1HKIA

Crystal structure of human chitinase in complex with glucoallosamidin b
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 121
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkiA01
4KRUA 5CQ1A 3WQ5A 1J0HA 1E6RA 4CVUA 2YKKA 7A3HA 1CPUA 1EH9A 2D3NA 3VIGA 5FCZA 2V3FA 3RM4A 2WMFA 2J75A 4V2XA 3CH9A 3ARPA 1HKKA 1BHGA 2ESCA 2J77A 5CG0A 4C7DA 2EXOA 3THCA 3SCPA 1OM0A 4PMDA 3WDQA 1E72M 3WDRA 3SUTA 3UR8A 1OCQA 1XSJA 1W3LA 3O2LA 5A6MA 1KR1A 1JFHA 2UY2A 4J27A 4OOUA 1MFVA 1WCGA 3F5LA 2J7FA 1JZ4A 3QHMA 3MU7A 1B2YA 1VFMA 3CTTA 1PZ3A 1V0NA 2XIBA 3GXDA 5CXPA 1US2A 1CEOA 2TAAA 1CGTA 1H0IA 5A8MA 2GJRA 2OWWA 3VD4A 2V5CA 1PPIA 2WHLA 3DC0A 1CGXA 3WNOA 2WZHA 1UWRA 1NP0A 3AS0A 4MNLA 1UWSA 1LG1A 3L2LA 2DGAA 5A8OA 3I3EA 2OWXA 1MXDA 2CETA 5HPOA 3WFLA 3PHAA 2XPKA 3OLGA 3CUJA 3EDFA 2D20A 3KEHA 2VVSA 3WBAA 2PWDA 2PF0A 3AIBA 2WMJA 2YL8A 1B3VA 4FLRA 4AZ6A 1L8NA 1E4MM 3N15A 5FKYA 4F8XA 3QOKA 2BY0A 4ACYA 1LQ0A 4GI9A 3AZRA 1B90A 1D7FA 1UD4A 4PMYA 5BXTA 3AHXA 4UOQA 2VOTA 3CLWA 3ARQA 4ZXOA 2FH8A 4M82A 4E4PA 5DEZA 3ARUA 2E40A 1QBAA 3OGSA 1EDQA 1GCYA 4J3SA 1LF1A 3CZ8A 1CXFA 1GZJA 2WVTA 2Y2WA 2VC9A 1HJUA 3QGVA 1NWTA 1V08A 3BH4A 1NWRA 5FL1A 2WC3A 1TVPA 3WH5A 1W1TA 5HXMA 1EHAA 4GXPA 2VL4A 4MDPA 4RE2A 5E0CA 5D9PA 1KWKA 2J7DA 2J78A 3VIKA 3VIIA 5A8NA 5I0DA 4WKAA 3AHVA 4M1RA 4QDMA 1UA7A 5FL0A 3MO4A 1BYBA 3K8MA 1MQRA 1PX4A 3NSNA 3VINA 5LA0A 2VJXA 4ZE4A 3EDKA 2RGMA 3F5KA 2J8FA 2W62A 2DH3A 4JCLA 1AQ0A 1KGUA 1GVIA 1GJUA 2ZWYA 1NOUA 1HNYA 1LL6A 1J0YA 2JEPA 4PCTA 1DP0A 4AW7A 4HOWA 4D6JA 2W61A 3VD9A 1UR4A 4NI3A 1XGZA 2CIPA 3BAIA 2G3MA 1G5AA 1BPLB 3CUGA 5A8PA 1KXTA 3N11A 4D6GA 1H41A 3VDHA 2UWFA 3SCQA 3RM9A 3VMPA 5DO8A 5CLTA 3AZTA 1E4IA 5FOOA 4LXFA 5AC5A 3BLPX 3OA5A 4PCSA 1CLXA 4AZHA 2VZUA 5EMYA 4AD1A 4W85A 5JBDA 4F79A 3IANA 2FGZA 1TR1A 4P7RA 2VQUA 1KCKA 5C71A 1UR0A 1EQPA 3VDCA 2D22A 4PUEA 1CDGA 1M7XA 1GNXA 1M53A 3VM7A 2WHKA 3NYDA 4Z2GA 5CLWA 5I23A 2QMJA 1E55A 3T09A 6CGTA 4XB3A 3T2PA 4GIAA 1XCXA 1OB0A 2G8ZA 1BGGA 1FP9A 4GKLA 2XTKA 2ZOXA 1RD6A 1TUXA 1FOBA 2CHOA 4HTYA 1DTUA 3ZSTA 4M81A 1UKPA 1VEPA 5M03A 1JXJA 4AZIA 1UD8A 3K1DA 2BHZA 1OD8A 1E0WA 3EBVA 1M03A 4AWEA 1H09A 2CEQA 2VO5A 2X1IA 3L4VA 1G94A 4AZ7A 3BMWA 3VIPA 3WDHA 2W63A 3NDZA 4YHGA 4UFKA 4MNJA 4Z2HA 2GVYA 3N12A 4W84A 1GJWA 1CZ1A 4HPGA 4TVDA 1QVBA 4AY1A 3RPMA 2WBGA 2YJQA 1IV8A 4PMZA 3IK2A 3RILA 5JIPA 1EGZA 1CXHA 3W82A 2WXDM 3AHZA 3AICA 4MADA 2VQTA 4GPNA 4M24A 4JHOA 2D24A 1BLIA 4ZENA 4AIOA 4AD3A 1MQPA 3AYSA 2EPKX 4MNMA 2JF6A 1NOWA 1QW9A 4R27A 4ATLA 5C70A 1B3YA 1WZKA 1S46A 3POCA 3W81A 1UG6A 1WP6A 4QCFA 3WF4A 2VRJA 3CUIA 4W8LA 3ZT5A 1EQCA 4P7QA 3CZJA 3N9KA 1TCMA 2EBNA 1GOOA 3LPGA 1XHGA 4AZGA 5I24A 3M07A 2WMGA 4JFSA 1KFWA 5CGTA 2W4XA 5JBFA 1LL4A 2GK1A 1JIBA 3GH5A 6TAAA 3IJ9A 4RE3A 3WH6A 3DECA 2FGLA 4OIFA 2GJPA 2V3DA 1HKMA 1PJ9A 5A3HA 1W9VA 1J0JA 1K9DA 1U2YA 3WDPP 1VRXA 3AIRA 1OGBA 1JNEA 3CMGA 3QOMA 3VIJA 3AFBA 1R87A 4PTWA 1BAGA 3WQ4A 4AD5A 2W5FA 5FD0A 3OLEA 1ZU8A 2QMKA 2WWDA 5A95A 2WC7A 2Y4SA 3VX0A 1OD0A 3JUGA 2D0FA 4HA4A 1TFVA 5A2CA 1OIFA 1E6XM 1EA9C 5C8BB 1E56A 4E8DA 1XD1A 8A3HA 1LL7A 3WF0A 1AQMA 1VFOA 4H8HA 3WUFA 3NUKA 3WD2A 1GW1A 3ZMRA 1Q6GA 1BVNP 3K8LA 2DQXA 1E6QM 3VGHA 1J10A 2HVMA 5E6ZA 3RDKA 5A6JA 1FH7A 4HPHA 4HMDA 1E6PA 4DM1A 3TTQA 1E40A 5GQBA 2D1ZA 4D6HA 3IAQA 3ZQ9A 2VUYA 3VGBA 1ZL1A 3G6LA 1AMYA 2E8ZA 2CBVA 3ARVA 3AXIA 1IT0A 4CGTA 2VRQA 3PZOA 2MANA 3VIHA 1I1XA 3AIUA 1V3MA 2DH2A 3AHYA 5EFFA 1KBKA 2VI0A 2WCAA 1FHLA 1E71M 2BNJA 3EMZA 3AROA 2W66A 2YL9A 2BHYA 2G3IA 1KBBA 4GZIA 3J7HA 2WMIA 3F5JA 2ZX7A 5BXSA 4MAVA 3MUIA 1W1YA 1EDTA 1PX3A 3OLDA 1E1FA 2O9OA 5DT7A 2PWFA 3NCOA 4J3VA 3SCOA 3GXIA 2VZOA 5BXPA 1CXKA 1E4LA 4UNIA 4Z2KA 2Z1SA 3M7SA 3GH4A 2XM2A 1HP5A 1HVQA 1WDSA 3WELA 2AAAA 3UR7A 2DSUA 5A8QA 3T0DA 2CKRA 2YL5A 2FDMA 1ESWA 1QBBA 1UH4A 3F4VA 4QLKA 2J7GA 2ZUWA 2DT2A 3BXWA 1B0IA 4U31A 2FHCA 4D1IA 1VBRA 1K9FA 5I3DA 4JFVA 4ZFMA 4K68A 1W1PA 3MSGA 4AYSA 3WQ6A 3VTRA 2V3EA 2DSZA 5FIPA 4BF7A 4D6FA 4M8UA 2VX4A 2WW5A 1H11A 4W89A 1WAWA 4EANA 4HA1A 1WKYA 3B9AA 4XZWA 5GPRA 1U30A 4UQBA 3U5UA 2BFGA 1OT1A 3KZSA 5A6SA 3VU2A 1BYAA 2OSWA 5BYWA 1NP2A 1WDPA 1W91A 2ZUTA 2WKLA 4F9JA 5GNZA 4CCDA 5A6LA 1WZLA 3N13A 1JDCA 1PX8A 1YQ2A 5CSUA 2BV9A 4BQ4A 1IZKA 4CU8A 2YL6A 5I77A 4PTMA 1HX0A 4F9DA 3BSGA 1CTNA 3ZR5A 3NSXA 3A4XA 4X9YA 1VFUA 1UR8A 2Y8KA 4JKKA 4MJ2A 3VGGA 1W3JA 4RE4A 4JHZA 2E9MA 1QNOA 5BWFA 1TA3B 6A3HA 2WCGA 3MUY1 2XM1A 1HJXA 3ALGA 1VEOA 4TVUA 1A47A 5IXEA 4U2ZA 4HU8A 4EAMA 1R85A 3VILA 3W37A 1UKTA 3OB8A 2B31A 3GYCA 3BCDA 4HOZA 3VKKA 1B31A 1UKSA 1ISVA 3WF2A 1UD3A 1V0LA 3WBEA 5KZ6A 1EO7A 4B3KA 1CXEA 1OGSA 4H7VA 3AMKA 2FHBA 1NWSA 4N42A 2WWCA 3WF3A 1XCWA 2WVVA 1UZ4A 3ZT7A 1CWYA 3S2CA 1ITXA 3TTOA 5ABHA 2PI6A 4NZCA 1V3JA 1TZ7A 2ZUVA 4CU6A 4PMQA 2XUCA 2WKGA 3B9DA 3K8KA 2EPOA 1JZ3A 1E70M 2EEXA 4UFHA 5GNXA 4IISA 2QPSA 1MW0A 2XSAA 4AC1X 1M04A 3U7VA 1KB3A 3D5HA 1W3KA 1KR0A 3SUWA 2EQDA 2WCSA 3UCQA 1GOKA 4JFWA 1E3XA 4HZ7A 2V3GA 4U33A 5JH8A 3KE0A 4BA0A 3ARRA 1AVAA 2PWHA 1RH9A 3NJ3A 3QHNA 4XUYA 2GSJA 3VOCA 1BG9A 1HT6A 1ZBCA 4Z2JA 5HBFA 3RMEA 1J11A 1PZ2A 3T0AA 1C8YA 4ZXLA 1F4AA 5BROA 1H49A 3W25A 3KWXA 1X6NA 1V6UA 2D23A 1CXLA 3VD5A 1FP8A 3WH8A 1BSIA 1Q4NX 4JFUA 1UWUA 1GQJA 3L4XA 1JYNA 1J01A 2BXYA 1MW2A 2CNCA 3I3DA 1E6ZA 1DWIM 4P7LA 1G01A 2QV4A 3OZOA 1ZBWA 5I6SA 1MW3A 3RJYA 4L4OA 2VZVA 1QHPA 1RPKA 1HF6A 3VIOA 2C7FA 3RIKA 4P7NA 3GZAA 1EOKA 1GOQA 3FHAA 4JZ5A 3K46A 1FH9A 3VGFA 5A6BA 4UQ9A 3FY1A 4YHEA 2C8NA 1VEMA 2CCRA 4IUGA 2EJ1A 3VX1A 3AMGA 4BS0A 2XG9A 1ZJBA 4B3LA 2J74A 1WO2A 4DWSC 2F8QA 8CGTA 1QI5A 1V6VA 3CHFA 1BFNA 1QW8A 1JDDA 1Q6FA 2J7EA 5EFDA 2E9BA 2XIIA 1H3GA 1JI2A 4UZUA 4H8VA 4M80A 1US3A 3SCVA 1W2PA 2W91A 1H1NA 4N0RA 4LYPA 3WN6A 2Y8VA 3ZOAA 1G1YA 1E6SM 4A3YA 4UFJA 3N1AA 1ISYA 3BAJA 2J8GA 4NRRA 2C0HA 3SIMA 3AMDA 3UEQA 3RCNA 4A4AA 2WB5A 3TONA 2WSPA 4PBGA 4WF7A 5AC4A 2XVGA 3T0BA 2NT0A 3WMSA 7CGTA 1H5VA 1QHOA 4D6IA 7TAAA 1C8XA 1ZBKA 4ACZB 1OT2A 4DWSA 3IJ7A 4J3TA 2JIWA 3MUZ1 3VMOA 1H4PA 1QHZA 3UG5A 1VF8A 4KH2A 5AY7A 2DEPA 2D0HA 2O92A 1C92A 2VVNA 1PBGA 2YA0A 5IHSA 1LG2A 4DUXA 2XWDA 1CECA 1SYTA 1NWUA 5D9NA 3ZSSA 3EDJA 3THDA 4MB5A 1B30A 1Y7VA 3DHUA 1JYVA 2EPLX 3A6OA 1NM9A 4V28A 4LGXA 3ZR6A 1A3HA 2VCBA 4AD4A 4P8VA 1JAKA 3GXMA 5LYRA 1I75A 3IAPA 5E9AA 3K4AA 3GBEA 2YLAA 4D72A 4E2OA 2ZX6A 3BLKA 1QNRA 1JFXA 4AIEA 1UH2A 1CGUA 1K9EA 1WDQA 5EB8A 2PBGA 1HJQA 1WDRA 3VGEA 3WH9A 1V3LA 4UOZA 1WZAA 3ARTA 4FF5A 2XGBA 1R7AA 4CN6A 2G4FA 3ZT6A 2CHNA 4CN4A 1WPCA 1KXQA 1SFSA 3QR3A 2J62A 1WZMA 4B16A 4W7VA 2QF8A 4PEEA 2Y24A 2XVKA 3CMJA 2WHMA 3VIFA 3AMCA 4J3XA 2BXZA 4CCEA 2DSWA 2BHUA 1UKQA 4PMVA 4S3JA 1V3KA 1BF2A 2FHFA 2BS9A 1UD5A 2CXGA 4TX8A 1UR9A 3CHCA 3SUUA 4LYQA 1E0VA 5BXRA 1NH6A 4QFUA 1H0GA 2CBJA 3W29A 5HNNA 4YN5A 1X6LA 5I78A 1Q6EA 3OG2A 1JYXA 1HN1A 4PMRA 1PAMA 3O9NA 3FAWA 3VDAA 3GM8A 4H04A 4XV0A 1KGWA 5D8WA 2ZUSA 3TA9A 2DT1A 4JL1A 4KGJA 1XYFA 5DF0A 4ML4A 2WVUA 3WENA 1VFFA 3WEZA 3AIVA 5AYIA 2XVPA 3VVGA 1BG4A 4UQAA 4TOQA 2PC8A 2Y5EA 4W7UA 2VMFA 5CPSA 2PWEA 1B3WA 2OLHA 4W86A 2WLZA 1HVXA 4PRWA 5EBAA 1CGVA 4PSPA 2VCCA 3ZJKA 4WLCA 4WKHA 3FHQA 4PMNA 2YBTA 3WNPA 4TTGA 2EPMX 5BCAA 3WFZA 4CD7A 4UFLA 1KQYA 4AZCA 3AXHA 3AI0A 4B9YA 3BAWA 1EIBA 2WLYA 5E09A 1PIGA 3NDYA 4JKLA 4OZOA 3FW6A 3VUPA 2VX6A 2WVSA 2UY4A 2ZWZA 5BRPA 4CN1A 2J25A 1X1NA 3KL3A 3AZSA 2VURA 3ARXA 4HA3A 1DWGM 4QCEA 5CPTA 1KXVA 2NW0A 4CD6A 3KL0A 1ECEA 3GXFA 4GZEA 1PEZA 4WSJA 2WMKA 4WSKA 2O9TA 4LPCA 1GVYA 4J28A 1UH3A 3WQ8A 1M01A 4WIWA 4MB4A 1EDGA 2X2YA 5ABFA 1GOIA 4W5UA 1V6XA 3MMUA 2YA2A 2Q8XA 3PZGA 4GO9A 3T08A 3T2QA 1MW1A 1MVYA 2X05A 4D1JA 1K9TA 4AD2A 1OWQA 2E8YA 4CD8A 1CENA 2CYGA 1DWFM 2XYLA 1JNDA 1Q6DA 1MYRA 3L4TA 4HP5A 4DWSB 1U33A 4U5IA 1UD2A 2J7HA 3MS8A 2E0PA 3VO0A 5CZKA 1HL9A 4NF7A 1NARA 1W9BM 3PTKA 2J47A 3SCRA 1VAHA 3N18A 3II1A 1HJVA 1O6IA 2O9PA 3AIEA 2WZEA 5ABEA 4KGLA 4FK9A 1OINA 1W9XA 5E6YA 2OWCA 3WD3A 1BYDA 4C7FA 3ECQA 2BVTA 2A3HA 2JALA 4JKMA 5A69A 1UZ1A 2VZSA 3W6MA 1UOKA 4EK7A 1UWIA 2XHYA 3B9EA 1DEDA 2WSKA 4WK9A 2J7BA 1JZ5A 3LPFA 4FLQA 4H41A 1QPKA 4D6DA 5JBEA 1MQQA 3PZIA 3GNRA 3ARSA 2CKSA 2A3EA 2VX5A 1V3IA 5IFTA 1BQCA 4Y7EA 3WL0A 4EE9A 4P7OA 3SCTA 2OYLA 4TXEA 1V0KA 3WD0A 2A3BA 1MFUA 3B8SA 1E73M 4GZJA 1XD0A 3G6MA 2W92A 2YDQA 4S3KA 4MAZA 4U2YA 4R5EA 4OJYA 4UFIA 4U5KA 5A6BD 2CBIA 3SUSA 3MUAA 1KCLA 4GQRA 2X09A 1XV8A 1XH2A 2E9LA 4AEEA 4AMCA 3OLIA 3PBGA 4PN2A 1BYCA 3TP4A 5I5RA 4J3WA 3VMNA 1E1EA 4NSBA 2ZUUA 2XFRA 3OZPA 3W6LA 2WNWA 3W4RA 3AS1A 3GNOA 3K4DA 2XGIA 4RL3A 1WB0A 5M5DA 1JZ7A 1C7SA 1UQYA 4GI6A 2J7CA 3WEMA 1TA3A 3CPUA 4URIA 4XZBA 5DT5A 4ACZA 4J3UA 5IDIA 1UA3A 2ZXAA 4GO8A 4PMUA 2IUZA 4D71A 3FN9A 3N17A 4PSRA 2WZIA 1W1VA 2G3NA 3VDBA 1CLVA 3GBDA 4W93A 2E3ZA 4F66A 4DUVA 4FLSA 1AQHA 1PIFA 2ZE0A 2DIEA 1E5JA 1DWHM 4HZ6A 2OSYA 1JD9A 1DWJM 3GH7A 5A6KA 2VTFA 1KWGA 2GJXA 2YLLA 1QI2A 1O7AA 3AYRA 3QHOA 1JGIA 3PZ9A 2D3LA 3WNKA 1JF5A 3M46A 1XH0A 1LLOA 4MNKA 4QP0A 1HP4A 2O9RA 5AYBA 4TVCA 1C7TA 3W24A 2JEQA 3L4UA 2JFEX 4KWUA 1SMDA 3NIYA 3OIHA 3AQUA 4IPNB 3LPPA 3O6AA 1I1WA 4KMQA 3W0KA 1H2JA 3CUFA 1KGXA 1K6AA 4QAWA 1GQLA 2VR4A 2BVYA 3UG4A 2QHAA 3WMCA 1RP9A 5CGMA 4WJXA 1V0MA 1J0ZA 1VB9A 1P6WA 3PTMA 1CIUA 3PZUA 3DYPA 1ISZA 5CJ5A 4P8WA 4ATDA 2ZXBA 1HKIA 2UY5A 3T2OA 1CXIA 3WMBA 5CPQA 1XH1A 1MWOA 1VJZA 3A47A 3CZEA 1DHKA 3CZLA 2XWEA 2EPNA 5DFAA 4X0NA 1XRVA 3WUGA 4AD0A 2XJ7A 1KXHA 1G9HA 4E8CA 4Q22A 2D2OA 1JD7A 4MTVA 1EHNA 2WMIB 4AZ5A 1W3HA 3WD1A 3DYMA 5TD4A 3HJEA 5JUVA 4JFTA 2IXUA 3W26A 1TMQA 1UWTA 1QOXA 3EDDA 2DT0A 4OOZA 1BGAA 3WNLA 4CUCA 2OSXA 3RM8A 1G0CA 2GUYA 2BY3A 4HZ8A 3CZKA 4W87A 2DPEA 2D0GA 3VD7A 2YA1A 3I3BA 2DSKA 3VPLA 3BC9A 3BAYA 4A3HA 3WEOA 2FH6A 4QLJA 3HU7A 4MB3A 2GK1B 4D6CA 1E5NA 1GUVA 1DWAM 1GQKA 2AOSA 2W67A 4GINA 4FMVA 2IXVA 1ZB5A 2J4GA 2PB1A 3W38A 1TG7A 5A2BA 3HN3A 1JYWA 5HOSA 1VBUA 4B15A 3BGAA 3W27A 1GORA 3A3HA 3IJ8A 3UESA 3MMDA 4ZE5A 3LMYA 1J0KA 4C7GA 1R86A 2PBOA 4CD5A 3PZVA 1LWJA 4JL2A 3ZM8A 2VR5A 1FFRA 3L4WA 1OBAA 2WANA 3E1F1 1XYZA 4H8UA 2A3CA 3VD3A 1V6WA 1YHTA 3CHDA 2HISA 4AISA 2ZXDA 2YOCA 5ABGA 3AMLA 4CU7A 2XVNA 3FAXA 2ZX5A 2ZIDA 1J12A 2GDUA 4MB1A 4V27A 1JZ6A 1LWHA 2CBUA 3GDBA 3WNMA 3AJ7A 1GHSA 1XC6A 3WQWA 5D8ZA 3AIQA 1C93A 1L0PA 2PWGA 4BQ3A 4NRSA 2NSXA 4WKFA 1JAEA 4UQDA 1BTCA 2WM0A 1W9PA 3ARWA 1VJSA 1WE5A 3WH7A 3WDJA 4ATWA 5IHRA 1QNPA 4UTFA 5A2AA 1CGYA 5HPCA 3WL1A 1B1YA 1CBGA 4UCFA 2BY1A 2ZUMA 2WK2A 3SUVA 5I2UA 2VT0A 2ZUNA 4Q7NA 3AHTA 4KRTA 2ZICA 5D4YA 3M6DA 3MV11 1CGWA 2X0YA 3WUBA 1E3ZA 1VENA 1Z32X 1IZJA 1ISWA 2CESA 2ZXQA 1JG9A 3SCNA 3U7BA 3EMCA 1ZS2A 2YDRA 1OSEA 3ZJ8A 4PUDA 1NQ6A 3ALFA 1OIMA 3W28A 3L2MA 2DSVA 5M3WA 4OBSA 1W32A 2JE8A 4UFMA 4HMCA 1C91A 4M56A 1JDAA 3OGVA 3L4YA 1GHRA 3SCWA 3CHEA 4HU0A 4CCCA 2G3JA 1HJWA 2BY2A 4OKDA 3APGA 1ITCA 2J79A 3WDIA 3UG3A 1W9DM 4BCEA 4HOXA 1B3XA 3LPOA 1SR0A 1J9YA 3CIVA 1GOWA 4TX6A 5E0FA 1NOFA 1GQIA 4W88A 3EYPA 1QI4A 2Z1KA 3ZJ6A 2DDXA 4JAWA 1UYQA 5F7UA 3AS3A 3GTNA 2VX7A 1EO5A 3ARYA 3A4WA 3OBAA 3DHPA 1C3FA 3MKKA 2GJXB 4AZBA 2YBUA 4L4PA 2G41A 1D2KA 5M17A 1MXGA 4D6EA 5D9OA 2VZTA 3U5YA 2XSBA 1RP8A 4U3AA 4LYRA 3N04A 2OYMA 4UOJA 1XSKA 2GDVA 2WBKA 2OYKA 1V02A 3WNNA 1V6YA 3MV01 4OBRA 1UHVA 2CPUA 1ZBVA 3U57A 3W53A 1JZ8A 4MPKA 3VGDA 1OGGA 5A6AA 3BAXA 1HKJA 2F2HA 5D9MA 4UQCA 2YIHA 9CGTA 1UUQA 3VNZA 2WAGA 2A3AA 4PTVA 1TVNA 1R7OA 2VRKA 4PTXA 3NSMA 3MSDA 4GQQA 1UR2A 2RGLA 4PYSA 4OUEA 1FFQA 2DT3A 3UERA 3PZMA 1UQZA 1B3ZA 2QPUA 1ODUA 5DMYA 3WKZA 1JL8A 1QI0A 3VNYA 4P8UA 4UR9A 2V5DA 1E15A 4MJ4A 1WNOA 3CO4A 1R8LA 3WUEA 4DUWA 3PZTA 4TUFA 1E4NA 1UD6A 5I79A 5CSYA 1QNQA 4CVWA 2VCAA 4LQ1A 3TOPA 3SCSA 1EXPA 3SCUA 3ZIZA 2X0HA 4W7WA 3S6TA 2WPGA 5GNYA 4EKJA 1CYGA 4MDOA 2AMGA 2BVDA 1LJYA 2WC4A 3OGRA 3WD4A 4Z2LA 3UETA 3ZJ7A 1JF6A 4PMOA 2JF7A 3VM5A 5IFPA 5HDRA 3SURA 1CNVA 4LX4A 3CZGA 4DWSD 1BVZA 2XFYA 1GPFA 1JXKA 1JZ2A 4B9ZA 4GI8A 2GFTA 4BQ2A 1JI1A 3WIJA 3EMQA 2X8RA 4BQ5A 1UWQA 3KL5A 2DIJA 5ABFB 4DM2A 1ODZA 4JIEA 5LA2A 3A4AA 3VIMA 4CD4A 1QNSA 1EOMA 3PTQA 2YDSA 1J0IA 1XSIA 2F61A 1B9ZA 3ZO9A 3EDEA 3WF1A 1V03A 4IPLA 3TTYA 1W9UA 1HJSA 3L4ZA 4FLOA 3WQVA 3BMVA 3SEPA 1V02E 1C8QA 2WVVB 3WY1A 3POHA 4AIUA 2UY3A 3CBWA 4JCMA 2JIEA 4AEFA 1VIWA 4QLLA 4Z2IA 1N82A 4X0VA 3AISA 3RJXA 2NT1A 2XVLA 5KEZA 1V3HA 4HMEA 1D3CA 1HXJA 1FH8A 1C90A 4J7RA 1GOMA 2QLYA 4U3CA 1UKOA 3PZNA 5BRQA 1J18A 2CITA 3HMCA 4ZEPA 3FXYA 2EO7A 1E43A 1GONA 3CUHA 2CERA 1E0XA 1Q6CA 1HL8A 4W5ZA 1UR1A 4PMXA 2E4TA 3BAKA 3PZQA 5E70A 1W2VA 5ECUA 3RO8A 1TE1A 3AOFA 3MANA 2WMHA 1KQZA 3MMWA 3DYOA 2WHJA 2ZX9A 1ISXA 2VNCA 3TTSA 3ARZA 5JIWA 3PN8A 3CGTA 4XX6A 4UQEA 3BCFA 5LA1A 4CKQA 4M29A 1HIZA 4AZCB 1FHDA 1ZJAA 3D3AA 3AIWA 3BSHA 1FA2A 1SMAA 1F4HA 3FNDA 5A1AA 3GNPA 2XFFA 4AXNA 3WSUA 4TTUA 3AXXA 2WYSA 4UZSA 1E6NA 4W8BA 2V38A 1QI3A 5A94A 4BZYA 1E9LA 4H2CA 3AS2A 4W8AA 4P8XA 4IM4A 2ZX8A 4YPJA
chains in the Genus database with same CATH superfamily
3WQ5A 1TIWA 2WMFA 4IF2A 1X6UA 2CC0A 2PDNA 3NPXA 4FEZA 4DWDA 4L3NA 1E9YB 5C0QA 4DF2A 4HQVA 5AHLA 1W26A 2PDUA 5KZDA 2EXOA 3F4WA 4MM1A 3RF9A 1OM0A 3LN3A 1E72M 2QCEA 4L64A 3FEMA 3SUTA 3UR8A 3GDMA 1IEXA 1OCQA 3O2LA 3S2JA 1YKWA 1AZ1A 4PUMA 5A6MA 4FZIA 4TV5A 4JTIA 4XO7A 2CLKA 2BVWA 1IYXA 3WMLA 4LAWA 2J7FA 3NZ1A 4BF5A 3MU7A 1MDRA 1VFMA 4M6VA 5HANA 1AL8A 3QN3A 3GXDA 1CEOA 1H0IA 1Z69A 2V5CA 4H9YA 3UWQA 1KM5A 4JNZA 5LNVA 3Q2DA 2R14A 3F4DA 4Y9OA 4HBEA 2Z2UA 5HWNA 4G5DA 4JEJA 1DE6A 4Q8QA 1M68A 2HTMA 2OWXA 1NJJA 4HPJA 3GG8A 4C6LA 1ME7A 4L5ZA 3TAOA 2PWDA 4N4QA 3AIBA 1VR6A 4J4KA 1SZEA 3W7PA 4GACA 1J2BA 3N15A 3H4GA 4F8XA 2DQWA 2BY0A 4IT4A 4Y9NA 1WOBA 3BG3A 4GI9A 2GLKA 3TYCA 3R5EA 1O1ZA 2R1LA 3WJZA 1UD4A 4PMYA 4GY1A 1LLWA 2VOTA 3KAHA 2FH8A 1H50A 1FWRA 4E4PA 4XD6A 5DEZA 3E5BA 2E40A 4E2DA 3MVIA 1IXQA 3ABSA 2GWGA 4WOQA 4EXAA 5TF0A 1GCYA 4I8DA 1TIMA 2VC9A 1S2AA 3V5FA 1A5CA 3QGVA 3BH4A 3WQDA 5FL1A 3I7SA 1TVPA 3WH5A 1W1TA 4RE2A 4FR6A 4DJEA 5D9PA 1KWKA 1US0A 2J7DA 3VIKA 3ZXWA 1PTDA 1SO4A 5I0DA 5HNRA 2GJNA 3AHVA 2XZ7A 4QDPA 2AL2A 1EUAA 3TJLA 2EG6A 1GT8A 4W9OA 3EDKA 1L8PA 5I3FA 2J8FA 2W62A 3CC1A 1KGUA 4M5PA 1GVIA 1IZCA 1UUOA 3C3UA 4QE4A 5XIMA 3INPA 4ES4A 3BJFA 1LL6A 4IPXA 4GBDA 1J0YA 1I8JA 3QRHA 2JEPA 1G4PA 1DP0A 1XQKA 4UUIA 1UR4A 3KRUA 1OX4A 5EL1A 4ODNA 2CIPA 1KA9F 3CUGA 4IL2A 4B2DA 3EWCA 2UWFA 1BRLA 2PDJA 4Q8OA 4H4IA 3AZTA 1E4IA 1Q63A 3CV6A 3OA5A 4QIUA 3GNDA 3DERA 2FGZA 1ZPTA 1TR1A 4P7RA 3UR5A 5IBXA 1S1RA 4LS1A 4H9VA 3WLKX 4L56A 1EJUC 1T5AA 2D22A 3N4EA 4N9DA 1CDGA 1GNXA 4OHQA 2IPWA 4HTBA 2QNEA 2NV1A 3DHFA 3NYDA 4DRJA 4Z2GA 3PY2A 3UQNA 3G0UA 1VHCA 3T09A 6CGTA 1XCXA 4H6KA 3O15A 4L1XA 1FOBA 4KCTA 2GGHA 1DTUA 7REQA 5M03A 2BGNE 1JXJA 2INFA 5HWBA 3NQMA 1EFZA 4LW7A 3VDGA 1OD8A 2QJJA 3AWNA 1E0WA 4AWEA 4B5UA 1G94A 3BMWA 1PTAA 1D8WA 2W63A 2PP0A 4Z2HA 3N6JA 2Z6IA 3LBMA 4XAZA 4AB4A 1A4LA 1GJWA 1OC7A 2EKGA 3NPWA 4TVDA 1W3IA 3A12A 3QQ1A 3G5EA 3LNPA 2WBGA 4HKPA 1P0KA 1IV8A 1PSCA 3NQ6A 4BY3A 3KRBA 2WXDM 4NAFA 1UP2A 3P62A 1I9CB 3AICA 2PCEA 2VQTA 2R82A 4PRRA 3DFTA 3OEXA 2GGEA 1IIHA 2D24A 3B8WA 4ZENA 4AIOA 2PN0A 1BWVA 1PKLA 2EPKX 4MNMA 4B90A 3U2EA 4QISA 4R27A 1QW9A 5C70A 3V5OA 1XIIA 4IGHA 2ZR4A 4UR7A 4DZIA 4QCFA 4AAJA 2VRJA 3CUIA 4KCWA 5D05A 3HG2A 3EA2A 1EQCA 3LPGA 4AZGA 5I24A 1OQFA 2C1GA 1KFWA 2GK1A 3LENA 2VEIA 2QW5A 4OIFA 3ZWSA 2UV8G 5A3HA 1J0JA 1U2YA 1TWDA 1NDVA 1VRXA 3W83A 1J79A 5BZAA 3BK0A 1KTBA 2Y62A 4PTWA 3O5EA 4AD5A 1R3VA 3EEZA 4MLJA 2VFFA 5A95A 3LHUA 1OD0A 3JUGA 4HJWA 4Y9PA 2D0FA 3TYAA 4HA4A 4JDYA 3UZJA 3OZYA 1TFVA 1MUMA 1Q85A 1XI3A 4G7EA 4JTKA 5LGXA 1IEIA 4ZQNA 1OC6A 2XH4A 3LCWA 8A3HA 3WF0A 4H8HA 2NQLA 5AVHA 3WD2A 1GW1A 3ZMRA 3LB0A 1J10A 4PUJA 5E6ZA 1F3XA 1W8GA 5FI8A 1NEYA 4EACA 4ERGA 4WUIA 3EWBX 5CG7A 4ADTA 1JCHB 1ZL1A 3TE9A 1FTXA 1AMYA 3AXIA 2MANA 2IQDA 2X16A 2FFCA 5EFFA 4KETA 3GR8A 2WCAA 1DJIA 1FHLA 1DJNA 4LS2A 3CUXA 3A23A 4NQ1A 5FEXA 1JDFA 3TN3A 2WJFA 4IJRA 3AROA 2W66A 2YL9A 3WFAA 2G3IA 3IACA 1KBBA 2ISDA 3F03K 4UTJA 2NX3A 1PX3A 2GGJA 2O9OA 5DT7A 2PWFA 3GAYA 3NCOA 2VZOA 1FD9A 1E4LA 1WKEA 3B97A 2WQPA 4KQZA 2YYUA 1SO3A 1HVQA 1K1DA 3KBMA 3UR7A 3VA8A 4DF0A 3T0DA 1X7IA 4B5SA 3H7UA 2VELA 1ESWA 1SVDA 3TJXA 3CL8A 3EB2A 3CPGA 3TV8A 4U31A 3TDFA 2FHCA 4YU1A 4D1IA 4MY9A 5GJPA 4MWAB 1W1PA 3W7HA 3WQ6A 5CJNA 3VZXA 5CSRA 4M19A 1Q2RA 2QJIA 2VX4A 1H11A 3R12A 4QJ1A 3C0QA 3B9AA 4POCA 1YNQA 3U5UA 2BFGA 1ZGDA 2L5HA 2RFGA 4B5WA 4GHRA 1BYAA 2QCGA 4ZO8A 1NP2A 1WDPA 1W91A 2PTWA 3LRKA 1VFHA 4R7WA 3ZZ1A 1BXNA 1PX8A 1YTKA 3NTPA 1GYNA 4BQ4A 1IZKA 2YL6A 4F9DA 1CTNA 3NSXA 1O5RA 2YW4A 4XKYA 6XIMA 3GFXA 3N3MA 1QNOA 5T9BG 1HJXA 3CWOX 3V18A 3OHMB 3APYA 2PRHA 1A47A 4LYKA 3B0PA 4A8RA 4GLEA 1VCVA 3BQ5A 2HCVA 4YCOA 4G2PA 3VILA 3SGUA 3OB8A 2B31A 3QXBA 4HBKA 3BCDA 1MMFA 1B31A 5F2MA 1UD3A 3DFOA 3S5ZA 2P8CA 4O14A 1U1JA 4H7VA 4A8LA 1W31A 4PCFA 2WWCA 3NQGA 2WVVA 3EWDA 4K7VA 5HMSA 3CAKA 4W9PA 2PI6A 4NZCA 4JTDA 4LC6A 3B9DA 3LHZA 3K8KA 1R2TA 4DZAA 3VE9A 4NP7A 3URBA 3ZVIA 1YXCA 4XUGA 4AF0B 7ODCA 1FBAA 4Q32A 1AL7A 2EQDA 2WCSA 3UNDA 3T07A 1GOKA 3KVJA 5FJOA 4U33A 4OE7A 4LUIA 2PWHA 1F73A 5FEZA 1BG9A 2W6RA 2CW6A 1NF7A 4JFKA 5BROA 3W25A 3KWXA 1BSIA 1Q4NX 3WO8A 3IJ6A 2VCDA 3LZ3A 3SDOA 1YE4A 4TW6A 3PF3A 4AX7A 3GVGA 4ZVJA 2PTZA 4L4OA 1QHPA 4JBRA 3T42A 4O17A 5AZ1A 1S2TA 2F38A 2NWSA 1KM0A 1XIFA 1EOKA 2CLPA 3THQA 3VGFA 4RDWA 4ZQRA 1KT0A 4IUGA 3I4EA 2EJ1A 3GNXA 2XG9A 1ZJBA 4GYJA 3BQ6A 1FKXA 4C1KA 1HUVA 1XLDA 3FA3A 1KW1A 5HUPA 3CHFA 1OK4A 5C2GA 1QW8A 4LVBA 2J7EA 3GE7A 2DJXA 3UA4A 1O66A 4HZMA 1JI2A 2R6OA 3O3RA 4C6KA 1PO9A 4M80A 4XKYB 3CQJA 1W2PA 2KFWA 1A5OC 1ICPA 1ICSA 3TR2A 4LYPA 3WN6A 1R46A 2FTWA 3BV7A 4V33A 3UGVA 4LANA 5LIKX 4NRRA 1W5PA 3RCNA 4MUZA 1G7VA 5DQPA 3AXMA 3BICA 4PBGA 1OFPA 4WXZA 1H5VA 2OOFA 1DIEA 1W5OA 5AECA 5CPNA 3IJ7A 4J3TA 2D2JA 5LIXX 3KM8A 3VMOA 4BJHA 1H63A 1VF8A 3NOEA 5D02A 2DEPA 3HPSA 2D0HA 4IIFA 2RDTA 3VCRA 4A22A 2VVNA 5B7YA 1I4NA 2R1KA 2ZQVA 1X97A 1LG2A 4YL2A 1CECA 5D9NA 3NL5A 2PC4A 1B4KA 5E0KA 5G4EA 3MDUA 3DHUA 4LVAA 4YMZA 3A6OA 4FO4A 2I9EA 3A4JA 4M0XA 2FFIA 4S2CA 1JAKA 4UTHA 5LYRA 3GBEA 3NRKA 3UWUA 4E2OA 2QDEA 3B06A 5G4WA 3B0UX 4TMCA 1FWSA 1WDQA 1H5YA 4FR1A 1RCOB 3VGEA 3GR7A 3WH9A 1V3LA 4UOZA 4CN6A 2G4FA 4U28A 3QPZA 5HR7A 4IQCA 1Q5MA 2CLIA 2Y24A 4NNAA 3TW9A 2OT0A 4J3XA 2DZTA 1PE1A 2QDDA 5DXYA 4PMVA 3G1RA 4M6UA 1V3KA 2C6QA 2CXGA 1YATA 3CHCA 1MUCA 4NG3A 1FKDA 3K2GA 4LYQA 2G50A 5BXRA 5A8GA 4LNYA 2E7FA 2A79A 4REQB 4O1EA 3W29A 3BPWA 4YN5A 4A2RA 5I78A 1HN1A 2ITKA 1PAMA 1OFBA 3VDAA 1EWEA 3LI1A 3P93A 2DT1A 3E49A 1XYFA 4ML4A 4ERIA 4NL1A 3WENA 3WEZA 5AYIA 1BEUA 3HO8A 2XVPA 4PCNA 2QCNA 2VMFA 4DJFC 3CL7A 2NVDA 3VK5A 1R3RA 4B3ZA 4W86A 1WOAA 5EBAA 4PSPA 3CM4A 4GABA 1THFD 1AK5A 3FHQA 5C2CA 4PMNA 3R8HA 4TTGA 2EPMX 2Z25A 4A29A 3UI4A 2P5NA 1QDSA 3WQEA 4NHVA 2ZR6A 4IPIA 3AXHA 3AI0A 1RK5A 2IPGA 3ZYZA 2PPOA 4KF1A 3NDYA 1X8FA 4JKLA 4OZOA 2OU4A 3WH0A 3G1HA 4QEHA 3NPVA 2GVEA 3BG5A 4WQ6A 3S1VA 1D8CA 5EA9A 1H7RA 2WVSA 3MJMA 3W1LA 4XD3A 2J25A 3AUJA 1X1NA 3AZSA 2VURA 5C7HA 1F76A 1ZAIA 3BVJA 4CD6A 3TW6A 1EQ3A 3PNUA 1ECEA 4WD0A 4GZEA 3VKBA 1E44A 2POZA 2WMKA 4WSKA 2O9TA 3A5FA 3NDOA 4WIWA 3C56A 3L5AA 2X2YA 3OHIA 1KNWA 3KRSA 1V6XA 3I6TA 2YA2A 2Q8XA 2VC5A 4XBKA 4Z08A 4J3ZA 2JKEA 1K70A 2QJNA 2Z1XA 1K9TA 1OWQA 1LQAA 1Q7QA 5JH2A 4K37A 4MGVA 1Q6DA 3RGTA 3NL6A 3M43A 5ABTA 3OW1A 1UD2A 1SQ7A 3QV8A 4ZS6A 2FZ9A 4K3ZA 2MUCA 3VO0A 3UFYA 2H9AA 1RBOB 4NF7A 5I09A 2J47A 4NYUA 1TJRA 1VAHA 3N18A 5H8UA 3II1A 2E68A 1N8FA 1O6IA 2O9PA 3KRZA 2YBVA 2RDXA 3PBUA 4LWWA 3G22A 4DZ3A 1DTNA 1I0BA 2OKTA 4PZVA 3TX9A 4DUOA 3ECQA 2A3HA 1O4UA 1U1HA 1UZ1A 4IG2B 4TU1A 3W6MA 1AW5A 2KX9A 4DO5A 5FF0A 3BG9A 1ZZMA 1DEDA 4C02B 1BL4A 3C0LA 1ONWA 3HIJA 3LPFA 1EEPA 5AHMA 4PULA 4JYDA 5JBEA 1MQQA 3PZIA 1AH4A 4OECA 2BBFA 3GNRA 3LBOA 3IEBA 3NM1A 2PWUA 4JFMA 1EP3A 1BQCA 1XGDA 1TWIA 3AU6A 4G1KA 4TXEA 1EJRC 1EC8A 3WD0A 3S5YA 4GZJA 3SO7A 4MAZA 3N3TA 1XGEA 4GNJA 1LRQA 4U5KA 5A6BD 3MUAA 1OFOA 3WBWA 3MQTA 4DQWA 1AH3A 4GQRA 2IS7A 2C3ZA 1XH2A 3A22A 1HFBA 3GTHA 1LT8A 2KI3A 3QJAA 2IKGA 4PN2A 1BYCA 4ROPA 3TP4A 4J3WA 4L6OA 3QYSA 3HB9A 3BO9A 1JPIA 1VLWA 3CQHA 2WOQA 3K4DA 5CBBA 1JQXA 4HHHA 2BWGA 4RL3A 3IV3A 1JZ7A 2OELA 3LGDA 3EOOA 1TA3A 3WK1A 3QVQA 4GC3A 7TIMA 4WGHA 1UIOA 1S1PA 3LUOA 2ZXAA 2POTA 3A9IA 4GO8A 1TJPA 3TUUA 3BLLA 3N17A 4O53A 2D9FA 3D47A 4PSRA 4EWND 3TSDA 2PWVA 4FLSA 5GJNA 2WSYA 3A3WA 1DWHM 5CBIA 4JFIA 2OSYA 3N2TA 1DWJM 2ZRZA 3DFNA 4GVIA 4GZ7A 1ALDA 3FJNA 2VTFA 3KHDA 2YLLA 3IGUA 3OQEA 1OFQA 1QO2A 2FPTA 4L4LA 1QXLA 1JF5A 5F2LA 3LCGA 4MNKA 1R9HA 3GKFA 3CU2A 1C7TA 3W24A 3L4UA 2JFEX 2AQVA 4I6KA 3G1SA 4ORMA 3C2FA 1KGXA 2FB2A 4PC8A 3R10A 1OYBA 1N7KA 2Q01A 1OCJA 4LBRA 2P76A 1RP9A 3TJIA 2PZNA 4WJXA 1J0ZA 1YMYA 1P6WA 3PTMA 1ME9A 1QASA 4HSOA 3V7PA 4ATDA 2ZXBA 2IPFA 1P0BA 3HGJA 3A47A 4C6JA 1DHKA 3CZLA 2XWEA 1TVLA 3G0SA 3H2NA 1XRVA 4ODOA 1G4EA 1QAPA 3LGGA 1KXHA 2PTXA 5MKGB 4UTUA 1TRIA 1JD7A 4IGSA 1FAPA 4DRHA 2WMIB 3PPGA 4AZ5A 3WD1A 3UWZA 5LNRA 4JIQA 3L9CA 5JUVA 1QK0A 1RQEA 4JFTA 4GYPC 1PS9A 3T44A 1GKPA 2XH0A 5JXQA 5FJIA 4OOZA 2PURA 4CUCA 2XN1A 2PU1A 2BY3A 2D0GA 1TUFA 2YA1A 1H7PA 3I3BA 3UBPC 4QLJA 2VGGA 3HU7A 2CZFA 1NIUA 1JVWA 4WX2A 1ZB5A 1RLCL 2LJ4A 1QPRA 3W6YA 2PB1A 5A2BA 4KQNA 3PSVA 1G7UA 4KKXA 3T05A 2PDPA 3D6NA 1ONRA 1S2CA 4GYPA 2FJUB 3W27A 3GVQA 3PRDA 3RHGA 4MYAA 4RKAA 3VC6A 5CZ0A 3E96A 5CSSA 1LUCA 3MMDA 2BOFX 4ZE5A 4JIPA 3EX3A 3E12A 4UBPC 1W37A 2WSRA 2Z0IA 1NFGA 5DRIA 2A3CA 1YHTA 4DZ5A 2ZXDA 4CU7A 1XLFA 2QGYA 1AW1A 4PBFA 1FQ0A 1I6NA 2GVJA 3M41A 3QLDA 5LHEA 3EEGA 4ONVA 4V27A 4HB7A 1JZ6A 3VCCA 1LBLA 1Q45A 1RQBA 3GDBA 3ZFHA 3FA4A 1R6WA 4PTDA 2OLAA 3VNMA 2R8WA 1K7EA 1SJBA 5G2WA 2FVMA 4WKFA 2DIKA 1TE6A 1OFDA 4UQDA 4O11A 4UTFA 5A2AA 3TFXA 5CGQA 5HPCA 2Y61A 4Q7IA 4R7OA 2BY1A 2ZUMA 1EX5A 2VT0A 1Q6LA 4HK5A 4DRNA 2ZICA 2PA6A 3OP2A 3QQWA 4FOUA 3P0XA 5XIAA 3S0CA 1JG9A 3LCIA 4CQ9A 4RNJA 4GYKA 1I60A 2KGJA 5B8IC 3ALFA 1TO3A 2JE8A 3DG7A 4M56A 1JDAA 1EJTC 1GHRA 2DZBA 2BY2A 3BE7A 2CZDA 1UIPA 3W02A 3CUZA 4JEQA 1B3XA 1ELSA 1XYBA 1W5MA 2DORA 2P10A 2ZZ3A 3WQOA 1XLAA 1VPXA 2WNZA 1F8AB 4EPDC 4FNPA 1ZFJA 4YIWA 1TJ1A 2X7VA 4LEFA 3RX3A 3EYPA 1XLIA 2YDAA 2VX7A 3VKJA 3ARYA 1OF6A 3A4WA 2ON3A 3T8LA 3UQAA 4L4PA 2YCJA 2KZHA 3LY0A 8XIAA 1I2NA 1NQKA 1FWHC 5FEPA 3BOXA 2OJPA 2FLIA 3VYLA 2X1UA 4ERAA 3SN4A 3U5YA 1MO0A 4M7TA 3LM7A 2C0AA 2OYMA 4R9OA 4UMCA 1H7OA 4MSPA 2Y89A 1XS2A 2WBKA 2OYKA 2VUNA 1V02A 3WLNA 3WNNA 3U57A 4AHPA 2OQHA 4N6FA 3BAXA 1HKJA 5D9MA 1UUQA 2Y7FA 4ZZ9A 1DXIA 3SGZA 3LK6A 2ALRA 4PTXA 3NSMA 4K1GA 3E0IA 2E77A 1VYPX 3ORWA 4M6PA 2DT3A 1JUBA 1XIGA 4E3VA 2I14A 3PZMA 1XLLA 1JL8A 3KZPA 2E1DA 2Z1BA 3VKDA 2QUVA 1R8LA 3L5MA 3QF0A 1SZGA 2PDYA 4C1NB 4F0MA 1R0MA 3CS2A 3S8HA 3UWWA 4LQ1A 4KEUA 3ZIZA 3L21A 2ZC1A 3S6TA 3NQ7A 1LDCA 4EKJA 1RBAA 4R9XA 3V1PA 1QTWA 1PTGA 3VFCA 4ZODA 1IXPA 1YDYA 1JF6A 3GXPA 3FVDA 1K8ZA 3R1ZA 4LTSA 5HDRA 3SURA 5IFPA 3KXQA 4LX4A 3CZGA 4GBUA 1JZ2A 2FZMA 4JTUA 4MWAE 3E2QA 3W7JA 4LB4A 2F23A 3ABQA 4BQ2A 3GK0A 3FDGA 4ALDA 4ZA0A 2XU2A 2MLXA 3KL5A 3W7DA 5I7GA 1BVWA 2Y5JA 1ODZA 5LA2A 4N4PA 2FPYA 3GHUA 2B7OA 3NFUA 4BEUA 1TMHA 2YDSA 3BGJA 2HVNA 4K6AA 4Z0JA 3V0UA 4WR3A 1FWEC 3R89A 3P8JA 1TPFA 2PBCA 3WYZA 1VHNA 4FLOA 1LRTA 3SEPA 2YXGA 4XISA 1EUNA 3MSYA 3MBFA 1POJA 3POHA 2UY3A 4MIMA 4JCMA 2V2DA 4LVFA 3TQ0A 3SN1A 1Q8AA 4QLLA 4Z2IA 2HXUA 2NT1A 1LP6A 4DXXA 2ACQA 2GGIA 4HU4A 1VKFA 1D3CA 1RUSA 2Q02A 1HXJA 1FH8A 5DY2A 3S1WA 3U3HA 2FMOA 4XAGA 1B4EA 3NPUA 1IX5A 4TX9A 1ZY9A 5D2WA 4GFIA 3PZNA 2NQ9A 4H1ZA 2CITA 3HMCA 3FJ6A 2TMDA 1J4HA 2PDHA 1E43A 3TWBA 2PS2A 1XX1A 3CUHA 2PCQA 4ZQOA 1J4EA 4Q8UA 1PBKA 4FPSA 2E4TA 3PZQA 5DY3A 1TSIA 5E70A 4ZBCA 3AOFA 4JTHA 2WMHA 1S5NA 4IJCA 4Q3MA 5ECVA 2X30A 4JQAA 2ZX9A 1VP5A 4MOZA 5FJRA 2DUAA 3BCFA 2OXNA 4CKQA 1FHDA 1ZJAA 1J96A 3D3AA 2DZPA 3S47A 3S2MA 1F4HA 5A1AA 1IGSA 3WSUA 4IGNA 2O56A 4TTUA 2Y1HA 3AXXA 3C8FA 4ZB5A 1N1AA 4UZSA 3CIWA 4TQTA 1MNZA 3N6HA 1NDWA 3FX4A 3REQA 3F2BA 3SIZA 4PB3A 3UD6A 4P8XA 4HNTA 4YPJA 5FF7A 4IGMA 4CNSA 5JU6A 1E6RA 4CVUA 1WKDA 3H54A 7A3HA 4BR1A 2D3NA 1ZLPA 4N9BA 2V3FA 3RM4A 1A53A 1LLZA 1XISA 1QFEA 1HKKA 1A4MA 1BHGA 3KOZA 2ESCA 2C1IA 3O5FA 4IQDA 4RDYA 2E5DA 3KOYA 3ES7A 4DJEC 1JVNA 4KESA 5CJMA 4PL2A 5D03A 4DJDC 4I7VA 4GIRA 1XSJA 1DJGA 4DELA 4MMWA 1JFHA 4J27A 5CCZA 5DMNA 4NAEB 5T8GA 3QHMA 2QCDA 2OO6A 3CTTA 3RFAA 1PZ3A 1O68A 3GPKA 4CQDA 1YXYA 2GJRA 1LTDA 3BMXA 1KD0A 4MZ1A 1CGXA 2WZHA 1KFLA 3HPXA 1NP0A 3AS0A 4XBSA 1UWSA 2ABBA 1Q7ZA 1XL9A 1LG1A 2OZ0A 2DGAA 5A8OA 1P6BA 1F6PA 5HPOA 2CETA 3OLGA 3WQPA 3CUJA 3ZR4A 1Y65A 2D20A 3KEHA 4S3BA 1VPYA 2B7NA 4AZ6A 3KBVA 5FKYA 2V63A 4ACYA 2XIJA 1O5KA 1LQ0A 5J6EA 4JY8A 3AZRA 1B90A 4S3GA 1FWBC 3AHXA 2FZNA 3CLWA 4FSAA 3QY6A 4XAFA 1D7KA 4J2PA 1EKOA 4JNMA 3QR0A 3WLHA 4LV4A 1G69A 3PUDA 3GQYA 1J8VA 1L2QA 1RCXB 2WPBA 4J3SA 1DVJA 1LF1A 3H9RB 3FEQA 1GZJA 2Y2WA 4F0HA 1HJUA 4GUHA 2HE5A 1NWTA 1TQXA 1NDZA 1ZP4A 1QUMA 3VI2A 2REQA 1H51A 2HRWA 4K7YA 4MDPA 2NV9A 5HXMA 2Z1VA 5E0CA 3CGNA 2J78A 2OZTA 1TRDA 3VIIA 3W7NA 5FESA 1XLCA 1UA7A 2V30A 3K8MA 5DRCA 1MQRA 4NU7A 3NSNA 5D75A 4ZE4A 2ABAA 3WJWA 3F5KA 5IDZA 1FWJC 2Z24A 3LM3A 2QPXA 1M7OA 1GRJA 1FDJA 4U10A 3TC5A 4D6JA 2ZTJA 3FS2A 4NI3A 1BPLB 1KXTA 4D6GA 4IIEA 5EPDA 3PBWA 3RM9A 5DO8A 4LUJA 5K9CA 3ONCA 1NSJA 2HPIA 5FOOA 2Y63A 4LXFA 1CLXA 4IIHA 4AZHA 4MYXA 2VZUA 3I7QA 4I5XA 2HZGA 4W85A 3IV8A 4FX7A 3FDKA 4DX3A 1O60A 4MLRA 1KCKA 5C71A 1UR0A 1EQPA 3BLFA 4NKCA 4DI9A 4DRKA 3VDCA 3SQMA 1X98A 2AWGA 3GW3A 3VM7A 2B81A 1IGWA 3MW7A 2A0NA 3TQVA 2NQJA 5I23A 3MT1A 3W1XA 2Q8LA 4XB3A 2QJHA 4PUUA 5CC5A 3VFLA 2G8ZA 3DH7A 3VZYA 2XTKA 2Y8UA 2BOGX 1RD6A 1TUXA 4GG9A 4HTYA 2CHOA 1CB7B 3ZSTA 4M81A 1VEPA 4O1FA 4DHGA 2KAUC 4TIMA 4AZIA 3JU2A 2DG9A 2PPPA 1RAKA 3T55A 3B40A 3BDKA 1M03A 2VR2A 4EPKA 2JKAA 2ACUA 3MA8A 1V79A 3A9BA 3STEA 4GOAA 1BTMA 3APTA 4D2JA 2V68A 2GVYA 4RV8A 2OX4A 3OBEA 3G1VA 4W84A 1CZ1A 3NO3A 2HDJA 4ICCX 4HPGA 4S3DA 4E38A 3QY8A 1Q6HA 6XIAA 1PVNA 1GYMA 2NXHA 1EJXC 2IKHA 3RPMA 1GVSA 4PMZA 3IK2A 4ASTA 2E28A 1CXHA 4LAVA 4FIRA 4QJ3B 3E2VA 1TX2A 1W54A 2CU0A 4MADA 5F2IA 3GIYA 4WZHA 4GPNA 3W7OA 4JHOA 3EAUA 1MQPA 2JF6A 4JYEA 2QVHA 1NOWA 2ZKMX 2AL2B 4HYWA 1S46A 5I00A 2H8ZA 1UG6A 3OA3A 4Q4QA 3NA8A 3U2CA 3W9ZA 3RPDA 3UPMA 5LIWX 4XVEA 4ENLA 3CZJA 2EBNA 1GOOA 4JQ1A 2G97A 1FKWA 2WMGA 4S3CA 5CGTA 3QLLA 2W4XA 5JBFA 1LL4A 5TNVA 1HXVA 3GH5A 2X1TA 5AHFA 2PODA 3NM3A 3HURA 5LSMA 2QS8A 3EX2A 3U0HA 4AVOA 3WDPP 1IR1A 3AIRA 3L0KA 1TWWA 6ENLA 3CMGA 3NQAA 5EGRA 5L9FA 2RDUA 3AFBA 1VGAA 4JTGA 3R0DA 2QCMA 3UY8A 2F21A 1BAGA 3QM3A 3WQ4A 2VFHA 2W5FA 5FD0A 2QMKA 3SM0A 4GYFA 2Y4SA 3NYZA 1YIXA 3KAGA 5HA7A 1A7XA 5A2CA 1UC5A 5MF5A 2ASHA 3BLEA 1O5QA 1OIFA 1MNSA 1POKA 5C8BB 3C2YA 1E56A 3GHRA 1JNTA 1V77A 3FYOA 4F0LA 3WUFA 5I02A 3DBPA 1ADOA 1Q6GA 1BVNP 1E6QM 1UW9A 3VGHA 4C6BA 3RDKA 1FH7A 5G1TA 4HMDA 1YYAA 3KAFA 1GTEA 4A2SA 1XDJA 3T9PA 2AGKA 3TCSA 2GVLA 4R3UA 2VDGA 2V81A 3M0ZA 2PPGA 1IT0A 3MWAA 1V3MA 4JTSA 1KFJA 1KBKA 4LVGA 4UNLA 1E71M 2FB3A 1QW7A 1XLGA 3FAPA 2BNJA 3EMZA 3IIPA 4GZIA 3IGXA 1EJSC 4GJJA 3RMJA 1XCFA 1KRAC 4R0XA 2ZX7A 4JTRA 1GZ1A 4MAVA 2OGYA 3MUIA 1W1YA 3HBLA 3OLDA 3SY1A 2V5JA 1IXNA 3SCOA 3GXIA 2CZVA 1U5JA 3ANUA 3PAJA 1CXKA 3ITLA 3KLKA 4Z2KA 5HMFA 3GH4A 3WJXA 2PDQA 5CH9A 2UZ9A 4E3TA 1XPYA 4MG4A 2YL5A 3OBKA 2SFPA 4X9SA 2PDBA 2ZUWA 3T8QA 4BEQA 4UTKA 2NUXA 3G24A 5HR6A 1K9FA 4JDBA 3G8EA 4JFVA 4ZFMA 3C2RA 4K68A 4QNWA 3MSGA 4AYSA 2V3EA 4BF7A 2WZTA 1WAWA 3LXBA 3EX1A 4XZWA 5GPRA 1U30A 5LIUX 3RLGA 4UQBA 1I0DA 3LG3A 3S9ZA 3O5IA 3TQPA 1YE6A 3VU2A 3GVVA 4OWGA 2OSWA 5BYWA 4UB9A 2E6DA 3SECA 4GH3A 2ZUTA 2WKLA 3GC2A 4MJMA 4F9JA 3QV6A 5A6LA 3VKCA 1JDCA 2H3DA 2PSNA 3UJSA 4PTMA 3USZA 1DBTA 3TN6A 1B6CA 3MCNA 4B5NA 3H26A 1Q6RA 4DJED 3W7LA 1VFUA 4MJ2A 2Y8KA 1T0OA 1W3JA 2QAFA 2E9MA 3STPA 3IUHA 3H70A 1NELA 5BWFA 6A3HA 2WCGA 1JPHA 1F7BA 4DRMA 3S46A 1VCGA 1VEOA 4TVUA 5IXEA 2XP3A 3EA3A 1L6FA 3NTYA 4EAMA 1R85A 3DUGA 1UKTA 3GYCA 1M6JA 4HOZA 4N19A 3VKKA 4YVVA 4M7SA 4GVFA 3WF2A 3WBEA 4FX8A 1ICQA 1EO7A 4B3KA 3SY5A 2LKNA 1CXEA 3NZRA 1KM3A 1X7FA 4ODLA 3IARA 1GK8A 1NWSA 3TEVA 2M08A 4KCVA 3NL3A 4OUIA 3TTOA 3KHJA 1XINA 2XUCA 4KFNA 3SI9A 2PPNA 2V5LA 1NF0A 1XLJA 4IISA 3DXIA 4Q4MA 1Y0EA 2QPSA 2XSAA 1EGMA 3U7VA 4OFCA 2OQLA 3HGSA 1A80A 3PPFA 3MY9A 3QV9A 2WZMA 3UCQA 4N9EA 4S3EA 1OY0A 2OX1A 5JH8A 3R4IA 1PKNA 4Q4SA 3NZGA 1RH9A 2GSJA 3V36A 3VOCA 5BWAA 1LBFA 4Z2JA 3EWYA 3T0AA 1PZ2A 1DIDA 3VAWA 1VJIA 4FN2A 1RY0A 2D23A 1CXLA 2WJEA 3DFQA 3SJ3A 3WLSA 1QPFA 2XP8A 3R8GA 3MI6A 4US5A 3HV8A 3BGGA 1PHWA 4PL1A 1JYNA 1J01A 4XWUA 4Z1BA 2DZAA 1OZQA 1G01A 1Z89A 2OTDA 1ZQ5A 3BTNA 5D2TA 3VNDA 1HF6A 3RIKA 3Q94A 4O57A 3GZAA 3CAVA 4FHAA 4DBDA 1GOQA 5TQLA 2C8NA 1VEMA 4LV9A 3NURA 4KFOA 1KFKA 4B3LA 4F4RA 5FF4A 2WNNA 1E0UA 1GWJA 1WO2A 1B3OA 8CGTA 1QI5A 2NX1A 1R2SA 1JDDA 1EPVA 4LY4A 2X1RA 1FHUA 5ENLA 2XIIA 1H3GA 5KZEA 4QTGA 3SCVA 2W91A 3ZOAA 2Y8VA 4X63A 4A3YA 3C6CA 4ECLA 1FCQA 3HM7A 5JVLA 3VABA 3AMDA 3TONA 4JFJA 3KDNA 4UNKA 4WF7A 5AC4A 2XVGA 3UG8A 1TYGA 3IJDA 2P8BA 1W3NA 4HNCA 3VCNA 1TV3A 4G2DA 1ZBKA 7TAAA 4O8RA 4ACZB 1OT2A 3NXLA 4QRNA 2I16A 2Y0FA 2I5IA 3RUBL 2JIWA 1KFBA 2FYMA 2P53A 5LNUA 2QIWA 3UG5A 4HVXA 1JRBA 1WUFA 2ONEA 1KFCA 1PBGA 4LAUA 2PGWA 3NWRA 4DUXA 1PKYA 4H6RA 4MVAA 4EVZA 1SYTA 3THDA 4MB5A 1V8EA 4JTLA 4YS1A 2EPLX 4R34A 5FF2A 4LGXA 1XRTA 3QYQA 2VCBA 2ALDA 1EWDA 3R79A 2OCZA 3UI5A 3IAPA 5E9AA 4B4FA 2G0WA 3K4AA 2PTYA 2GUBA 2ZX6A 3BLKA 4W9TA 1TPH1 1Q1CA 1AD1A 1CGUA 5JQ9A 3ZLHA 1HJQA 1H61A 4ZB2A 2C71A 5F1VA 1MI3A 1WZAA 4AHQA 3ARTA 4M3PA 1YPXA 3DGBA 2ZQTA 2CHNA 5J8LA 3RU8X 1WPCA 1SFSA 1EP1A 3LEPA 3QR3A 3W1NA 4B16A 3BZJA 2QF8A 3RCYA 3CMJA 4AVFA 2WHMA 3VIFA 1MUWA 4QE1A 3KACA 5E1QA 5BU6A 5A6TC 3HA1A 1UKQA 3O5PA 3RX2A 3IKDA 3W1UA 2X40A 1JDEA 1TPC1 3SUUA 3MHUA 1RR2A 3R7MA 1H0GA 4IT6A 2NVCA 3L68A 3OG2A 4E4FA 4PMRA 1JYXA 3O9NA 1XR2A 2OT1A 4J2MA 3GS6A 1NMWA 3XIMA 4HJFA 5DF0A 3W2UA 1AW2A 1V5XA 2BGSA 3MJYA 5K3VA 1VFFA 5F4WA 4QHRA 3EY6A 3SFWA 4UQAA 2Y5EA 1TWZA 2EHHA 2OLHA 1XDMA 3VXGA 3LZ5A 5EBUA 1S5TA 1HVXA 4PRWA 2ICSA 4CQAA 3CAQA 3IK4A 2YBTA 3WNPA 1W17A 3A5VA 3P3BA 3I6CA 1QPQA 1SO6A 4AZCA 2VDIA 1V6TA 3BAWA 5FSEC 1EIBA 4GXWA 2WLYA 5G2IA 3ATYA 3VNJA 3VUPA 2VX6A 2HJPA 2HVOA 1A3WA 2UY4A 3E2SA 4J40A 5BRPA 4CN1A 4HA3A 1DWGM 5F1UA 1YRRA 3SBFA 4GUIA 2XDFA 3KAIA 4QS6A 3KL0A 3SQSA 1W5NA 2NQ5A 4DVOA 2AKMA 1ZALA 4DF1A 2XISA 3D46A 8XIMA 3DENA 3USBA 4S38A 4DLMA 4MB4A 4HT3A 5CEWA 4MKVA 2BMBA 5ABFA 1GOIA 3MMUA 2VHLA 2IF4A 1SW3A 2BP1A 4FF7A 4GO9A 2ZA3A 4GUJA 1WAUA 4D1JA 2Q3OA 3S5OA 2E8YA 4CD8A 3QKZA 4CEUC 3WJYA 1BXCA 2VXNA 4U5IA 4Z17A 4Q33A 2J7HA 4QM1A 1T40A 5CZKA 1BWKA 3PTKA 1U83A 3M5YA 3GNNA 3FVMA 1HJVA 1HO1A 4UMAA 1Q2SA 2XP6A 4YJ5A 4KGLA 1S3TC 1W9XA 1XIEA 5DCBA 1F5ZA 2OWCA 2ISVA 3WD3A 3FCPA 4C7FA 5A69A 2VFEA 1UOKA 3CGMA 3DDMA 2XFWA 3B9EA 4O8AA 2HNEA 2Z7KA 2WSKA 3SRFA 1JZ5A 4C5YA 3LBCA 4RZ4A 4D6DA 3FLUA 2J6XA 1HTIA 2PDIA 3ATZA 4Y7EA 3PVFA 2PV1A 4EE9A 3BW2A 3KW3A 3SCTA 1QMLA 7REQB 3SGGA 3F4CA 4ODKA 2A3BA 2QCHA 3MYOA 4KWWA 4IPJA 4S3KA 3GR4A 4OJYA 4UFIA 2CBIA 4RE0A 2QT3A 2XPAA 2VOMA 3H12A 3IS4A 4GUFA 4UTIA 1WXJA 2E9LA 4AMCA 3A3XA 4BF8A 1FCVA 1J6PA 5I5RA 2OO0A 1T41A 1GKQA 2PFHA 4IIBA 4LFYA 1CI1A 1ECQA 2XFRA 4C60A 3NQDA 2DG4A 3RPTA 3W4RA 4I5RA 2A6NA 3R8RA 5FJTA 1C7SA 1UQYA 4GI6A 3T81A 2J7CA 3B0YA 3NQFA 4L80A 1DOSA 3CPUA 5DT5A 3UY7A 5DCEA 2IQTA 4KIEA 5IDIA 1FY6A 2IUZA 4IIGA 4D71A 3G3DA 3S6OA 2ZQ0A 4I90A 4IPPA 1YLVA 4QAIA 4Q8WA 4GY7A 3VDBA 4X60A 1CLVA 3W7QA 3I65A 3LLDA 1I45A 5FEWA 3TXZA 2ZE0A 2R1NA 1E1CB 2DIEA 1VD6A 4HZ6A 1Z6KA 1JD9A 3GH7A 2GJXA 4QX4A 1LWIA 3V0SA 3GDTA 1ZCOA 3UF9A 3AYRA 3HG5A 5AB3A 4XG1A 1M3UA 4V1YA 5J04A 2PRLA 4B5VA 3WNKA 1TKKA 3M46A 1XH0A 4QXIA 4RV3A 4KERA 4HARA 3NIYA 4HBOA 4JTJA 3JXVA 2VM8A 3G3MA 3WLIA 1YX1A 1X1OA 3LPPA 3CYVA 3VNIA 3RLVA 2CWXA 4KMQA 3TKFA 3W0KA 4GVHA 2TPSA 3P84A 4IXHA 2C91A 2BVYA 3UG4A 2QHAA 3W7RA 3IHZA 3GFZA 2R91A 4PUWA 3S2NA 3W2MA 1T8QA 5DMMA 1ISZA 1EJWC 5CJ5A 4P8WA 3KTSA 3HFTA 1MWOA 3ERPA 1VJZA 3UP8A 5AKQA 5C9ZA 2EPNA 5EMMA 4ZOAA 3WUGA 3GVRA 1YW1A 4AIBA 3DCPA 1G9HA 4E8CA 3O5MA 4MTVA 1Q6OA 3PUGA 3O5LA 3RR4A 3DYMA 4H9XA 3SRHA 5E9XA 2VEMA 2KE0A 4I5UA 3HJEA 4ZQMA 1Q4WA 1I2RA 1QOXA 3EDDA 1UP0A 6REQA 2GQ9A 3O5JA 4ODQA 4X22A 3KCJA 3WNLA 4U86A 2OSXA 4YTTA 3RM8A 2WJZA 2QYGA 1G0CA 2GUYA 3OZMA 2BTMA 4HZ8A 3CZKA 4ADUA 5DBUA 1W1IE 3TTEA 3F4NA 4O16A 3BC9A 3BAYA 4A3HA 2FH6A 4RNHA 1VYRA 4K8HA 3MB9A 4ZOCA 2QUMA 3DKLA 1E5NA 4QG6A 3QGKC 3N2CA 1DWAM 2Z4GA 2W67A 1YPIA 3CWNA 4FMVA 2IXVA 4GINA 4O0ZA 3GG1A 8RUCA 2F2KA 2X1SA 3CEUA 4S23A 2J4GA 3H2EA 2MLYA 3PJTA 3WLJA 2V2CA 1QOPA 3IVTA 1D9EA 1JYWA 1A50A 3U6WA 4Q8PA 3TAKA 1B5TA 3DI1A 3W86A 4V15A 4B15A 2ZRYA 4OTKA 2WQDA 3RR1A 3E0FA 3DFSA 3MKCA 4YTQA 2OMAA 1R86A 4CD5A 4YYFA 4L9XA 2Q09A 1OYAA 3S5SA 4GCXA 3E1F1 1QNVA 2G95A 3HZ3A 2HK0A 3DFPA 3VD3A 2BSLA 4BI6A 5C9XA 3U4AA 4LCQA 3CHDA 2HISA 2YOCA 1FJDA 2XVNA 3FAXA 3RRXA 1R2RA 4RK8A 3BW4A 1HW6A 1UJQA 2CBUA 3BSMA 3WNMA 3WQWA 2V9DA 5D8ZA 3DX5A 2HWGA 2YXOA 4DNMA 1JAEA 1WE5A 2ZRUA 1VFTA 1J2WA 1QNPA 1CGYA 2C79A 5HT1A 2XN2A 2QXWA 5F2GA 3WL1A 3TLQA 4UCFA 4GE8A 2WK2A 4GX9A 4Q7NA 1DJWA 3AHTA 4ZOEA 4ZTYA 2OVLA 5D4YA 3PP7A 1DL3A 3B8TA 5HWMA 3LLFA 1VENA 1ZP3A 3KVLA 3L5LA 2CESA 5EMKA 1Y0OA 2F7FA 1KFEA 1PZ0A 3U7BA 1S2WA 3WLPA 3WBXA 3UJRA 4HNUA 3ZJ8A 1NQ6A 1EBHA 1OIMA 3O0KA 5G5IA 1W32A 4UFMA 4HMCA 1C91A 3NI6A 3WK0A 3GIQA 4HU0A 1RJQA 3QQ0A 4HHLA 4OKDA 5HTGA 1IT7A 3K30A 4JQ4A 4WY0B 2W27A 3UG3A 1ZK6A 3IJIA 5M1TA 3HPAA 3UYCA 1O1HA 2INZA 5D30A 4AU0A 4NJIA 5DIUA 4B5TA 3KP1A 1GOWA 2ZYFA 1NOFA 1GQIA 4W88A 2CLLA 2DDXA 4KWSA 4JAWA 2HNHA 5F7UA 4KW2A 1P4CA 3BV4A 3KADA 3H2FA 3MKKA 3RK8A 1VQTA 3TH6A 2HXTA 4AZBA 4RCXA 3GHTA 4O12A 3O06A 2PP3A 1MXGA 1YNPA 2HE8A 4CNUA 3FJ4A 4D6EA 4L7ZA 2FQIA 3V4BA 4U3AA 4LYRA 3N04A 1TPUA 2VEPA 4XAPA 2E5CA 3LUTA 4TO8A 4OBRA 3RG6A 4N7QA 3UXLA 3VGDA 5A6AA 1DQUA 3VNZA 1AH0A 4PTVA 2VRKA 1UB3A 5HNUA 3SJNA 4GQQA 4JFLA 4PYSA 1FFQA 2PAJA 1D7HA 4E2BA 3UERA 3UQIA 4Y2WA 3C2EA 4DRQA 1KBIA 1WX0A 1A49A 4KS0A 1JNSA 4PTNA 1QI0A 3S9IA 4P8UA 4H9ZA 1E15A 4QS5A 1WXZA 3CYJA 2GQ8A 4DUWA 3TK7A 3PZTA 1E4NA 4LCRA 2E67A 4IMDA 4K8EA 1QNQA 3TOPA 1LQ2A 1EXPA 1SPQA 2X0HA 4DBWA 3OVPA 1GG0A 4GFSA 1WUEA 5GNYA 2GPTA 2AAMA 1UMYA 3NNTA 3N4AA 1LJYA 2WC4A 1OX4B 3WD4A 3QZEA 5BW6A 4Y96A 4Z2LA 3W2JA 4Q6JA 3PULA 4CQ8A 3MHGA 4MWAC 1CNVA 1BVZA 2JBMA 3RAOA 2QZRA 3VNKA 4H7CA 4C6CA 2MLZA 4KIRA 1JI1A 2FVLA 1UWQA 4QNEA 5CZTA 5ABFB 4JIEA 1XLKA 3A4AA 3VIMA 2NLIA 3ODKA 4IL0A 2DU2A 5H8MA 1GEQA 3ABRA 4G1NA 1XSIA 3HTWA 3N29A 1B9ZA 3ZO9A 3EDEA 1V03A 3UF8A 1W9UA 3L4ZA 1Q66A 4IUOA 4GQ0A 4UTTA 2RQSA 1VPQA 4IMEA 3SZ8A 5HW6A 4L65A 3ITCA 1FWIC 1JCMP 4DI8A 4XBJA 4O4WA 1LT7A 1JJKA 3AISA 3G18A 2XVLA 1KRBC 4HN8A 3R2GA 1WDWA 4QBXA 1NU5A 1B57A 1X39A 2BX7A 5CC6A 3IUIA 1W0MA 2OB3A 4PBEA 4FXFA 3GHSA 4U3CA 1UKOA 3FJLA 3NO5A 3S6DA 4IOTA 4H7ZA 5LZLA 2EO7A 1XLHA 4JNYA 3S3GA 1GONA 4UWMA 1WDDA 2RJHA 2PLCA 2CERA 1MXSA 1Q6CA 3NEVA 5REQA 1A5MC 1EYWA 4W5ZA 5AFDA 3PFMA 1KQZA 1CX9A 5EY5A 1UBPC 3C3NA 4WDXA 3H7VA 3LTSA 2R9RA 3CGTA 1IQ8A 3SSZA 4FAMA 1OYCA 3RLHA 4AZCB 3CNYA 1FDZA 3GUWA 3AIWA 4P61A 1OG0A 1UOZA 3VOJA 1FA2A 1QZ2A 1YTDA 4TW8A 1EZ2A 1P7TA 4IP4A 2TRSA 3FV9A 2OKOA 3H2OA 4CNTA 2WYSA 3NL2A 4LOCA 3S9YA 3V0TA 3B8VA 4YXGA 1TQJA 1XUZA 4W8BA 2V38A 5A94A 3HOJA 3BCJA 4B91A 2P4VA 4H2CA 3VAVA 1EJVC 3AS2A 1IEWA 3WLQA 5TIMA 3KS5A 4KRUA 5CQ1A 3ZLFA 4ZFCA 5IRPA 2VD9A 2E25A 3V16A 1CPUA 1EH9A 5FCZA 4A8IA 1QR7A 3MDYB 3LRLA 3ARPA 1XIHA 1KCXA 1MEIA 4RX0A 1XP3A 1XIDA 1SR9A 3QSTA 3EXSA 4RUBA 3M6YA 4I9JA 3SCPA 3TYDA 3WDQA 4JOMA 1LCOA 3LRMA 2GYIA 5CC7A 4FNQA 4Q8VA 3PR2A 1W3LA 4H2HA 1KR1A 3WQCA 4QSHA 2ZQSA 3UW6A 2UY2A 2DZSA 4NJJA 3U48A 1MFVA 1WCGA 3E3HA 3G1YA 4K36A 1SZNA 3F5LA 3M5ZA 1BKHA 2XINA 1ZNNA 4NYYA 1LYXA 1V0NA 5CXPA 3MYPA 2TAAA 1CGTA 1LOLA 5A8MA 1GGOA 4JN6A 3VD4A 3MBDA 1PPIA 5EMUA 3PR9A 3DC0A 5T91A 1R38A 4HPNA 4MNLA 3PBVA 4NJGA 1WYIA 2F2DA 2P50A 4EOUA 3L2LA 4QGCA 4JTCA 1MXDA 3K5XA 3WFLA 1PUDA 3OJGA 1Y8BA 3EDFA 2V69A 4NZ1A 3LD5A 2VVSA 2EG8A 2JZVA 3NOYA 4WCJA 2BXVA 2YL8A 1B3VA 2WJDA 1W5QA 1L8NA 4GIYA 4C6FA 1E4MM 3WLOA 3B05A 3CWHA 1VFLA 1E1CA 2C19A 1GVFA 3LCFA 4IWWA 1XIMA 4C6DA 4UOQA 4BK9A 3ARQA 3LXCA 4EP8C 3ARUA 2IQ0A 3M9YA 1M5YA 5AYZA 1CXFA 2WVTA 1OHLA 1IEVA 4I9MA 4LU0A 2V2HA 1A0CA 4BFAA 1V08A 1ZSXA 3QW4B 2ZR5A 4Q4PA 2RSEA 2WC3A 3U2OA 4J9JA 2EGZA 2HBVA 1EHAA 4DBEA 1KKRA 4H6QA 3TVAA 2NXIA 2BODX 3LSCA 4M1RA 4PR4A 4F0SA 3LCXA 5FL0A 3MO4A 5I3KA 3PPCA 1PX4A 2VJXA 4MHBA 3L7RA 4MPQA 2RGMA 3SFKA 5A5WA 2Z27A 2DH3A 1AQ0A 4YVXA 1W56A 4RR4A 1Z8AA 1HNYA 4US5D 4MWAD 2I5GA 5LIYX 4PCTA 3CPRA 1PWLA 1LORA 2W61A 3A13A 3TC3A 1XGZA 3GZ3A 3O5OA 2PLKA 1OJXA 2G3MA 5D04C 2Z29A 3VDHA 2GVGA 3T7VA 3SCQA 4WOZA 3VMPA 3CQ0A 1DKWA 2D2HA 3BLPX 4PCSA 4A8NA 2J6VA 2ZZ5A 3RXZA 1F74A 4AD1A 4J4NA 5JBDA 4F79A 1VH7A 3F2DA 1TTQA 1H7NA 1UC4A 1KCZA 5I98A 2Y88A 3JZEA 2PDXA 2QCLA 4PUEA 3RX4A 1DPMA 3M0YA 4X2RA 2NVAA 1OFRA 2QDGA 4DIAA 5CLWA 4CQBA 4R85A 1NMVA 1QK2A 1FWWA 2Z28A 3UU0A 2NX9A 2ZOXA 1WXYA 2MNTA 1Y5VA 4L1GA 2PLMA 4ZO9A 1UKPA 3JYJA 1UD8A 4CNOA 3K1DA 3DC8A 2BHZA 3EBVA 3GX9A 4YVPA 2CEQA 2VO5A 3N9SA 2X1IA 3SAZA 2ZTKA 1KC7A 4AZ7A 3STFA 4UFKA 4MNJA 1UROA 4C6IA 2C13A 1IT8A 1XXXA 2H9AB 2XN0A 3R13A 1WA3A 1XPGA 1QVBA 2XPBA 3GTIA 3HPZA 1RV8A 2YJQA 3LDVA 2YYTA 5JIPA 4PODA 1EGZA 4DY1A 1CT5A 2DUXA 5G4HC 1KBLA 1V7YA 1XLBA 3AHZA 1XYAA 4M24A 3NEHA 2A85A 1P43A 3CHVA 4PE8A 4ATLA 2J9ZA 1WZKA 4JX6A 3HQPA 3POCA 3W81A 2Z7GA 1SJCA 2DW6A 4ORIA 5C2XA 1AA1B 1ZRQA 4LBSA 3W72A 3WF4A 4W8LA 3F2CA 4L6DA 5LXXA 4P7QA 1PDZA 4LRSA 4XTDA 3M07A 4JFSA 4FALA 3TYZA 3UWVA 1JIBA 4JX5A 4RE3A 3WH6A 3B8IA 3IRSA 2GJPA 2V3DA 4XQ6A 4L72B 1HKMA 1PJ9A 2FJKA 1ZCCA 3BL3A 3SADA 3T78A 4IX2A 1C29A 4LF2A 3VIJA 5HW8A 2Y7GA 1P7TB 2FDSA 3N6QA 1R87A 3F1QA 2PD9A 1AUSL 3THAA 4E8GA 3MMTA 3OLEA 9RUBA 4O0QA 2PDKA 3ID7A 1FWGC 1Y5WA 1ROUA 4RZBA 3O0FA 1E6XM 1G6CA 4JTTA 4E8DA 3ABXA 4ICMA 1VFOA 3C52A 3QFWA 2ZZ2A 3K8LA 4IJBA 1H1YA 5AVNA 5AYYA 4ILSA 1PZ1A 5A6JA 2XIQA 4HPHA 4Q4OA 1OCNA 1RBLA 5GQBA 2YCLA 2D1ZA 4JR5A 4EWJA 3I6EA 1XYMA 4IFRA 4EPBC 4S3FA 4D6HA 3ZQ9A 1A5KC 4HCLA 2VUYA 4O52A 3G6LA 2CBVA 3UJ2A 1TB3A 1F9CA 4HK7A 2VRQA 1YDNA 1M41A 3AHYA 3O5GA 4B4HA 3Q4DA 3W7MA 1LZOA 2DZVA 2X41A 4LS0A 2BHYA 3FFSA 3P0WA 3QMRA 4ZL1A 5LHFA 3QC3A 3W2KA 1E1FA 4LAKA 4J3VA 2W79A 2QGHA 3H2AA 5BXPA 4DO4A 2Y6ZA 1M65A 3E02A 3E6EA 3URAA 1XG3A 4AH7A 4UNIA 4RJEA 4LH8A 1FKTA 5HJXA 3WELA 1WDSA 2AAAA 1MDLA 2DSUA 4GKTA 2ZE3A 2CKRA 2VENA 2FDMA 1WKFA 3H53A 3NVDA 1UH4A 3F4VA 3OYXA 3UCCA 4GGQA 1RXOB 3GIPA 1B0IA 2DZUA 2MPHA 2PV3A 4OV9A 1A5NC 3M1ZA 3CB8A 1FX6A 4FNSA 2EPHA 2YFOA 4M8UA 2XP7A 2WW5A 3P80A 2NSOA 4HA1A 1WKYA 3B0XA 5HQMA 4IQLA 1OT1A 3IJLA 3LHVA 3W01A 3HGRA 3XINA 4DIPA 2ZA1A 3W75A 4A6GA 3NGFA 2ZCGA 3VE7A 3FSTA 4HIBA 4WDUA 1GTHA 1VS1A 5J5DA 1YQ2A 2BV9A 3WQGA 2VEFA 4L1WA 3NQBA 4GNKB 2I57A 4RXGA 2FZ8A 1AMKA 3A4XA 2GUUA 1SJDA 3AUOA 2Q6ZA 4WDWA 3MUY1 4H00A 4JTAA 2XM1A 3ALGA 3PJXA 4ZSUA 1XYCA 2PGFA 3W37A 2DFAA 5DBTA 3BLOA 3UVIA 4YNGA 3ME3A 1XWYA 1K6WA 1UPPA 4GIVA 3CMFA 4N42A 5KINA 1XCWA 4L61A 4Y6GA 3ZT7A 3S2CA 1ITXA 5ABHA 2OFJA 1JEZA 1V3JA 1FCUA 4NZFA 4QQUA 4MZ8A 4ZPTR 2CWNA 1JZ3A 3T6CA 2V6AA 2EEXA 3PUOA 5GNXA 1PCKA 4O19A 3VOHA 3KBWA 1QT1A 1M04A 1KB3A 3NXFA 5HAOA 1G4TA 1F3EA 3O7UA 2GWNA 3D5HA 4Q8NA 2Y78A 1XC4A 1PHQA 1W3KA 3URNA 1TPVA 3D0CA 1SZRA 3KE0A 2PD5A 2DZWA 4BA0A 3N4FA 3ARRA 1Z48A 3NJ3A 4INFA 4E2VA 1HT6A 1KO0A 1IXOA 5HBFA 5G1MA 1J11A 1XYLA 1EC9A 5K9XA 4FNTA 1X6NA 1V6UA 2VC7A 1FP8A 3VD5A 3URQA 2R94A 3B4YA 2DV0A 4YWIA 2LPVA 3GDKA 2J8TA 4AWTA 1FDYA 3TJ4A 1N55A 3SR7A 5RUBA 1DWIM 4P7LA 2QV4A 3OZOA 5I6SA 3RJYA 1YDVA 4DLFA 2VZVA 1F05A 1PYMA 2JGYA 4P7NA 1OK6A 3P74A 4G7EB 3KS6A 4JZ5A 4DAIA 3K46A 2AQOA 3HG3A 4H19A 5A6BA 4JPGA 4UQ9A 3FY1A 4XAYA 2XP9A 2F8QA 4NVTA 3GSMA 1V6VA 3S83A 3IIZA 1Q6FA 3EB3A 2Q71A 3E0LA 5EFDA 1ONEA 4H8VA 1US3A 2ANUA 3BWWA 1H1NA 4N0RA 1AJ2A 5BOEA 1G1YA 3OQ8A 3N1AA 1ISYA 1IWBA 3BAJA 4N9CA 4DAFA 4YTUA 1QPNA 1X8CA 2J8GA 3QFEA 2Z00A 3N2BA 4ZCWA 3W1TA 4Q4RA 5I06A 2ZBTA 3P5YA 4JTQA 4D6IA 1C8XA 1XM3A 1OADA 4DWSA 5JH1A 2VGFA 3JZUA 1QHZA 4REQA 4KH2A 2CLFA 5AY7A 2O92A 4A3QA 1C92A 2YA0A 4GUGA 3B9OA 1NY1A 4JHMA 3ZSSA 3EDJA 4G6CA 3TDBA 1B30A 4EAYA 3DIPA 1Y7VA 4S1FA 3RO6A 1JYVA 3UI6A 3PTDA 1NM9A 4V28A 4AF0A 3N25A 3CASA 1A3HA 3BOLA 1W3TA 2GOKA 1CLKA 4P8VA 3GXMA 4FS9A 2XSXA 2YLAA 4D72A 4AWUA 2W0UA 3DESA 3UXKA 3LYEA 3AC0A 4Q7BA 3ZWTA 1JFXA 4AIEA 3MUCA 1XDLA 2XH2A 1DJXA 2PBGA 1WDRA 4QROA 4FF5A 3UGRA 2XGBA 1J5TA 2H6RA 1R7AA 1Q8JA 1DYSA 3ZT6A 4CN4A 1JCJA 2VFGA 1KXQA 2J62A 1WZMA 2Y85A 4LAOA 3W23A 3PBMA 2XVKA 4JN7A 4ODMA 3GO2A 3HG4A 2BHUA 3LU2A 3WG6A 4LAMA 2TSYA 2A1YA 2QEZA 1BF2A 3LCHA 1PINA 4TX8A 1HZYA 3NQCA 1QRQA 1NH6A 2CBJA 1GW9A