1HKIA

Crystal structure of human chitinase in complex with glucoallosamidin b
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
total genus 121
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkiA01
2WYSA 1JFXA 4MJ4A 1KQZA 2XM2A 3CZGA 3GH7A 3PBGA 3VMPA 2D20A 3PTMA 1GOIA 2JEPA 3SIMA 4U3CA 3RIKA 1JZ7A 1UH4A 3SUUA 1OBAA 5IHRA 1DEDA 1EDQA 3ZSSA 2WANA 5BROA 2VZVA 1WDQA 4CVWA 3WELA 1CENA 3RJYA 3EBVA 1QI3A 2OWWA 5CXPA 1XH0A 2FHFA 4D1JA 3WF2A 4XZWA 1QHOA 2WWDA 3T0DA 1JNEA 3OBAA 2WPGA 3BXWA 2BFGA 4C7DA 3WNLA 2BHUA 4AZHA 4ZXOA 2A3AA 1E6ZA 4W7WA 5LYRA 2D0FA 3W38A 1KXVA 3MUY1 4AIEA 2ZUTA 2V3DA 1K6AA 3D5HA 2V3EA 4YPJA 3AIRA 3KEHA 3SCUA 3N04A 3AMKA 2X05A 3TTSA 2XFRA 1U2YA 1GQKA 1PX3A 1Q6EA 1E43A 1UH3A 1WZAA 3BLKA 3GXFA 2PBOA 3SCVA 2CCRA 3WD2A 2EJ1A 1WO2A 1CGTA 1W3HA 4W7UA 1ODUA 2F61A 5FOOA 1L0PA 1NOFA 2XVNA 1VEPA 1ZS2A 2GJPA 5FIPA 3VIIA 1JD9A 2WSPA 3UG3A 4TXEA 3NCOA 4UFKA 4D6JA 3N1AA 3AIVA 3UR7A 4W86A 1D3CA 2PWEA 5BWFA 3HN3A 3KL5A 3PTKA 2G41A 3WQ5A 2W5FA 1BHGA 5AY7A 4GIAA 2CERA 1K9DA 4GINA 2WCSA 3BSHA 5DEZA 2CESA 4J3VA 3RO8A 2WHKA 3WUGA 5D8WA 2XPKA 1DHKA 2CBIA 3L4TA 4PRWA 1FHLA 2ZUWA 2W67A 3BC9A 3WF4A 1UQZA 3GH5A 4M56A 5FD0A 1UZ1A 2D1ZA 3G6MA 3AHYA 1LG2A 3VGEA 5I2UA 2VO5A 2DEPA 4PMQA 2Y5EA 1EXPA 1ZJAA 3AFBA 1B31A 3PN8A 1E56A 4JFWA 3PTQA 1E73M 1UWRA 1QI5A 1OIMA 2W63A 4M80A 2YL9A 2CKRA 3T2QA 4AXNA 1AQ0A 1UG6A 2CIPA 4DWSC 3PZIA 3G6LA 4QP0A 5BXSA 3W6MA 1BAGA 2QV4A 1V03A 2F2HA 2PBGA 2G3JA 2IXUA 3EMZA 3IJ9A 2TAAA 4HU8A 2O92A 2WMGA 1NWUA 4BS0A 2VNCA 2X09A 5I3DA 1EH9A 4A3HA 3QHOA 4J27A 2QHAA 1V3KA 4P8XA 4PMNA 4XV0A 3KL3A 1ZJBA 1E6SM 1Q6DA 3MKKA 5DFAA 3CGTA 2V3FA 2E4TA 1P6WA 5I6SA 4GI8A 5LA1A 1R85A 1E72M 4PMYA 1SR0A 2DIJA 1GNXA 1PBGA 4FMVA 4PTVA 3A3HA 3NSNA 3BAKA 4MAZA 1EO7A 1E5JA 4XZBA 1NWTA 5FL0A 3AIBA 3KL0A 2WZHA 5CPTA 3U5YA 4BCEA 1UUQA 3AXHA 1EDGA 5F7UA 1QI4A 2XSBA 4PSPA 3PZQA 1J10A 4PCSA 2E8YA 1EQPA 1NQ6A 3FHQA 3VGHA 4NZCA 1US2A 3ZR6A 1W1PA 1KBKA 1DTUA 2ZXQA 5E70A 4XB3A 3CLWA 4JFUA 3SCOA 1A3HA 3VGDA 3ARVA 2MANA 2YIHA 5DT7A 4DUVA 3M07A 3AXIA 1H3GA 4F9JA 1HJQA 4TTGA 3WQWA 2Y4SA 1B0IA 3AJ7A 2DT0A 1IZJA 3AS3A 3OA5A 2VVNA 1MQPA 1OGSA 3CH9A 1E0XA 3A4XA 3L4UA 5HNNA 1B9ZA 4LYQA 2ZICA 1CLXA 3K4DA 3D3AA 4DUWA 1PZ2A 2GK1B 3CO4A 3NUKA 4MAVA 4GZJA 3ZT6A 2WMFA 2Z1KA 3AHTA 1CEOA 2WVVA 1G5AA 4J3SA 1LWHA 1XH1A 5EFFA 3UETA 2HVMA 2YL5A 4TUFA 4NF7A 1HJVA 4M1RA 1HIZA 1E6PA 1CXIA 2OLHA 1WDRA 3F5JA 5GQBA 5A3HA 1UKTA 2V3GA 4EKJA 1QOXA 5I78A 1JDDA 1UA7A 4IUGA 4U5KA 4BA0A 1E55A 1KGWA 3OGRA 1FH7A 1KBBA 3LPOA 3OG2A 2FHBA 3MO4A 4FLOA 1TE1A 4WKHA 1XYZA 4WF7A 4WIWA 3VIKA 5ABHA 1LL6A 3L4XA 5A8NA 3MS8A 1JZ3A 5E9AA 3U5UA 1W9BM 2JFEX 2OSYA 2ZX9A 3WEZA 2ZX6A 5FKYA 1UQYA 2WB5A 1W2VA 4P7LA 3B9EA 2WMIA 2VURA 1TFVA 2Y8KA 3WMBA 3KWXA 2WXDM 4GKLA 3CTTA 4QAWA 3SUSA 2E8ZA 3L4VA 3L4WA 3NSMA 3WUFA 3AMCA 1GOOA 2O9PA 3WEOA 1VJZA 3MUAA 3AXXA 3AYRA 2VJXA 1VFOA 1HJSA 3WDIA 4UR9A 1HKKA 4D71A 2J7FA 3WENA 4P8UA 1E71M 5TD4A 6TAAA 3W37A 1NOWA 5I77A 3GXDA 3ZMRA 1Y7VA 2UY3A 3U7VA 3AHZA 4Q22A 1W9XA 2DSUA 4BQ2A 3SURA 1UA3A 2OSXA 1LF1A 5EMYA 4HZ8A 4EAMA 1JYVA 2FHCA 1J0ZA 2GDVA 4Z2HA 3PZGA 7A3HA 3AHVA 2D2OA 2J77A 3AISA 3WF3A 3AHXA 1JD7A 4HZ6A 1KXQA 4D6IA 1JF6A 2VZOA 2G3NA 2D0HA 3WH8A 1I75A 1WCGA 2BVDA 4TX8A 4CCEA 5C8BB 4P7OA 1FP9A 1W9DM 4ZEPA 2WAGA 2D3LA 1OB0A 5BYWA 3WBAA 2YA1A 1UKOA 2J75A 1VRXA 3A6OA 4ZE5A 3WY1A 3TTQA 1DWGM 2YJQA 2W66A 2BY1A 1IV8A 1ESWA 4OZOA 5I23A 5M03A 1H5VA 1QVBA 5CPSA 2J74A 3B9AA 4HOZA 2D3NA 4JKLA 1V6YA 1Q4NX 4PMUA 3ZJ7A 1IT0A 1E70M 4W87A 1GOWA 3U57A 1ISXA 5HOSA 2WW5A 2YOCA 2J62A 1W1TA 3BAYA 1VFMA 1X1NA 1CIUA 1HVQA 4ATDA 1OT1A 5D9PA 3MMDA 1V3HA 4AC1X 1EA9C 3F4VA 5GNXA 1FH9A 4QLLA 3POHA 1FA2A 3SCNA 2GVYA 1GORA 3AIUA 1TVPA 3VM5A 3QOMA 3BLPX 1BYDA 1B3XA 2J4GA 1K9FA 3WL0A 1CWYA 1NH6A 2WKGA 4Q7NA 1PX4A 5A6BD 4E4PA 3QOKA 4PCTA 3LPFA 4FLQA 2GJXB 1UR0A 1CTNA 4RE4A 1F4HA 4CU6A 4W5ZA 2CHOA 2ZX5A 5AC4A 4AZ5A 3KE0A 1QI0A 1U30A 3K1DA 1XCXA 3DECA 4XX6A 2PWFA 5CJ5A 4KGJA 1HL9A 3DYPA 4HU0A 5D8ZA 1GQLA 3THDA 1QNSA 4B9ZA 3OIHA 4D6HA 3BMWA 2VRQA 3VNZA 4UQBA 3WN6A 1DWFM 4KWUA 5JH8A 3THCA 3VM7A 2IUZA 1IZKA 4MB5A 1RP9A 4CVUA 3BSGA 1OD8A 5JBEA 2YLAA 1MFUA 1JYXA 1B3ZA 1ITCA 4JZ5A 2DDXA 3CUIA 1AMYA 4GI9A 4U31A 3UR8A 4CD4A 4M24A 1KGXA 1CGVA 1SFSA 3N11A 1ZBWA 3VIGA 1HKJA 5HXMA 3ARZA 3SCSA 1XRVA 1NARA 1FOBA 4JCMA 5CLWA 5A2AA 1E6XM 5I79A 4F8XA 1H41A 3CMGA 3AMDA 3ZIZA 1QNQA 2VQTA 4GQQA 3WQ6A 3L2LA 1OSEA 4H8UA 1JNDA 2QPUA 1V0LA 2G4FA 1F4AA 2CPUA 4W8LA 1TCMA 2OYLA 1UH2A 1XHGA 1ZB5A 3VDCA 4UZSA 2J7EA 4B15A 1UD4A 3DYOA 1JGIA 1RP8A 4DM2A 2EEXA 4W85A 4ZFMA 1GUVA 3NIYA 4ML4A 2ZUNA 3T0BA 2J7BA 1WB0A 2CXGA 1VAHA 1X6NA 4W84A 4NRRA 4DWSD 2JF7A 3VD5A 1ZBCA 2CKSA 1E0WA 4MDPA 4F9DA 1K9TA 2OWXA 4ZENA 4RE2A 1C90A 4F66A 4HOXA 1BGAA 4FLSA 2E9LA 3RM4A 1CLVA 4MADA 2XVGA 1DP0A 5KZ6A 2VTFA 4YHEA 1BQCA 2DSWA 3EDFA 4CN1A 3ZR5A 1BVNP 3MMWA 2OYKA 2VZTA 4JKMA 4U33A 1Q6FA 4BQ4A 5E6ZA 3RCNA 1MXDA 4QDMA 2XYLA 4MNMA 2ZX7A 1W91A 5A8OA 1E15A 3CZKA 4U5IA 1WPCA 5JUVA 3T0AA 5A2BA 3WIJA 3ALGA 1J01A 1ZL1A 2BS9A 5CPQA 5A69A 3RM8A 1SMDA 3WDPP 3WH7A 3LPPA 5CSUA 2V5CA 1J12A 1VIWA 3AZRA 1OIFA 7TAAA 1V3MA 5DO8A 1WDPA 5AYBA 5D4YA 5C71A 4AD0A 3BGAA 1CXHA 1JIBA 3AOFA 1KFWA 3W53A 1JXJA 1WDSA 2EPNA 1TVNA 1OGGA 2YDRA 3N17A 1EHNA 3FN9A 2XVLA 1LQ0A 2DSVA 2BV9A 5C70A 4V27A 4QCEA 4TVDA 1V08A 3CHDA 4ACYA 3EMCA 1MXGA 2CHNA 4J7RA 4PMRA 1XSJA 2Q8XA 4UFJA 4V2XA 1PIFA 3F5KA 3HJEA 4X0VA 2WBKA 4UZUA 2QLYA 2WZIA 3II1A 2D22A 3WFLA 5E0FA 1C91A 1W9PA 2VVSA 3VVGA 4AYSA 1E4LA 1CNVA 4PBGA 5ECUA 3WH5A 2XFFA 4W89A 3ARRA 1QBAA 4E8CA 5CLTA 2UY2A 4WSKA 1TZ7A 3GZAA 3UG5A 1R86A 2EPKX 4HZ7A 4ATLA 1V3JA 3ECQA 1GHSA 3VO0A 1KQYA 1R8LA 1Q6CA 3GXIA 3UCQA 3VU2A 2A3HA 4UQ9A 4AD4A 2PI6A 1UD5A 4PUDA 3WDRA 3WH6A 4E8DA 5JBDA 5CGMA 1B2YA 3GXMA 4NI3A 3DHPA 3OLGA 2G8ZA 2XIBA 3AS0A 1D7FA 4A3YA 3CMJA 1M03A 3ZJ6A 1MW0A 3N12A 3VIOA 2ZWYA 1J11A 1XV8A 2CNCA 5FCZA 4J3UA 1JG9A 3W81A 2BHZA 4HPHA 4UOQA 1V02A 5ABFB 3VDBA 3VOCA 1XH2A 2ZX8A 2ESCA 1UR2A 3VD4A 2BY0A 2GFTA 4EE9A 5D9NA 1OCQA 1CXLA 4M8UA 4MPKA 1C93A 3ARPA 2VCCA 4GO9A 1UWSA 2PC8A 3VIHA 1ISYA 4PUEA 3SUTA 2HISA 4ACZB 3A47A 3ALFA 3CZJA 3OZOA 3EDDA 3ARXA 5GNYA 2J7DA 1NP2A 2ZXDA 5A8MA 1MYRA 2NW0A 3ZOAA 2EO7A 2Y24A 4AWEA 3RJXA 1M01A 3EDEA 2BY3A 1UD2A 1TG7A 2VQUA 3HMCA 1CXEA 3UESA 4GXPA 3RMEA 2F8QA 3GH4A 1GZJA 3K46A 1TA3B 1UOKA 1J9YA 1G1YA 1E6QM 1R7AA 1WZLA 1KXHA 1OD0A 3MUIA 1O7AA 3IAQA 5FL1A 4D6CA 4H41A 4JFSA 3WNPA 3PZOA 2WSKA 1NOUA 1C8XA 4YHGA 3BCFA 4CD5A 1PJ9A 1UHVA 3EDJA 1E1EA 1J0IA 2PB1A 4M82A 4CKQA 3VIMA 1E6RA 3FXYA 1EOKA 1TMQA 3OLDA 1EOMA 5I0DA 2VCAA 4ATWA 1HJUA 3BAXA 3W26A 4M81A 5IFTA 4AZ6A 4P7QA 4PTXA 3WUEA 2DH2A 4U3AA 2XGBA 4GQRA 1G9HA 4TVCA 1C92A 3VMNA 3ARTA 3FAXA 2W92A 3FY1A 4PMOA 4C7FA 2J7CA 4Z2LA 4UOZA 1H49A 3AIQA 4MJ2A 2J47A 1WNOA 1KB3A 3VINA 3NSXA 4PEEA 2WC3A 5HPOA 2BXYA 1EGZA 3WQ8A 5HBFA 3I3EA 2XVKA 4AW7A 5AC5A 5A6JA 2VZSA 1QPKA 4YN5A 8A3HA 2WMHA 1GVYA 5BCAA 4OOUA 2W61A 2YL8A 3AMLA 1HX0A 2GJXA 4P7NA 3CZLA 1CZ1A 1FFQA 3WD1A 1BFNA 3CUFA 2XSAA 1ZBKA 4QLJA 1BF2A 2WWCA 3NDZA 3WNMA 4DWSB 1VFUA 4AD2A 2D23A 4X0NA 4RE3A 2WC4A 1UWIA 4JCLA 4PN2A 3GNRA 1JZ4A 2PWHA 3U7BA 2ZUSA 1Z32X 4GPNA 4H8VA 1JDCA 3MU7A 1E1FA 2VOTA 3W82A 3ZO9A 4WK9A 1G94A 4FF5A 3TP4A 3A4WA 3SUWA 2VL4A 4UCFA 4UQEA 3MANA 2NT0A 2C8NA 1PEZA 4PMDA 3VX1A 3FHAA 4OBSA 2QMKA 4OKDA 5A8QA 4H2CA 1OT2A 1V6UA 1GQIA 3VDHA 1UWTA 3WSUA 3MSDA 3MMUA 4H04A 1QW9A 1MW1A 5LA0A 1B1YA 1VF8A 4HOWA 3BCDA 3AYSA 3CUGA 1X6LA 1JFHA 1KGUA 4D6GA 3RPMA 5AYIA 1NM9A 1E3XA 3K4AA 1CECA 1GOQA 3B8SA 4IPLA 1ZBVA 1DWHM 5CG0A 4JAWA 5EFDA 3CHEA 3AQUA 4MDOA 3B9DA 5BXTA 2XIIA 4PMZA 3WNNA 3AZSA 3VGGA 1L8NA 3O6AA 3T08A 2X1IA 3TOPA 1GHRA 1ITXA 3QGVA 3OLIA 1W3JA 3OGVA 4AZGA 1HN1A 1R87A 3ARYA 2J78A 1H0IA 2JE8A 4GZEA 1JXKA 1JYNA 4HA3A 3AIEA 3OB8A 4B3LA 3SCTA 4L4OA 1C3FA 2UWFA 1JYWA 2VC9A 2GDUA 1BTCA 2AAAA 1PIGA 1ISZA 2VX4A 4S3KA 2WNWA 3WL1A 5JIWA 4W8BA 2J79A 6A3HA 1UR4A 4KMQA 1AQMA 5I24A 2E3ZA 4AZBA 5BXRA 2E9MA 4Z2GA 4P8WA 4MNJA 3EDKA 3A4AA 4NSBA 4W7VA 5E0CA 3RILA 3TONA 4IM4A 3SCWA 1ODZA 4H7VA 4D72A 1HP4A 1VBRA 1NP0A 1UD8A 1UZ4A 3L2MA 4UFHA 2DPEA 4WJXA 1HJWA 1E4MM 4J3XA 3ZT7A 3ZSTA 3WQVA 2WLZA 1J0HA 4HPGA 5GPRA 1FH8A 2VX5A 2QMJA 3AZTA 3LPGA 4W8AA 1JI2A 5GNZA 4LYRA 3K8MA 4F79A 3IJ8A 4QFUA 5CSYA 1MQRA 1WE5A 2XHYA 1HJXA 4UQCA 1LLOA 1OWQA 4UTFA 1HXJA 1VJSA 3WMCA 2WLYA 3WFZA 1BVZA 4PSRA 1C7TA 1BG4A 3AS1A 2VZUA 5IDIA 4URIA 2XTKA 1E0VA 2W4XA 1LL4A 1V6VA 3PZ9A 1V02E 1WP6A 2DH3A 2XWDA 3I3DA 3W6LA 2VI0A 1OGBA 3VKKA 4J3WA 1H1NA 3O9NA 3OZPA 4LYPA 2YLLA 1W3KA 4AZCB 4L4PA 3WMSA 1C8QA 2YKKA 4WKAA 2O9OA 3POCA 2QF8A 1BYBA 4S3JA 3WDHA 1GQJA 4AZIA 2YBTA 1V0KA 3TA9A 1Q6GA 3RM9A 4KRUA 1YQ2A 3CZEA 1PX8A 3VD3A 5HDRA 1QHPA 4UFLA 1W1VA 3N13A 4TTUA 3UERA 2B31A 3VILA 3VDAA 1DWIM 3BH4A 1UKSA 1KXTA 3WUBA 2WBGA 1H0GA 2ZOXA 4EANA 2FDMA 1D2KA 4XUYA 5CQ1A 3CUJA 4R27A 5LA2A 2FGZA 4CN4A 2XVPA 1RD6A 1V6XA 3VNYA 1UKPA 3SCQA 1W2PA 2XUCA 3NYDA 3PZMA 1LG1A 2ZUUA 3VIFA 3IANA 2J25A 3SCRA 5BRPA 4K68A 4LX4A 5D9OA 2VR4A 3SUVA 1XC6A 4JFTA 2BHYA 2BY2A 3E1F1 1MWOA 2VX7A 2X8RA 2AMGA 4P7RA 4JL2A 1JZ5A 3M7SA 3N15A 5M3WA 4CGTA 1DWJM 3VD7A 3SEPA 1G0CA 2BVTA 2EXOA 3VTRA 1JDAA 4JFVA 3N18A 1A47A 2CITA 2DSKA 4UQDA 2YA2A 1HKIA 3N9KA 1V0NA 5ABFA 1RH9A 4MB1A 2BVYA 3PHAA 4CD6A 2WCAA 1YHTA 3FNDA 2DT3A 3F5LA 1C7SA 1B3VA 5IFPA 2XG9A 1QHZA 2EBNA 1H4PA 4U2YA 3CPUA 5D9MA 4W93A 1GW1A 2XJ7A 2WHMA 5CZKA 1AVAA 1GJUA 3MV01 4HP5A 1E9LA 5A2CA 2Y8VA 3GYCA 3AIWA 2FH6A 5A6BA 1QBBA 4V28A 4CCCA 2FGLA 4TOQA 1I1XA 4LPCA 5CGTA 1JZ8A 1KWKA 4ACZA 4FLRA 1R7OA 4AIOA 5A94A 1SMAA 3IJ7A 1JAKA 4AISA 2GK1A 2NT1A 4CU7A 1E4IA 2J7HA 2O9RA 4AD3A 1LL7A 3AICA 1GONA 2J7GA 2YBUA 4Z2IA 1GOMA 3DHUA 3EMQA 2JIWA 1N82A 4Z2JA 1V3LA 3L4ZA 1JZ2A 1HNYA 1JL8A 2WVUA 1UR8A 2WMJA 4RL3A 4CU8A 3IK2A 3GNPA 3BAIA 1PZ3A 1BYCA 4H8HA 5E09A 1TA3A 7CGTA 3W25A 4IISA 1ISVA 3GBEA 2OYMA 3LMYA 2XGIA 2EPOA 4M29A 1CPUA 3VPLA 2DT2A 2VRKA 4A4AA 4HMEA 1KR1A 2DGAA 2CBJA 1U33A 3BAJA 4UFMA 1WKYA 2IXVA 4GO8A 1QNPA 4PMVA 5A6LA 1NWRA 4AEEA 2WC7A 3DC0A 1J0YA 1WZMA 2GJRA 3JUGA 4MB3A 3T2PA 1ZU8A 1UR1A 3ARWA 2X2YA 3MSGA 1CDGA 3ARUA 4OUEA 1MW3A 4Z2KA 3WBEA 2YL6A 2WK2A 3HU7A 4LGXA 5DMYA 5A95A 4ZXLA 2VUYA 4KRTA 3WF1A 4ZE4A 1KWGA 3M46A 1TR1A 2OSWA 5ABEA 4C7GA 3WDJA 4PTMA 1EO5A 2PWDA 3OGSA 5JBFA 1SYTA 2J8FA 3DYMA 1BG9A 5JIPA 1I1WA 3K8KA 4OIFA 1EHAA 1V6WA 1GCYA 1HVXA 4MTVA 1VFFA 1JI1A 3K8LA 4EK7A 5A6KA 1BYAA 1MFVA 2VCBA 4CCDA 2G3IA 1FHDA 3ARSA 3PZUA 1M7XA 1BLIA 4DWSA 1XSIA 2GSJA 4HMDA 3WH9A 3CZ8A 4QLKA 1UKQA 1HF6A 3L4YA 3W24A 3GBDA 1RPKA 4E2OA 1MVYA 3W28A 2VX6A 4LQ1A 4W5UA 3WDQA 4NRSA 1O6IA 3WNKA 2UY5A 1H2JA 2EPMX 2UY4A 3AI0A 3VUPA 3PZTA 3BMVA 4MNLA 3WD4A 2BNJA 1UWUA 2CBUA 1ECEA 2A3CA 1PAMA 2E0PA 3PZNA 4BF7A 3T09A 4D1IA 4KGLA 5HPCA 1E40A 4JHZA 4P8VA 1MW2A 3VX0A 4D6DA 2GUYA 3J7HA 4N42A 2XFYA 4AMCA 1XCWA 1XD1A 1XSKA 1GVIA 2Z1SA 4GI6A 3OLEA 3O2LA 2Y2WA 1CXKA 1V0MA 4FK9A 3BAWA 1E6NA 1CXFA 4UQAA 4WSJA 2V5DA 3ZM8A 1ISWA 1XD0A 1EQCA 1FP8A 1GJWA 3UEQA 4Y7EA 3KZSA 2RGLA 2ZIDA 1B90A 1CGUA 2X0HA 3ZQ9A 2A3BA 1B30A 2EPLX 1VEOA 1KCKA 3WEMA 2E40A 3WF0A 4OJYA 1US3A 3T2OA 3ZJKA 3CHCA 1B3WA 3SCPA 1JZ6A 1J0JA 1VBUA 4N0RA 1EDTA 1B3YA 4HMCA 2W91A 4J3TA 4W88A 1QW8A 4UNIA 3QR3A 1KR0A 3QHNA 2RGMA 4AZ7A 2O9TA 4GZIA 2WVTA 2V38A 3WD0A 1XGZA 4WKFA 2PF0A 4CUCA 2PWGA 2ZWZA 4MB4A 4TX6A 1GPFA 2D24A 4PTWA 2C0HA 3NDYA 3S6TA 4MNKA 2OWCA 3TTYA 2WVSA 2YDQA 5A6AA 4AEFA 3FAWA 3WD3A 4JHOA 3CIVA 2VT0A 2BXZA 1HP5A 2WZEA 3VGFA 1UR9A 1BGGA 1FFRA 4OBRA 3UG4A 3W0KA 3WNOA 2DT1A 5ABGA 5A6MA 2XM1A 1KCLA 4JL1A 3MV11 1E5NA 1UYQA 1EIBA 2G3MA 3ARQA 5A6SA 1HL8A 2QPSA 2YDSA 2CYGA 1G01A 2WVVB 5A1AA 1C8YA 5IXEA 3AMGA 1W9UA 2C7FA 4HA4A 1QI2A 1CGXA 2VMFA 5DF0A 3MUZ1 1E3ZA 1UD6A 5BXPA 3NJ3A 5EBAA 1CGYA 1CYGA 1OINA 1H11A 3VIJA 1CBGA 4D6EA 4PMXA 1W3LA 3WKZA 3FW6A 2X0YA 3M6DA 1WAWA 1K9EA 4D6FA 5A8PA 4B3KA 6CGTA 2CEQA 1NWSA 4JKKA 3WQ4A 4AZCA 4UOJA 2JALA 4U2ZA 1W1YA 4HTYA 4JIEA 3VIPA 4BQ5A 3GDBA 1CGWA 2ZUVA 2EQDA 3CBWA 1JAEA 3S2CA 3PZVA 4HA1A 1UWQA 4CN6A 1MQQA 2JF6A 1BPLB 2ZE0A 2WMIB 3RDKA 3CUHA 3VMOA 1H09A 4QCFA 4X9YA 5BRQA 4CD7A 1TUXA 1LJYA 2AOSA 4BQ3A 2VR5A 8CGTA 5M17A 3I3BA 4BZYA 2NSXA 2E9BA 5M5DA 1V3IA 4LXFA 1QNRA 4DUXA 5KEZA 2ZUMA 2D0GA 2WHJA 3VGBA 1W9VA 3W4RA 2DSZA 1E4NA 1M04A 1W32A 3IAPA 4DM1A 5IHSA 2CETA 3EYPA 3GNOA 5DT5A 1BSIA 2DIEA 4AY1A 4B16A 2FH8A 3ZJ8A 5I5RA 2DQXA 2ZXAA 1PPIA 4J28A 4AIUA 2YA0A 1WZKA 4AD5A 1HT6A 1S46A 4TVUA 4AD1A 1UD3A 1M53A 2WHLA 2JEQA 1JF5A 1J18A 4IPNB 2XWEA 1DWAM 1VENA 3W29A 3APGA 3VD9A 2WM0A 4WLCA 2ZXBA 2WMKA 1HKMA 4KH2A 3W27A 3CHFA 3ZT5A 1LWJA 3GM8A 2VRJA 3TTOA 1VEMA 4UFIA 1VB9A 1GOKA 1OM0A 2CBVA 2J8GA 4PYSA 4OOZA 2WCGA 3GTNA 2JIEA 3QHMA 4CD8A 1J0KA 5E6YA 1QNOA 3AS2A 2WKLA 2A3EA 1AQHA 9CGTA 1XYFA 3AROA 5EB8A 4R5EA 4B9YA 2W62A
chains in the Genus database with same CATH superfamily
3EWYA 2WYSA 2FIQA 1OJXA 3GU1A 1KQZA 4NJJA 4GVGA 3CZGA 2ACRA 3P5ZA 3UD6A 2D20A 2Q01A 3WCZA 1T8XA 4E0CA 1GOIA 4U3CA 4Q4MA 2DORA 2FDSA 4O11A 4GZ7A 3H54A 3N2XA 2XDFA 1DEDA 3ZSSA 2C0AA 1DJIA 4PEKA 1K8XA 1A5MC 5KTLA 1YDNA 3EBVA 4L9ZA 1XH0A 3B4UA 3WF2A 3HB9A 3A23A 3W7RA 1RQBA 3RCMA 1JNEA 3QN3A 1XGDA 3H12A 4C7DA 3O0FA 3WNLA 3QV7A 5MKGB 2D0FA 1QWKA 1BRLB 1RHCA 3W38A 4UTIA 3P80A 4K38A 3D5HA 4YPJA 3TSMA 4R0XA 3TU9A 2P3ZA 3R0UA 1D3HA 3DGRA 4ODNA 1Q6EA 2AKZA 4JY9A 4Q8PA 3M47A 2EJ1A 1TJ2A 4CQDA 2NQJA 1ZS2A 3Q4DA 4ZO6A 5I07A 4TMCA 3UG3A 3N1AA 4BK9A 3JYMA 3WQ5A 4JTIA 4GIAA 2CERA 3AJXA 3P0WA 4RZ4A 3GIYA 4GINA 3UG8A 1V4YA 1NQKA 3BSHA 4H2HA 4ITZA 4XAKA 2H9AB 3BICA 2WHKA 3QSTA 3RPDA 5CBJA 2CBIA 1FHLA 2ZUWA 3FEQA 3KAIA 2J9ZA 2Y5SA 3GH5A 4C6NA 1PDYA 2EF9A 1DHPA 5FF7A 4IIEA 1UZ1A 2D1ZA 1WKFA 1BD0A 4GIYA 4IPJA 3VGEA 2DEPA 2Y5EA 1ZJAA 3WMLA 2HWGA 1OIMA 4IZGA 2YL9A 3NQ7A 3K1GA 2CKRA 3T2QA 4AXNA 2CIPA 4ZVJA 1GGOA 1FJDA 1V03A 2PBGA 1QJWA 3IJ9A 4CQ9A 3V7PA 1FXQA 4Q8UA 2EGZA 4MIMA 1NWUA 4DAIA 2VNCA 3GQYA 2GWGA 1EH9A 3RK8A 4A3HA 4LUJA 3GU2A 4J27A 1V3KA 4PMNA 2YFNA 3KL3A 2ABBA 2V3FA 4XQ6A 3G1SA 1P6WA 4YYCA 5I6SA 1E72M 3GYEA 2DIJA 1GNXA 1PBGA 1RY0A 4IJBA 3G77A 3NSNA 3BAKA 3P0XA 1PB0A 3AIBA 4JTQA 3DFYA 5CC3A 3U5YA 4BCEA 2XP3A 3P67A 5LIKX 1EDGA 2EJAA 2XN2A 3IKDA 5AYYA 3PZQA 4IP5A 3NVDA 3NRKA 4AY7A 4BWLA 2E8YA 4S3GA 3ZR6A 3LERA 2EKGA 2I16A 4GY0A 4KEUA 4IF2A 1QPRA 4XB3A 3SCOA 4JFUA 2ZE3A 3AXIA 1XW8A 2E5DA 2X1TA 4TTGA 1FKJA 1AZ2A 1GG0A 5JU6A 4GVIA 4YTUA 3DKLA 1D7JA 1K7EA 3OA5A 5DN1A 3IUIA 4B90A 3B0XA 1GEHA 2EG6A 4OT7A 1ICSA 3L4UA 5HNNA 4LYQA 2ZICA 5HUPA 1RLCL 4DUWA 1ZAHA 1F6YA 4MAVA 1M1BA 3OOBA 3KS5A 3ZVHB 3E9AA 3TWAA 8XIMA 9XIAA 1G5AA 4F2TA 2VFFA 1KKOA 4J3SA 1LWHA 1KCZA 1D9EA 4HNVA 1S5TA 3ABSA 4TUFA 4AF0B 4NF7A 3KVMA 2OT0A 3W6YA 3R0DA 1WDRA 4Q4KA 1UKTA 3STGA 2V3GA 1UC5A 1QOXA 1JDDA 1UA7A 4U5KA 3OGRA 1KBBA 1JPMA 2YFOA 1QOQA 1TE1A 3VOIA 5K3VA 3L4XA 5A8NA 1J2BA 3NNTA 3U5UA 1EUNA 4JQ3A 1L9WA 5FESA 4MWAA 3URQA 5FKYA 2ALRA 2WB5A 1W2VA 1REQA 3WMBA 2C91A 3TYAA 1E1CA 4AX7A 3NSMA 4B2DA 1ZP3A 2VEFA 3S6DA 3MUAA 4RJEA 3R43A 4B92A 3AXXA 2VJXA 1H60A 1HJSA 2Z25A 1HKKA 4D71A 4CNNA 3GU9A 1E71M 4LAVA 4U85A 1NOWA 3BSMA 1H50A 3GXDA 3ZMRA 1CX9A 2UY3A 3U7VA 3V1PA 3QH2A 3AHZA 1UA3A 2OSXA 4IIHA 1ZCOA 1IIHA 4C65A 4RDYA 3LCFA 3RGCA 1FTXA 1TPB1 4GMEA 3KOYA 3NPXA 4ZPWR 1FWJC 1PYFA 2J77A 3THUA 5LIXX 1RXOB 3AHXA 4HZ6A 3SY1A 4D6IA 1JF6A 2XP6A 3C0QA 2WJDA 2D0HA 1RJQA 1S2WA 1WCGA 3H7UA 5AOUA 1T40A 4CCEA 1TSIA 1YPIA 5C8BB 1MDRA 1W9DM 2W9MA 3PUEA 1AJ0A 4EWND 5BYWA 3WBAA 4IG2B 3MW7A 4ZE5A 2J6VA 1TZ9A 3I4EA 3R8HA 2DG4A 5CCZA 1SW7A 1Q6LA 5I23A 4CNTA 4PB3A 3TYZA 4QSHA 2WNNA 5DELA 3G24A 2J74A 3GUWA 4HOZA 3ZYZA 4N4QA 1PCWA 1ADOA 4JKLA 5HT1A 1WX0A 1AJZA 3VNIA 3TZNA 1Q4NX 2P76A 3D46A 2B0MA 3W1QA 4YCOA 1W1TA 1M41A 3KDOA 1XR2A 2V2CA 4LEQA 1K7FA 2G96A 3ZZ1A 1CIUA 1HVQA 4ZQPA 2F2KA 4O54A 5BZAA 1EA9C 5FA5A 1SU5A 3POHA 2QJHA 1FA2A 1FXPA 1LM1A 2GVYA 1JVNA 1GORA 4RNFA 3AIUA 3BLPX 1BYDA 1B3XA 1E9YB 1P0KA 3WL0A 1NH6A 1SW3A 3GAKA 1PX4A 4CQCA 1M9HA 2INEA 3B8VA 2J88A 2GJXB 1UR0A 3DERA 3DAQA 1A49A 1VC4A 1XM3A 1KBLA 4AZ5A 4C6DA 4MJMA 3CQKA 1M5WA 1T41A 3S3GA 3R12A 1XCXA 3DECA 3Q2DA 3BJFA 3NVTA 2PWFA 1Z69A 3KX6A 5J8LA 1HL9A 2Y62A 3VZYA 5KZEA 5F2MA 3THDA 3PBWA 1KM4A 2HMCA 4B9ZA 4Q8TA 2I9EA 1DWFM 3LBCA 5JH8A 1R2SA 5D2TA 9XIMA 3VM7A 4P5UA 1DPMA 3MDUA 3LDVA 1D6OA 4GKTA 4QITA 4EXQA 5JH2A 2R8WA 3CUIA 5KZDA 2DG3A 4U31A 2PCEA 3OBEA 3B04A 2OOGA 1CGVA 5HATA 2Z1VA 2GVLA 1Q7ZA 1FKRA 3H23A 1IXPA 5HXMA 3DIPA 4V1YA 2PDKA 1XRVA 5AZ0A 5AC6A 4JCMA 1XINA 4AIBA 3KP0A 3WLRA 2ZTJA 2KX9A 4GQQA 1FWBC 4WOQA 3WQ6A 3L2LA 5K9CA 3QMRA 1F4AA 2A21A 2CPUA 3MJMA 1AUSL 1Q5MA 1XHGA 1ZB5A 4MKVA 3BOXA 4B15A 4DLFA 1DIKA 2GWNA 4JN6A 1UD4A 4UMCA 3ENLA 2X1UA 3LMZA 1R9XA 3QLLA 3TUUA 3MJYA 4MY1A 4ML4A 2ZUNA 4DZHA 2OTDA 3EA3A 1XLBA 1WB0A 4PUUA 2CXGA 3A24A 1JNTA 2GLKA 2H6RA 1R46A 2JF7A 3VD5A 2CLOA 1QMLA 1ZBCA 1XBZA 2CKSA 2IPJA 1E0WA 1Z48A 3PG8A 4F66A 4HOXA 1GG1A 2E9LA 2NVAA 3UJRA 4YHEA 3SW6A 2DSWA 3AYTA 3KOZA 4CN1A 3ZR5A 4AHPA 1BVNP 3T55A 2VZTA 3RPTA 1AL7A 3XISA 4MNMA 1KM2A 4FS9A 1W91A 3S6OA 1E15A 4HZMA 3R8RA 3O5JA 1KRAC 3T0AA 1F74A 4JNMA 4C6FA 4XTDA 5CPQA 3W2MA 4Q6XA 4O8AA 2P88A 4C91A 1JVWA 5CSUA 2V5CA 4GYPA 1J12A 3AZRA 1OIFA 1V3MA 4ZQCA 3WLSA 5AYBA 2FZDA 3H9RB 4K36A 4CCZA 1CXHA 3T44A 2NVDA 2ZC1A 1XLLA 3L5LA 3N6HA 1JXJA 1ZCNA 1WDSA 2EPNA 1TVNA 1EHNA 3L0KA 1DJQA 5H8MA 1ONWA 3BW2A 2J8TA 1O5RA 3V0TA 3CHDA 2NUWA 1FKTA 3UJSA 1MXGA 4GIRA 1FKDA 1XSJA 4Y9OA 2AMXA 4NZJA 4BWLC 2Z6JA 2QLYA 3II1A 3NL2A 3TC6A 1DJGA 2VCDA 3ATYA 2VVSA 4REQA 1SFJA 3TMLA 3UWUA 3S2NA 1CNVA 3W2UA 1OFQA 1G69A 1TWWA 3ARRA 2CLMA 1F40A 1UW9A 3H22A 3KOFA 2V6AA 5D04C 5CLTA 3ES8A 2PPPA 3G8RA 4D9PA 4WSKA 1CB7B 4GXMA 4L72B 4GI4A 4ATLA 1OFOA 1V3JA 4FOJA 1YDVA 1GHSA 4QJ5B 1EA0A 2PDCA 1IR1A 5J5DA 4NJGA 3GFZA 4AD4A 4PUDA 3WH6A 4AU0A 2X7WA 4BF9A 3NZGA 4DY1A 1EJRC 4KETA 3OLGA 3C0LA 2X30A 2HBXA 2MLYA 3AS0A 1D7FA 1FDZA 2RDWA 3EWXA 2NSOA 1LROA 2J66A 4BHYA 2WPBA 4QHRA 4IFKB 2CLEA 3MSRA 3TAOA 3N12A 3G22A 1XV8A 4AWSA 3MUCA 3W84A 3O5QA 3EWBX 4ZMGA 1V02A 3TN5A 3RGTA 1XH2A 4B3ZA 3S1GA 4L64A 1GW9A 2JBMA 2BY0A 4GIEA 4WQ6A 1OCQA 3LHVA 4GO9A 2VCCA 3SGGA 4AQLA 3C86A 1JCJA 3WJYA 2QCCA 4MWAC 1JCXA 1A7XA 1MRQA 2HISA 4DX3A 3ALFA 1JUEA 1XCFA 1HKWA 5C55A 3TQKA 3LGEA 4O53A 4QIUA 2XZ7A 5I06A 1AFSA 3F7JA 1X1OA 4AX6A 1EJ7L 3M0LA 5HNUA 2QGHA 4DPPA 2Z24A 3WQGA 1U5VA 4KWVA 4LUSA 1OY0A 4E4FA 2JKAA 4RPPA 2F8QA 2TSYA 3VCCA 4OTKA 3NM3A 4C6EA 3K46A 3OYZA 3A64A 2FZMA 1TA3B 1UOKA 2QR6A 1E6QM 1WZLA 2DZTA 1KXHA 4FNTA 1J6PA 3ITVA 3MUIA 1O7AA 4ADSA 5FJOA 4QQUA 4US5D 4E38A 1WDDA 4ZQNA 2BZNA 3CIXA 4L9YA 1XKJA 1FWWA 1UHVA 4FNSA 2PB1A 1M68A 3N9RA 3BARA 4TW8A 4CKQA 5AHLA 5G1TA 2C1IA 4RV8A 3OLDA 3DG3A 5I0DA 2VCAA 2DJLA 4NIRA 3W01A 4M81A 4H01A 3M5VA 4PTXA 2QCFA 4DI9A 4GQRA 1LZOA 4NAEB 5HW8A 1XIHA 3EAUA 1C92A 4TVCA 2XH7A 2AQOA 3UWEA 3W2NA 1NSJA 1PO9A 1MZRA 2C3ZA 3W2JA 2J47A 1PTDA 1KB3A 4EX4A 3VXGA 1OX4A 2Q6ZA 2OKOA 4B5NA 5HR7A 3SIZA 4AW7A 2C18A 5AC5A 3NZRA 5BCAA 3FYPA 3LI0A 3V0UA 3T0TA 3PR2A 3CPRA 4LB3A 2HVNA 1ZBKA 4JFMA 1TELA 1ZLPA 1J6OA 4XAGA 2KI3A 4PTNA 3LZ3A 2J27A 4AD2A 2P8CA 3SJ3A 4X0NA 1Q6IA 2QDHA 2F6KA 1R30A 2FTPA 4UXDA 1IXOA 2PWHA 4GFSA 1BF6A 1Z32X 3UU0A 4GPNA 4E3VA 3W82A 4WK9A 2MUCA 1V51A 3SUWA 4UCFA 1NMWA 2A85A 4BR1A 1V6UA 3PWGA 2VN1A 4ZOEA 1UWTA 1UZHA 3WSUA 2C1GA 4O17A 5D05A 3RRXA 4LS0A 1MW1A 3OA3A 4S3DA 4HHHA 3LQGA 2KZHA 4OVXA 1YNQA 3FX4A 4Z1CA 1OEPA 3R6IA 4B5SA 4D6GA 3QQ0A 3HM7A 3W3OA 4F0RA 3RPMA 3DC8A 4AFYA 1DWHM 4JAWA 5EFDA 1GVOA 3E2RA 4N2YA 5DXYA 1W1A1 1KTBA 3M0MA 2ZC8A 2PP3A 1EBGA 2L2SA 3WNNA 3D6NA 1L8NA 2UBPC 3T08A 1I2PA 2I56A 1GHRA 4ML9A 2F7FA 2YXGA 3VFLA 1RJRA 1UBSA 1MUMA 4RW5A 3OLIA 1W3JA 3ANVA 3OGVA 2OFJA 3L67A 3ARYA 1H0IA 5HINA 3N2MA 1JYNA 3AIEA 3SCTA 2VC9A 3GDMA 2GDUA 1BTCA 2AAAA 1KNWA 3H4GA 3PSVA 2GZXA 1DJNA 1RQEA 5C2XA 3GKAA 3WL1A 2C79A 5BXRA 4Z2GA 3ANYA 4P8WA 4B5XA 4MNJA 4NSBA 4W7VA 3RILA 3MI6A 4IM4A 1YATA 4HNUA 3N6JA 1HP4A 4I7UA 3HPXA 3MHFA 1O94A 2E67A 2VC5A 2DPEA 1JUKA 2OELA 3EKZA 5A5WA 1E4MM 1K1DA 3F4NA 1RVGA 3WQVA 2WLZA 4HPGA 3OBKA 3GPKA 3QM3A 3KAHA 5GPRA 2HXUA 2VX5A 3N2CA 2O7QA 2Z7KA 1JI2A 2PV3A 4LYRA 4C6IA 1K3UA 1QPNA 3UZXA 3IEBA 1MQRA 1IGSA 3IVUA 3I7RA 4XO7A 4UQCA 2IQ0A 4UTFA 3WMCA 4LALA 3KHDA 4LC6A 3OJGA 1Z3NA 1SO5A 2W4XA 1LL4A 4KRZA 4WHBA 3PZ9A 5EMKA 1V02E 5AN7A 1TZZA 4JNYA 3CAVA 2XWDA 3QRHA 3W7LA 3NQVA 1PZ0A 4TMBA 3VKKA 4J3WA 1H1NA 3O9NA 3RX2A 3OZPA 1W3KA 4L4PA 3UF9A 4GBDA 4LUIA 2G97A 3O5GA 3SY8A 4DUOA 1KTNA 3KTXA 2PBCA 2ZQ0A 3U3HA 2X40A 3PSWA 4I9JA 4NZ4A 2JK2A 1R6WA 6REQB 1EEPA 4AZIA 3UI6A 2YBTA 1BSLA 1V0KA 1YXDA 3TA9A 1YQ2A 4HBKA 4GYPC 3KCEA 1QHPA 4HCHA 4ONVA 3N13A 4TTUA 3UERA 7REQB 1DWIM 2VGIA 4BI5A 2QT3A 4X63A 2WBGA 1TTPA 1H0GA 4XUYA 5CQ1A 2PLCA 1LOSA 3CUJA 3SQLA 3TH6A 5LA2A 1UCWA 2FGZA 2XVPA 1RD6A 1V6XA 3IUHA 5CZTA 3OZYA 5AB3A 1LBFA 1Q13A 2W6RA 3PZMA 1LBLA 1GZGA 4WY0A 2E6FA 5RUBA 3PC0A 4IQCA 5HKGA 1XC6A 1Z6KA 3M16A 4TNSA 1U1UA 2VX7A 3O07A 3S2MA 4XBJA 1AD1A 1JZ5A 3N15A 4XTIA 1DWJM 3SEPA 1QXLA 2EXOA 4QNEA 5C2CA 2I5IA 3N18A 4EOUA 2DSKA 2XSXA 3L12A 4PB4A 2RJGA 4DH0A 4XD5A 4MB1A 2BVYA 4CD6A 2WCAA 1G7VA 2PLKA 1NIUA 4RXGA 4P61A 2PP0A 1XYAA 1ELSA 4GCXA 4Y90A 5FEZA 4Q4SA 4LWWA 1GJUA 4LAWA 5XINA 3MV01 4B5UA 3AIWA 1QBBA 4V28A 4CCCA 3NZPA 2OLSA 4RZBA 2I5QA 4H9VA 3HGOA 4AIOA 4IOTA 4DEFA 1F3WA 5A94A 1JAKA 5EL1A 4AISA 1ZAIA 2PGEA 1JCTA 5E0KA 1U1HA 4NJKA 4ORIA 1FAPA 1R3YA 3AICA 2RJHA 1MXSA 2Z28A 4M6VA 3QJAA 4AB4A 4FB7A 2JIWA 1M6JA 1FKWA 1ML1A 4FOKA 3W1AA 1FWRA 3SO7A 3P74A 4B2DD 4Z08A 3HIJA 4CU8A 3B0YA 3H6OA 3QY7A 1J6YA 2A6NA 7CGTA 3E74A 4QSFA 3VZXA 4JTFA 1S5NA 2XGIA 3GVVA 4GQ0A 2FPTA 1CPUA 2V67A 2DT2A 4A4AA 2E1DA 2FZ8A 1KR1A 2Q02A 2CBJA 1U33A 3BAJA 4UFMA 2IXVA 3TX9A 4Z42C 1FRBA 3G1HA 4PMVA 5I3KA 1G67A 3S1VA 1VHNA 4GISA 4WJEA 1C8VA 2HS8A 1ITUA 3H21A 4XAZA 3TN4A 3KAOA 5AHEA 1ZU8A 2BOEX 3ARUA 4GC4A 1AQFA 1VZWA 4CQAA 2NLIA 3HPSA 2V63A 3GU0A 3D3FA 3UXIA 3L68A 5AC8A 3M46A 1B4KA 4TU1A 3ITOA 2Y78A 3WDJA 2PWDA 5JBFA 2NWSA 1SYTA 2J8FA 3DYMA 1BG9A 3CWHA 3IV8A 1YDYA 3P7YA 1EHAA 1V6WA 4MTVA 1VFFA 1JI1A 3H55A 1DJYA 3T07A 2P0OA 3W1XA 3UFYA 4EK7A 5A6KA 5HMDA 3VKCA 2VCBA 3W1MA 3W7GA 3QLDA 4DWSA 4L3NA 1XSIA 4MVAA 4Q8QA 5CSRA 1Y0OA 3CZ8A 3EKLA 1JGMA 3WZ0E 4LANA 3TVAA 1PKNA 3G0SA 4HN8A 3BGGA 4IPIA 1HF6A 3L4YA 1RBLA 1RPKA 1MVYA 3UWQA 3W28A 3N29A 3KRSA 4NRSA 4ERGA 2UY5A 1DXIA 2C15A 2DW6A 4MPQA 3FAPA 2UY4A 3AI0A 3I68A 3PZTA 4O28A 3P6LA 2R1LA 4HYRA 3VNMA 3CH0A 2BNJA 4DF1A 1ECEA 1PAMA 3V3WA 1AH3A 3FGCA 4BF7A 3T09A 4A8LA 5HPCA 4RDVA 4JHZA 4P8VA 2XZ9A 1FWSA 3HURA 1FWCC 3QMTA 2PDBA 4AMCA 2DVXA 1XD1A 1XSKA 1GVIA 2Z1SA 1J96A 3SSJA 1GVFA 2Y2WA 1S2VA 4W9OA 2ZZ6A 1CXKA 4FK9A 4WSJA 3TXVA 1FP8A 1GJWA 1SZEA 3UEQA 1K70A 1B30A 5EMLA 5LNSA 2ZQTA 4OJYA 3IIVA 3EWDA 3ZJKA 4I5UA 1GT8A 3CHCA 2WV8A 3TNOA 1VBUA 4DJFA 3MWAA 1EDTA 4HK6A 1B3YA 2P53A 4J3TA 1R47A 1O1ZA 1Y5WA 3T81A 4Z1DA 4AZ7A 5DIUA 4GZIA 2V38A 5D75A 3N2TA 1XGZA 3VOJA 4RX0A 3H2FA 2OMAA 3EOLA 5HWBA 4CUCA 3IJQA 2ZWZA 2ZR4A 3IACA 1PIIA 4O52A 1XIBA 3VAVA 2YDQA 4BFAA 4AEFA 1MMFA 3WD3A 1MSSA 1E51A 2K8IA 1QOPA 1VJIA 4H7ZA 1J5TA 4S3AA 3VGFA 1UR9A 5REQA 3ZS4A 4UMAA 3EWCA 1PTGA 2DT1A 4DZIA 3HQPA 2XM1A 1E5NA 4ODOA 1UYQA 5H8PA 4LCQA 1C8YA 3AMGA 1A5SA 3UNDA 3FYOA 1CGXA 3W7JA 2PS2A 2QCDA 2VMFA 3MUZ1 1K7XA 1NDVA 4L4LA 4XD3A 4WGXA 5T9BG 3UNTA 7ODCA 1W3LA 2GQ3A 3FW6A 1RVKA 1UJPA 4QISA 2X0YA 3QPEA 1K9EA 4IGMA 1TRIA 5A8PA 2ETNA 2WKJA 1NWSA 1AK5A 3HFTA 4JKKA 1W17A 4IHCA 4U2ZA 2Z1WA 1KFKA 1W1YA 4HTYA 4JIEA 3VIPA 3AXMA 2J6XA 1Q6HA 1JAEA 3QW4B 3S2CA 4HA1A 1P48A 3LI1A 3NL3A 1T11A 5CPNA 1MQQA 4TQTA 2NXHA 3CUHA 1K8YA 1AW1A 1KBIA 4X9YA 4CD7A 2ZBTA 4OV4A 1LT8A 2D9FA 5AHMA 1LCOA 4H8NA 5M17A 2E9BA 5DITA 3CC1A 2SFPA 2VR2A 4DUXA 1XLDA 4H3DA 3NM1A 4Q8WA 5LXXA 2Y5JA 1PXGA 2E5CA 3VGBA 5LGXA 3FOKA 4MYAA 1EYMA 3N4FA 2DSZA 5EU9A 3U0HA 4YVXA 1M04A 4DM1A 1UIPA 2Y89A 5IHSA 2VGFA 1H63A 3M0YA 2YPIA 2F23A 5D38A 3TXZA 1VGAA 5HANA 2DQXA 2ZXAA 1TPVA 3QYQA 2Z27A 4DRSA 3GXTA 3GUGA 4XAFA 2NV2A 4AD5A 1S46A 1MRAA 1FKBA 3CJPA 2EAWA 3C2FA 1QT1A 2W0UA 3IV3A 3GW3A 4WLCA 1GQNA 3SECA 3CHFA 3GHRA 5CZJA 4GUJA 2VRJA 1X7FA 3JYJA 2NXGA 4JQ1A 5HQLA 1XIGA 1OM0A 2CBVA 4PYSA 4OOZA 3UGVA 1G4EA 2WCGA 4AEOA 3SR7A 2PLJA 3GTNA 3VNKA 3V5CA 4MG4A 3NWRA 4YYFA 3AROA 4R5EA 2ZDSA 4JYDA 1PZ1A 2W62A 2UV8G 2XN0A 4MGVA 1TO3A 2H3BA 1ZENA 3PTMA 2QYGA 3MDWA 1TJRA 1JZ7A 1CLKA 5DBUA 3RO6A 3GHTA 3DBNA 3UJFA 4JTLA 1IR2A 3WELA 4ZA0A 1CENA 4NKCA 3RJYA 1F6KA 4JTCA 2FHFA 2J24A 3LBOA 1MEHA 1QHOA 1X1ZA 2R14A 2NQZA 3T0DA 3MZ2A 5HQMA 2CHRA 4JTEA 3GKFA 1BWVA 4EIVA 3BXWA 2BFGA 4M7SA 1FCVA 2BHUA 4A3UA 4QAIA 2A3AA 3KFTA 4DRIA 3IVSA 4UTHA 1I6NA 3NURA 2GGEA 4ADUA 2ZUTA 3USBA 3N2OA 3SCUA 3KOWA 3N04A 3UZZA 2P3EA 4QE5A 1NY1A 5IM51 2XFRA 2WSRA 3B4YA 2A1YA 4QT2A 3BLKA 5GVJA 4DT4A 3W7QA 1K77A 4ZO8A 1WO2A 4B5WA 4LV9A 1T96A 1L0PA 5FOOA 1NOFA 2XVNA 3UVAA 6XIAA 2GJPA 1W5OA 1TIMA 3CO8A 2WSPA 4NILA 4UFKA 4D6JA 3GC2A 3UR7A 4HK5A 4FR1A 2CW6A 3V5FA 2BGNE 4O16A 2W5FA 4L9XA 6ENLA 3VOHA 4NZFA 4J3VA 3BUVA 3GDTA 1DHKA 1TJPA 4ZSUA 2POZA 1B54A 4LF1A 3EX1A 3WF4A 2MLZA 2P50A 4M56A 4E4UA 4NP7A 5LIWX 1NDWA 3DX5A 1UWRA 1QI5A 2X42A 3WLMA 3IJIA 4M80A 3GS6A 3SGZA 4DWSC 4IQLA 4QP0A 5BXSA 3W6MA 1BAGA 4A2SA 2IXUA 4Q8OA 1E0TA 1DE5A 3PM6A 5AHFA 1SJAA 2TAAA 2WMGA 3OHIA 1WUEA 4EXBA 4PR4A 4GX9A 2YCIX 3QHOA 3WQCA 1G6CA 4XV0A 1E6SM 4JDBA 5DFAA 2ZZ7A 3L0NA 1EWEA 3ZWTA 2CU0A 3GHUA 1O5KA 4GI8A 5LA1A 1R85A 2PRLA 1PWLA 4Z1BA 1PUDA 2G3FA 4I90A 3I7SA 4PTVA 3A3HA 4MAZA 3CNYA 5GPGA 1EO7A 1E5JA 4TX9A 4XZBA 3TAKA 1PKYA 3TLLA 2VEMA 3AXHA 3N6QA 1QI4A 2GDQA 4PSPA 3S46A 4GA8A 4K1GA 3B06A 2CLIA 1EQPA 4POCA 1F3XA 3LU2A 1W1PA 4UCGA 2Z26A 2VFGA 2ZXQA 3H4XA 5E70A 3CLWA 3S5SA 3VE9A 4DUVA 3G2GA 3M07A 3LRMA 1H3GA 3WQWA 2Y4SA 3UF8A 3PA7A 4NX0A 1IZJA 5DXXA 5C54A 1V6TA 3RU8X 3U48A 1MQPA 1OGSA 4IP7A 4HJWA 4GUHA 2POTA 4DJFC 3Q67A 1B9ZA 1A5KC 4ECLA 3LHWA 1IGWA 1FKFA 3NXLA 3BOLA 2VFEA 2VEKA 3I4KA 4BJHA 1GKQA 2H90A 2Z1KA 4LBRA 3DN5A 1PSCA 3EIPA 5BRBA 1XH1A 5EFFA 4HPJA 4QE4A 1KRCC 3QFWA 4XWUA 5HUAA 3S5NA 2Q8LA 1W8SA 1E6PA 4GFIA 1M5YA 5GQBA 5A3HA 3S83A 2PDPA 2L5HA 4EKJA 1EGMA 3S5OA 3EXSA 3RN6A 2FVKA 1WBHA 2B81A 2ZQVA 5DMMA 1W56A 4WKHA 4WIWA 3V1HA 1DJXA 1LL6A 1CB2A 4ICNA 2OX4A 4FALA 4AY8A 1W9BM 1FCBA 3MPGA 3TR9A 1A4LA 3JXVA 1WOBA 1F7BA 1A5NC 2BB0A 3LY0A 1TFVA 2Y8KA 3N4EA 1I2QA 1C9WA 2WXDM 3WUFA 2E8ZA 4HYVA 3O8AA 3AMCA 4XVDA 7XIMA 3LHZA 3O5FA 2F6UA 1IT8A 2IPGA 5GJMA 3WLNA 1EP2A 2HK1A 2EG7A 4IQEA 2RUCA 1EWDA 5TD4A 6TAAA 3W37A 2OPJA 1Q65A 2OQHA 2ICSA 1AJ2A 8TIMA 5HWMA 5H8UA 4O13A 3L9CA 4R7OA 2V9DA 1P6BA 2DSUA 4X2RA 3GXNA 1LF1A 4HZ8A 4EAMA 3BLFA 4NZ5A 1OZQA 1JYVA 1R9YA 4Z1YA 3NTPA 2GDVA 2BGQA 4Z2HA 3AHVA 2D2OA 3HV9A 2WJZA 1WUFA 1FWAC 1O5QA 3AISA 4CNUA 4LUTA 1XG3A 4RXFA 3O5DA 1KXQA 1TPC1 2VZOA 2G3NA 3NPVA 3WH8A 1I75A 4JTAA 5DCEA 2WO5A 3QC3A 1BWKA 1VBGA 3B8TA 3TCZA 4I9TA 2NQLA 1AW5A 1VRXA 3A6OA 4WD0A 3S42A 1TV8A 5CBBA 2YJQA 3ITCA 1XP3A 3WBYA 1IV8A 2YCLB 2FB2A 1RCOB 1QVBA 3AU6A 1BKFA 1D7IA 3C5QA 4GNVA 4QROA 2D3NA 3KCOA 3DG7A 4S1FA 5SWUA 5G2WA 4KQNA 3QR1A 4PMUA 3ZJ7A 3RLVA 1IT0A 2OU4A 1GOWA 4FNUA 3U57A 1ISXA 4FHAA 2J62A 1W3NA 4M6QA 4D2JA 3KRZA 1X1NA 7REQA 3A5VA 1W26A 3UI4A 4O57A 4ZS6A 4ATDA 3GG1A 2KAUC 3UI5A 2VOMA 3MMDA 3B7XA 4DNMA 1P5BA 4DJDD 1G4TA 3KBWA 1FH9A 3TJ4A 2AWGA 2Y63A 2ZR6A 3VM5A 3HOJA 2ZQUA 1K9FA 1OFPA 3OODA 1OG6A 3LPFA 3DXIA 1IXQA 1F8AB 1POKA 4ZPTR 1IWAA 5D2WA 2Q71A 2QAPA 2CHOA 3LN3A 3W1RA 5AC4A 1U30A 4A29A 2B5UB 3N9SA 1Y8BA 3RHGA 4GOAA 4FX6M 4U4MA 4KGJA 4M7TA 4GUIA 5D8ZA 3W72A 3EOEA 3NQFA 1YE6A 1GQLA 1QNSA 1JCNA 3BQ6A 4UQBA 4PC8A 4K37A 4DRQA 1J2WA 4HU3A 2IUZA 4MB5A 1RP9A 3ZXWA 5JBEA 5C9UA 2YLAA 3H2NA 1B3ZA 4JZ5A 1OX5A 4DBEA 1AMYA 3GAYA 4N9EA 4M24A 1KGXA 2FGBA 2PDXA 4IX2A 3M0JA 1ZBWA 3VIGA 4MKSA 1HKJA 2R1PA 2PGWA 3MHGA 4FXFA 3ARZA 3H4WA 3SCSA 1NARA 4DZ2A 1E6XM 1C9HA 5I79A 5XIMA 2ISWA 4FAMA 3KBJA 3TFCA 4GWEA 4IMAA 3CMGA 3PY2A 3ZIZA 3G1XA 4KESA 2PDYA 3LD5A 1XDMA 1TX0A 1JNDA 1S2TA 1V0LA 4FIQA 4IFOA 4E5TA 5LNUA 3DFSA 1GVSA 2PEVA 2J7EA 3TV8A 4DM2A 4R85A 3W1UA 4ZFMA 3QEZA 1FKXA 3NIYA 3MWCA 3ITGA 4QE1A 3D0CA 4L80A 3NL5A 1QTWA 1VAHA 1X6NA 4W84A 2B4GA 4EPEC 4DWSD 1NSGA 4M19A 2Y70A 5A8GA 4PULA 1W37A 4MDPA 4F9DA 3LK6A 4ZENA 1IEXA 3W7CA 4RE2A 3LG3A 1FDYA 2QJNA 3RM4A 1CLVA 4KPLA 2A7RA 2XVGA 1DP0A 5KZ6A 1VFLA 3P3BA 3R11A 2OYKA 4IXHA 4YU1A 4U33A 1Q6FA 2AQWA 5E6ZA 1P1MA 4E2DA 1ZP4A 2AL2A 3TSDA 4F2UA 1XLHA 4KEZA 5A8OA 1U83A 3RFAA 1WYIA 3OEXA 3PJUA 4BY3A 3CZKA 1WPCA 2ZVRA 3WIJA 1TTQA 4X22A 4C1NB 1J01A 2V5LA 3RM8A 1HQTA 1OFEA 3W76A 3CL6A 2CLKA 3ICJA 3E5PA 5D02A 5DO8A 4NJHA 4GNJA 4XKYB 5C71A 1VBJA 2WSQA 3RAOA 1PVNA 3W53A 4RLIA 5XIAA 5DLCA 1H51A 3LCWA 3W02A 2C6QA 4NXKA 2YDRA 4TX0A 5EMUA 3EB4A 5C70A 2X2GA 4QCEA 4TVDA 3PK7A 4RDZA 3MTWA 4PMRA 3LHTA 1YBQA 4G7FA 4X0VA 4MZ1A 2RURA 4UZUA 5G4HC 2WZIA 3R58A 2D22A 2IMRA 1C91A 3QGAC 1W9PA 2QCHA 4DJFD 4AYSA 1YEYA 3QR0A 4PBGA 5ECUA 3WH5A 2XFFA 5IOBA 2XP8A 2VDHA 3SZ8A 2FPYA 1RBOB 2DVTA 1OF8A 2NV9A 3JZEA 1R86A 2HROA 2EPKX 2I57A 2OVLA 2FB3A 4W9TA 4ZZ9A 2PODA 3PPCA 1W0MA 3OQEA 3OTRA 4RNIA 1A5AA 2ZRXA 1U79A 5JBDA 2PU0A 2BLEA 1B2YA 1EX1A 3DHPA 2G8ZA 2O7SA 4ZQMA 2ZYFA 3FKRA 2PA6A 2RDUA 4KF1A 4A3YA 1R3TA 3GWQA 4OHQA 2X41A 3SM0A 1F76A 2P8BA 4EPBC 4FA3A 3VIOA 2ZWYA 4XG1A 2IF4A 1K8CA 1HW6A 4J3UA 5HJXA 1JG9A 3SSZA 3TYBA 5FACA 3W81A 3LLFA 1MEWA 3NO3A 2IKJA 5ABFB 4XO6A 4O14A 1J5SA 3O63A 3BLIA 3S5ZA 1EPXA 1JULA 3L2IA 3DFQA 5I3JA 5D9NA 4Q32A 4PCFA 4MPKA 2PSNA 3MI3A 1K8ZA 1T6MA 5EGRA 2X16A 4Q8VA 3ARPA 2PC8A 3CHVA 1ISYA 3QPZA 5DQPA 2ZZ3A 1U5JA 1O60A 3O3RA 1SFLA 3SUTA 3CZJA 4LBUA 1K6WA 3WLLA 4QDPA 2ZXDA 4LSBA 4A8IA 4J2MA 2NW0A 5FJTA 3ZOAA 4MYXA 4KBXA 4AWEA 1M01A 3EDEA 1O1HA 1V79A 2BY3A 2VQUA 1XRTA 1NVMA 2PE4A 2NQHA 3SQSA 4L56A 3BWWA 3UESA 3V36A 4HNNA 4GXPA 2R1NA 3URNA 4AUBA 1J9YA 2ACSA 4IQJA 4DHGA 1QO2A 1OK6A 3IAQA 5FL1A 2BODX 3SDOA 3CQJA 4N9CA 4JX5A 3ORWA 3WNPA 1RLDA 1OCNA 3PZOA 1C8XA 3LRKA 5LGZA 4C90A 4CD5A 1P1XA 1PJ9A 3KBSA 1E6RA 3EOOA 3FXYA 4HHMA 1R0MA 5JXQA 1EOMA 1VCVA 2YYTA 4YJ5A 4N19A 1YYAA 5IFTA 3N3TA 4P7QA 4HGXA 4U3AA 2XGBA 1G9HA 1SFTA 2BWGA 4FXRA 3ARTA 3FAXA 2W92A 3F2DA 4C7FA 4Z2LA 4XSMA 4LVAA 3K4WA 1YE4A 4MJ2A 1XLCA 1MNSA 4K3ZA 4EAYA 3ITTA 3SFKA 3W7EA 2BXYA 3NGFA 3NL6A 5HBFA 2XVKA 4L4MA 2OLAA 3NEHA 1QPKA 1XBXA 4YN5A 3LTYA 2O56A 1GVYA 3C0SA 4Q4PA 3AMLA 3PBVA 1HX0A 4P7NA 3P82A 5DY2A 1WOAA 1BFNA 4D8ZA 2XSAA 3VE7A 1BF2A 4C1KA 3DOPA 5I3IA 3CQIA 3EZ4A 2WC4A 1XBVA 2PUZA 3GNRA 4DN1A 3MBFA 2E6AA 1T8QA 1TWZA 3GIQA 3MU7A 4DZ3A 1E1FA 2VOTA 2LGOA 1FCQA 2Z00A 4RCXA 3TP4A 3A4WA 3W83A 2B7NA 2XP4A 3JRKA 2C8NA 1WDWA 3FHAA 1AG1O 3GLCA 4XZ9A 4FP1A 3TYDA 1OT2A 3NG3A 5CH9A 3I6EA 5FF4A 1EJWC 3O5EA 3MSDA 1HGWA 5LZLA 1EXBA 2ISSA 4KW2A 1BKSA 4YMZA 3GD6A 5LA0A 1P7TB 5LXEA 2IPWA 5EYWA 4A8RA 3OW1A 3V4BA 3AYSA 2GOKA 1IXNA 4G5DA 2JZVA 4NX5A 5B8IC 3FV9A 4PH6A 1GRJA 5AYIA 1NM9A 1E3XA 3K4AA 1CECA 1GOQA 3B8SA 5CG0A 1Q2SA 3C4UA 3AQUA 5FSDC 2ZZ4A 1N8WA 4RDWA 1G4PA 4FX7A 5BXTA 1KTCA 4Y9NA 2XIIA 4S39A 3M43A 3AZSA 2P4VA 4JN8A 2EKCA 1XLEA 3FVDA 2NX9A 1WXYA 3R0KA 3LENA 2VWSA 4AZGA 4PL2A 5G4WA 5K9DA 3BQ5A 4UTLA 3QV6A 1UMYA 2PDGA 1THFD 3TOYA 1C3FA 2XP9A 4NAFB 1ME9A 4C6OA 2VX4A 4U28A 4EACA 5JIWA 4W8BA 3W7PA 4JYFA 3QKZA 1AQMA 5I24A 2E3ZA 4AZBA 5C9ZA 3BCJA 2KR7A 1FWFC 3EDKA 1D8WA 1Q85A 3A4AA 3P84A 5E0CA 3TONA 5G1YA 2JQXA 1VBRA 3SN4A 3SADA 1UD8A 1JUBA 1EX5A 1S3TC 3BVJA 1HJWA 3PB2A 3PBUA 2CZVA 4XAYA 1EJTC 1UMLA 1FH8A 2YB1A 3KBNA 3E38A 5FF3A 1TIWA 3S5YA 3O5LA 3QVQA 4C6JA 1PDZA 4F79A 5D2XA 5CSYA 4IWWA 3WX7A 2ZRYA 4BEUA 4TYOA 4JNZA 2WLYA 3WFZA 1BVZA 1C7TA 5HW7A 2VZUA 3M5YA 3REQA 2VD9A 3WYZA 1XISA 1V6VA 3MP4A 1I2RA 1U5HA 4NHVA 3V0SA 2DY3A 3W6LA 2VI0A 4H1ZA 3OQ8A 1GWJA 4AZCB 1XYLA 3WMSA 3GR8A 1H1ZA 2BSLA 1C8QA 4WKAA 2O9OA 3POCA 2Q3RA 4NVTA 3MZNA 1QR7A 3HZ3A 4LEFA 1N8IA 2WNQA 2OZTA 4YL2A 4JICA 1GQJA 3IGUA 3RM9A 4KRUA 2LLEA 2ZZ2A 1PX8A 5HDRA 3ZFHA 4M1BA 2A0NA 4XZHA 4UFLA 3UP8A 1ZGDA 4LCSA 1KXTA 3SAZA 1KV5A 3WUBA 4FAPA 2C14A 1VPQA 1FD9A 3MSYA 4KFNA 3O5RA 4R27A 3KP1A 1PKLA 1X38A 3TTEA 1LG1A 4Q7IA 4DRMA 2E5BA 3IANA 2J25A 4C60A 1DIOA 2DIKA 4NNAA 3SCRA 4K68A 1DE6A 4Z1AA 4LX4A 5BRPA 3LCXA 1YPXA 4B91A 4JFTA 2BY2A 4FX8A 1Q6QA 3CEUA 3ABRA 2X8RA 4I8YA 3M7SA 3CV2A 3M44A 1TV4A 1JDAA 3BLEA 4JFVA 3SB0A 1XX1A 2YA2A 3FCPA 1V0NA 2PRHA 3TC5A 3HGSA 5LNVA 3B0PA 3PHAA 4OU1A 4D8AA 4AHOA 1YHTA 1NFBA 1QUMA 1ADSA 3FNDA 2DT3A 1GKRA 2XG9A 5F4WA 1W1IE 5JMUA 2VYOA 1TCOC 3CV6A 1XIMA 1GW1A 1TUFA 3BZJA 3NFUA 4KWOA 5CZKA 1AVAA 3KCJA 2REQB 1Q7QA 2Y8VA 2FH6A 4E6MA 2FGLA 5C7HA 1I1XA 1JZ8A 4ACZA 4WGHA 2MLXA 3E0VA 4ENLA 2BP1A 1Q6OA 4CU7A 2O9RA 4AD3A 1O68A 4Z2IA 4ODQA 2O0TA 1PV8A 4E8GA 1XYMA 4U84A 4Z2JA 3L4ZA 1TWDA 4RNHA 2Z4GA 1HNYA 3EA2A 1JL8A 2WVUA 1VR6A 3A4JA 4CNPA 4NNBA 4AYGA 3CL7A 4RL3A 3QV9A 4UB9A 4PL1A 3STPA 4AH7A 4K7YA 1MEIA 3IARA 1VHCA 4M29A 4HSHA 4WXZA 5H2ZA 2KE0A 4UUIA 4HNOA 3EX3A 4V1XA 1LUCA 2DGAA 3B3DA 4GYJA 1GJPA 2ODOA 1WKYA 3H2AA 3IGSA 5BNKA 4GO8A 3W1TA 1QNPA 5FF0A 5A6LA 4AEEA 2WC7A 2Y7DA 4JY8A 2VD8A 4KWWA 1WZMA 4O12A 1DL3A 4MB3A 5KZMA 2X2YA 3E6EA 4WUIA 3O6DA 3WBEA 4IQ2A 2Y8UA 4MKNA 5A95A 1SUXA 4ZXLA 1Q2RA 2VUYA 1KWGA 1TR1A 4LTSA 1V5XA 1PHQA 5ABEA 3SFWA 1EO5A 4O0QA 3R94A 3CQ0A 3T0CA 3G5EA 4AXKA 1HVXA 3NOYA 3WG6A 4TIMA 3C2OA 1I0DA 1IIGA 4A05A 3KBMA 1BYAA 1ENUA 4HSOA 1XGEA 4K6AA 3BE7A 4XD4A 1XXXA 1MFVA 1GVEA 5CSSA 4H9TA 4O0KA 4PUKA 1K02A 2Z7GA 2C19A 1BLIA 3DHDA 3FA3A 3SN0A 4LYKA 4RUBA 3WH9A 4QBXA 1W31A 3V18A 4ES4A 1LRNA 1UKQA 5FAGA 2HPIA 2XH0A 3GBDA 2VX6A 1TYGA 3WNKA 1O6IA 2XIOA 5DY3A 3TWBA 4PRTA 2V68A 1X7IA 2EPMX 1FQ0A 3KUMA 5TQLA 5U7SA 1OC5A 4MNLA 2W3ZA 3UPWA 3H2CA 1TV2A 2QUVA 4PE8A 4QJ3B 1LORA 3DGBA 1VLWA 3UQNA 4LAZA 2ZCGA 3AWOA 3ID7A 2QCGA 4FNPA 4KGLA 4AWUA 1MW2A 3A3XA 4IL2A 3NQGA 1XICA 1GZ1A 3PS7A 4JX4A 1FKGA 4JFLA 4DRKA 1HGYA 4GI6A 1QNVA 3OLEA 4K8GA 3O2LA 4KT2A 4K8HA 1V0MA 3CB3A 3BAWA 4PUWA 2QEZA 1CXFA 3T7VA 1ISWA 1XD0A 2HVOA 4DJEA 1X97A 4DRHA 1VEOA 3GDLA 3O5MA 2E40A 5BMWA 1US3A 4QTGA 3KWSA 1B3WA 3OVGA 3SCPA 1J0JA 2NV1A 3I65A 3EXRA 1FBAA 2LPVA 4UNIA 4A3RA 4RK8A 3GTFA 4IPPA 3IK8A 1NJJA 2WZMA 5L6UA 2RGMA 5CC6A 4YTQA 4GC3A 3OYXA 4EF8A 2VKZG 3U6WA 2PV2A 3U2EA 1BWLA 2GVJA 3W87A 5J5RA 2OWCA 1JCYA 2WVSA 5A6AA 1FWDC 3QZEA 2TRSA 4M6PA 5F1UA 2BXZA 1HP5A 3SRFA 2WZEA 3LXCA 1KKRA 3G0XA 2H3DA 3F4CA 4OBRA 1VH7A 3WNOA 2ANUA 2CZFA 1KCLA 4JL1A 4I7VA 3A13A 4H6KA 4XIMA 3ARQA 1HL8A 3SRKA 1A0DA 3BO9A 3W1NA 2CYGA 1OC6A 5CJMA 5E93A 2VC6A 3WQOA 3CIWA 4YXGA 4LVGA 2ZRUA 3E3HA 3BURA 3DI0A 5EBAA 1CGYA 1CYGA 1OINA 4D6EA 1US0A 4IIGA 3M6DA 1WAWA 3PRBA 3W00A 4B3KA 2OKTA 3NQEA 4G1KA 3DFNA 4ZB5A 1SSDA 2JALA 3LUTA 5I3HA 2PCQA 2V8ZA 4HU4A 3GDBA 1CGWA 4DROA 2ZUVA 1Z44A 3E12A 1EC9A 3B8UA 1JJKA 1DOSA 2PD5A 4MWAB 2GGGA 4QX4A 1UR3M 3EX2A 1REQB 1SO6A 2ZE0A 3RDKA 1H09A 1XQKA 1UJQA 1AH0A 5BRQA 1MO0A 1LJYA 3G0UA 4DF0A 1E1CB 5AHNA 4QG9A 3E0FA 1RA5A 2VR5A 3UYCA 3VYLA 1ROUA 4WVXA 1GVQA 3DFHA 4S3EA 4QS5A 1V3IA 3EPNA 1CI1A 1CW2A 3JW7A 4WRHA 2WHJA 4Z17A 4L7ZA 3UY8A 4LY4A 2GGIA 4DIAA 4ZODA 1V8EA 1P5QA 3AC0A 4QG6A 5G1MA 1O95A 4XVEA 1TRDA 1YMYA 3IAPA 1FWEC 2CETA 1BSIA 1R3QA 2DIEA 1LBMA 1Q1CA 2OO0A 1R2TA 4MOZA 2I1OA 5I5RA 1PPIA 1W5PA 4AIUA 2YA0A 3SN1A 4AVFA 3DFOA 1SR9A 1HT6A 2QCEA 3DH7A 4AD1A 1UD3A 2JEQA 3EB2A 1UIOA 4K8EA 4ROPA 3TJLA 1EB3A 3W29A 5LKYA 3PUGA 1TTIA 1NDZA 1FWIC 1I60A 4XKYA 1OFDA 1LOQA 4DLMA 2ZXBA 2VEPA 2EG8A 3ELFA 1HKMA 4KH2A 3KABA 1VCGA 1ZTVA 3W7DA 1F05A 2DJXA 3GM8A 4INFA 3TTOA 2QJMA 1VEMA 1Q6RA 2ALDA 1VRDA 3BL3A 1XBYA 3M9YA 2JIEA 3QHMA 4CD8A 1Q8JA 3AS2A 1EBHA 3GFXA 4ZGYA 1EF3A 2WQDA 3O0KA 1AQHA 1OCJA 4WX2A 4ZTXA 2N87A 3W7HA 4Z0JA 2BG5A 1JFXA 3EY6A 5DMNA 2XM2A 3CV7A 2DZVA 3PBGA 1R3RA 2ZZ5A 3VMPA 3C2EA 1ZAJA 3MBDA 3TEVA 6TIMA 2A5HA 3RIKA 3WK1A 3S8HA 3SUUA 4MY9A 5IHRA 2FJKA 1EDQA 4UTTA 2VZVA 4GJIA 4DBUA 1V77A 3LV6A 1AW2A 2H8ZA 4ODRA 2OWWA 3AYVA 3PBYA 3LGDA 5CXPA 3IVTA 3B8WA 4D1JA 4XZWA 2PTYA 2OGYA 5K4XA 2D73A 1UWAA 2O4MA 5AECA 1XWYA 2Z2BA 4W7WA 1E6ZA 4WJ8A 4GJ1A 1DIEA 3C2RA 3MUY1 4AIEA 1QAPA 2V3DA 1K6AA 3AIRA 2G50A 3PFRA 3TTSA 1XLJA 3GXPA 2GVEA 1GQKA 2QDGA 1ECQA 1PX3A 4O19A 1E43A 1UH3A 1VS1A 4WEVX 4JTUA 3GB6A 2PBOA 4M5PA 3SCVA 3TW9A 1I2OA 1QK0A 2XPAA 4BKNA 4XSLA 3EKGA 3L23A 3KRBA 1ODUA 1L1PA 2PPNA 1LOLA 3KVKA 1VEPA 4H9MA 3N25A 4N7QA 2VXNA 5FIPA 3VIIA 5BW6A 4TXEA 3NCOA 3BMBA 3KVLA 2FZBA 3B9OA 1D3CA 5BWFA 3HN3A 2OX1A 3PTKA 2G41A 4PRRA 1ZPTA 1SJBA 4DAFA 1BHGA 4ALDA 2RKXA 2WCSA 4XZMX 1KD0A 5DEZA 3W75A 2CESA 5D8WA 3L4TA 1A5UA 3LHUA 2NXIA 2IW0A 2TMDA 1S1PA 4PRWA 3RG6A 1XJBA 3BC9A 2PTWA 2PU1A 4F0MA 2E25A 3GVQA 1UQZA 3TFXA 3GTHA 2O4QA 4ODMA 3UYIA 2ZRWA 3AHYA 1LG2A 5I2UA 3QQ1A 5T91A 3KACA 3PAOA 3NYZA 2PPGA 1FVPA 3EX6A 1B31A 3PN8A 2QUUA 3H24A 1FX6A 2XH2A 4L1WA 1UG6A 4UBPC 2DZXA 1BXCA 3O1NA 1KM5A 4IMDA 3PZIA 3G6LA 2XIQA 2HNHA 2QV4A 4LOCA 3A3WA 2G3JA 2YZRA 2O92A 3RX4A 1JPDX 4MGGA 3T9PA 2QHAA 4P8XA 3DZ1A 3BGJA 3BANA 4JX6A 4KIEA 2QJGA 3NO1A 7ENLA 4LV4A 1HUVA 1S39A 4PMYA 3WQDA 5HJLA 2DV0A 4JIRA 4HN4A 3LV5A 1YDOA 2R9RA 3F03K 2VEGA 1UUQA 6ALDA 1EEXA 1OHLA 3ERPA 5KMYA 2B7PA 1OVDA 1Q6UA 3TQ0A 2OODA 1NQ6A 1NTHA 4IMFA 1XQLA 1US2A 1YTEA 3W07A 3LLDA 4JTTA 5I3FA 3NQBA 1KBKA 3C8FA 1VPYA 3VGDA 4BI6A 1ONRA 4Q6JA 3ARVA 2MANA 2YIHA 2W27A 5BOEA 3EPOA 4X3ZA 4F9JA 4CEXC 3LXAA 1H7PA 3LOTA 3U2OA 1B0IA 4HNLA 4ZOBA 4DJEC 3AJ7A 2PWVA 1SVDA 1JPKA 1PYMA 1W5NA 2DT0A 1MNZA 3PP7A 4G7EA 4DBWA 1J93A 3VCRA 4Q4QA 4UTKA 1E0XA 4Y8EA 1H62A 5LSMA 3URBA 5MF5A 5GJNA 4KQZA 3CO4A 3K5XA 4GZJA 3G8EA 3R2GA 2WMFA 1H5YA 2VGGA 3AHTA 2WVVA 4R33A 4C6PA 2RFGA 1F07A 1G7UA 1QU4A 4H9XA 3UETA 2HVMA 4DI8A 3TK7A 1VYRA 1D3GA 4M1RA 3GTIA 2IQTA 3SQMA 4LS2A 5BU9A 4QGCA 1CXIA 2OLHA 1QPQA 1MDLA 5I78A 2IKGA 4LW7A 4HPNA 2BVWA 3VK5A 4JXCA 5FF2A 1E55A 1KGWA 1Y0EA 3NZ1A 2V5BA 3TDFA 4RV3A 3MO4A 4FLOA 5I09A 2FZ9A 1LT7A 3TNBA 5C9XA 2P0IA 3VIKA 5ABHA 1JEZA 4ZPVR 5E9AA 3C3NA 2ZX9A 3O16A 3QMSA 4P7LA 4DB7A 5LHEA 2WMIA 3KW3A 3CXOA 1XFBA 4S38A 5I00A 4ZOAA 4NAFA 2ASHA 1DVJA 1L2UA 3BOFA 1SZNA 3FJLA 3NDOA 4GKLA 3L4WA 4QAWA 5C7VA 3Q37A 2O9PA 5DRIA 3FJNA 4HB7A 3DFTA 4PBFA 3F2BA 1VFOA 3WDIA 2ZVIA 2Q8ZA 3KXQA 4UR9A 2PD9A 4H9ZA 2J7FA 3WENA 2YZ5A 5E9XA 1Q4WA 4IMGA 1R2RA 3ABOA 4NG3A 3HPAA 5CJNA 3P14A 3PBMA 4JTGA 5L9FA 4MLJA 4J5NA 5DANA 2FHCA 4DZAA 7A3HA 1WXJA 3C2YA 2GQ8A 4ZFCA 1JD7A 4G6CA 3CB8A 1QO5A 4HD5A 1M7OA 2BVDA 3HO8A 4J9JA 1X39A 2WOQA 1FP9A 2WAGA 2D3LA 4WXYA 3M0IA 4FO4A 1UKOA 2YA1A 3TCEA 2QCMA 2C16A 1DWGM 2DZBA 2W66A 2V2DA 4OZOA 3IPWA 1H5VA 2PV1A 2ONEA 4HA0A 1AA1B 1GYNA 2E6DA 2PRMA 1F6PA 3B9AA 5JVLA 1DORA 2BOGX 3E2VA 1E0UA 3LQLA 1YW1A 1ZHAA 4GJJA 1TMHA 4W87A 4EXAA 3EWUA 3BPWA 4K1WA 4QJ1A 4I6KA 1L2QA 5HOSA 2WW5A 1AL8A 5CGQA 3WH0A 3ATZA 4FNQA 1VFMA 2Z1XA 1VD6A 1E9IA 1V3HA 1RAKA 4QLLA 4DO5A 1N8FA 3SCNA 3THAA 3QOMA 1OX4B 4AAJA 2J4GA 1IEVA 2WKGA 3S2JA 4E4PA 3QOKA 4PCTA 3EPMA 1IQ8A 1Z7AA 4CU6A 3PJTA 1Z89A 3BK0A 3MC5A 5MKGA 2FYMA 1BRLA 1O5XA 3KE0A 2LKNA 1QI0A 4O1DA 3M0KA 4Y96A 4KERA 4PUNA 3W88A 2GUBA 1J4HA 1HO1A 2R1KA 5CJ5A 4UTTC 4IFRA 3SJNA 2DZPA 4WDXA 2ZTKA 3OIHA 1KFEA 3WN6A 3FDKA 4EVZA 4KWUA 5DMLA 3THCA 3B03A 3T8LA 3CGMA 1IZKA 1X96A 4EWJA 3MYPA 1KC7A 3BSGA 2VEIA 1KM1A 4IH3A 1MFUA 4QEEA 1JYXA 3VKAA 1ITCA 3K30A 2A4AA 3UR8A 3GNXA 2PZ0A 4CD4A 5KINA 4MUZA 1SFSA 3H2OA 4MZ8A 3PFMA 2QS8A 1LP6A 1WV2A 5CLWA 5EBUA 2BGSA 2H9AA 3EEGA 1JRBA 1H41A 1QNQA 4WDWA 2VQTA 4LH8A 5TAOA 2HTMA 3VFCA 1F8IA 2G4FA 1W6TA 2HXTA 2QCLA 3N3MA 2OYLA 1UH2A 3VDCA 4UZSA 3W2LA 4TV6A 5DO2A 4O1BA 1JGIA 4GH1A 2EEXA 4W85A 3TN6A 3VKJA 1C29A 1GUVA 2RHGA 3RNDA 2E6YA 4ZB2A 3N14A 2J7BA 4I9MA 4IIDA 3WK0A 4PZVA 3AUOA 2I5GA 2J13A 4GK8A 4MHBA 2V0TA 4DBSA 2PDHA 2OWXA 4G9PA 2P5NA 2A79A 1C90A 1B5TA 3UZWA 4NQ1A 3AXKA 1P43A 3JR2A 4O4WA 5CPLA 1XDJA 2VTFA 3DHFA 1BQCA 4DRJA 4JQ2A 4DQWA 4BQ4A 3APYA 3RCNA 1MXDA 4QDMA 3T6CA 2A7PA 5TNVA 4S3FA 4U5IA 4ZQRA 5A2BA 3ALGA 1RCXB 3R5EA 3TW7A 1SMDA 3GX9A 4LAMA 5DIVA 1VIWA 2QUNA 2KO7A 4DJDA 7TAAA 1YLVA 1WDPA 2C1HA 5D4YA 4AD0A 1JIBA 3HPZA 1KFWA 1A53A 2JGQA 1R9HA 4I6VA 1B3OA 1OGGA 3IIXA 3N17A 4RPQA 2XVLA 1RV8A 1LQ0A 4YTSA 4DJED 1V08A 4LAXA 3EMCA 2CHNA 4J7RA 2NUYA 3N4AA 3S2LA 3UXDA 2Q8XA 4UFJA 4V2XA 1HZYA 1T0OA 2WJFA 2WBKA 1NAL1 2JKEA 2E7FA 1XRFA 3WFLA 5E0FA 3HFYA 2G37A 2BXVA 2FZNA 2P10A 3ABZA 3HF3A 1E4LA 2Z29A 5EMJA 3ZVHA 1YXCA 2HS6A 3CMFA 5D37A 3IJLA 4KKXA 1QBAA 4E8CA 1NEYA 3NQCA 3W85A 4AF0A 4J2PA 2DZAA 3NA8A 3GZAA 3TDBA 1RY8A 3OO2A 4HZ7A 4C6LA 3OVRA 1DQXA 3VO0A 1OYBA 1KQYA 3DG6A 1R8LA 1SSGA 3G3DA 3UWVA 4UQ9A 3T1GA 2PI6A 3BLOA 4C6QA 4WY0B 4E8DA 4AVNA 1M65A 3CGNA 2D69A 3GXMA 1OF6A 4NI3A 2GGJA 2XIBA 3QQWA 1ICQA 3HQ1A 3V5OA 4JIQA 3U2CA 1TTJA 3VDGA 3ZJ6A<