA 3BEVB 3QEUB 1I3RB 2IANA 5IQ7H 4HWNA 3TJHC 1ZANH 5DZOA 1K6QL 1OAYH 1FNFA 3MLXH 1IC4H 5D7IF 3RDTA 2RFXA 2AJUH 4MYWB 4OUUA 4OAWA 4Z7OE 2RHEA 4PRAB 3RX5A 4Z8FL 1C5DA 4HWZA 4QOKA 5CBAA 5T5FH 1IILE 5DK0A 2AI0L 4MCYB 2C7UA 4P59L 2YRPA 2GJZA 4GW5B 1X5IA 2PETA 3WHXA 3QWOB 2BC4B 2HJKB 1ZKAA 3TVMB 2I60H 2X10A 3O6FA 2NY3B 5D1ZC 4L3EE 3VFRA 5M7QA 2BSSA 1BZQK 5IB5A 1VFUA 3KPSD 4G8EA 4JKMA 4MAYC 1F4AA 1SQ2N 1KEGH 3QRFM 4X6DF 3B2VL 5DQJB 1QHPA 4YHPB 3UTTE 2E7LA 5J1SC 2QLVB 3PL6D 1P5VA 4APQA 1XIWA 1OPGH 4PJEA 3ALXA 4DN3H 1DP0A 3RIAK 3OMZA 3CMGA 2WWMD 2X4PB 4BFIA 5DJYB 1GC1H 1JPTL 3RWCA 1TQCB 1D9KC 3L1OL 4YUEL 3PWPD 2F15A 3K81A 5FYLH 3PGDB 5DEFB 2HA1A 4KTYA 5JW5A 3S37H 2BX5A 1LO0H 3QJHA 3BE1H 2OI9B 5IMMB 4HFUL 4LCUA 4YFLF 5L2JB 1XCQA 1RUKH 1G7LA 9CGTA 1S3KH 1M7DB 2HT2D 5C09E 1MQKH 3OKLB 2Q3ZA 5D96B 3FB5A 3UC0H 4NO5B 1P4IL 1RZJC 1CGUA 2ATPA 2NY7L 4P3CL 1HINH 3WV0A 2D7TH 3MODH 1GC1L 1JPTH 2EC8A 4TNWK 4ZFOL 2CKBA 5IEHA 2YPKA 1VFAA 1S5IL 3GB7A 1AO7D 1MI5B 2NZIA 2R0LL 3NCCB 2DWEB 4R3SB 1K3ZA 3KPNB 3KPNA 3VFMB 1KB5H 3NTCH 4P0DA 4PB9L 2BNRB 5BVPL 3BQUD 3HFML 1T80A 5DJDA 2JF1A 5MEPB 4XWGL 5D7SH 3D9AL 4Y8AA 4HUUA 2VIRB 3FQWA 3F7RA 5CAYB 4QHKJ 2XWJB 4NO2A 5GGRY 3E0GA 5EBLA 3BX7C 3QIWC 3VDBA 2V6HA 1QUNA 3KJ6H 4U1MA 2YSSA 2EIBA 5T5FL 4PRPE 2BSRA 2ZCKH 5T1DH 4KZEL 2FH8A 4IDJL 4CVUA 4MB3A 4NRZB 2X89A 3CCHB 2F53B 1N7ML 4HMDA 3WNMA 1FYTA 2JKXA 3MV9D 1WBZB 1F4WH 1LNUA 1QFWL 4OI9A 1A1MA 1ITBB 1A1MB 5IF0A 1OF2B 3HAEB 3WUZA 2ZCLL 1AHWC 4GMSL 4YNYA 1N5AA 4EN3A 1UB5B 3MZTA 4WW1B 4ZD3L 1OAKL 4CN6A 3RVWC 1XF3A 12E8H 3LAFA 2QSCL 1CFBA 3P0GB 2E6JA 4X5XA 3B2UD 2VLRE 2XZQL 2R2HB 4S1SL 3MRHB 2XZQH 3GM0A 3UYRH 4IM8A 5GHWH 3OPZL 1ZVYA 5MERB 2FB4L 3S5LB 1RUAL 1Q0YH 4GKOA 1IGML 3VJ6B 4XP9H 3FO2B 2E7BA 3QA3A 2EEAA 3NZ8A 1OSZB 1L0QA 3SKMA 2VXUH 1MOEA 5HYJA 1S5IH 4GW5A 3O8XA 1U8NB 4EI5D 1R3LB 3MBXL 3MX0A 5HHMD 4R2GB 4PV8B 1A6AB 3PDOA 2PYFB 1FNHA 4OD2B 4U1HA 2B4CL 5TPWH 4KTEH 2VDLH 1I1AC 4KJPC 2OJZH 1QEWA 5IHUL 1HXYA 4L9LC 4UDTB 2OXHA 3PWJA 1K6QH 1OAYL 4ZTPL 2Q7YA 3P4OA 4F57L 1RUPH 3M8OL 2P8MB 4NQDD 4Y8DC 5DFWH 2UZXB 1H5BB 2AJ3B 3CFIC 3RHWF 2PTVA 3V0VA 3IF1B 5IQ9A 4U6HA 4NO3A 4WU5A 1WTGT 4WTWA 1Y6NR 4LFHD 4HK3N 4PY8I 2VZTA 3TFKC 4QRTA 1QP1A 3FN3A 4O2EB 5C0FB 1F4YL 4OZHA 3UBXG 3HZKB 3Q5OA 5I2IA 1VGKA 4JPIB 4Y16C 1ITCA 5GISL 4AH2B 4IRZH 4XP6L 3EFDH 5E2JA 2ICWJ 1NUNB 3MMEA 3QRGH 4RGND 5E6IA 3QJHB 2Q7NA 4HJJH 2VABB 3MJ9A 1LDSA 4LSRH 2VABA 1RD6A 2J6EA 4Y0GA 2IH1A 5K93A 4LSRL 4W4NA 4JEGB 4YBHA 2VDQL 1PQZA 4ZUVA 2QKIA 3OKLA 3OR6A 3CLFH 3MJ9L 4Y4HC 4PBVC 1DLFL 2D3VA 3QBTB 3SE3C 4A6YB 5A1AA 1CYGA 3Q5TA 3QDMB 3MNVB 5BJTA 1KIQB 1VPOH 3FN9A 3ZT5A 4WGVB 4Q9BA 5SWSB 3U0WH 2F19H 4IRJC 3KPOA 1S9KC 1PEZA 4LPUA 2BY3A 3ROOA 1BEYL 4NZRL 5DMKA 3ULUH 1U8MB 1MCFA 3T2PA 1Z9MA 3FTGA 3VI3F 5EZLA 2IPKA 3IDXH 3MRPB 3CXHK 3KLAB 1AGBB 4JDTH 4NZDA 5INCB 3G6AA 3AS0A 3E8UL 4KWUA 3Q6FA 4HS6B 5DS8B 3DXAD 1SY6L 4OZGE 1TQBB 1S9XB 3PHOB 4FQCL 3PQYD 4QT5A 1ZVSB 3MBED 5DQ9A 1AC0A 1G7IB 4S0SD 4R97C 1CU4L 5I76B 5ILTL 3GJEA 2UVEA 3SDYH 2VDPL 5DT1H 1DZBA 4YHNB 1MRDH 3JTTB 5E7BA 5F7MC 3D85D 4LFHG 4LSTL 1OAQL 2OL3B 5IM7B 3STLA 4G8GE 5T33L 2AKRA 1HDMB 1IL1A 3A67L 4NQVA 2OP4L 2Z92A 3EGSB 5DK2A 5KVFH 1UENA 4TUOA 5ANME 4CVZA 2B20A 4GXVL 4WFGD 3GBML 1IGTA 5IT2H 3D39B 1BZ7B 1KN4L 1PFCA 3MRBB 1F13A 3GK8L 1ORQA 4X99B 2FH6A 2YD5A 4IRSB 2BFVH 3SKJL 1OY3B 3VGAC 5F7HA 1A7OL 2CIKB 4EIZC 4F9LC 3NCJH 4ZO9A 1U36A 5IMKA 4R9HA 1JV5A 5FHAL 1F3RB 3U0PB 4PGDB 2X9XA 4QRRD 5GZOC 1H0DA 2APWA 3GUTA 4QYOB 4QRUA 2WQ8A 1RJLB 1G6RH 1KLUA 1RJLA 3FT2A 2HFEB 4IMLB 4NM4H 4PGJA 2BOCA 2VXVH 3RU8H 5D7LD 3SY0B 4G8FA 4W4OA 2OBGA 2YPLB 2VLJE 2H6PA 1RJZB 1CE6A 1T5WB 1HE7A 4ONHA 4B0MM 4ENED 1C16B 3LPFA 1T7WA 3JUZA 5CP7A 1NCCH 3DO3A 2OQJA 5FOBB 1JWSA 5KJRH 2I07B 1MVFA 4OD1L 4R8WH 1JZ2A 1MRCH 2M8XA 4TPRH 4LSVL 5TGBA 2YMXL 4R7NB 5FAAA 3T0ED 5GSVA 5DJYA 3P73A 5DI8A 1U95A 4H25B 3ULUF 3RHWK 1A64A 1A9EB 4PJFB 2EEDA 1WWWX 3ZKSD 4XPAL 1NBQA 1FFOB 5GRVK 3RTQB 3NCMA 4OUUB 5J1AB 5DTFB 5KSUB 1N64H 4HX1A 4YXHL 4LSSL 1F00I 3DNKA 1J0YA 4YFEA 1BIHA 3VXNA 4ZYKB 3OKEA 2VLKB 2XI9A 5FYKE 1ZWIB 4FNLL 2WBKA 3SJVE 4JG0H 5EN2A 1YEHL 3TNMB 4K94H 4K7PH 2NY1C 2GFBB 1LQSR 4MJ4A 3MXWL 1FCCA 4PR5B 5L8KB 3JWOL 1QBBA 3B8SA 1UEMA 4X5WA 3CC5B 4GRLA 4X5WB 4BQ6A 4LMQI 1NGPH 2XT1B 4HIEA 1Q9KA 3VFPB 4F57H 2JB6B 43C9B 3NIGF 1IAIM 4LSQH 5CKGA 5CEXB 4PREA 3VFUB 4EUPH 3QUZC 4RBPK 3CXHJ 1CQKA 4BSJA 5E9DA 1UM4H 4FZEH 4ZMAT 5CEZL 1E6JL 5KZCD 5IW1B 2Y6SC 3Q3GB 3CGTA 3C6LA 3TV3L 5GJTL 4X4ZA 3RAJH 4P5TB 4P2CG 1IGJB 4LSPH 3BEWB 4N5EC 4N0CC 4MCYA 1FZMB 2C7UB 1ZLUH 1IAOA 4PJIB 1OAUL 4RA0C 5EBWA 2YC1B 3MLSL 4KK9D 4JR9L 1Q8MA 3GMPB 4X4MA 3GSQA 1CF8L 3BPOC 4GMTL 4IRJA 5LGHL 2Z8VC 1B9ZA 5C6WH 2XQBL 3X17A 4JG1H 2CQVA 2VISB 1RMFH 4XAWH 5B4MC 5BOPA 3BZFA 5D7LA 5DURB 3HZMB 3KXFA 1G7JB 5IROC 3IKCB 3STBA 1AY1H 4NSKA 4Q58C 1T0NB 1T0NA 1G84A 1FZKA 3JTTA 1L7IL 1SEBA 4M3KB 5DLMH 3X12A 3OX8B 1MFEH 4D9LH 4BM7A 2XWTA 4C55A 3GBNL 3BMWA 3K74B 1CGXA 5GQBA 1XR8A 4KK8D 4J3UA 1MAKA 4XPTH 3BW9A 4RGOH 1TZIA 1MVUB 1TCRB 4X4ME 1DQDL 4Y4FC 4ZS6D 5CKAA 1NC2D 2G5RA 3INUH 3ULVH 3DUSA 4NQXA 3FB6B 4HUVB 3D3VB 3FHQA 2A0LC 3VFWA 1ORQB 1OTUD 4YGAB 4F7MA 1G7HB 3BQUA 3CFBA 5TH2B 5DDHA 1QFPA 1XF5A 3KLSA 4NQCA 4GKNA 3LEYH 3C5ZB 1IM3B 3QIWD 2C4XA 2V17H 2HTLD 4XWOD 1MPAH 3ARZA 3TO2A 3UCRA 5C0RH 5TE7H 5HHXH 2BVPB 4XRCA 2X4OA 3JWDC 4XRCB 3EO1A 5I71C 1AI1H 4GS7B 2BOCB 4JHAL 4S0TD 3L3DB 5IBTL 3OB8A 4GG6A 2H9GA 4X8JA 1YMHA 3X3FL 1ZHLB 2KH2B 2RQ8A 3NIDF 1CE6B 1T5WA 1I1AA 5LGJB 1NGWA 1U8LB 5K59E 4Z5RA 1BEYH 5F1SA 3VRJA 2ZOKB 3CFKA 3G04A 4YNYB 2F19L 2NY4C 3EFFA 1J8KA 3VFGH 5JHDD 4B7LA 3CUPB 1I9JH 4Z9KB 1QLEH 4NBZB 2G60L 2IFGA 2OTPA 4S1RH 5DSCB 4OKVA 1DUYB 3H9SD 1QO3A 4XNMB 1FGVL 3CVHA 3FT4A 1KELH 3WNNA 2A73A 1DQJB 3BGMB 2NNAA 1AGFA 2WINA 5ITFB 4ZYKA 4ZXBA 4U31A 1SY6A 1B2WL 5EBLB 5ETUA 1J8HA 4KAQH 3VGEA 4EZMA 5ETUB 4G7VH 2BVYA 3PABB 3KXFD 4PRHD 4MGXA 3MUZ1 2VR9A 5JLZB 2J5LB 1AHWA 4FQXC 1FSKB 3QG6A 2ITDB 3IDMA 3GNML 3LN4A 1FNSH 4FABH 3GSXB 5DA0B 1BOGB 3KNBB 3T3ME 4LLQB 1DFBH 4YHIB 2COQA 4P2QB 1FYTB 1BGXH 1JUFA 1RJYB 4PRBA 1I7ZB 1WT5C 3PDDA 4MHHI 3I9GL 1KCVH 4HWBL 5DZNA 1Q9OB 1AGDB 1RIVH 4JRYE 4P5KB 4XNZC 4NO3B 2R29L 3O3DA 5E5MA 1UQSA 1QR4A 3QDGA 4HJGA 2XQYG 5FGSA 3RWFA 5FYJU 2YN3A 1I1CA 4MZ2A 3MFFA 5IG7A 3DYOA 5I1HL 3N1QC 5E8DL 1NEZA 3ULVE 1YYLL 3FB5B 5E9DD 1DSFL 1EVUA 1CN4A 1RIUH 3LD8B 2C3WA 1Y0LB 4KQ4L 1QFHA 4RSVA 3RRQA 3O6ML 3ZSTA 3QUZD 4OGYH 4P4RA 3MRNA 4JQVC 5GJSL 2PXYB 3MYJB 5DJXA 2P5EA 3VA6A 2XN9D 2X1WL 3IB4A 3NABH 4MJ5A 1NCAH 5ISZB 2O26U 3QWOA 4NJ9H 5L2KE 4GMTH 5DD5L 1IGCH 4LPXA 5J56B 4Z95L 1WLHA 3IRPX 1CDBA 3O45B 3DMMC 1HILB 2X4SB 4LP5A 5CGYD 4AENA 4FQXD 1CD0A 3P4MB 1AC6A 4OLEA 4PGZA 1RK1A 3I9GH 1MCQA 4X9HA 4ZTOH 3D39A 1JCKA 1KB9K 2XYCA 2V2TA 2QV2A 1KIRA 1VEMA 3RL1A 4DGIL 4NCC2 3H9ZA 3K7UA 3UTTA 3IJSA 3IJSB 1GSMA 4BZ1L 4U1MB 4KDVA 1LD9B 5AZ2H 4GBXA 3IFLL 1P2CB 5TDOA 4EDXB 3JV6A 4P2OD 1FJ1B 4K8RD 3R0MA 3IU3B 2HH0L 2R1YB 3WKNA 3QEQE 4LCWA 3SDXE 15C8L 3TWCL 5FF6A 3VMPA 5GJSH 1NFDA 2WWKO 5JXEA 1MHHB 3RZWA 3NA9L 4MD0A 1CFQA 1TNNA 3PHOA 4U1IB 4KVCH 3QXDA 2XNAB 2IG2H 1YEDB 4GKSB 4N1HB 1YEDA 4GKSA 3VWKD 5HGAB 1RMFL 4XAWL 2B2XL 3MCKA 1JK8A 3MV11 2R9HD 1ES0A 3FO9A 4GT7A 4F2MA 2OQJB 3WFDL 3LS5L 1KLGB 4IHOA 4NC1E 5SX4I 4HFWB 3T77B 2CLVB 1TETL 1O7VA 3RY6C 2DKSA 1QG3A 4X9BA 5D6CA 4M5YL 4MDJB 4KKNA 3W0WD 1KG0B 1NDMA 1TFHA 4XCYA 1RULL 2EIDA 3DIFB 3S6CA 1A6PA 3OXSA 2FNBA 2AEPH 4POYA 3OBAA 4GBXD 5DHVA 4QRRA 3VH8B 1G1YA 4NKDA 3G6JE 4HPOH 1BGXL 4X99A 5C0JB 5GZOD 1TZGH 5I1DA 3D48R 4D9RE 4FFVC 5GGVH 3LH2H 4FQ1L 4N0FB 4TN9A 3U46B 5HJ3B 5CJ5A 4UINL 4YXLH 1A1NA 4O58L 3W39A 5JXAL 1IKFL 3TBTA 4M4PA 1VADA 5INDA 1D5BB 3LS4H 3BKCL 5I1EH 4DZ8B 5INCA 5E2UL 4XP4L 2L0DA 4CVWA 4KI5F 3U4AA 4Z7UA 1YY9D 3HKFA 4RFOH 3EO0B 2ILLA 1EGJL 2VN7A 3EDKA 3KPRE 2DLFL 1TVHA 4TQEL 4C56D 4PJDF 3N0PB 3TH3T 3R8QA 2NY2D 5E2WH 1MIMH 4DCQA 2VN4A 4P4KA 4HV8A 3P4NA 1OT1A 5DQDL 4X5LA 4IOFD 3G6JF 1N5YL 3QNXA 4QCIA 4OT1H 2VO5A 2CJUL 3DX6B 1AGEA 3L7FB 5ALBL 1QLRB 1YPZF 1GGBH 5T3ZH 1GGCL 2GJZB 4DUXA 4MJ2A 1LHZA 5C0BE 1MREH 2FDBP 3LRSA 2VDKH 3T1FB 1F11B 4Z7UF 2DQHH 2LE9A 2JJTC 4ZFGL 4X6EB 3G9AB 4NKMB 4XPBL 3QNZB 3UO1H 5HYSB 4JB9L 3SQBA 2VB5A 5HYSA 3BFOA 4WWKB 3IJYA 3ZO0A 4ZUWB 3HUJA 4OZGB 3B3IB 1I4FB 3A6OA 4QTIL 5CHNB 3MRCB 5IROA 4Z7WA 3EDEA 2XQYK 3AREB 3CVHL 5DJCB 4ODSH 1S7WA 3ZZ1A 5DD5H 1KTRL 4LAQL 1UH4A 1T21B 3IRZA 3ROLA 5F6HJ 3T65A 1XR8B 4YZFF 3O0RH 5JA8B 4LNVA 1DL7H 1U8PB 4PJGA 4NQXB 5FV2A 5GS2H 5IFJB 2FZ3A 4Q74A 4RGMB 4P3DB 1HWHB 1CCZA 1JF1A 1LP9E 3EUUA 2DQUL 5EIVA 1JHTB 4YHOH 5IJKC 2LABA 1WIOA 4PJBA 1MCOH 3HUJE 3RZCD 5IMLA 3SJVD 25C8L 2R2BB 1E6OL 1OVZA 4LSTH 4Z7VB 3UBXA 2DDQH 3MV7D 2D0HA 2OJEA 1BQLH 4X8JB 3S36H 4MD4A 2QQQA 3X14A 4GAGL 4K3GA 3I50L 5GGUB 3BUTA 1GOGA 8CGTA 4X7SH 4XMPH 2CMRL 1KV3A 5E8NB 5FM5O 4XMPL 5H37G 4HHAB 1NGXB 1OAZH 4U1JA 2W9DL 3VXPA 5D4QA 4X4YA 1VGEH 5ADPH 4R97B 1LO5B 2KPNA 1F3DH 1F58L 4OCXH 1YNKH 3DVNB 5HTSA 4JFPB 4PJAA 4CN4A 4I9WD 4DGVL 1JWMB 4XNXL 4HKBA 3NH7H 4NJ9L 2P1YA 1QSFA 2ICWA 4QEGA 3KLAA 5D7JC 1D5BA 5AZEL 2CKBL 2XRAL 2ZUVA 1NSNL 3WNLA 4I0PA 5ICXA 5AZEH 4HC1H 1NFIA 2DWDB 4G6FB 1RJYA 3QIBA 4LVHB 2JB5L 1HKLH 4HWEL 2I27N 5I76A 2XA8L 5BRZB 3GB7B 2MKLC 3SQOL 5GIRA 1GOFA 4HJGB 1CLYL 3ARRA 4W4OC 3KPRB 2GKIA 3IDYC 4ODXB 4LF3A 1NEZB 5IB3A 2YUWA 2WSKA 3PWVA 3MRLB 4GG8A 4KV5F 1NKRA 2C3VA 4O9HH 4OUOA 3I84A 4NFBA 2B1HL 5FYKU 1OTTD 3VFWB 4Y4FB 1FNEA 1F3JB 4YWGL 3H6JA 5SV3A 3WXVL 3QDAA 3RY6A 2CIKA 1KPVB 2N4IA 2N7AA 4UINH 1B88A 1FVCB 4N5ED 1U8JA 4YXLL 3O11B 4PJ8C 1FYHB 4HC1A 4KK5C 1RURH 2YWZA 2BC4A 1QACA 4NQDE 4KAQL 1W0WB 3KPSB 4JY5L 4TUKL 4WUKH 5HGBA 1I1FA 2P7TB 3RVTD 3FB7B 4YBLB 5ID0B 3RA7L 1C5BL 3WD5L 43CAB 1WZ1H 2N1KA 5E2VH 5HYIA 5J3HD 4NNYA 3B3IA 2D9CA 2GYSA 2P8MA 5IIEB 2HVKB 5IIEA 2FBJH 1D7FA 4ZO6A 3CAFA 1RY7B 4KTDH 5HI5C 4XBPA 1CR9L 3G6DH 5IR1A 4WCYH 4H1LB 1QTYT 3FQUB 4NCDA 1SBBA 2YC1A 5DI8B 3AM8A 3MNWA 4NJAH 3TJHD 4JPIA 1YJDC 1IEHA 2HWZL 3MOBH 5B3JF 1OGAB 4JFDE 4MQ7A 2PTTA 1V8HA 4HJJL 4Z76B 5E2UH 4ALAH 1AKJB 4QRSA 2P5EE 4I3GA 1UJ3C 4LEOA 1LO2L 2AJXH 1LP9B 4ZFZB 5TE7L 1A7NH 1NANH 1JNHA 3C60C 5D1QB 1F4YH 2P5WE 4OZFA 3SGDH 4AY0A 4YDLB 3LV3A 1YC7A 5TQ2L 2A77L 1DBAL 4F37F 4KJPD 4QWWC 3DX8B 4IDJH 4P5TC 3SPVA 5D2LF 1SMAA 1IC1A 1AD9A 3DETD 4WEMB 4L8SB 3EHBD 1FCGA 1MHPH 4GAJH 2E6QA 5CSZB 5LQBH 3K2UL 4D9QE 1DQDH 3PWJB 4ONFH 4GRLB 5ENWA 4M5YH 3D0LA 5DUML 3DI2B 1SJXA 4YDVA 2EDLA 1P7QB 3BQUB 1FC1A 4R3SA 5I1CH 2WK2A 1HK6A 2IJ0C 3IFPA 4ZPTB 3KYKL 4G3YH 1P7QD 1RFDH 5EIIA 1EO8H 5CIPB 3C6SA 3U9PH 1WAAE 1YNTB 4GG6F 4HQQL 2C1PB 1IQDB 2HT4C 2QHLA 4YBQC 1RIUL 1XGRA 1II4E 4JHWH 2ATPB 1N64L 1KC5L 2HVJA 2MHAB 1YMHB 2WBJD 1WICA 3CFDA 4X0KB 1I7RA 1XR9A 3BHBB 4FOMA 2VUOA 4M7KH 3KJ4B 5GZND 1F4XL 2CLRB 3MREA 4YFLI 1OAUH 3VD4A 5FKAB 1TJIH 5IVZA 1DBBH 4LRIA 2VAAB 1T1WB 1KCSL 3T77A 2F5BH 3PHQA 4MNQB 1NGQH 4OGXH 5F6HI 2QQKL 4N1EA 5LBSL 4AEFA 4XP4H 5FUZH 1FZOB 3NIDE 4KI5C 2F5BL 3OKNA 5C08B 4LIQL 3HI6L 2NY2C 2C3HA 3IU4H 3B9VA 1GPOH 3TO4B 3MV8E 3WFBH 5D7KE 4NO0D 3V4VH 3MGTB 3DVGA 4M6AA 5J12B 4IMKA 2ARJB 4TYUA 2YD8A 3QHFH 1NMAL 3V4UL 1D5MB 2XTJB 3TVMC 3OX8A 4LAJH 3C2AL 3QUMA 2VQ1B 5MHSE 5EO1B 1P2CA 2C3GA 3H42H 4DOHE 4UV4L 2WZPD 4JZNB 5E1AB 2R1YA 2MQCA 4YHYC 4NUJA 5C0EA 1N2RA 3VD5A 2ATKB 5E8DH 3T0EE 3F7PC 1WZLA 3ARDD 4KI5E 3SKMB 4HLZG 1MWAA 1OP3H 1H9VA 3NCYP 4RGNB 3S97C 3X11B 3KPRD 3A67H 3FFCD 4N0UE 4P9ML 4PJBF 5TJWK 2GHWB 2W92A 2EDOA 3S88H 3FQTA 2QADD 4MA3A 3HZYA 2OMBA 4S1DC 4DW2L 4EQ3A 3WFEH 4XMLH 4OCXL 2BZDA 1HNGA 2W38A 1XGYH 1OD7A 5BZWB 2P46B 4X7CC 3WL9B 2BXYA 4KK5D 2AXFA 3O81A 3IFNH 4U2ZA 3OL2A 1OB1B 3BO8A 1JGVH 4BZYA 2ORBH 4XP6H 1F4WL 2XWBB 5D1XD 3WFZA 4LVEA 3QXWA 4GRWE 3I6LE 5JNYA 1MRCL 2AP2A 3D1MC 4TPRL 4D9RD 1Z9LA 4F8QA 4RMSA 3AB0B 4KFZC 4PB0L 3SGKA 2P48B 4NN7B 1EO5A 5BRZD 3JV4A 3U0PA 5C0GB 1NLDL 2HJKA 2HWZH 5L7XL 4N8VA 4XPFL 3UTSA 5I8OL 1H3PH 4ELMA 4NM8H 2WUCH 1QO3B 4XNMA 3NCBB 1IKNC 1Q0XH 4FQIH 4GRLC 2X9WA 4RBPH 1J12A 4U0RC 3BE1L 4OCLC 4Z7UE 4OF5A 3C09B 2DKMA 3CPLA 3V5DB 5HYJD 4L4VB 5DWUH 1A7RH 1WWCA 3TBWB 1CICC 4FTVD 2HRLA 1S7WB 2CXKA 3TN0B 3D69A 4G7YH 4HKXB 1WZMA 4PJEB 1J0KA 3LKSB 5CZXD 5EZJB 3DX8A 1M05A 4BH8B 1JL8A 4OFDA 4TOYH 3MLZL 4PTUA 3MACH 1KENL 3X3FH 2GJ6B 5CCKL 4LLQA 4HGKC 4CUCA 3JWDH 4LLVA 2W60B 1ZA6B 2E27L 3OXRB 5AWNH 5KS9E 1FIGL 1RZGB 4XPHH 5H35B 5HPMA 3QUZA 4GJTB 1AGDA 2R29H 2BK8A 5L2JA 1MCBA 3JXAA 4ZS7H 4K71C 1HI6B 1KJMB 3K80A 4Y19D 1KJMA 4O51B 3DOSA 1INQB 5EOQH 4NQDB 4U1SB 1YNTA 1P4LB 2GSGA 5ANMA 4CVXB 4Q9RL 1ACZA 2IAMD 1FVEB 3DIFA 3UYPA 3HC4H 3RGHA 4X0KA 3HZMA 4EKXA 5F88B 5SWSA 5EC1A 3MRIB 2XTJC 2OJZL 1X5HA 3QCTH 2P5EB 1S7SA 5TE6H 2XIDA 1RSFA 1FZKB 2YD1A 4R96A 3TBYB 1CXHA 1A47A 4E9LA 3KPRA 1NGXA 5FYLD 1AY1L 4F33B 3MA9L 2BNRA 3VCLA 1UXWB 2UWEF 3BIBX 3FL7A 1TJHL 5K9JL 2QQKH 3SKNB 1LEGB 1XCTB 3EJJX 4WFFE 2DQFA 1PD6A 4M6NH 1E4WH 1JGEB 4K7PY 5I1HH 5IWLA 3B2VH 4EIGB 3Q3GA 4J1UA 2BJMH 4AL8H 2VXTH 4HULB 3QFJD 5C8JB 3CDCA 5SWZD 2XOTA 1IGJA 1GJIA 1I9IL 5KAQG 4ZUSA 5EO9B 2IADB 2GAZB 5CD3A 1J05B 3SDYL 3W9EB 3SKOB 1MCPH 5ID1A 2DI9A 3QQ4A 1FJ1A 4ODHH 3GSNL 3P30L 3QQ4B 3RY4A 1DFBL 4KROD 1QA9A 3CK0L 1C12B 3SE8H 1G0XA 1ZE3C 2VLRB 3SDAA 3SO5A 1I8KA 3GMLB 2OTUB 2B4CC 3GMLA 3WO3B 5IP4A 1FZJB 2EE2A 4MZ3A 1CBVL 3BZFB 2X42A 2HKHL 5D7LB 1HINL 1RZ7H 3LHPL 5I1CL 2OX5A 3BZEB 5E08L 4X6DB 3OAUH 4S10A 3FQTB 1LK2A 2Z8SA 3BKML 4DKEL 3PWLA 4OF6A 5IQ7L 4L4TD 5L2KD 2NZ9D 4LVNB 3PQYE 4L8BB 1MJ7L 4WFEE 4YDIH 5LKNA 5DSCA 1CDUA 4KMLB 2B0SL 4JM2D 5SX5K 2C1OA 4Z78B 5E5RB 3HB3C 5EU3A 2APFA 4JFPA 3RI5F 1AXSA 5C08E 1PVHA 5D6DC 3GMNB 1MCOL 2GIYA 4U7SA 1RJZA 4ONHB 4WVRA 3JSSA 3I3BA 4Y4HB 1AQKH 4Y4HA 3HE7B 1MCRA 1QQDB 5CEZE 2HT3C 3O8XB 3U4EA 3LV3B 4Z77A 5I1IH 3KPSA 3NACL 1YN6A 2VLME 1BF2A 1JHLH 1NBVL 1UM5L 3MSPA 1I1YB 2XQBH 3H2WA 1I1YA 3MV7A 4ODUA 5HHNA 2EIEA 1X5AA 1T2XA 3FB8B 5FO9A 3O6FD 1KEGL 3QI9C 1H3XA 4Y2DC 1EZVY 5IFJA 1PX4A 1FV1B 3ARFB 2J1KA 4P9HH 3PIQA 4CADA 5FO7B 3LN5A 3BP6A 2XZCL 4MXWL 5TF0A 1NMCC 1NUDA 4XBPB 4OF7A 1XH3A 3FCTB 4OLWH 1KJ3L 4XC3H 4XCFL 3CFJB 4Y19A 3U82B 4HJ0C 4S1QL 1WZ1L 3LQMA 5B39G 4EJ1C 2AGJL 4P4KB 2NMSA 3M17B 1TPXB 4UQ2A 5FUCC 1VFOA 4K9EC 3LSOB 1QFWH 4NO5A 3GIVA 4D0DA 1SJHB 1U93B 3G9VA 5KSBA 4QNPE 3MRNB 1U42A 2JCCB 3RI5K 2NX5A 4HIEB 3MBXH 1LK3L 3O6MH 1MFBH 4PJIA 4DVRH 4PS4H 1NGYB 3B9KA 1D9KB 4PJ8B 4JFZH 3QYCA 3JBG7 3LY6A 4PJXA 3AAZA 3C8DA 1RUAH 3O2WL 5J0BA 3BKJL 1S9YB 1MLCA 4UTAL 1IQWL 1NCDH 2NY3D 5CSZA 5DGRA 5DD1H 3TVMD 4ETYA 5CP3A 4Y1AD 4G43B 1C1EH 3OJ2C 3TYGL 3T0BA 3O3AA 5EORL 3IDYB 1KXVC 4P5KA 1A02N 1G7MA 3WE6B 4YXHH 2ZPKH 5TDOB 4CRPA 3RWFB 5TDPB 4AEEA 4IMKC 4UAOC 3D2UA 5HD8D 3WN5B 1RFDL 4JJ5B 4NNXB 3MR9A 2A9ML 3DUSB 2Q86B 2FZ3B 1NGZA 3QO0B 4RNRB 4L4JA 1E4XH 4AQ1B 4Z76A 3BPLB 3E3QE 3WBDA 5J6GB 4N8CH 1WBZA 2NY7H 1TVBB 3RWIB 5DDHB 4F58L 3W0WB 3TZVD 3WSQH 1LEKB 4PRDA 4YBLC 4QXWA 1MQKL 2DQDH 4S2SB 1BJ1J 4WDIA 3RKDD 4BQCA 3PNWA 2R2EB 1NCBH 3N1GC 1YEIL 1JI2A 4Q9RH 1M71A 1S7QB 2OL3A 4HLJA 3STLB 3QIWA 5D70H 4ZTPH 3CCHA 2PN5A 1FAIH 3T0WA 2AXFB 2Y07H 3DUUA 3W2DH 1T66C 1EERB 2H9GB 4MHHG 5ERWB 4JN1H 1KF9B 5ICYA 5DHVB 2HKHH 5TPWL 2RGSA 1HYSD 4JCMA 3EOTL 4OKDA 1D5ZB 5KVDH 2CMRH 5FGBC 3ARDB 2YD6A 4QF1A 2VKXA 3GSNA 5FYKD 1NCTA 3ZL4L 5HJ3A 3P9LA 5C7XH 2X70A 1NAML 2UWEB 3ARPA 4RDQF 1P9MA 2FHCA 5C7XL 3SDDD 1VADB 3MJ8A 4L29B 2W65B 1WIPA 1CG9B 5C3TA 3BZDA 5I16B 2FECI 3BDBA 1R5IA 5MP6L 4D0BB 4S1SH 5C0NC 2J6EL 4Z7NE 4LCCB 1UZ8B 4WUUD 4G8FB 5DWUL 5JUEL 4HDIB 1IGIL 4UNUA 3BKJH 5DVMA 4F37K 3PL6C 2Q7YB 1QQDA 1HQRA 4J4PA 4POUB 1IAKA 2DMBA 4XHJC 5D2LB 3DRQA 1HHKB 1WAAA 5GZNC 4F80A 4XC1H 2EKSA 4DKEH 5DJ2B 2UYLA 4JRXE 2BDNL 4MQ7B 5DJZB 3PGDA 5DEFA 3TBSA 5D72H 2GSIB 3K46A 4YDKH 5E8PA 5FO7A 2VLMD 4G9DB 2DBLL 1ETZB 4Q0XH 3MLWH 3BPCB 3P77B 4LARH 4IIQB 2Q8AH 3PF2A 1URLA 4JQXC 3U46A 1INQA 2WP3T 1UWXK 5CJBA 4X5XB 3KPPA 3LDBB 3QH3B 3MRRB 4KK6C 1VPOL 3QH3A 4FFWC 2APBA 4JO1L 5F71A 1TJIL 3LSOA 3OPZH 4A6YA 2FWOA 4X6EA 5E1AA 2FJFA 4DOHB 4MAYA 3P9WB 5CZKA 3PWPB 1F4XH 1R3JA 4KU1A 5BS0B 2JLLA 1MI5D 2P8LB 5LGKA 5A3IC 3JWNC 5C07A 5HYEA 4PIRF 4M8VA 3ARGC 1T1ZB 3NACH 2I9LB 5F7LB 4OGAD 5FKPB 3M1BB 3D18B 2FX8L 1S78D 3FTGB 3QDGB 2XXMB 4PJ8A 3IETB 5D8JL 4XXDA 5F7DB 3U0TA 1PGRB 4PREB 2JJUA 3U0TB 5GS0C 4G3YL 4NQSB 1HXYB 4X8XA 1BJ8A 3G5YB 4MNQD 3ZTJH 1F6LL 3S9DB 2Y07L 2OMNA 4YHLH 2CDGA 1QBAA 2ZNXA 1G9EA 3WDJA 4D9QD 2VLKE 1C5DB 1JPSL 2H8PB 5CUSL 1IGYB 3I6LD 3QNYA 4CW1A 5CUSH 5IMLB 4J2XA 5E4EB 5L7XH 5IVXF 1Q1JL 1JFQH 1GHFH 1HN1A 3SCMB 2E7LC 2P5WA 5JOPD 1B4JH 2NY5C 2BNUB 3MO1B 1FFRA 3TIDB 2NR6C 4R6UA 2AK1L 4K7FA 4M02A 3I2CL 4WI2A 3V6BR 3QXDB 4PGBA 3F7YA 2NY4B 4RMTA 1SHMA 3RWJA 1LEKA 6FABH 2CK0H 2Y06L 5CHNA 1A4JA 4ENEC 3O41B 4YHNA 3ZLQC 1I8IB 2XY2A 1INEL 1WQVT 4JHAH 1CK0H 1HDMA 4GBXB 3QIWB 2J8UB 1U58A 4XCYB 2M2DA 3RKDC 1DQMH 2OTWB 3FZUD 1DN0A 1TZHB 3VH8A 5JR1L 2HRPL 4NKDB 4M6NL 5CWSA 1NCCL 5JW5B 3F7VB 5L9DH 1W0VA 1ZXQA 1KGCE 4JDVB 5IK3A 3ZYZA 5IB1B 2BXZA 1JV5B 4OFPA 2G75A 4DEPC 1YEGH 1RUKL 2ZJSL 4Z8FH 2XKSA 1CL7I 2DQEL 2H45A 4R4NC 2W65A 4U1SA 1NMCB 3TA3C 3F7QA 2HFEA 1GC1C 1RZ7L 3LHPH 4NQEB 3D0VA 3ZE2E 3MLRH 4MD5B 2MJWA 3WKMH 5LGJA 4MB4A 4JFFE 2CLRA 4P3WA 2D7OA 5HBBA 1OLZA 3I02A 4JZOB 1NAKL 5EC2A 3VXNB 5JNYB 5F7NC 2I5YL 4Y4FD 4ZS6C 1UJTA 4FMFA 4NJAL 1T1YB 1K8IB 4MQXC 32C2B 4X4YB 1D6VL 5GS0D 4G8GB 5INDB 3B9KC 4CVZB 3BN9C 1AFVL 1ZSDA 2YZ8A 1ZSDB 4LPCA 3QIUB 2A6KA 3SDAD 4P2RE 3H7LA 4HWEH 4JVPA 2OZ4H 3MOAH 1I1RA 2JCCA 3R1GL 3N9GH 3BGMA 1YMMA 4KROC 1EZVX 4UILL 5CSGA 3VI3E 3QFDA 3VXSD 2YZ1A 5EN2B 1TQBC 5EUKB 4MXQC 1P7HL 4LLDA 4WW2B 1I8LC 2ERJC 5JLZA 3TO4D 1XFPA 5BV7C 1FG9C 3M45A 3QXUA 1CFTA 5EA0H 2QR0B 3HRZB 4IMLA 4P23C 4E5XA 1QFWM 5DC4B 5DO2C 4JHBA 3K2UH 3LKRA 3PIQB 1D5XA 3OKYA 5I1LB 1YECH 3MLTB 4FQQB 3WUWG 4RFOL 4RQQB 5DMKB 4K3HA 4PRIA 1Q9OA 5L8LB 4KK8C 2NY1B 3RWDA 2NW3B 4C54A 3D18A 4NCC1 5TGBB 3C6LD 3N1FC 2P5ED 4JKWA 4BQ8A 4R7DA 5CGMA 5A2IH 4P46B 5DZLA 4LK4A 1P84J 3MR9B 4PBXA 3LKNB 3QJFA 4OM0L 4XHJD 3PJSB 4HIXL 2IAMA 3HFMH 1AKJA 3S36X 5I19L 5C6TL 4PRAA 3DROB 4G7VL 3QWQB 1A3QA 4PG2C 4QXGH 4KC3B 3O9WC 5ISZE 2F54D 3REVA 1CS6A 5F1NB 4OZFG 1S7QA 5GXBB 1NGYA 3IAQA 4CL7A 3ZKXC 1TJGL 2A1WL 5EBMB 1MUJA 4MA8H 1LILA 4Q2ZA 1T20B 4M7JL 1U6AL 4Y5VB 1S8DA 2YOCA 4Z7QF 3V0WL 4QY8B 1SBSH 1IGTB 1TITA 3NVQA 1G0DA 3VXUE 4YDVB 4IS6B 4WTZG 2Q76A 2JJVA 4KGJA 4LCUB 1GGIL 3V0VB 3IFPB 1HQ4A 5J4MA 5IR1B 2G9HA 3UJIH 2PYEA 3BD3A 4I3RH 4W68A 3RWHA 3GJFH 1FQ9C 1J86A 3T0XA 5BV7H 1CVRA 1KPUA 5FDWA 4NOBA 4LCCA 4QHKI 2CO6B 3VI4F 3VDAA 3WCYA 2YPLA 4Q6IC 2UV3A 3RX7A 4MJ6B 1GCFA 5FYKH 3LEYL 4LASL 4LEOB 3VA2C 1NMBL 4MLSA 4WUUE 1IM3A 4QLRA 2H41A 2IH1B 1OCWL 1KCSH 4C56B 5IWLC 5HYQB 4C56A 2DWEA 4DW2H 3OAYK 1ZEAH 2NY2B 3GMPA 4P9MH 2YBRB 3B9KB 3P73B 2F9BT 4Y19E 3OKNB 4UT7H 1K5NA 3L3JB 1IC5H 4NRYA 3H7BA 5JW4M 1HKLL 4I5BA 1NBYB 3T0DA 1W0YT 3ABZA 2EDEA 5MEOB 1U8OA 3GSRA 5F96L 1N0LA 1U3HA 3ARDA 2HJLA 3QHTC 4QF1B 1NFDF 2A74A 1U3YA 5KG9B 3GJFB 4N0FA 3GJFA 4K8RC 1MIML 2BY0A 2XWTB 1T1YA 5DURD 5C0BD 4XNUL 4NQCD 1RURL 5HGHB 1F90L 1CF8H 5DGQA 4AEHH 3NMEA 4JM4H 4MQSB 5A3ID 2A73B 3HG1D 5FM4A 1Q0XL 3O3EB 3UX9B 1S9XA 3CD4A 5I18L 4TNWF 1AGCB 2W0FA 4WHTA 1ZGLP 4O9HL 2KZ1B 3L3KA 4JY6A 1NGQL 3GKZA 5CGYC 3I3EA 3V5HB 5GRYA 1KFAL 1U6AH 3ARVA 5CJQL 4LLMA 2PCPB 1FNSL 4N90E 3VFOA 1CIUA 3HHRB 5ALCH 4XZUB 1MJJA 1UG9A 4V1DE 3ULSB 3RWEA 4N5UA 4G6JH 3CLFL 5MEND 5T1KB 5BVPH 3V6OC 2E7CA 3UYOD 1CICA 2VH5H 3WDHA 5I8EA 3L5XL 2QHRL 2GJJA 4CJ1A 2Y5TA 5DRWA 1NDGB 5CILL 1MIEL 2CJUH 2IPTL 4WO4B 1O7SA 2ARJA 5CJOH 2V7HA 4FXGA 4R4FL 4EUPA 4R2GD 1ED3A 3H0TB 3F6LA 3EO9L 4EBQH 5DMGD 1MCNA 3KPPB 1WT5A 3UJTL 4OD2A 3HC0B 3SGKC 4UT6H 3GSUB 4WFHD 1JFQL 4NQEE 5D70L 4OCSL 1A2YB 1EGJH 3F7YB 1R3JB 1MWAH 1N6QH 2X4UB 3QEGL 4FQXA 1TPXC 1PAMA 4KPHH 1FDLL 5AAWA 2QHRH 4APQB 1A3RH 4YO0A 2NCMA 4P57B 4P57A 5T1LA 4F58H 5E08H 3HB3D 3HN3A 3O6KL 1ZA3B 2H2PC 2VDLL 4IOIB 4V1DB 1V7NL 4R0LB 2EDNA 1VACA 1YYMH 2R4RH 2O93L 5D71L 2A9NL 4GUPB 4U6TA 3ZKXB 5JO5A 5D7IE 1EXUB 1BAFL 4ODBD 1FRGL 3VXQB 4LIQH 1MCJA 2GSIA 1UKQA 3VXUB 3FQXB 4JFYA 5I73C 1GRWA 4ZFZA 3MCKB 2VZVA 3CSPA 4ISVA 3DX7A 5CIPH 4ISVB 4UT9H 5J6HB 2GITB 5C09D 4GLRI 3CU7A 1NCNA 2Q6WA 3IDNA 3MV8D 1T1XB 5DVKA 5IVXE 3JWOC 4HKJB 1KIUA 4OQ1A 4HT1H 2K3TA 4E41D 5IEKA 1KJ2H 2MHAA 4KKBD 4X6BA 2KBGA 3P0YH 4J6RL 3WMSA 1DEEB 2GCYA 4OSUL 3ZE0E 3L3GA 2XN9E 2LAAA 3MLRL 4WUKL 1A7RL 3BN9D 3MGOB 4JFEA 2DIAA 2IPKB 4JCLA 3QFJB 3MLUH 5DJDB 4IRSC 3DXAE 5AZ2L 3T3MF 1Q72H 1UC6A 3GIZH 1ZANL 2JIXA 5A40E 3JTSA 4PJ7F 2A6KB 3JTSB 1G7PA 1VCAA 1QKZH 2YR3A 3IXAB 2EDRA 3GMOB 1H15B 2O5XH 1I7RB 4OLWL 4XCFH 2ITCB 5HY9A 4M7ZC 4UIMA 5KW9L 5JOFA 5EOCH 1D5IH 4QHUB 3N06B 2BSRB 4PGEA 3OZ9L 1RZFL 1S7RA 4Y4KD 1BQUA 3NZHH 1X44A 5D2NA 3LMJL 5B39B 1QA9B 2X4NB 2R23B 5A16B 1JHKL 1N8ZA 2AQ2A 4J8RA 1XF2B 4NQEA 5ELIA 3A6CL 3PGCB 1QPPA 3WLBA 4EN3C 2YS4A 4JHWL 4ZNEE 1ZVSA 1NFIB 2DWDA 3PP4H 4N9GA 5D5ME 5IF0B 4FZ8H 4OJFL 1AGEB 3L7FA 3MUJA 5IV2B 4UAOB 1T2QH 1I9IH 1JK8B 4KQ4H 1YDPB 3S88L 3HAEG 5CJXA 2N7BA 5HDQH 1UACH 4EVNB 5GRZA 5H94B 1PYWA 4L8DB 3GMQB 4H0HB 3MXWH 4M6MH 2YUZA 5CD5D 3QIBD 3VGHA 3W2DL 5I6XC 5CEYB 4QRUB 5T5NG 3C60D 1G9ML 7FABH 4PJHE 4YJZL 1MJ7H 4NM8L 3OAZK 1NDGA 3I75B 3FONA 1OSZA 1P84K 2NXYD 3QUKB 5I71B 4DK3A 5JW4Q 1CD8A 4Y4KA 5KSBF 4DAGH 4GKNB 1KT2A 3BSZH 4DN4H 3TNNB 1A7NL 4R90L 4LLDB 4WW2A 3HZYB 4BZ1H 1OM3L 5F7DA 3SDCD 4OLUL 3GMMB 5J13B 1S9WA 4HWBA 2FJGA 5LJYH 1BP3B 4E0RA 4LKCB 3P9MB 4QHMA 5K9OA 2JIXD 3LEVH 3AS3A 5E8OB 1XGPB 1A7QH 4RFNB 3DVIA 1TVDA 4Z7WB 4U6HB 4WU5B 3I02B 5DEZA 1RUPL 2DMCA 5D2LA 4Z95H 3G6DL 3GHBH 5DRNA 4O2EA 3CDGB 1PZ5A 4HMCA 2HP4A 3LIZL 2GJ6A 5DLML 5D7JB 5LAXA 2HJFB 4P2OA 2LAGB 3CVHB 3FT4B 1DCLA 4P5TD 3WNKA 4DEPB 5JTWA 1OP3K 3L3OB 4XNQB 1FHGA 1ETZA 2XNAA 3MLWL 5DA4A 5FUOL 3DSFH 3HE6C 1CGTA 1WFNA 4JPWL 1QLRA 3N9GL 3RNKB 4N9OB 1PSKH 1T89C 5H2BB 3LOWA 3LQZA 1H3GA 4O51A 4PJ5E 3QISA 4HMEA 1D9KA 1IC4L 4Z77B 1ZLUK 5EU6E 3VFSA 3NFNB 1NEZG 3IDMB 1MPAL 5J11C 3SDCC 4TTGA 4MAYB 1AD9B 1A3LH 5L88H 4FG6C 1A7QL 2W0LA 4QY8A 4BSVA 1ORSB 2W60A 3FRUB 3OB0H 3WDIA 5IW1A 1N6UA 5BRZE 2YPKB 4X80H 3ULVC 4R4BB 3G5ZB 4ZTOL 3O3AB 3DV4B 4G42B 2X1QA 1JMZA 3CFBB 3ARSA 4W6WB 3WKML 3CDFA 4L9DA 1CQYA 4LPVA 4XH2B 4I0PC 1J0ZA 3OF6D 1FPTH 4L1DA 2QQLH 2HFTA 3QIUC 4F9LA 1DANT 1G9NL 3TGXA 5L0QC 4HBQA 3S35L 4OZIF 3EYFA 4I48A 1JGEA 3I6GA 2WIMA 3UDWC 5J6GA 3AMKA 3MNZA 2GK0A 4HPYH 1JZ8A 3T4AA 5T3ZE 4KJYB 2D31A 1ZLWK 5DMIH 2ADIB 3RPKA 3Q6GH 1QSFB 1A22B 4YDLC 5HVHB 4MJ5B 5ISZA 3B9AA 1IM9B 1BFOA 1VEOA 3SCMA 4MA8L 4LSUL 4YHZH 4N0CD 1EO7A 5GGRB 3TBVA 1A9BA 1YEFL 5K9KA 3WS3A 4FQPA 5C0AD 1BECA 3TO4A 5GRUL 1FN4B 1YNKL 2VIRA 2VC2H 1EAPA 4DUWA 4OLZL 3HZVB 1KIRB 3VXSA 4WI7A 2CIIA 2HG5B 4NZUH 4E41B 2HN7B 1XF5B 5C6TH 1Z5LB 5CLWA 5BO1H 4EUPG 5IMKB 3WE6A 2B1AH 3QI9B 2R39A 4Q7DA 1GIGL 2MWCA 2B1AL 4X7SL 3UDWA 2XFXB 1OGAE 3R06B 2HLAB 2EXYD 1OOAA 1T4KB 3GSNH 3DXAB 1S9VB 4KDTA 1FORH 3L3DA 3EKCA 3D3VA 1CGVA 2NY6D 3MOBL 4X9IA 4HUXB 1KOAA 1AXIB 3T0EB 4NHCH 1XAUA 1X4ZA 5IB2A 4NNYB 2BMKB 1REIA 4LLUA 5AYUH 3ARBB 3FKUS 1OF2A 3MC0A 4PRHB 1RUQH 4YHZL 4O4YL 1BQHG 4ZAKA 3CFEB 1LK2B 1I1FB 1IGFH 2P7TA 4OCRH 1KLGA 2ZG1A 4HUWA 2Z4QB 4FXKB 5GSRB 2Z4QA 1EPFA 2IANB 1YEHH 4HC1L 1JRHI 4KVNL 5JHLH 1A9EA 5L8JB 5KN5B 1JZ4A 1DUYA 3VMNA 3DVFA 1KJVA 1OT2A 1U3ZA 1JN6B 1JZ7A 4EQ2A 1XZ0B 2VXUL 3ZKMD 4Z5RB 3NFPB 4LQFL 4JG1L 5KTEL 1HHJB 1UM6H 4TQEH 1JYNA 3BRGC 4MA1C 3HE6A 1IEAA 4M8QA 5D1QA 5DRXB 3VE0A 3Q0HA 2NZ9C 3FT3A 5LQBL 4PJFF 1HH6B 3IU4L 3L95B 4LL9A 2FWOB 1OQOA 4P48A 2MCPL 3VFRB 3ZT6A 1WZKA 2VDML 1QEWB 1RZJL 1HH9B 4Z7UB 3HI1B 5M94B 4MX7B 4ZFGH 4KKAC 3H9SB 4LARL 2CUHA 5I18H 2DF3A 4WHTB 4RGNE 1Q9KB 4P2RD 4P9HL 3VXRA 4ZOCA 4A2MA 4P2YA 4JFDD 3O4LA 1QVOA 4PV9A 4FP8L 3I50H 4PY8J 3RVTC 1ZHNA 1NCAL 4BELD 4WGWB 4E5XB 3QDMA 4YIQB 3T8XA 1L9NA 1NAMB 4NZTL 4D0DB 1ULVA 1SEQL 1YEKL 3DYMA 2HFGH 2BFVL 1Y0LA 5BZDA 4WO4D 1PKQB 5IMMA 5IBUG 4HSQA 1PKQA 4QGYA 2PXYA 3MYJA 1K8DB 3RWGB 2HKFH 4CKVX 4KHXH 1A7PH 1G7LB 3ZSSA 2CPCA 1QR1A 4Y5XB 3L3IB 5JMOC 4QOKD 3GSQB 4RGNC 3EO9H 5EFIB 1MQ8A 4FQIL 2MQ0A 3KS0H 3QJFB 3ZTNH 3RA7H 2FIKB 3ETBF 3UTZB 3HNVL 3TV3H 3DROA 3WFCH 3RWIA 3GSWB 1T04A 5JPMA 4WWKA 3KYNB 1DDHB 4RMWA 2Y7QA 3RL2A 5HHQA 3IFLH 4KRPC 4ETQB 4F7CB 1JYVA 4OV6F 3U83A 3FHAA 1LO2H 5K9QG 5JORB 1LE5A 3IFNL 2D0FA 5GGRA 1X6NA 1ZA3A 1Z6JT 5IB3B 5CEYA 1NJ9B 3HRPA 1P6FA 5CGTA 1MCKA 1CLOH 3WFEL 4JFDA 4MSWA 1W8OA 3D39E 3SE4C 5KS9B 3OKDA 1RULH 5FA4B 4MXQD 1GGUA 2PO6D 1F8TL 2ZOLB 2E9BA 2BJML 1SYVA 1TETH 3PXJA 5HYJB 4GRWH 1Z9OA 2UY7A 5L2KA 2L7UA 2V2XA 2XTJE 1MNUH 3FOMB 1TVHB 3OG4B 4LQ1A 4UDUB 1HEZB 2F74A 3GMMA 3VXME 2EYTB 3EJYC 3OQ3B 5C86A 3SY0A 4J6RH 2OTUA 1EJOL 3T0EA 5CINL 3RDTB 5IB2B 1BJMA 3BDXA 4H5SA 1BD2B 1X5FA 5IHBA 2XWBA 1HXMA 3LB6D 3B5GA 1KTKE 3L3GB 4KJWD 1FPTL 1KB9J 5E8NA 3S3PA 3QDGE 2Z0BA 2A6DB 1UWGL 4NFCA 1U95B 5T5NF 3KVQA 3SBWA 4LDLB 5C08A 2NQCA 2NYYC 1B3JA 3P0VH 3MMEB 3SDDA 4F3FA 1J88A 4TVPL 4PUBL 1OP5K 1JPFA 3ILPA 3F5WA 2DTMH 2XICA 3F5WB 5D71H 3I75A 1T5XA 1X5LA 4WU7A 4XXCC 1Y18A 3RVVC 3M07A 1N26A 3HA0A 2E3VA 5CP7B 2F8XC 1A4KA 1O5DT 3TYFB 3LN4B 1HOCB 5EU4A 2VLJA 3U9PL 1R3IL 3KLHC 3PWPE 4I0PB 5A2KH 3SKJH 2VKWA 1T0PB 5B3NA 3QULA 1X5YA 4U1KA 1JWUB 3T4YA 5KSUA 1WISA 5DHYB 4I0PD 1Q0YL 1JHTA 1MJUH 3W81A 5A2LH 2GTZB 1DQLH 3PWUA 2BNRE 4MA3B 3F12A 1MFDL 3QHZH 1ERNA 4TUJB 4HKZA 2X7LA 4CU8A 3AXLB 1JZ6A 4OV5B 1INEH 2CR3A 1EEUA 32C2A 3H8NA 5MI0B 4HXBH 5I2IB 5J57B 4JN2A 4GRWF 3TM6A 1ZA6A 3DGGA 2HVJB 3QNZA 3WNPA 2YPVH 1C8PA 4MMZC 1SY6H 4EI5C 4MNGA 1DEEA 1L0XA 3BEWA 4ODWB 1KT2B 5GGQH 4JFFD 1D3CA 3QDJA 3P11H 1TZGL 4Y5VC 3ZYOA 5FB8A 2VERN 4JVWA 4YHKH 1CGYA 4HUNB 4JFEB 1MHEA 2GEEA 3CDYA 5ITBH 1CVSC 3S37X 4XHQA 2JIXB 1UA6L 1MLCB 4QRPD 5KANG 4YLQT 1EEZB 1FC2D 2DQDL 2BNQB 3HLAB 4QOKE 5EDXA 3ZHDA 3V5DA 4JFQA 5F21B 2CIIB 2HG5A 4AZ8A 4E41A 1WWAX 1J0JA 3DLQR 4XTRC 4FTVE 3ZYIA 1U8MA 5I1JL 1G7MB 4YBQD 4GW1A 2R8SL 4HKBB 3ROLB 5FXCH 1H8NA 4YHML 5I66B 1YJDL 3WHE1 2IALB 5TDPA 1V05A 6CGTA 3NTCL 4MXVE 4KRPD 5TDNA 5SWSD 5ICZB 3P4LA 3PL6B 3S34H 4DK6A 2IH3A 1KYOK 3U1SL 4NT6B 4U05A 5JDSB 1UYWH 5T3ZD 5LG1A 1WV7T 4QT5B 5DQ9B 4NKQB 3EZJB 4JRWA 2QQLL 2ICCA 4WRLA 4X9FA 4EOWH 4H88L 5HHXL 4JPKL 4UT9L 1FGNH 4DVBB 4QTIH 5CJQH 2AV7A 5FV1L 2RJMA 2VZ1A 5EH1A 4NQDA 3SKOA 2UUDH 4FXKA 1MY7A 2IQAA 2YK1H 1WWBX 1A6VH 2YUXA 4HCRH 1I8MB 2ADJA 1K5NB 2YK1L 3C08H 3HR5B 3L3JA 3LEXB 4NN6B 4Q2ZB 1T03H 4Q9QH 3EYVB 4CNIB 3MRLA 2Z31D 5EU6B 3TN0C 4ELME 4OLUH 4H0GA 5DXWA 2HMIC 5T1LD 2GCYB 1SVZA 1AP2B 4NM4L 1AE6H 4M1GH 2HJLB 1OL0A 1M1SA 3O6LL 3TLRA 2CK2A 4R96B 1WBYB 3LDBC 4Y4KB 3LRGA 2JB5H 1CFSA 3B5TA 3C5JA 4Y16D 4HPOL 4RFEA 5A2JH 4U1JB 1QNZL 2WWKT 3QDJD 3FT3B 1FO0B 2DQCL 3ULUL 5AG8A 1ZVHA 5J7CC 3AGVA 1EO8L 5HI3C 3VU2A 4S1QH 1CG9A 4CN1A 4MX7A 1B90A 4TSCH 5LGHH 1JZ5A 3QZWA 3AY4A 3F58H 5MENE 4LNRA 5MENB 1IAII 4HK0B 4G80A 1GZQB 3VI4E 2VDOH 5HGDA 1M6OB 4ZO8A 4Z7VF 4H1LA 4GS7C 4RMQA 2SEBB 1PG7W 1YNLL 2Q1EA 3E6FA 4CDHA 3TESA 5E56A 3MNWB 2H2SC 3A6CH 2DAVA 1ZOXA 2A38A 1KNOA 3GIVB 2PTTB 1U91A 1UZ6F 4FABL 3IGAB 1IZKA 2HAZA 4OM0H 4PJAE 3HAEA 3O9WA 3VWJA 4QRSB 2KUTA 3TPUB 1T0MB 1NC4A 3O2VH 1F42A 5F1KC 4LSQL 2QL1A 1KFAH 1EJ6A 1QZ1A 3BJ91 4Y2DD 2LVEA 1WCBB 3WHXB 1M7DA 2ZSVB 3QEHA 4R7DB 2X7LB 3UJIL 2OS7A 4L8BA 1A6UL 4OV5A 1QSZA 5F6IC 1WJ3A 1UT9A 2AEPL 5ID0A 2QSVA 4WHCA 5HD8C 3VFNA 4PJFE 2NY0C 4UZGA 4S1RL 5L9DL 1VSCA 3IJYB 4I0KA 3HI1A 5KVEL 1FVCA 1S7SB 2VL5B 3L5IA 3WFDH 1ZK9A 4I4WA 5C08D 3MLTA 4FQQA 4ZFFA 4X6FB 4M6OH 5F1NA 1V3MA 4GXUN 4PRPB 4I3SH 1C5BH 3ZKMC 4XXDB 4QXGL 2R56H 4QRQB 3K1DA 1MCPL 1UZ6E 3LKQB 4P23D 4DTGH 1OGAA 4NN7C 5T1KA 6FABL 3QO1B 2X6MA 4LDOB 2J12B 1MCSA 4RNRA 3ARFA 1HYSC 4G6JL 5ACLA 4F7MB 1QFUH 1RHHA 5D7LE 3CVHH 2ESVB 2BCKB 4JO4H 2P8PA 2DTML 2BNQE 4HWZB 1OAQH 4QOKB 5CBAB 3QUYA 4LSVH 4UB0H 1EIBA 1YUHA 4X4XA 1KCVL 3C09C 1WFTA 2CDFB 1PZ5B 1TJHH 5K9JH 4YX2H 1CDGA 4U6XB 4HBCL 1M7IB 3UBXB 5C09A 1MCDA 4Z6AT 4CMMB 2WBJA 5C9JB 1BFTA 4NQUA 4FQCH 5IOPA 1M7XA 3M8OH 3CJJA 3LKPB 4H8WH 1RZ8B 4PTTA 1HHIA 5FO8B 1XGQB 4JFHE 2K9UA 4XPTL 5KSBB 1A2YA 3MBEB 5DD0H 2C26A 5GRJH 3GKWL 2AJUL 1QBML 4DN4L 2PO6B 4PRDB 4X7TB 1T83C 4WWID 1P7QA 1EEQA 1V7MH 4EI6A 3SOBH 3ZHKA 1QVOB 4PV9B 2J8OA 3PGFH 4ZPTA 5D6CB 5I75C 4DN3L 4IIQC 3Q48A 1T03L 3WIHH 1OWRM 1LO5A 3I85A 4YPJA 5KSVA 3R0NA 5KVMC 5IFHL 2HRPH 3AU1A 4NUJB 3IDJB 3EYOB 2QTEA 5FA4A 5F1IA 4FFYL 5DUPL 3MRFB 1F2QA 3SGDI 5IK3B 1JNLH 2FX7H 1BBJA 1ZT1A 2YHGA 3HNSH 2WIIB 4R4FH 1HQRB 3HCVA 3MXVL 4OGZA 5EB9A 4BSWA 4N0RA 5IKCB 3RDTD 1Q9WA 5GS1A 3WIIL 3VW3H 3HR6A 1X9QA 4WW2F 3L7EA 4HGWA 3O3BB 5CEZH 5I16A 4YHIA 4EN3D 1IKFH 3VXTB 4AT6A 1B6DA 4HH8A 3S4SB 5DJ6B 4JJHA 3E8UH 5E5UB 1DDHA 4RISL 5E8PB 3X13A 2WUBL 3VWKC 4JY6B 4PJCA 4EXPX 4UU9A 1UADC 2RIKA 3IDXL 1BFOB 2Y9RT 1C7TA 4TUJA 2DQGH 5GS2D 5TF1L 3TNMA 4NQVB 1N59B 2EDFA 3JV4B 3M17A 1VGKB 1KACB 5I8CA 3RU8L 3CFCH 1KNOB 2G60H 3DGGB 2ADFL 2OR9L 4KI5D 5C0EB 5I30L 1IFHL 2A83B 3H3PL 3FO0L 3O9WB 5D7SL 4P4RB 2JJSA 1KEML 2J6EH 2FR4A 1NKOA 3EO0A 3O11A 2EDYA 3VRLF 1RVFH 3MJ9H 4WU7B 1FSKC 3AFLA 3ZDZE 4KVCL 3K8KA 1W0WA 5CJOL 3P30H 4UMGA 1KCUH 3MJ8B 1A5FL 5JW3L 5JHDE 2CDEB 2X1PA 1F11A 2CDEA 2J2ZA 2IPUK 2FJGB 2FL5B 1B0RB 3BT2H 1R5IB 4KXZH 1BZ9A 3MRQA 4DFHA 5BMFL 1X5GA 2X4TA 4G43A 1CFVH 1I4FA 2X4TB 3CXDH 1I7ZA 3WUWB 3BZ4B 3O2WH 4R8WL 5I30H 2ZUWA 2IFFL 2G5BA 4KKCD 3AROA 4LVOB 1IT9H 2EXYC 2XKNB 5CD5C 1CU4H 4JFZL 4CW1B 1SYSA 1XF3B 4ZG1A 1QRNB 2DQHL 4NZJA 1R3IH 1NCBL 4R0LA 4FZEL 4OIAA 4PD4K 2DQCH 3C2AH 5EZOH 4Q97A 3O8XC 4NIKB 3VFVA 5KZCB 2NXYB 2ID5A 5F3BA 1AXSB 1MFNA 5SWSE 2PW2B 3NFPA 5IHZA 4XBEH 5E94A 3FO2A 4KROB 2EH7H 2Y72A 2DQEH 4DZBA 3V4VL 1QSED 5DJXB 2NYYD 2AGJH 4WW2C 4MJIA 3U2SA 1A7OH 4NC0B 3SE4A 4NC2B 4Q9QL 4R26H 1ONQA 3T65B 3OHXA 3GI8H 3V0WH 4OCRL 4YC2C 2AJYL 4AYFA 4ZOAA 3PWPA 1XGQA 1G9MC 1ORSA 5FK9B 1RV6X 3P9MA 4G9FE 3S35X 1E4XI 3NAAH 1QYGL 4L5FH 4WI9A 1I3GL 5J9PB 5KS9A 3RWJB 2O61A 3WN5C 3AREC 5ESQA 2H32H 4LLYA 5FUCE 4UTAH 4FNLH 5C8JA 1W72L 3BP7A 3FQNA 5BVJB 3QAZC 4EDWH 1EHLL 3CH1A 3MRPA 2Y36H 5EO9A 1BVLB 5D2LE 1AH1A 1HZHH 2IALA 4FA8A 4PJ7A 3CNKA 4M61B 4GW4B 5TDNB 2FX9L 3KYKH 4FHBD 1HSBB 3UTSE 1QBLH 2CLZA 5TE6L 1NFDB 2B8OT 1FVDB 4NT6A 1ZHLA 2BDNH 3NCYS 3NH7L 2OR9H 3MUHL 2DM7A 4DAGL 1C16A 5CLTA 1JI1A 4JGJA 4QTHA 5IGXL 4BK4A 2AW2A 3G5VA 1ZGLB 4F15B 2OCFD 5D2NB 2ADGA 1QRKA 3ULVF 4J3VA 4BKLB 4ZSOB 1E27A 4JLRB 5DD3L 3ARYA 3VFTA 4RWHA 4YHKL 5TQ2H 4J3XA 5C07D 2APVA 1UXSB 4I5BB 3B2UC 1K4CB 2B7DT 1YDPA 5BMFH 1JGVL 3JUYA 4P5MB 3RJDA 1PDKA 5B8CB 1JNJA 1HZHL 1WCBA 2IPTH 2P47B 2ZSVA 3QEHB 5C0CE 3K4DA 1R0AL 1YNLH 4LKXA 1BQLL 5CBEB 4GXVH 4N0UB 2VH5L 3PWVB 4RFNC 1QFOA 4M62L 4IRSD 2AXJA 3VG0L 5ICZA 1LGVA 5HHNB 1OTSC 4AL8L 2OL3H 2AEQH 3C60B 3MA7B 5D1QC 2FBOJ 2R9HC 3HUJB 2EDTA 5C2BL 2CGRL 4TVSa 3WFHB 3ARUA 4XVSL 1CD1A 2ZSWB 3W0WA 3OKKA 3HG1B 3HG1E 3D25A 2H1PL 3RP1A 1N5AB 5DD3H 1ZS8B 4JFFA 2LU4A 4O5LH 2NW3A 1M6OA 2D0GA 2BVPA 1UQSB 4UV4H 4GXUM 3FB7A 3DBXA 4ELMF 1UKTA 2PCPA 4F7PA