1HKIA

Crystal structure of human chitinase in complex with glucoallosamidin b
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 121
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkiA01
4EK7A 3MUIA 5DEZA 4PMNA 4AEFA 2X8RA 4KH2A 4UFLA 4CN4A 4ACZB 1E73M 1VBRA 4S3JA 1KXHA 4W86A 1Y7VA 2XVKA 3L4YA 1MW2A 1VEPA 2VUYA 2EQDA 1LF1A 3MMWA 3B9DA 5BXPA 1VEOA 5JBDA 2FDMA 3ARSA 1JZ8A 2Y4SA 5A3HA 2DSWA 4W7WA 4EE9A 1V02A 2WHLA 3THCA 2CITA 1NWTA 3DHUA 1BAGA 4J3VA 1VRXA 4PTXA 3OGSA 1JIBA 4C7DA 2WK2A 1TE1A 5E0FA 3IJ9A 4GPNA 1CDGA 4M29A 2D1ZA 4UCFA 1H11A 3PZOA 4UR9A 1WDPA 3LPPA 1RP9A 4M80A 4D6CA 3RILA 2PWGA 1V3MA 3ARVA 2XIBA 5HBFA 3VU2A 1R87A 4GO8A 4E2OA 2MANA 2WHMA 4ATLA 2V3DA 2XIIA 5EMYA 3U5UA 1W2PA 1LJYA 1QNRA 4AMCA 2AOSA 1OBAA 2YDSA 5CSUA 5A8MA 1BVNP 4U5IA 4NRRA 1UR2A 1E3XA 1TA3B 3MO4A 1FH8A 2C8NA 2XYLA 2WCGA 4Y7EA 1V3JA 1WPCA 1DWGM 4ZE4A 3K8KA 1J0JA 1OCQA 3PTQA 3DYOA 2BY3A 8A3HA 5D8ZA 2EXOA 3GYCA 2YDRA 2YLAA 4ACZA 2YJQA 2E0PA 1UWSA 1RP8A 4PUDA 3LPFA 4JFTA 3ARQA 2VCBA 1Q6FA 4GQRA 3WNMA 4D1IA 2ZIDA 5HXMA 3T2OA 1I1XA 2A3AA 2DT0A 3WMSA 3F5LA 3MU7A 2D24A 1K9DA 3WNKA 3AISA 4U2YA 1QBBA 4CVUA 2GUYA 1CENA 3WUGA 3N12A 2WCSA 3AHVA 1BHGA 2GFTA 1F4HA 1WDQA 3ZOAA 2WWDA 4TVDA 1FP8A 1YQ2A 3E1F1 3GTNA 4H7VA 4MJ2A 1C8YA 1OIMA 2CNCA 3GH5A 2VNCA 3ARPA 3WENA 1LL7A 3B8SA 3QR3A 4GIAA 1H1NA 2OWXA 2TAAA 2E8ZA 3QOMA 4DWSB 5HNNA 3SCPA 1XYZA 2UY3A 3SCWA 1R8LA 2CKSA 3CZJA 2ZUNA 1B31A 1E4MM 4FLSA 4JL2A 4W7UA 3T2PA 1E4LA 5A1AA 3N15A 2VQUA 2CESA 2XFRA 4QCEA 2WPGA 5D4YA 4M24A 2CBVA 5CLTA 5ECUA 2OSXA 1V03A 3AS3A 4W5UA 3OLEA 4W93A 4CKQA 2PF0A 4LX4A 1TA3A 1J18A 2WM0A 2A3BA 4H41A 4LYPA 2F8QA 4UOQA 3OB8A 4F8XA 3BCDA 4B3LA 1SR0A 3WH6A 3L2LA 4AZBA 2J7EA 2XGIA 2NW0A 4J3TA 2VRKA 3VGHA 3CBWA 3N11A 3GNOA 1OM0A 2E3ZA 4KRUA 4KWUA 1GQLA 4W84A 3WSUA 4P7QA 4DUWA 1ZBVA 1JZ2A 4LYRA 1PIGA 4GO9A 1EO7A 2VCCA 7A3HA 4AZ5A 3CLWA 1KGUA 1HVXA 1XC6A 1SFSA 2VX6A 2G8ZA 2V5CA 4TUFA 3T2QA 2EO7A 2ZUWA 3SUSA 2JF7A 4Z2GA 1ZJBA 4PTVA 3ECQA 2Y5EA 4CD6A 2B31A 2ZXDA 2E9BA 4FLOA 4JCMA 1MYRA 1KCKA 1EHNA 4HU0A 4H8HA 1QVBA 3WH8A 2J77A 4D6GA 5BXRA 1SYTA 3OIHA 1JFHA 4N0RA 3WDPP 4PTWA 1XCXA 1CGXA 1JDAA 2D0HA 4LYQA 3CHCA 4JKLA 4GINA 4MTVA 2PWEA 4UFKA 3ZIZA 3AZRA 1GJWA 1WZAA 1LLOA 4ZEPA 5BCAA 3WL1A 4YHGA 2FH8A 1D7FA 1RPKA 1GHRA 3CPUA 4P8WA 2PI6A 4CVWA 5DF0A 2ESCA 3PTKA 5GNZA 4AD4A 1UWRA 2WZHA 2RGMA 3ZSSA 3PZVA 1X6LA 4QDMA 1US3A 1HL9A 4IISA 3UG3A 5A95A 2YL6A 5E6YA 2J4GA 2YL5A 4CGTA 1LL4A 1W9BM 5CGTA 1IZJA 1UD6A 4ACYA 2BHUA 3W82A 1R86A 3WQVA 1UKQA 2VZSA 4AIUA 5A6BD 2O9PA 2D0GA 5DT5A 5LA2A 1C7SA 3W38A 3RJYA 2XSAA 3F4VA 2XFFA 4MB4A 5CLWA 1FHDA 2GK1A 3HMCA 3WQ8A 5KEZA 3N1AA 4JKMA 3CMGA 3AI0A 1JZ6A 3GM8A 5BRPA 4CD4A 1G0CA 5M17A 1HF6A 1K9EA 1KWKA 2VZOA 1G5AA 2J7DA 1E5JA 4J3WA 2EPNA 2YBUA 1W3JA 3BXWA 4YPJA 1B3ZA 2IXVA 3LMYA 1E6ZA 5A2AA 2W91A 4OJYA 4HOWA 4B9ZA 3M6DA 3ZJ8A 1PJ9A 3SCVA 3WBEA 5A6BA 2HVMA 4IUGA 1XHGA 4DWSC 1JI2A 2A3HA 2VR4A 3CHFA 1Q6CA 2ZOXA 1CXLA 4PCSA 3VGGA 2WVSA 4JFSA 4U3CA 2VC9A 1CGVA 3CUIA 5HPCA 1VFMA 2D23A 5A6JA 1B3WA 1UZ1A 3O2LA 5ABFA 2ZXAA 3BLPX 4UQDA 2YA0A 5HOSA 1V6WA 3ARYA 3ZO9A 1WZLA 4P8VA 4AZCA 2O92A 2CYGA 3OA5A 2BY2A 3T0BA 3M07A 4B16A 3NSXA 4M82A 4XV0A 1ZJAA 4M56A 1J10A 2DH3A 2BY0A 2XUCA 3WF0A 2YLLA 1NOWA 1QI5A 2FGZA 2WVVB 3WUEA 2GSJA 1O7AA 1EQPA 3NIYA 3FW6A 4S3KA 3IANA 1B0IA 3BCFA 3VIPA 3AYSA 4HA1A 1O6IA 2ZUVA 4TTUA 3VX0A 3APGA 1E70M 2JF6A 3AIRA 5I78A 1EDQA 1JD9A 5E0CA 3VIGA 1DEDA 5A6LA 2G3MA 3N04A 1QW8A 1U2YA 1QI2A 2VO5A 2J7CA 3KL0A 3CZLA 1HJSA 5I0DA 5BXSA 1CNVA 4OOUA 3ZR5A 4CCCA 2DSVA 2J78A 4UQCA 1CXKA 1E5NA 5FKYA 1V6XA 1WP6A 2WC3A 1B3YA 4Z2LA 1UH3A 1CECA 1YHTA 5A94A 5ABEA 2WHJA 5GPRA 1MW3A 3M46A 1FH9A 4M1RA 1JAEA 4AWEA 3CTTA 3DHPA 1HP5A 1WAWA 1KXTA 3QHOA 1KXQA 2ZX6A 1GZJA 1UHVA 4W8LA 1GVIA 4Q22A 3WBAA 5HDRA 1UOKA 3NSMA 1NP0A 2ZWYA 3AIBA 4UQBA 2E9LA 1UD8A 3ARWA 1V0LA 3VGBA 4B3KA 4D1JA 3AHZA 1ODUA 1PPIA 3PHAA 4BQ4A 1QPKA 3S2CA 4CD8A 2BXYA 3BGAA 5I77A 1LL6A 4LPCA 2WBGA 4WKHA 2G3IA 2DGAA 4U3AA 5EFDA 4BF7A 1Q6GA 1QNOA 4V28A 2ZX5A 4DUVA 1M04A 2DIEA 3WD4A 4U33A 3WH9A 2W92A 2VZUA 4GQQA 1NARA 2Y8VA 3W81A 2VX5A 1W3KA 4ZENA 2XWDA 3UCQA 1C91A 2WKGA 3ALFA 2YL8A 2GJXA 3ZT7A 2UY4A 1EO5A 4GI8A 4UQ9A 1H49A 2BVYA 2VRQA 4JCLA 2WMIB 1DP0A 5D8WA 4W85A 3L4UA 2UWFA 3UG4A 2WCAA 3D3AA 1E0VA 4OKDA 2XVPA 4CN1A 3ZJ7A 4J28A 3U5YA 1GNXA 1H2JA 1JDDA 1UD5A 4TX6A 4AZ6A 4CU6A 4RE4A 2E8YA 1J01A 4HTYA 1PZ2A 2Y8KA 1B30A 1J0IA 1UD2A 2VCAA 4RL3A 1PEZA 2WMKA 3MS8A 1HT6A 4W88A 2C7FA 3IJ7A 4HOXA 1H3GA 1KQYA 1E6NA 1E56A 1M03A 1SMAA 3W26A 2OWCA 3EYPA 4W5ZA 1CEOA 1CLVA 2DT1A 1R85A 1UA3A 2WMHA 2XM1A 4P8UA 1BPLB 2YBTA 3OLGA 2W67A 3HN3A 4HA4A 4C7GA 4XB3A 2X09A 2JIEA 2C0HA 1TFVA 4UNIA 4Z2KA 3D5HA 4E8CA 2WSPA 2BXZA 1CIUA 4CCEA 4EAMA 2DIJA 1Z32X 3RMEA 4F9JA 1UKSA 3AIUA 4MNLA 3AIWA 1KCLA 1KBKA 5KZ6A 3WQ4A 2JEQA 1E3ZA 1KBBA 2GVYA 3PZIA 2JALA 2OYKA 3RIKA 1HL8A 4MAZA 4TXEA 2YA1A 3BAJA 3VM5A 4CUCA 1U30A 4JFUA 2WANA 1B1YA 2GJXB 1XGZA 3VIJA 3AXHA 4AZCB 1XSJA 1E15A 4FLRA 1CGWA 4MB5A 5CZKA 1GPFA 2WMIA 2ZUSA 2ZUUA 2BFGA 3A4AA 1B3VA 5JBEA 3WEOA 2VQTA 3EDDA 1ISZA 2WWCA 3NDZA 1CZ1A 3PZQA 2OWWA 3SIMA 3WEZA 1M53A 3II1A 3VOCA 5ABGA 3ZT5A 3MV11 4WSJA 1HVQA 3EDFA 5CJ5A 1GORA 4FK9A 2ZUMA 1GOIA 4NRSA 4Z2IA 4AZGA 1E40A 2EBNA 4PRWA 3VDCA 2XVNA 3RJXA 1W9UA 2ZICA 1CLXA 1V0MA 3A3HA 3AS0A 1WKYA 3GXDA 4PMZA 4YHEA 1SMDA 3FHAA 2A3EA 1BYBA 2QPSA 1BGAA 1QI3A 1UH4A 4QLKA 3ZT6A 3W6LA 1PX8A 1HKKA 5JIWA 4JFWA 1XD1A 3ZM8A 2JFEX 3VO0A 1ZB5A 2YKKA 8CGTA 3DYPA 4W8AA 3GXIA 1K6AA 4N42A 4R5EA 4FLQA 2QHAA 3AJ7A 3ARTA 2UY2A 1UWUA 1ZBKA 2J8FA 5BYWA 1CXEA 1OT2A 1H5VA 2WAGA 3POCA 1OB0A 4OUEA 3WUFA 3B9EA 4DM1A 5FL0A 3KEHA 1XRVA 3WMCA 2VL4A 3AMKA 3KL5A 1W9XA 2WLYA 4JIEA 3SCQA 4ML4A 2J7GA 4J27A 3UR7A 3F5JA 5DMYA 1FOBA 2X2YA 4E8DA 2J74A 2XVGA 3MSGA 1U33A 3VIFA 1X1NA 1V6UA 3MKKA 1NH6A 2CPUA 1VFOA 4URIA 4V2XA 2WC4A 3W0KA 1UWTA 1ZL1A 1DWFM 2YDQA 1QI0A 4CD5A 1QHOA 5LA1A 5JBFA 4WIWA 3WD2A 2J8GA 3OZPA 5E09A 4MDOA 4HZ8A 4P7OA 1OD8A 2CKRA 4X0NA 2J7FA 1I75A 4NI3A 3ARXA 3UEQA 4ZFMA 1HKIA 3KE0A 1NQ6A 3VVGA 4PMXA 4TVCA 2DT2A 2J75A 4OIFA 1E0XA 1OD0A 2V3FA 3WEMA 5FD0A 1BG9A 5TD4A 4MNMA 3RM4A 1UR9A 1GOWA 3GNPA 5A6KA 1HJXA 2PWFA 4U2ZA 4C7FA 3WFZA 4UOZA 1Q4NX 1MVYA 4OBRA 5C8BB 1UQYA 3CZEA 3TTSA 4KGJA 4UFJA 4XZBA 1LWHA 3SUUA 4UZSA 2IUZA 5A8QA 5E6ZA 4MNJA 4W89A 5BWFA 3WKZA 1HNYA 4AD2A 2CHOA 4AZIA 3CGTA 2DPEA 4B9YA 5CG0A 3AQUA 3J7HA 1E6XM 1ZBWA 3PZMA 1S46A 1XSKA 2WYSA 1UYQA 3U57A 1B9ZA 1LG1A 3T09A 1L0PA 2CHNA 2DSKA 1MQRA 4D71A 2VI0A 3NDYA 1HKJA 1MFUA 2PBGA 1FHLA 3WNOA 5A2BA 1ZBCA 3BMWA 1JF6A 3CMJA 1WZKA 3L4WA 5E70A 5I2UA 3TTYA 2XTKA 5EFFA 5A8NA 3FAWA 3VD5A 3VMNA 3CH9A 1XH1A 1FA2A 3POHA 4F9DA 3ZJKA 2E4TA 4FMVA 9CGTA 3ARUA 3A6OA 3S6TA 3QHNA 2EPOA 4U5KA 1AQ0A 1GQJA 2W63A 3O9NA 3OG2A 1V3HA 4GI9A 4UFHA 2CERA 4FF5A 1BG4A 4QAWA 3WL0A 4JHZA 4A3HA 4F66A 4HPHA 1JGIA 3N13A 1KR1A 3WFLA 3CZGA 1KWGA 1M01A 1HJUA 1RD6A 1Q6DA 1E6QM 1JNDA 1G9HA 3VX1A 1BYCA 1V3KA 2WXDM 1XH0A 3VD9A 1JNEA 4BQ5A 5GNXA 3HJEA 1AMYA 1UKPA 3MUAA 2W66A 2WMGA 4MAVA 1EQCA 1HJWA 2VRJA 1HXJA 1W1VA 2EEXA 2OYLA 4PUEA 4MNKA 4J3XA 1JDCA 2W62A 5JH8A 4ZXLA 1C93A 1UWQA 5GQBA 1K9FA 1JG9A 2CEQA 3UETA 5I6SA 3GBEA 3OGVA 1CXFA 3RPMA 3MMDA 5IHSA 4WJXA 5JUVA 4HZ6A 3GZAA 1G94A 3GXMA 1ISYA 1UD4A 1KFWA 3M7SA 3CUGA 1FH7A 3NYDA 2W5FA 2CBUA 3G6LA 3AS1A 1C7TA 4PMRA 1BFNA 4DM2A 4WF7A 2JIWA 3KL3A 1GOOA 1F4AA 1ECEA 2F2HA 4MB1A 3EDJA 1J0YA 4D6HA 3CUHA 1JYNA 1E6SM 2GK1B 2WNWA 2O9TA 4HMEA 1EA9C 2WKLA 1TUXA 3VDAA 3FXYA 5A2CA 2ZE0A 4IPLA 1XSIA 3CHDA 1MW1A 2BVTA 2Z1SA 1CBGA 2OSWA 4J7RA 5CSYA 1KB3A 1CYGA 4U31A 1BLIA 3BAYA 3VKKA 4JZ5A 1LWJA 3VIHA 1UD3A 1WE5A 1BVZA 3QHMA 3L2MA 1NOFA 2OSYA 3K46A 1JZ5A 4XUYA 4B15A 3K1DA 3AS2A 3VM7A 5ABFB 1ISVA 2VX7A 1NWSA 2DH2A 1WZMA 5E9AA 1E6RA 1HP4A 4ATWA 1A3HA 4YN5A 1W9DM 3WN6A 1CGUA 1GOQA 4TX8A 4F79A 4AISA 2VJXA 1WDRA 3TOPA 1VFFA 1K9TA 1W9VA 4R27A 4MPKA 3BC9A 3BSHA 3K4DA 3L4ZA 4LQ1A 1V3IA 1FFRA 1VF8A 3THDA 2AAAA 2ZUTA 3W25A 4JKKA 4K68A 1QNQA 4X9YA 3GXFA 5FIPA 1DWAM 1DWIM 1IT0A 5LYRA 2WHKA 3IK2A 3VIIA 1QOXA 3NJ3A 1R7OA 4JFVA 1L8NA 4QFUA 1JZ4A 2G3JA 3TA9A 3VD4A 3WD1A 1EOMA 5D9NA 5DFAA 5M5DA 4KMQA 2F61A 2G41A 1E4NA 1QHZA 3WF3A 1KGWA 1CGYA 3TP4A 5FCZA 1AQHA 2V38A 3F5KA 4HMCA 2VVNA 2XGBA 1NOUA 3WMBA 1EDTA 3ZSTA 2Y2WA 2J62A 5DO8A 2HISA 1ITXA 1C92A 1HN1A 3GH4A 1ITCA 1H4PA 3AHTA 1MQPA 4GZEA 1HKMA 1EHAA 3WQ5A 2D22A 4JAWA 1TMQA 2PC8A 1MFVA 4PBGA 1OSEA 3IAQA 1HJVA 3VIKA 2WZEA 4AD0A 5IHRA 4V27A 3JUGA 1OGSA 3WELA 1ODZA 4AD3A 2XG9A 2DDXA 5I79A 1VIWA 2GDVA 3IJ8A 2E9MA 4HMDA 1CGTA 3NUKA 3PN8A 3WF4A 3FN9A 3QGVA 3AZTA 3EDKA 3WD0A 5A8PA 2D3NA 1DWHM 1G1YA 3FAXA 1NWUA 1EXPA 1QNPA 3CO4A 3I3EA 3W24A 4D6IA 2WB5A 5BXTA 3DC0A 3DYMA 4AIEA 2QMJA 3CIVA 1OWQA 4LXFA 5EB8A 1J0KA 4M81A 1GCYA 1JAKA 4IPNB 1GJUA 1MXDA 2NT0A 3T08A 3LPGA 2DT3A 1A47A 1XH2A 4PN2A 5AYBA 3SCTA 1CXHA 5AC5A 3GDBA 4GZIA 5IXEA 3A47A 4UTFA 1VJZA 4WLCA 1E1EA 4D72A 7TAAA 1ZS2A 2WSKA 3N9KA 5CXPA 1J11A 1JF5A 2WMFA 1E1FA 4BS0A 3W29A 3ZR6A 1UKTA 3EMCA 6CGTA 2Q8XA 2XWEA 1IV8A 3PZNA 3TONA 3EMZA 1BSIA 2G4FA 3WDJA 3WH5A 3AMGA 1MWOA 6A3HA 3FNDA 5F7UA 3PBGA 1VEMA 4TOQA 1VB9A 3MUY1 3VPLA 1JFXA 1ISWA 4PMDA 1FFQA 1V6YA 2CBJA 4DWSD 1LQ0A 3UR8A 5AYIA 2JEPA 7CGTA 2J7HA 4OZOA 1MQQA 3W4RA 3A4WA 6TAAA 3ZJ6A 2X05A 2CBIA 5CQ1A 5I5RA 2UY5A 1UKOA 1JYXA 4DWSA 2ZX8A 4Z2HA 4PEEA 3PZUA 2PBOA 4L4PA 2G3NA 4H8UA 3VTRA 3VMOA 3WDHA 2W61A 1QHPA 2ZXBA 4BQ3A 1HJQA 4P8XA 1B2YA 1JL8A 1E4IA 3RDKA 4AD5A 2CIPA 3OLDA 1VENA 3CZKA 3QOKA 1JXKA 3UESA 3K8MA 4PSRA 4XX6A 3AIVA 1DHKA 3WQ6A 5FOOA 2WC7A 2EPLX 4JHOA 3VDHA 3I3DA 1BTCA 4UFMA 1P6WA 3RM8A 3W27A 1H0IA 1WB0A 5HPOA 1W1TA 1KR0A 1CWYA 1EH9A 4HP5A 1AVAA 5AY7A 1GHSA 4HA3A 2CETA 4KGLA 2WVTA 1DWJM 2GDUA 1QNSA 1XV8A 2ZWZA 2ZX7A 4AY1A 5CPSA 3W37A 3VNYA 2EPKX 3ZMRA 4TTGA 2A3CA 1J12A 2J79A 1X6NA 2J7BA 5EBAA 3PZTA 4CU7A 5C70A 1V08A 3SCOA 1TR1A 4JL1A 2X1IA 3K8LA 2VOTA 3W53A 3OGRA 4X0VA 3BMVA 3SUWA 5IFTA 1GUVA 2EPMX 2OYMA 4BZYA 4AZHA 3NCOA 1G01A 1E9LA 4J3SA 4UOJA 4Q7NA 4IM4A 4GKLA 3AHYA 1VAHA 4BCEA 1V6VA 1E72M 1W3LA 4QCFA 3BAXA 4OBSA 1W1YA 1Q6EA 1IZKA 3GBDA 4CCDA 3SEPA 3L4TA 2PB1A 1TCMA 2WMJA 3PZGA 2BHZA 4L4OA 1VBUA 4PMQA 3L4VA 5LA0A 1GQKA 2PWHA 4WSKA 1GOMA 3OBAA 1PX3A 1H09A 1I1WA 3SCSA 1NM9A 4UZUA 5M03A 1JYVA 3BAKA 3OLIA 1C8QA 3NSNA 2WW5A 4MADA 3BSGA 2CXGA 1XYFA 1RH9A 3U7VA 1GVYA 5BROA 1V0KA 3VGFA 4AXNA 1UR4A 3SUTA 1BGGA 3AMLA 1W3HA 5A6MA 3VILA 2RGLA 3AMDA 4D6DA 5IDIA 5GNYA 4KRTA 1OGGA 1HX0A 1E71M 3GH7A 4W87A 2Z1KA 5I24A 3CHEA 2DSZA 1H0GA 1W91A 2VZVA 4AIOA 1WCGA 2VR5A 3AICA 5CGMA 1TG7A 1TZ7A 4PMVA 3MANA 1EDGA 4NF7A 3VGEA 4W8BA 4OOZA 3WD3A 4HZ7A 1QI4A 4BQ2A 3AXXA 1GW1A 2NT1A 1B90A 4PMYA 1J0ZA 3AYRA 3AOFA 1OINA 3BH4A 3RO8A 1KGXA 2BNJA 4AZ7A 4Z2JA 1NWRA 2V5DA 1VFUA 5FL1A 1J0HA 3PTMA 5I23A 2V3EA 3O6AA 4EKJA 4NZCA 2QLYA 3T0AA 5DT7A 3DECA 2FGLA 4HOZA 4A4AA 3AIEA 2QF8A 4QLLA 4PCTA 4H2CA 1UQZA 4A3YA 1KQZA 4NSBA 4D6JA 4XZWA 2WLZA 3VNZA 4D6EA 1MXGA 2GJRA 1GQIA 4CU8A 3TTQA 2AMGA 5A6AA 2VMFA 4CN6A 1D3CA 3WNLA 4ATDA 1MW0A 4DUXA 4AD1A 2WVVA 1KXVA 2BVDA 2E40A 2WVUA 4J3UA 1OT1A 2BY1A 2XVLA 5BRQA 2XFYA 1JI1A 4AEEA 4PMOA 4MDPA 1PIFA 3W6MA 1PX4A 2VURA 1B3XA 3TTOA 3BLKA 3WNPA 1EGZA 3VD3A 2VX4A 3EBVA 2X0YA 1QBAA 3SCRA 1OIFA 2X0HA 4P7RA 1XCWA 2FHCA 1PZ3A 3L4XA 1UH2A 1W9PA 2VTFA 3MMUA 4H8VA 3WNNA 3VIOA 1W32A 1DTUA 4UQAA 3T0DA 1BYAA 3ZQ9A 1W1PA 2D0FA 2WZIA 3SURA 3MV01 3WF1A 4P7LA 1EIBA 1E55A 3OZOA 1V02E 3FY1A 2IXUA 3WIJA 3SCNA 2D20A 5A6SA 2VT0A 2V3GA 1FP9A 4ZE5A 5A69A 3EMQA 2XHYA 5M3WA 1XD0A 2BS9A 1UZ4A 3VUPA 5C71A 3ARRA 1WNOA 1WDSA 2YL9A 3AIQA 5A8OA 2XPKA 2VVSA 1GONA 3SCUA 1E0WA 1JZ3A 3AFBA 2O9OA 5ABHA 4QP0A 2PWDA 2YOCA 1NP2A 1UR8A 2QMKA 3HU7A 3WDIA 4E4PA 1LG2A 2BHYA 1PBGA 4WK9A 3KZSA 2CCRA 4UFIA 3CUFA 4WKAA 4GZJA 1PAMA 2WBKA 3RM9A 3SUVA 1D2KA 2FHBA 3I3BA 4PSPA 2OLHA 4M8UA 4PMUA 3RCNA 1CXIA 4D6FA 2XM2A 1JZ7A 2BV9A 2FH6A 2JE8A 1C3FA 2EJ1A 3B9AA 2O9RA 2J47A 4W7VA 5I3DA 1H41A 2W4XA 1ISXA 3N17A 4UQEA 1CTNA 3WDRA 4TVUA 1JYWA 3AROA 3CZ8A 1JD7A 3ARZA 2DEPA 2Y24A 4H04A 4AW7A 5IFPA 4PYSA 2GJPA 1M7XA 5D9OA 2QPUA 2ZXQA 3AXIA 3N18A 3VINA 3WUBA 4HU8A 1QW9A 1UR0A 1US2A 1EOKA 3UERA 4RE3A 4RE2A 4QLJA 2VZTA 1ESWA 1V0NA 3A4XA 3MUZ1 3IAPA 3VGDA 5D9MA 4AYSA 1ZU8A 3VDBA 4BA0A 3WH7A 1C90A 1UWIA 3VIMA 1UA7A 1UUQA 3GNRA 2DQXA 2DSUA 2XJ7A 5D9PA 3WQWA 3ALGA 2J25A 1GOKA 1V3LA 4GXPA 1AQMA 3MSDA 4PTMA 1C8XA 1UR1A 4AC1X 3KWXA 4LGXA 1E43A 1OGBA 2YA2A 3W28A 2FHFA 3AMCA 4P7NA 2NSXA 3AZSA 4GI6A 1WO2A 1CPUA 4EANA 3EDEA 1TVNA 4HPGA 1JXJA 3VMPA 3FHQA 4WKFA 3UG5A 4ZXOA 2QV4A 3VD7A 4CD7A 3U7BA 5JIPA 3K4AA 3WDQA 3PZ9A 5AC4A 3WY1A 1BF2A 3AHXA 3LPOA 2XSBA 1W2VA 4MB3A 5CPQA 2ZX9A 4MJ4A 2D2OA 3CUJA 1BYDA 3BAIA 1TVPA 1R7AA 1J9YA 1N82A 1BQCA 3WF2A 1HIZA 2YIHA 3BAWA 3G6MA 1UG6A 2D3LA 1E6PA 1VJSA 5CPTA
chains in the Genus database with same CATH superfamily
2FFIA 3EA2A 5DEZA 2QV5A 3TYAA 3OBEA 4AEFA 4GBDA 1VBRA 4S3JA 3S5NA 5E1QA 1H7NA 1UBPC 1Y7VA 1Q5MA 1G67A 1FWBC 1T8QA 3FLUA 1RR2A 1YBQB 3UD6A 3MQTA 1AH0A 5HMSA 3MMWA 1RQHA 2J9ZA 3ARSA 2OT0A 3PVFA 3B3DA 1LOLA 3N2CA 4LBRA 3V4BA 2DW6A 4EE9A 2WHLA 1XIEA 4KCWA 3THCA 3DHUA 3EWZA 3M47A 3ES7A 4O54A 1LBLA 3WLPA 4C7DA 1A80A 4DZAA 4JTFA 3SO7A 5KINA 1CDGA 2D1ZA 3PZOA 4UR9A 1LZOA 1XM3A 2DUXA 1SPQA 3W7NA 5HBFA 3VU2A 3KP0A 5D30A 5D02A 2WHMA 4ATLA 2XIIA 4IQLA 5EMYA 3U5UA 4J1OA 2OQHA 1W2PA 4L72B 1X1ZA 4LVAA 3HG4A 2AOSA 2OGJA 3A3WA 2YSWA 4F0SA 3S1XA 4KCVA 3OIXA 1TA3B 3MO4A 1L6FA 3RYSA 2PGFA 2WCGA 3SGUA 3UWYA 1DTNA 1J0JA 3GW3A 4AX7A 5C2XA 5C9XA 3DYOA 8A3HA 3KM8A 3GYCA 4ACZA 2E0PA 1UWSA 3PUEA 4AHQA 1EZ2A 3LPFA 3WQCA 3ARQA 5FJPA 3VI2A 2QCHA 1D6OA 3F7JA 2GOKA 2OQYA 2DZBA 1TMLA 3WMSA 5FF3A 5I3IA 3F5LA 2D24A 1XLKA 3GVGA 4I9TA 1QBBA 1CENA 1RJPA 1U22A 3DHFA 3N12A 2WCSA 2CU0A 1WDQA 3QW4B 2WWDA 2RUCA 4UTTC 4F2UA 1M5WA 4TVDA 3R10A 1YQ2A 3GTNA 1C8YA 3ARPA 3WENA 4BY3A 4GIAA 2OWXA 3QOMA 3SDOA 5HNNA 2AQVA 3SCWA 1RCOB 2CKSA 3CZJA 3BMBA 1R9ZA 2I9UA 3TLQA 3NG3A 1VH7A 1EQ3A 5A1AA 2VQUA 1W1ZA 3NAVA 2WO5A 3NZGA 3NQ8A 3GHSA 2CBVA 1Q6OA 5HTGA 2OSXA 5ECUA 3UCDA 4YNGA 4MZ8A 2RDWA 3LK6A 3OLEA 3UBPC 1IE7C 2BB0A 1J18A 4HCDA 4ICCX 3O5EA 3A22A 4UOQA 3OB8A 1XS2A 1DL3A 4AZBA 2C13A 2XGIA 3WJYA 2VRKA 4RDVA 1JQVA 1QFEA 1HO4A 3L0KA 2PZNA 4KWUA 4FNSA 3WSUA 1F8AB 1ZBVA 1KRAC 3SJ3A 3CLWA 3W01A 1QWKA 3GHUA 4KF1A 1QT1A 1SFSA 4Q4SA 2V5CA 3LB0A 3LDVA 2E5CA 2JF7A 4MYXA 3U9IA 4Z2GA 4X2PA 3PUGA 3KDOA 1V7YA 4LCQA 3MBFA 2ITKA 2KGJA 2CZVA 4QNWA 4K1GA 1EJSC 3G1RA 3CWNA 3M0ZA 1MYRA 3FDKA 2I5GA 4JEQA 4M7TA 5TBOA 2XH2A 4C6PA 1H7PA 3TNOA 5SWUA 3P61A 4D6GA 2CWNA 1JFHA 3WDPP 1UUMA 1YX1A 3E96A 1XCXA 1S5NA 4XWUA 1FWAC 3CHCA 3LUTA 2PWEA 4QZVB 1WKDA 1VHCA 3B06A 1TE6A 1WZAA 1GT8A 1Z44A 1M3UA 4LALA 2G37A 2IKHA 3E02A 2XN1A 4IG2B 1SFLA 2X7WA 1AFSA 3LBCA 3CPUA 3H4GA 1J93A 4XTDA 2PI6A 3ID7A 4CVWA 3PTKA 3NEHA 1UJQA 5G5IA 4AD4A 1UWRA 3GW0A 4WD0A 3ZSSA 2YYTA 4QDMA 3SQLA 1HL9A 1O12A 2Q3RA 4E2BA 2PP1A 1OX4A 2RDTA 2HVNA 2PV1A 1I4NA 3IIOA 4GIRA 3G1FA 1RLCL 1UD6A 4ACYA 2BHUA 4UNKA 3W82A 1R86A 4HK6A 2ZQSA 3WFAA 5A6BD 2O9PA 1C7SA 1IEIA 4C1LA 5FF4A 3Q2DA 1JPMA 4OWGA 3S5ZA 4JKMA 1A53A 2WZMA 1K7EA 3IIXA 4JX4A 3AI0A 1JZ6A 2A2IA 2XN2A 1XR2A 2Z1WA 3GM8A 5BRPA 3DFSA 4CD4A 4NG3A 1HF6A 4O1BA 3NZQA 2VZOA 1G5AA 1KRCC 2EPNA 4QDPA 1VFHA 4YPJA 2KR7A 3LMYA 1E6ZA 3NXFA 3GNNA 3R58A 5M1TA 3BZGA 4B9ZA 3ERPA 3M6DA 1Y5VA 3VZYA 1JCXA 1PJ9A 4ADTA 2HSAA 1WYIA 2IPJA 1BKSA 3CHFA 2ZOXA 3GIYA 1CXLA 4GX8A 3KXQA 4LY4A 3WJWA 2XIJA 2Z6IA 3ITOA 5I7GA 1A5UA 4LVGA 5I09A 3VCCA 1KFEA 1HZYA 5A6JA 4LRTA 1KTBA 3O2LA 2ZXAA 2W79A 1I2OA 3KOWA 2PDKA 1WZLA 4P8VA 3HPFA 2HQAA 3T0BA 4S38A 3C2VA 1H7XA 4M82A 2DH3A 2BY0A 3WF0A 2YLLA 4ZB0A 3TCZA 3WUEA 4JTEA 1JNTA 3B8TA 1XINA 2EGZA 4QISA 3NIYA 4B5NA 4QAIA 3VOGA 2D73A 4HA1A 2B4GA 1PTDA 2CZEA 4RNJA 1EDQA 1W5QA 5E0CA 2CLMA 2G3MA 1KFLA 3EPOA 4A8LA 5AVHA 1CNVA 4DJDC 1B57A 4DJDD 2QULA 4V15A 2DSVA 2J78A 2P53A 1Z7AA 2P76A 1YE6A 1PKNA 4GUFA 3TYUA 2AMXA 2A6LA 4Z2LA 2HDJA 2XH7A 5GPRA 4M1RA 1FH9A 1VPQA 4KFOA 5IDZA 3EAUA 1H1YA 4K7VA 1AUSL 4HHLA 1VBHA 1THFD 4DZ3A 2ZX6A 2X42A 1S2UA 3NSMA 3BV7A 3F4DA 1TWWA 4Z1BA 1V0LA 3B97A 2V63A 1CCWB 3OP2A 3PC0A 1W56A 2AQWA 1EBHA 4TMCA 3BGAA 4EXBA 1JCYA 1QAPA 4IJCA 4LPCA 4CNUA 2WBGA 5HWCA 5FJOA 2PTYA 1EGVA 1TPWA 5LXXA 2ZX5A 2MLYA 1M04A 3SFWA 3S9IA 4U33A 3UY8A 3WH9A 1NARA 3CV2A 2Y8VA 4RW5A 1W3KA 4ZENA 1C91A 2WKGA 4LFYA 3HF3A 4GI8A 4JTDA 4UQ9A 2VRQA 2J9XA 1DP0A 5AKQA 3ZLHA 4W85A 4QE4A 2PC4A 2ZZ1A 3GS6A 3D3AA 3QY7A 4FR6A 5I06A 2HK0A 5HUOA 4U4MA 3QFEA 1XISA 3T07A 4TX6A 1VFLA 2BLEA 4AZ6A 2E8YA 1J01A 4HTYA 5K9XA 1CB7B 1B30A 2YYUA 2C0AA 1S2WA 2VM8A 3CIWA 1XFCA 3WQEA 4TV6A 2QYGA 2H8XA 1PEZA 4LNYA 1NELA 1IEXA 2C7FA 3IJ7A 3VKAA 3CAVA 4M6PA 1E6NA 3OVRA 4HN8A 1SMAA 4HSOA 1XQLA 4Y2WA 4GACA 4ZQRA 4MLJA 4W5ZA 4H8NA 4N19A 1CLVA 2BVWA 3OLGA 4HA4A 3D5HA 5F4XA 1ZHAA 2F9RA 2J88A 2WSPA 2BXZA 1JCNA 1W5NA 2DIJA 3LX9A 1UKSA 3NPXA 1XBYA 1ZQ5A 2WOQA 3WQ4A 3P0WA 1RV8A 4RZ5A 3V0SA 3M5YA 3LXBA 4TXEA 2M1IA 3QV7A 2XDFA 1KBJA 2POZA 5LNUA 1XGZA 1A3WA 3UI6A 3OYZA 2BDQA 5CZKA 1GPFA 4AG0A 2WMIA 2ZUSA 1O66A 2Q8LA 3A4AA 3HQPA 1B3VA 4J40A 3KRSA 5JBEA 3WEOA 2VQTA 1ISZA 1Z9AA 1D7JA 2WWCA 3KWSA 5BNKA 3NO5A 1CW2A 3PZQA 1R3TA 3II1A 1B6CA 5ABGA 3ZT5A 3QTPA 4IQCA 5FEZA 1GORA 2D2JA 4FK9A 2ZUMA 4Z2IA 2E77A 3G77A 3AC0A 2PUZA 4MGVA 1BQGA 2R9RA 3GR7A 4JX5A 3W1LA 4PMZA 3QZAA 2RDUA 4LVFA 3FHAA 4INFA 2V68A 1BYBA 4GJIA 1QI3A 4QLKA 3TKFA 1EF3A 3ZLFA 3NOEA 1DXFA 4ZQCA 2YKKA 4XAZA 1JUKA 3DYPA 4FNQA 4W8AA 3DU0A 4N42A 1SW0A 3AJ7A 3ARTA 3SN0A 2YFOA 3S1WA 1L6WA 1UWUA 3QEZA 2J8FA 2Y63A 1J8VA 3QXBA 2NZLA 4PRRA 3POCA 1PZ1A 1OB0A 4OUEA 3WUFA 3CPRA 5FL0A 1ZP4A 1POJA 1EZWA 3AMKA 1OFEA 3EY6A 3V36A 1DIDA 5DIVA 3SCQA 2BOGX 4E8DA 3W1RA 3MSGA 1U33A 4OHQA 3NQVA 1VFOA 1Z3NA 3UWEA 1FWTA 2WSYA 4I9AA 4JY9A 4CD5A 1G69A 3WD2A 3RGCA 3O6YX 5E09A 4MM1A 3P14A 4P7OA 1OD8A 2CKRA 5LIUX 1JCLA 2J7FA 1I75A 4X0NA 3ARXA 2ACRA 2V9DA 3VVGA 2FPVA 2VWSA 4QTGA 2QIWA 1E0XA 1I0BA 5FD0A 1RVKA 5KMYA 2QJGA 4YYFA 1KW1A 5A6KA 2PWFA 2HEJA 3BW3A 1G4PA 4DJFD 4K39A 4XZBA 5EBUA 2QZRA 3ORWA 4BF8A 2IPFA 3KW3A 4ZA0A 3GFYA 2PRLA 5E6ZA 4K2SA 5BWFA 3EX3A 3L5AA 3UCCA 4X3ZA 4B5UA 3T44A 4J2PA 3CGTA 1ZAJA 3E38A 2Z1XA 3PUOA 2Y61A 1W5MA 4K37A 1S46A 5KZDA 3W1QA 4D71A 3CV7A 3O5JA 4TIMA 2QCEA 1P43A 3DN5A 3CMJA 5HR7A 1QW7A 4H9XA 2E6AA 3M0LA 5EFFA 3H2FA 4XQ6A 5A5WA 1FA2A 4F9DA 4P61A 5JXQA 1JPIA 2BP1A 3O5GA 2C71A 3FKKA 1PCWA 4ERAA 3A6OA 2ZRVA 3H8AA 4O17A 4M6UA 5FJIA 2GLKA 4DROA 1TTJA 2VEGA 4HYWA 2F21A 4ZBCA 4IXXA 3TX9A 1R6WA 1XRTA 4UFHA 2CERA 4FF5A 4LSBA 3RR4A 1MZHA 4RDZA 1AH4A 3MWCA 5HNRA 3WFLA 2AKMA 3CZGA 3W7EA 2H8ZA 1K02A 1R30A 1Q2RA 4Q6XA 3P5YA 1LLZA 1Q6DA 3C2RA 3VX1A 2AWGA 3LHWA 2WXDM 1XH0A 1GTHA 1TIMA 3WJZA 4JIIX 3HJEA 3M0IA 2WMGA 2VRJA 4DI8A 2C19A 4PUEA 4FI4A 4HBEA 1WKEA 2OEMA 3NZRA 2W62A 1D8CA 3H2MA 4G2PA 3UF8A 4QX4A 3SRFA 1R5YA 1JG9A 4PGLA 2V81A 3OGVA 1TJ1A 3MMDA 5IHSA 4HZ6A 1G94A 1ISYA 1UD4A 4IQJA 4WDWA 1X1OA 3XISA 4KESA 1WOAA 2F6UA 1HGWA 7TIMA 3CUGA 3NYDA 4MHBA 2GVLA 1Q7MA 3AS1A 2VC5A 1C7TA 1XPYA 2JIWA 1GOOA 1R3QA 2V5LA 4DF0A 2KI3A 3DFQA 1ECEA 2F2HA 3WLRA 5LKYA 4XD4A 4D6HA 1JYNA 2O9TA 1EA9C 1TUXA 3VDAA 3FXYA 4Q8OA 2ZE0A 4G2DA 3UXDA 3DFOA 2XP3A 3BARA 3CO8A 1LUCB 1KB3A 1IGSA 7XIMA 2Z25A 3VA8A 2VGGA 2ZRXA 4NZ4A 3VKKA 2P0OA 5I98A 2QDGA 1KLYA 1D7IA 4NT0A 4PTNA 3VIHA 3DKJA 3BOXA 1WE5A 1AZ1A 1PWMA 2PDPA 3QHMA 2BMBA 3PNUA 1X38A 3WLHA 5FSDC 4EPDC 2PDCA 4G5DA 4S2BA 4XUYA 2RUQA 5ABFB 4GY1A 1UIOA 1WZMA 5E9AA 5CPNA 3TYDA 3IGSA 2GOUA 3LZ5A 1W9DM 1CGUA 4JTIA 1ZP3A 4TX8A 3MHGA 4AISA 4DO6A 3V1HA 1WDRA 3S42A 3C4UA 1ENUA 5C5YA 2XINA 3W87A 3EIPA 1VFFA 1K9TA 4R27A 1OFPA 3BSHA 4QDWA 3K4DA 3L4ZA 4UTJA 1FFRA 3H9RB 1RJQA 1EJXC 1VF8A 4HQVA 4C5ZA 3MCOA 3GDLA 1PBKA 4PE8A 2D2HA 4K68A 3TOYA 5REQB 4Y9AA 1W0MA 3IK2A 3BOLA 1I0DA 1QOXA 1ZAHA 1R7OA 1UJPA 4UTWC 3LV6A 1L8NA 1JZ4A 4Q8NA 3WD1A 3QMTA 3JVAA 2NXIA 5D9NA 1MEHA 2X1TA 1KGWA 2YB4A 3EB3A 3TP4A 3HFTA 2DG9A 4HNUA 1UPMB 1AQHA 3BJFA 4HMCA 4DH0A 1VC4A 1EDTA 4Q4MA 2J62A 1A7XA 5B8IC 2TMDA 2Z29A 2HISA 3Q67A 1XLGA 1ITXA 1C92A 3N6JA 3E5BA 3W72A 2IKJA 1H4PA 3W73A 1ADDA 3N3MA 1NU5A 4XZHA 1HKMA 1XLHA 2D22A 4YVPA 3Q37A 1KLZA 4IXHA 3VIKA 1XIIA 1EPVA 4TV5A 3IJ6A 2ZA3A 4V27A 4XIMA 3E2QA 1OGSA 3WELA 4J35A 1A5OC 1YW5A 1E1CB 4L3NA 2ZZ4A 2DDXA 5I79A 4IGSA 3FA3A 1VIWA 4UUIA 2PCQA 3CWHA 5JMUA 4JX6A 4EIVA 2PDYA 2HE5A 3TA6A 1DIEA 1DJQA 1VPYA 1FHVA 1ZJHA 4NY2A 3FAXA 3FGCA 1VYSX 4IFRA 3W24A 1AQFA 2WB5A 1IX5A 3T40A 2CLEA 3BLIA 3CIVA 1OWQA 4LXFA 3PJTA 4M81A 2YCLA 2V8ZA 5J8LA 1GJUA 3KZ7A 2H6RA 3OQEA 1F3EA 1TPFA 2FMOA 5AYBA 3SCTA 1L6GA 3E0IA 4UTFA 3H22A 1ZS2A 2WSKA 4QG6A 3O06A 1JF5A 2WMFA 1E1FA 4BS0A 4A8NA 4B4HA 2Q8XA 1JDEA 1Y8BA 4DRHA 3TONA 3LZ3A 1GOXA 4IQDA 1LRNA 1BSIA 5CC7A 4LY8A 2IMRA 3S5OA 2E5DA 3WH5A 5K3VA 3FNDA 3PBGA 3UZYA 4TOQA 1K8ZA 1VB9A 1JFXA 3IGUA 4L64A 3C61A 3C2EA 5DMLA 1V6YA 4DWSD 4TW6A 3IEBA 1TCOC 4S3EA 2FB2A 3W4RA 3PWAA 6TAAA 3ZJ6A 2YXOA 4LEQA 5I5RA 2OMAA 1YTKA 5EMLA 1JYXA 4DWSA 2ZX8A 7ODCA 4IMAA 3LBOA 4Q7IA 1SSDA 4H8UA 3VMOA 2W61A 1QHPA 2AGTA 2NX9A 1PVNA 2Z4GA 4RUBA 4P8XA 1JL8A 3B7XA 1XJBA 2YCEA 2CIPA 3OLDA 1Q85A 3QOKA 1EEPA 2HE8A 3DX5A 4AFYA 3S83A 3GVWA 1FKKA 4R88A 1QTWA 4JHOA 1N8WA 2E1WA 3CEUA 1MNSA 1P6WA 3ZWTA 5E9XA 3W27A 1Q66A 1PKYA 3GC5A 5HW7A 4UXDA 1CWYA 2QVHA 1DQXA 1P1MA 1M1BA 2ISFA 3QSTA 1X8FA 3P74A 4AF0B 4EXQA 3HG2A 4H6EA 3T6CA 4QEEA 2ZTJA 3MSRA 4JYFA 3VNYA 4LUSB 3ZMRA 2J79A 3PZTA 4CU7A 3LI0A 2Y8UA 4EPEC 2VFIA 3SCOA 1JRBA 3GRIA 1AW5A 4IOTA 3KUMA 4NX0A 3LSCA 2PLMA 1FKTA 2WSRA 1OX6A 3UR2A 2EKCA 1GUVA 4NNRA 2OYMA 1G01A 4LCRA 3BLEA 4Q7NA 3W2UA 1NQKA 2ZC1A 3AHYA 1W3LA 1E72M 3BAXA 1Q6EA 4CCDA 4PCPA 3SEPA 3L4TA 3C0SA 3LTSA 5U7SA 1TCMA 5LA0A 3AXMA 2HPIA 2XN0A 1H09A 2V2CA 4XAFA 1VZWA 3BZJA 3L0NA 3W3OA 4MJZA 5G4EA 1YNPA 4CQBA 4JTUA 3LLXA 4H7ZA 4RPPA 2VD9A 3W88A 1GVYA 4IGHA 1MRQA 3VAVA 3JW7A 4NAFA 3PB0A 3W7KA 3SR7A 1Q7ZA 3H26A 1K7XA 5GJNA 2BGNE 4IQ2A 2IS7A 2BOFX 2QAFA 1UWAA 1QRQA 3EOSA 4AIOA 1WCGA 3FYYA 3VNLA 3AICA 4PMVA 3MANA 5I03A 3RMJA 1Y5WA 2QF7A 3B0YA 4M0XA 1YNYA 1YXDA 4DHGA 4UTKA 3T1GA 3MP3A 1TV5A 2G4JA 2C79A 3CUZA 3BH4A 4ZSTA 1JULA 2BNJA 1A5SA 3EWDA 3O16A 4XK2A 3UXAA 4S3CA 3SFKA 3O6AA 1S2VA 4EKJA 5CPMA 4GOAA 1W8GA 1H5YA 2QLYA 1R46A 2FGLA 1ZCOA 4JIHA 2R82A 2KAUC 3AIEA 3NQMA 3M7WA 1R9YA 4A3YA 4D6JA 2PSNA 3VNZA 4D6EA 1GQIA 5FI8A 5A6AA 2VMFA 4ATDA 1GYMA 3S2NA 1MW0A 1VFSA 2FPYA 2OFNA 1RQBA 1U5VA 3ZWSA 4O15A 4O8AA 2KX9A 1VLWA 4O4WA 4PMOA 4NYYA 3O5KA 1EC8A 4G56A 3S46A 3W6MA 2E1DA 2OEKA 4DEFA 3CIXA 3VD3A 1V7AA 4RDWA 4YTTA 1X96A 4GJ1A 3PANA 1QBAA 2X0HA 5HQMA 4P7RA 4HGXA 2NLIA 1WXZA 2FHCA 4ICNA 2VTFA 1W9PA 3OA3A 3P67A 3MMUA 3TN5A 3QR1A 1XLEA 1W32A 4Y9MA 1J2BA 4XZ9A 3T0DA 3WLQA 3ZQ9A 4ES4A 3SURA 4PB5A 1WBHA 1EIBA 3WIJA 3EKGA 1PUDA 4H3DA 3REQA 4FR1A 1FP9A 4QJ1A 3W00A 3VUPA 3C2OA 3PB2A 3SSZA 3ENLA 1T6MA 1NEYA 1WDSA 4RDYA 2XPKA 1E0WA 2O9OA 1P4CA 5ABHA 2R1MA 4B4FA 2PWDA 3LMZA 1X7IA 4PUKA 1PS9A 1V93A 4E4PA 4WHBA 3URNA 2BHYA 3H6OA 4UFIA 3VAWA 4DIPA 1PAMA 4DY1A 4LF2A 4M8UA 4PMUA 1NY1A 4D6FA 2NQZA 2XM2A 1H1ZA 3PWIA 1F6YA 3MVIA 3KBNA 5HAOA 2PS2A 1REQB 3GU9A 2O9RA 4JTGA 3NQDA 1H41A 3N17A 1ISXA 4X2RA 4DQWA 4CEUC 1JYWA 2IQDA 3CZ8A 4A21A 2LKNA 4H04A 2W9MA 4RZ4A 1XICA 5IFPA 4W9TA 2GJPA 1OJXA 2QPUA 3VINA 3NR0A 2NXHA 4Y9OA 3W7JA 2ALRA 3SN4A 2OOFA 2Q3OA 4RE2A 4LAOA 3G2GA 3HGJA 4AMAA 1NIUA 3I7SA 3VGDA 5TAOA 3IIZA 4N4QA 4B5XA 1PDZA 4BA0A 3VIMA 3D47A 3GNRA 3I7QA 3ISIX 5HJLA 3WBXA 2XJ7A 1PIIA 3P82A 2PDUA 5ECVA 1V3LA 4GXPA 4PTMA 1C8XA 1UR1A 2OKTA 3S5YA 1DJZA 1M41A 3VOHA 5AC8A 1DVJA 3GPKA 3OVGA 3AZSA 2OGYA 1CPUA 4EANA 1TVNA 1JXJA 1KKRA 3VMPA 4TQTA 3UJSA 1K77A 2QV4A 3U0HA 4KEMA 4CD7A 3M16A 2ZRUA 3WDQA 5AC4A 1W2VA 4L9XA 2D9FA 2X1RA 3A9BA 2QCDA 1TVPA 3RCMA 5EKYA 4U85A 5I3JA 1BQCA 2VEPA 1QO2A 1HIZA 1UC4A 3PBVA 3RPDA 1VJSA 3GAYA 4K7YA 4LV4A 4KQNA 4KH2A 3TDBA 4JGDA 1TPEA 4P2VA 1E73M 1KXHA 2UV8G 3M5XA 4W86A 4DI9A 1MW2A 2EQDA 1LF1A 3B9DA 3WJXA 4I5XA 1UBSA 2VR2A 5JU6A 4R0XA 4DRKA 1YEYA 2PPNA 1QATA 5A3HA 1XIHA 2DSWA 1HTIA 4W7WA 2R1NA 3BV4A 3EWYA 1BAGA 3SIZA 4PTXA 3NPWA 4LAWA 2PV3A 2PD5A 3FIGA 2GUBA 4OE7A 5E0FA 9RUBA 3IJ9A 1N1AA 3LXCA 4M29A 4UCFA 3UG8A 3IVSA 5BU6A 5FAJA 1SUXA 3RILA 1V3MA 4WY0A 1Y0OA 2XIBA 3SRHA 2GQ8A 5KTLA 2PN0A 3T0TA 4E2OA 1RVGA 1XG4A 3MJMA 1MI3A 3AAMA 5HWBA 1XGEA 4TW7A 4MFDA 3TMQA 3S6DA 2YDSA 2WNNA 5CSUA 5A8MA 1GTEA 4NRRA 4XKYA 1FH8A 3MT1A 2TYSA 1YPIA 4JDBA 1DWGM 2GZXA 1XX1A 1ICSA 3V75A 4R53A 7PTDA 2BY3A 1U79A 3R0KA 2EXOA 3UY7A 2YJQA 4PUDA 4UR7A 1BRLB 4GQRA 2J9YA 2A3AA 2DT0A 3QFWA 1NSJA 3MU7A 1EXBA 1XDLA 3AISA 4CVUA 2V69A 3WUGA 3KABA 1VYRA 1OHLA 4AX6A 2AAMA 2HPMA 4KRZA 2OX4A 2FQIA 3DFNA 3TZNA 1FP8A 3E1F1 4H7VA 4LYKA 3CK5A 4MJ2A 4YS1A 3V7PA 4BI7A 3GU0A 2VNCA 1XKJA 1LL7A 3B8SA 4MPQA 1TREA 1XYZA 4UTTA 4FLSA 1B31A 1E4MM 1QNVA 4ZSUA 5J5DA 1ZAIA 4W7UA 3HPSA 1E4LA 2P0IA 4BHYA 4KR0B 5D4YA 3UF9A 4ITZA 1V03A 3GAKA 4DELA 3PAOA 3D0CA 4W5UA 3B8WA 4CKQA 2QJHA 1FQ0A 2PF0A 4LX4A 4O0QA 2A3BA 1X8CA 4LYPA 2F8QA 3DBPA 5B80A 3QC0A 4B3LA 1SR0A 1Q3NA 1NF7A 2NW0A 3OQ8A 3VGHA 3N11A 3I65A 4WOZA 3RAOA 1OZMA 4W9PA 1V79A 2I5QA 3GNOA 2E3ZA 3L9CA 4DXVA 1FKBA 1TTQA 1JZ2A 4LYRA 5H8UA 1PIGA 4FXJA 2BG5A 4GO9A 5FJUA 1OY0A 4K1WA 1HVXA 3PPHA 1UIPA 1ZJBA 4PTVA 3ECQA 4CD6A 5TNVA 4JHMA 2QJIA 1KCKA 1EHNA 3E3HA 4HU0A 1XYMA 4H8HA 2ZR4A 1QVBA 2QUUA 2GYIA 3PS7A 1XC4A 4YVXA 2FYMA 1CGXA 5CH9A 1XKYA 4NAEA 2NX3A 4GINA 1GJWA 1RA0A 1ZLPA 5BCAA 3WL1A 2WNZA 4RZBA 3O7UA 5ENLA 1GPWA 1M5YA 3SRDA 4HJWA 2ONEA 2C18A 4P8WA 1OFBA 5B7ZA 2VELA 3UJFA 3LSBA 4PTDA 3IVUA 1L6SA 2P4VA 1Q8AA 5GNZA 4GI4A 2WZHA 1KV8A 2RGMA 3SGGA 2FVKA 3UVAA 4LC6A 3NZ1A 1R0MA 1B9BA 1S5WA 5F1VA 2YL6A 1XWYA 1ONWA 1KRBC 3BICA 4CGTA 3CT2A 1LL4A 4E38A 1W9BM 3B03A 3E2SA 1NMWA 1UMYA 4JXCA 1UKQA 3TWAA 3LHZA 1UW9A 4IJBA 1U5HA 2D0GA 1QXLA 3F4VA 4FPSA 3HMCA 3WQ8A 4CNNA 3N1AA 3NQEA 3NGJA 5HK4A 4RE0A 2J7DA 4J3WA 2FAPA 2C16A 2RJGA 4ILSA 2YBUA 4J4KA 4JQ4A 1HFBA 4A05A 1FWWA 2I17A 2IXVA 5L9FA 4KWVA 4AAJA 5A2AA 5D38A 1S2CA 3QSRA 5HWMA 4QNEA 2V5KA 3ZVHA 2XP6A 1YRRA 4L6DA 2FZBA 4PCSA 3VGGA 1IXNA 8XIAA 1B54A 3M43A 3GDKA 3MJYA 3CUIA 1EX1A 1B3WA 1DJYA 2YA0A 1L9WA 1GW9A 1V6WA 4FX7A 3W07A 3ZO9A 4AZCA 4ZR8A 2CYGA 2BY2A 1IQ8A 3NSXA 4XV0A 1ZJAA 4AQLA 3FEQA 3V1PA 4JTJA 1NOWA 4AY7A 1QI5A 2WVVB 3IJQA 5FF2A 4R7OA 2GSJA 1EQPA 1YPXA 4R3UA 3W1AA 1B0IA 3VIPA 3NTPA 3APGA 5FACA 5I78A 3O5MA 1JD9A 1BTMA 1KRMA 1K3UA 5C7VA 1NAL1 1QI2A 2JQXA 3P81A 4B2DD 2J6XA 3CZLA 2XGZA 4L1GA 3SY8A 2VGIA 4UQCA 3S6OA 2UZ9A 2RH9A 4UTWA 1D8WA 2B7QA 2B7PA 3G1HA 3WLNA 4GQGA 1WP6A 1B3YA 2Z2UA 1YHTA 2X40A 1LQ2A 4AHPA 4MGGA 4YTRA 4C1NA 2FZ8A 3QHOA 2HK1A 1RY8A 3V18A 2A6NA 2VC6A 3G3MA 4GUIA 3AIBA 4IPPA 4FA3A 1UD8A 1MUCA 3ARWA 3R0UA 1W3IA 3MHFA 3PHAA 3TQPA 3O3RA 3LV5A 3S2CA 1IR2A 4NAEB 3B0XA 5I77A 1Q7QA 1HO1A 3LCHA 1AMKA 4PZVA 4WJEA 3NFUA 4L56A 3LHVA 4O28A 1OC7A 4V28A 4IG2A 3OZMA 4X61A 4JN7A 4DNHA 4DUVA 1E1CA 2A7PA 1IXPA 1PINA 2VZUA 4GQQA 1ZCNA 3W81A 3UXLA 4MUPA 3UCQA 1SFJA 3ALFA 2GPTA 2E67A 1FRBA 2GJXA 2I57A 4FXSA 4N02A 4QQ3A 3UFYA 3ZT7A 1EO5A 4ODLA 1IIHA 4KBXA 1EBGA 5IOBA 3NRKA 1H49A 4QQUA 1FX6A 5D8WA 3L4UA 3DFPA 3NL3A 4GQBA 4CN1A 5CC5A 5CZTA 5C9ZA 1H2JA 4RV3A 2YCLB 3V5CA 3FSTA 3NA8A 3ITYA 2D69A 4LANA 4J3ZA 3HFYA 4PBFA 1OZQA 3LHUA 3H2CA 3RXZA 1HT6A 4W88A 2NVAA 3W7OA 4QG8A 1H3GA 2PURA 4US5A 4LB4A 4N9BA 3C52A 3T05A 2OWCA 3EYPA 1XLDA 3CQJA 2ZZ7A 2QPXA 3HJZA 2WMHA 4MJMA 2PGEA 4MKVA 3IVTA 2W67A 3HN3A 4XB3A 2JKAA 1TFVA 4AIBA 1OADA 4RLIA 5F4WA 1CIUA 2E68A 3RMEA 4F9JA 4EACA 5AVNA 1JPHA 3WBWA 1NJJA 2JEQA 4AWTA 1XUUA 3N2XA 4BWLA 2GVYA 2JALA 3RIKA 4MAZA 4NJIA 2OZTA 3QQ0A 3VM5A 3NI6A 2BXVA 4JFUA 4PA8A 1WX0A 1B1YA 2GJXB 3SSJA 2D2GA 3MY9A 4V33A 2JKEA 3AXHA 4AZCB 3BG9A 1CGWA 3JZEA 4MB5A 1LWIA 2KO7A 4NXKA 1KT1A 3BO9A 3BSMA 4DN1A 1RLDA 3QYSA 3IV3A 3NDZA 4R7JA 4LS1A 1CZ1A 3SIMA 1C9DA 4LOCA 4IZGA 1JVWA 3C8FA 2AKZA 1I9CB 3QPZA 5CJ5A 1GOIA 1LT7A 5H8PA 3E5PA 3LNPA 3N2MA 1SJBA 3RJXA 4XUGA 3PR2A 4UIOA 4IHCA 2DZUA 2PODA 3IK4A 2QPSA 4PL2A 3EPNA 4N6EA 4QJ4B 2I7GA 2PDXA 1HKKA 5JIWA 3TQKA 1OFQA 1QPFA 3N34A 4I6VA 3IKGA 2ABAA 4ZQPA 1XIJA 1YXCA 3FKRA 4HU4A 8CGTA 3GXIA 4CQ8A 4UNLA 2OJPA 4WGXA 1EC7A 4R5EA 2L2SA 2QHAA 4LU0A 2O7QA 4QSHA 3QPEA 5BYWA 1J96A 1A50A 4M7SA 1H5VA 2WAGA 4Q8QA 3B9EA 4MZ1A 1T40A 5BWAA 4O16A 4S39A 1XRVA 3M0KA 3W7PA 2IQTA 1W9XA 1F2JA 2J27A 1T7LA 4PUJA 2B7OA 4ML4A 3UR7A 2X2YA 3DG7A 1Z6KA 1NSGA 5G1MA 3W23A 4J4NA 1X1NA 3MKKA 2HVOA 1NH6A 5BZAA 2ZYFA 5F2LA 3FYPA 6REQA 4V2XA 3U4AA 3NL6A 3W0KA 1UWTA 3LCFA 3UI5A 4DRPA 3QW3A 3E0LA 3MMTA 2OQLA 1QI0A 5LIXX 2F2DA 4IFKB 1OX5A 4ENLA 1TPB1 1KCZA 3QQWA 2HWGA 2ACQA 3E0WA 3QY6A 1BRLA 1SZGA 1HKIA 1NQ6A 4TVCA 2VD8A 4OIFA 4K36A 1ALDA 4BR1A 3TWBA 4MNMA 3RM4A 4GA8A 5J5RA 3GNPA 4LUTB 1AG1O 4A8RA 4C7FA 3KP1A 1E9YB 4US5D 1Q4NX 4OBRA 3USBA 4EP8C 2PD9A 3CZEA 3TTSA 4ZFCA 4G7FA 3N6QA 5IM51 4GBUA 1DJXA 4UZSA 2IUZA 4DRMA 2OPJA 1OQFA 1AA1B 1S38A 3RX4A 2CHOA 3VFCA 4GGHA 5LIWX 4B9YA 1XLFA 4IGNA 1XSKA 2WYSA 4A6GA 4L4LA 3U57A 1S5MA 2CLFA 1NDYA 1MQRA 4G1KA 4EVZA 1O60A 4O53A 1MFUA 1FHLA 3U2OA 3WNOA 1FWJC 3BMWA 3QKZA 1WZKA 3L4WA 5E70A 5I2UA 2PAJA 3W2NA 2P50A 4HPXA 5A8NA 1O1ZA 2WSQA 3VMNA 3M0YA 1G7VA 3HM7A 2Z27A 1IWBA 1Q65A 3VNJA 2Y7FA 1F8IA 9CGTA 4AU0A 2ZA2A 3S6TA 3QHNA 1ZUAX 4HCLA 1L6YA 1AQ0A 1GQJA 3MC5A 4I8YA 1V3HA 4IX2A 4KS0A 4QAWA 3WL0A 1AL8A 2I9EA 7REQB 1KR1A 1R2RA 4MYAA 3QC3A 1KWGA 4MOZA 3SBFA 1QDSA 1PZ0A 2Z24A 4U84A 1G9HA 3DERA 1BYCA 4FS9A 3VD9A 1JNEA 4GVIA 5GNXA 4MWAC 3HQNA 3GTHA 1AMYA 1UKPA 3MUAA 3AUOA 5HANA 4MAVA 3PY2A 3QPYA 1KO0A 4K3ZA 1L8PA 2A0NA 3OVPA 3P5ZA 4S2CA 3DFYA 1OEPA 1PE1A 1BXCA 4ZXLA 1C93A 5GQBA 4C6IA 3GBEA 4LAXA 1OFOA 3UZZA 3NQCA 5D2TA 3NEVA 5I3HA 1UP2A 5AHFA 1BVWA 4NZFA 3UQNA 4N9DA 1TRIA 4LNCA 5H1WA 1WUFA 3Q45A 1QPRA 3PF3A 4JTSA 1BFNA 1P0EA 3KL3A 4YTUA 4XTIA 3TSDA 1IEQA 3GFZA 4MB1A 3EDJA 3PG9A 3GVQA 3EOEA 1BKHA 3P3BA 1E6SM 3VNMA 1DJIA 1NFBA 3TVAA 1PSCA 2WKLA 4HN4A 5DCEA 4IPLA 4S3BA 3CHDA 2BVTA 2Z1SA 5F2IA 3PAJA 4EPBC 3OTRA 4GIVA 4E4UA 1YDOA 5JH2A 3KLLA 3R79A 5LHEA 2W27A 2ZZ5A 4U31A 1EWDA 4I7VA 2IKGA 4H01A 3G5EA 4ODKA 2GSEA 3PPGA 1P0DA 5HATA 4Z1YA 3TC3A 1S5VA 2XIQA 3U2CA 5FJRA 3UA3A 1UD3A 3CGNA 1TELA 3UWZA 1IT8A 1F61A 3CYVA 3L2MA 3TN3A 4IUOA 2PDFA 2C3ZA 4BWLC 4IGMA 2NQHA 4B15A 3NQ6A 1M7OA 4GNVA 3AS2A 5G2IA 2G95A 1M9HA 3M6YA 1NWSA 3LENA 4UCGA 4AVNA 4B92A 1HP4A 3P8JA 1NFPA 4GVGA 4DZIA 4G7EA 3WN6A 4FIQA 1FWEC 4C6BA 1GOQA 3QGKC 3MB9A 2G50A 2QAPA 3FFSA 2Z00A 2FPTA 3C3UA 3QZ6A 2RAGA 4QRNA 1LOSA 2CLLA 4JKKA 2P10A 1DJWA 3LLDA 4X9YA 3GXFA 5FIPA 1DWAM 1DWIM 3NTYA 5D2XA 1JJKA 3TYCA 2WHKA 5U4NA 1Z89A 5C54A 3SJNA 3VIIA 3TC5A 1XGDA 3KS6A 2NQ9A 3CB3A 2CFFA 4M6QA 3KRZA 4GYFA 4JFVA 4QFUA 4X9SA 3JS3A 4B90A 1EOMA 5FAGA 2YB1A 2G41A 3WF3A 4CNSA 3HGOA 2PLKA 3CV1A 1CI1A 4QIUA 1J6YA 2FTPA 4IMCA 2VVNA 4A8IA 4HT3A 3WMBA 3MZ2A 3ZSTA 1YDVA 2M2AA 3MUCA 4YJ5A 5I07A 2WZTA 3UT0A 3M41A 2ISSA 2WJEA 3GG1A 1ITCA 3AHTA 3CQIA 3A9IA 1HG3A 3M5ZA 4GZEA 4BI5A 3RU6A 2EJAA 3WQ5A 2OOGA 1TMQA 1MFVA 4JDYA 1HJVA 3B8VA 1D7KA 3LTPA 4AD0A 1O95A 4C65A 1R9XA 3CASA 3KOYA 3M0MA 4XIAA 1TVLA 3SRKA 2XG9A 2Y70A 3KVJA 1GG1A 4KFNA 3IJ8A 2E9MA 4RXFA 4HBKA 3PN8A 3WF4A 4V1YA 1DE6A 3G8RA 3AU6A 3EDKA 4NVTA 3QV9A 3GKFA 3TYEA 5G4HC 3SQMA 4OGZA 3UWQA 3DC0A 3DYMA 4ZODA 4AIEA 3ICJA 1LT8A 1J0KA 1GCYA 3GZ3A 3GTIA 2A79A 3LPGA 3APTA 3U2ZA 3VKDA 1A47A 4PN2A 1YTDA 1GGOA 4N9CA 1CXHA 5IXEA 4MKSA 3A47A 2KE0A 3FX4A 1VJZA 2PWVA 5CGQA 1UR3M 4O8RA 1J11A 4IIFA 3CXOA 2YZ5A 5F1UA 4HZMA 2ISVA 3RLGA 4KIEA 4ROQA 4PCFA 5DN1A 3WDJA 2A7RA 4JTCA 4ZB5A 1PYFA 3GHRA 1U1JA 4LTSA 1R47A 4XAYA 1GYLA 1WOBA 5AHEA 2Z2BA 1NMVA 3AWNA 3R1ZA 5AB3A 2FZMA 3EWCA 4PMDA 2CBJA 5AYIA 2JEPA 2PDBA 1ZK6A 3EX6A 2N87A 4JTRA 5H2ZA 1XCFA 1WDWA 3RFAA 3W7DA 2B0MA 2ZZ2A 4Z2HA 2PBOA 4L4PA 4L80A 2RURA 2G3NA 2W6RA 3WDHA 1IT7A 1HGYA 4U86A 3ES8A 1E51A 1XYBA 4NU7A 2IF4A 2BASA 3BLFA 4OTKA 4WQ6A 3RDKA 1SJCA 3LI1A 5BMXA 4FSAA 4S3FA 1TX0A 1BWKA 5DRIA 1DQWA 1SQ7A 5CSSA 3GVRA 3PBWA 3B0UX 1S1PA 1FKFA 3W84A 2ASHA 3QM3A 5A6TC 3WQ6A 2WC7A 2EPLX 3TN4A 1OCNA 4UFMA 4R33A 3F2DA 3CJPA 5HPOA 5AHNA 1W1TA 5XIAA 4UBPC 1EH9A 1XLBA 1FKIA 1QNSA 3ITCA 1TPUA 3B0PA 3YPIA 5CPSA 4GJJA 3WQOA 3WQFA 3VZXA 2HNHA 1J12A 1GEQA 3H12A 1J4HA 3LCLA 1RJRA 4PH6A 1K7FA 3G1YA 3BGGA 4PR4A 4JL1A 4JYSA 2OT1A 3H7UA 3K8LA 1SFTA 3W53A 4ODNA 2VEMA 5G1YA 5IFTA 4LH8A 3GR8A 3D6NA 3NCOA 1E9LA 4IM4A 2DVUA 4J4OA 2F6KA 5A8GA 3KX6A 1IZKA 1VRDA 2PB1A 2BHZA 1VBUA 3VNDA 1TPH1 4DT4A 4OV4A 1A5BA 1GQKA 1TWZA 4WSKA 3OBAA 1GOMA 4RNIA 3HPXA 4A3RA 2HTMA 5BRBA 1I1WA 2I1OA 1NM9A 4LWWA 4O11A 1JYVA 4LAYA 1F73A 1UOZA 2WW5A 4MADA 3GIPA 1XYFA 3BW2A 1ME9A 1V0KA 4D8AA 3NL5A 3NO3A 4C6QA 4AWSA 1JCHB 1J4RA 2TRSA 4FX8A 3TLLA 4AC7C 5XIMA 4QXIA 3JXVA 5DX7A 4CQDA 1RK5A 1EB3A 4HPJA 1E71M 4GGQA 2OKOA 4W87A 5CEWA 3T4WA 3CHEA 4HK7A 3JYJA 4XD6A 3ITVA 2DSZA 3C0JA 3N2BA 1Z69A 4XVDA 2PDHA 2VZVA 3FA4A 2VR5A 1A5MC 1BD0A 4XD5A 1EDGA 4NF7A 3WD3A 2QW5A 4O19A 4BQ2A 3TW7A 4ZO9A 4PMYA 3GY1A 1OINA 4KERA 5FF7A 3RO8A 2HNEA 4DZHA 2A3LA 1NWRA 5LHFA 5CC6A 4JQ3A 4B5TA 1ZY9A 2ZVRA 4GCXA 3GR4A 5KZEA 3MKVA 1R3RA 4FX6M 4JN8A 1OFDA 4X60A 3T0AA 5DT7A 3WJSA 3HPZA 2INFA 3RF9A 1VFTA 3DECA 2YCKX 4HOZA 3DG6A 1V51A 3V16A 1WXJA 4H2CA 1UQZA 2PBCA 2ZDRA 4XZWA 4F3HA 1MXGA 2JZVA 3A13A 4CN6A 3WNLA 1RA5A 3DKLA 1KXVA 2FZNA 2R1KA 1TV7A 2E40A 2WVUA 1OT1A 2XVLA 1FAPA 1JI1A 3O8AA 4ZO7A 1CX9A 1O5RA 4IF2A 1A0EA 3R8RA 2FLIA 1PX4A 2VURA 3BWWA 4Q4KA 3WNPA 1EGZA 4I5UA 1RUSA 5AZ1A 2VOMA 4F0LA 4J5NA 1KM0A 2HV5A 3EBVA 4XAPA 1U1HA 2X0YA 4XAGA 1OIFA 1NVMA 4E3VA 4ZQOA 2DORA 2ODOA 1UH2A 3S1UA 1IXQA 3C86A 3STCA 1DTUA 3PTDA 3QYQA 2HXTA 1W1PA 1FJDA 4P7LA 1E55A 4LVDA 1V02E 3NURA 4MG4A 4GUGA 2IXUA 3R89A 2X2GA 5HUAA 4IP5A 4JTKA 5A6SA 4PRTA 2VT0A 4HNOA 5DQPA 3CPGA 5K9DA 4O1AA 5M3WA 2XHYA 1EYEA 2BS9A 1UZ4A 1RCQA 5C71A 1SO3A 3ARRA 3LCXA 1QOPA 4YU1A 3Q65A 4NASA 4E6MA 2FMNA 2VVSA 1GONA 1GZGA 4DJFC 2NLYA 4UTMA 4QP0A 9XIMA 3HPAA 3U3HA 5G2HA 1UR8A 4LRSA 2B5UB 3O5RA 3EWUA 3GD6A 4UWMA 1PBGA 1KM6A 4HNNA 5H6HA 1W3NA 1J4IA 4WKAA 2PCEA 3MSYA 4NNBA 4GZJA 3BQ6A 1XBXA 3SUVA 3W1NA 4EF8A 4IMEA 1G6CA 1PHQA 2PV2A 2FIQA 1DV7A 2BV9A 1C3FA 1J79A 3B9AA 1US0A 4CQAA 4R9XA 1ADSA 4TVUA 1KFCA 3NGFA 1Q6LA 3ARZA 2DEPA 4WDUA 4NAFB 3W02A 3GSMA 4M6VA 4PYSA 4GUHA 3GTFA 5D9OA 2ZXQA 1W37A 3N18A 3WUBA 3EWWA 1ZZMA 4C6LA 4MWAA 2ACUA 4ASTA 2OXNA 2VZTA 4KEZA 4AXKA 1E44A 4CNOA 4H2HA 4L9ZA 1F05A 4JFJA 5D9MA 3EKZA 4HPNA 3WH7A 4O1EA 2V0TA 1UUQA 2DQXA 4O0KA 1QO5A 4IMFA 5D9PA 3ALGA 1WQ5A 4DVOA 4DZ2A 1UPPA 2WJDA 4AHOA 1GOKA 1F76A 1KFJA 4WEVX 3KWXA 4Y9NA 1MZRA 2Y62A 1L1PA 4IIHA 4QT2A 2F4EA 1DJHA 2Y85A 4TMBA 2B81A 2FHFA 3DFHA 4P7NA 2NSXA 2J8TA 4YTSA 2NUXA 4GI6A 3WX7A 4PB4A 3FHQA 4ZVJA 4N4PA 3H2NA 5BU9A 4GXMA 4JBRA 3GUWA 3U7BA 3AU2A 5AN7A 3HIJA 5JIPA 3K4AA 4B91A 3W6YA 1BF2A 2Z7GA 3T0CA 5CPQA 4AUBA 1DYSA 2VFGA 4FALA 4WGHA 3CUJA 3B40A 4L7ZA 1BYDA 3BAIA 2FKEA 3TYZA 4GH1A 5CBBA 3ABSA 1R7AA 1J9YA 3N4AA 1N82A 4B5VA 3FJ6A 3W1UA 2D3LA 4N2YA 4J9JA 4EK7A 3MUIA 4D2JA 4ALDA 3OPSA 2JKPA 1EX5A 5CCZA 4TX9A 5F2GA 2DV0A 4IQEA 2H3DA 3TXZA 2Y6ZA 4GNKB 1PL9A 1T99A 5JBDA 4HHHA 2FDMA 3GG7A 1PXGA 1JZ8A 1BXNA 1YW1A 2Q01A 1DE5A 1S3HA 4C6EA 2ZDSA 5H8MA 1XL9A 1V02A 2F7FA 3K2GA 2VFFA 5FEPA 1HKVA 4J3VA 4FEZA 3CHVA 3O0FA 4GPNA 3UQBA 2HBXA 3LPPA 4PULA 1RP9A 3V3WA 2C91A 3EOLA 1FXQA 1J6OA 1R87A 4GO8A 2MANA 1XRFA 2V3DA 1XPGA 4DBUA 2YCIX 1QNRA 3W1MA 4AMCA 1QPQA 1IZCA 1VPXA 4E8GA 4A3UA 4ZPTR 5JH1A 1OBAA 5PTDA 4IP7A 1BVNP 4U5IA 1UR2A 1E3XA 2C8NA 3O07A 2XISA 3CQKA 4Y7EA 1V3JA 4L65A 1WPCA 4ZTXA 1UZHA 1JEZA 2PDQA 4QHRA 2AQOA 2GDQA 3BK0A 3WH0A 3TFCA 4GYPC 1MRAA 3PTQA 5AHLA 4WSHA 1TSIA 4KPLA 2YLAA 3SGZA 2PFHA 4ZPVR 3R25A 4Y96A 3EWXA 1RP8A 3A4JA 2QUVA 3G8EA 4JFTA 3RU8X 3I6RA 3WNMA 2ZIDA 3CNYA 3WNKA 5HW8A 2GUYA 3PWGA 1F3WA 3AHVA 1BHGA 1FWDC 2XP7A 1F4HA 3LCGA 1FKXA 4J2MA 3M64A 3QMSA 3PFRA 3CLMA 3R13A 3W1PA 5LNVA 4N6FA 4V1XA 1GVRA 4WDTA 1H1NA 2WQDA 2E8ZA 2J6VA 1U5JA 4QBXA 3VZZA 1R8LA 4JL2A 1KBLA 1OG0A 4GG9A 3WK1A 2WPGA 1MO0A 3KOXA 5CLTA 3H55A 2QDHA 1JUEA 1W8SA 2UBPC 1A5AA 3AS3A 4JYEA 4BKNA 5C55A 3W7QA 3ITXA 4XKYB 2CWXA 1EP3A 4H41A 2E09A 3S2MA 3KTCA 1IWPA 3RLUA 3WH6A 2J7EA 5FF0A 1Q2SA 3PBMA 3EB2A 4KRUA 1KD0A 3A21A 3NQAA 4P5UA 4W84A 1EO7A 4UB9A 1DBTA 1KGUA 2C15A 1QASA 1LOQA 2H9AA 4BK9A 2VX6A 2G8ZA 3HV9A 3UWUA 2ZUWA 4M1BA 4TNSA 1JCTA 2ZXDA 3ABOA 2E9BA 4GH3A 4FLOA 1LBMA 4XSMA 3WH8A 3UXKA 2J77A 4HYRA 4B2DA 5BXRA 1SYTA 2NV9A 4N0RA 4LAUA 1FCBA 1JDAA 2D0HA 4LYQA 3FOKA 4UFKA 3AZRA 3TC6A 4ZEPA 3DGRA 3TCSA 2QCMA 4YHGA 1D7FA 5AC6A 3Q94A 2GGIA 1RPKA 1PWLA 1N7KA 1R3SA 3BUVA 4ZO6A 6TIMA 4Z17A 2ESCA 3LY0A 4BEQA 1VYPX 3TXVA 1X6LA 3PZVA 3FDGA 1US3A 3WK3A 3AYVA 5HR6A 2C1HA 3UG3A 1RALA 5A95A 3RX2A 3GKAA 2YL5A 4M5PA 1AW1A 1TIWA 5CGTA 5C9UA 3FYOA 4JN6A 1IZJA 3T8LA 3O5DA 4LUYA 3STEA 2R14A 2VZSA 1Z48A 4IJRA 4O0ZA 5DT5A 1GG0A 4MB4A 1FHDA 4AVFA 4AEOA 1Q45A 1VBJA 5KEZA 4AH7A 1GZ1A 2ETNA 5BOOA 1PTGA 3QH2A 1QCWA 1NDWA 4JNMA 1MEWA 2A1YA 3WQGA 1G0CA 1K9EA 3GG0A 1KWKA 1S2AA 2OLSA 1E5JA 1H7RA 1R2SA 3TDFA 1G4TA 4HNTA 4F0MA 1B3ZA 3I6EA 2XP8A 5F4SA 2YPIA 3ANYA 1ZNNA 3EXTA 3L68A 4Q4QA 3ZJ8A 2V82A 1MUMA 3SCVA 3DZ1A 4ZB2A 2HVMA 4E2VA 1XHGA 4DWSC 4RNFA 1JI2A 2A3HA 1I8JA 1Q6CA 4JQ2A 3IV8A 2WVSA 4U3CA 1CGVA 4H6QA 1X98A 1VFMA 3R0DA 3LXAA 1UZ1A 1ZRQA 3BLPX 3BPWA 4FOJA 3ARYA 2VDIA 4M51A 3LM7A 3DEQA 3O15A 3PPFA 1OF8A 5H91A 4M56A 1J10A 4H9VA 2OFJA 2REQA 4GIEA 3LEPA 3FW6A 5IRPA 3LM3A 4S3KA 1BWVA 3IANA 3BCFA 1TWSA 3AYSA 3ITGA 1O6IA 5CJNA 2ZUVA 2A85A 1EYMA 3OBKA 5C9RA 3B8UA 3TU9A 4KW2A 4NZ5A 3VIGA 1DEDA 3DAQA 2TPSA 1QW8A 3PM6A 2J7CA 5EPDA 2AGKA 3KL0A 1HJSA 2XP9A 4HB7A 3AXKA 5C0QA 1AK5A 3LCWA 3W7IA 3M4HA 4JFLA 5FKYA 3FSUA 1V6XA 3ME3A 2WC3A 1CECA 1OYBA 2WHJA 3CQHA 1MW3A 2YX0A 4MY8A 4AWEA 4PL1A 1KTCA 2E28A 4QJ5B 1KXQA 4NP7A 1Q6RA 1RAKA 3WBAA 2GUUA 1DOSA 3CL8A 1C29A 4UQBA 4PB3A 2E6FA 4D8LA 3UXIA 3WCZA 3LGEA 3MDWA 4GLEA 4D1JA 1ODUA 1PPIA 1XBZA 4PUNA 2F84A 5DY3A 2PMQA 4EXAA 4IFOA 1QPKA 3DC8A 5DXXA 2BXYA 3NO1A 4O1DA 5HW6A 4WKHA 2PDJA 2MLZA 3VXGA 4U3AA 1HQTA 2PP0A 1KC7A 1QNOA 2X7VA 2XFWA 4A2RA 2DQWA 2E6YA 3L0GA 3ANVA 3WD4A 1Q8JA 3OYXA 2W92A 3ATZA 2XWDA 3IUIA 3IACA 3N19B 2XZ7A 2GL5A 2UY4A 5DIUA 4LVBA 1ROUA 4HSNA 3V0UA 1ME7A 2BVYA 3WLKX 4JCLA 3UWWA 4C6JA 2WMIB 1K4HA 2UWFA 2WCAA 4JFMA 2JK2A 4UC5A 4J28A 3STGA 1JDDA 4CU6A 4LUTA 1TWIA 1SZEA 1PZ2A 3ZZ1A 1GYNA 3LN3A 1XLAA 4HTBA 2VCAA 1RBLA 2RDXA 2WMKA 4GK8A 1XLIA 1O5KA 3N73A 3IJDA 3LLFA 3NPUA 4DPQA 4HOXA 2VN1A 1KQYA 3CAKA 1ITQA 1M03A 3CAWA 1SSGA 3DXIA 2DT1A 1R85A 1UA3A 4DRIA 4P8UA 5DELA 1UC5A 4C7GA 3VOJA 2X09A 4UNIA 2JIEA 5D2WA 2FVMA 4HHPA 4EAMA 2CLKA 1UASA 4JS3A 1MDLA 3QV8A 3AIWA 1KCLA 1KBKA 3KBWA 2E5BA 2ALDA 2NQ5A 3C3NA 3VKBA 4QM1A 3JU2A 1KBBA 2OYKA 3PZIA 1XIBA 3OJGA 3PRDA 1XF0A 1RD5A 2WANA 1A5LC 1E15A 4FLRA 3O1NA 2XZ9A 4DJED 2BFGA 3EDDA 3UQAA 3DOPA 3BJSA 2FKPA 4O1CA 1IYXA 3VOIA 2YFNA 3WEZA 3VOCA 4PFHA 3N4FA 5G2WA 3MV11 3HGSA 4WSJA 2ON3A 1SVDA 1LCOA 4DRQA 1JPDX 3BDKA 1P0BA 1S5TA 4IFKA 4XBKA 1JDFA 4NRSA 3WK0A 2RFGA 3C0LA 1SGJA 1E40A 2EBNA 4Q4RA 1T11A 4PRWA 4OVXA 3VK5A 3VDCA 4L9YA 2XVNA 5IBXA 1SO4A 1W9UA 1CLXA 1I2PA 1WKYA 4LW7A 1FXPA 3GXDA 5C9WA 3R5EA 4ZL1A 3E12A 4HD5A 2F2KA 1BGAA 1KFKA 3ZT6A 3W6LA 3IGXA 1FCUA 3C8NA 3M0VA 4JFWA 3PSVA 1T8XA 2JFEX 1T41A 5G1TA 4LUSA 5HMDA 1KM4A 5GJMA 4QG9A 1SM9A 4CQCA 1K6AA 1E0UA 2VUNA 1RBAA 3MYOA 4FLQA 4NIRA 3V5OA 6PTDA 1CXEA 4WY0B 4O18A 3QKEA 3IPWA 1N55A 3MTWA 4DM1A 1GVEA 3PP7A 1ZALA 1N8FA 2HCVA 5HQLA 2NUWA 4JIEA 2J7GA 4J27A 2Y5SA 5D04C 5EU9A 1I45A 1FDZA 2OB3A 1SZFA 4C60A 4JQAA 1OCBA 2NQLA 1BF6A 4JICA 1ZL1A 2RHGA 1DWFM 3TSMA 5HQEA 1IF2A 4YCPA 5JBFA 3B8IA 1SO6A 4MDOA 5C2GA 4HZ8A 2TODA 3LNMA 4NI3A 3UEQA 4Y8FA 4Q6JA 4C6OA 3N6HA 1J5SA 3UI4A 4PMXA 1W5PA 3HOJA 4XAKA 2J75A 4H6KA 1YIXA 1OD0A 2V3FA 3WEMA 1DJGA 3TH6A 4NQ1A 3GE7A 3DI0A 3G1XA 1UR9A 2EULA 1JCMP 4U2ZA 4GY7A 1MVYA 3MW7A 5C8BB 1UQYA 3DENA 2PWUA 3E74A 3STPA 5D37A 3THUA 2VEIA 1LWHA 3SUUA 1S39A 3MHUA 4X63A 5A8QA 1Y5XA 3SM0A 1DORA 1T0OA 4MNJA 5G4WA 4WUIA 1HNYA 4AZIA 2DPEA 1XDJA 3KBSA 2NVCA 4RCXA 5CG0A 1H61A 1FWRA 1E6XM 4I9MA 1XYCA 4Q4OA 4ADUA 5FEXA 1UYQA 2AL2A 3WLTA 3UPBA 2PTXA 1Q6HA 1FWFC 5TF0A 3KCEA 1L0PA 2CHNA 3E2RA 3NDYA 1HKJA 4Z0SA 5T9BG 3TR9A 4A29A 5A2BA 4ZS6A 3W86A 5JVLA 1C9HA 2WJZA 1JF6A 3RFWA 1XIMA 3QY8A 3UJEA 5K9CA 2CZFA 5K4ZA 4H9YA 1XH1A 3POHA 5LGXA 3I10A 1XUZA 1TPC1 4JR5A 2GJNA 4FMVA 4POCA 3ARUA 3HMJG 4EX4A 3NQ7A 4LT9A 1DHPA 1A0CA 4MKNA 1H51A 4D8ZA 2QJMA 1J2WA 2EPOA 3SN1A 4GWEA 3S1VA 4WOQA 3OG2A 4KEUA 2GGJA 1IWAA 1BG4A 4QIBA 1R3WA 4ZZ9A 3TE9A 1W6TA 4JHZA 4A3HA 4HPHA 3QMRA 3TTEA 3IJLA 3N13A 1K6WA 4RXGA