1HKIA

Crystal structure of human chitinase in complex with glucoallosamidin b
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
365
structure length
365
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
total genus 121
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkiA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkiA01
1V3HA 1GONA 2J74A 2UY3A 1LL7A 4TX8A 2XVGA 1BVNP 3O9NA 2GJRA 2X0HA 2OSXA 5A1AA 1XD1A 3VGHA 1E0WA 4HP5A 4ACZA 1OGSA 4RE2A 1BYCA 2QPUA 1V3LA 4WKFA 1VB9A 1CEOA 3PZGA 3MU7A 4B3KA 4GINA 3WD1A 1PIGA 1E72M 4U3AA 2WSKA 2EPMX 2J8GA 4EKJA 5EBAA 1B30A 4AIEA 5M03A 1FH8A 3GYCA 1NWUA 1J0ZA 1CNVA 2VR4A 3EDFA 7TAAA 3L2MA 1E70M 1ZBCA 1NWRA 3MSGA 2XFFA 1PZ2A 1GOIA 2O9TA 3AXIA 4HA3A 3WQ4A 4WSKA 1KQYA 2YA2A 5FL0A 3VIHA 4M80A 3VIJA 4MNLA 1IT0A 2NW0A 4FF5A 1KXVA 2BY2A 3WUFA 2W66A 1ZBVA 4M8UA 2WC3A 3N9KA 1FH7A 1M01A 1HVQA 3GBEA 2VL4A 1I1XA 3WNOA 5CJ5A 4DM1A 1U2YA 2ZUMA 3HU7A 1FFQA 4HU0A 3AMCA 3UERA 4JFUA 4BCEA 5A6BD 2BXYA 1JZ3A 4MTVA 1UD8A 5IHRA 3BAWA 1EO5A 4ACYA 1W9BM 3LPPA 4Z2HA 4WK9A 2VZTA 3IJ9A 3MKKA 1CLVA 1MW1A 5E0FA 1CXFA 3OG2A 1EGZA 2J78A 6A3HA 2YLLA 1MW3A 1W32A 3FAWA 4GIAA 1BFNA 4P7RA 1OD0A 3W37A 2ESCA 3CLWA 4ZEPA 4JHOA 3WENA 3PHAA 4R5EA 1JXJA 4W8LA 2VNCA 1B3WA 2DDXA 2XGBA 2CERA 4TOQA 1E5NA 3TA9A 5HPCA 3DHPA 2BY0A 3DECA 3F4VA 4AZGA 1LWHA 3AROA 4IUGA 4AW7A 1W9PA 3PTQA 1C7SA 2DIJA 1XV8A 1BG4A 1PJ9A 1TVNA 2WMKA 3IJ7A 2DSWA 1ISYA 4NRSA 3OA5A 4OOZA 4RE4A 4GI9A 5A8PA 5JH8A 2V5DA 3WEZA 2ZUUA 3BSHA 4PRWA 2PC8A 4AD3A 2AOSA 2PWFA 2DH3A 3VIIA 2J25A 3ZJ8A 2J7FA 2WMIA 2VO5A 4U33A 1UWRA 1TFVA 2J7BA 4AEFA 4NF7A 5A95A 4AWEA 2Y4SA 1NQ6A 3W6LA 2WCSA 2DGAA 3WY1A 4XZBA 1TVPA 5LA2A 4HZ6A 3ZM8A 4L4PA 1J9YA 2WPGA 3MMWA 1JXKA 3W81A 3T2OA 4N42A 3VD7A 4GZJA 3WNLA 3WQ8A 4XB3A 2GUYA 3CIVA 1CGWA 2VZOA 5A6BA 2WB5A 2VZUA 4QCFA 4J3XA 5E6ZA 1XYZA 1OGBA 5LA1A 4HMEA 5I23A 1O7AA 1CGTA 1TE1A 1V0NA 5A2AA 2DQXA 3K8KA 1ZS2A 1IZKA 4IPNB 1UKPA 1M04A 4UTFA 3GNRA 1GPFA 2J4GA 3T0BA 1RP8A 2DT1A 4QDMA 1B3XA 1TR1A 5A3HA 4PMYA 2PB1A 1E43A 3OLDA 3L4ZA 3CHEA 2DEPA 8CGTA 3ARRA 1JI1A 2PBGA 4JHZA 4B9ZA 1EXPA 4H41A 3VNYA 3W29A 5I2UA 1HKKA 4AY1A 5A6KA 4DWSD 1J0HA 5E6YA 1HKMA 5KEZA 1DWIM 1G1YA 1GJUA 3ZT5A 4CU7A 3RJYA 1JZ2A 4D6HA 2GJXB 1ZL1A 3AHXA 3VO0A 1PX3A 4AEEA 4D71A 4YHEA 4WSJA 1FHLA 1XC6A 1GNXA 3M07A 2ZICA 4BA0A 2WYSA 2XVPA 5A8QA 4HOZA 4WKHA 1EHNA 1EH9A 1E4NA 1AQ0A 2AAAA 3ARZA 4JIEA 1W3LA 5A6MA 1AVAA 2W63A 4GPNA 3UG4A 1V6UA 1M03A 2GK1A 3W27A 2WLZA 1CGUA 4CCDA 3FHAA 2UY2A 2IUZA 4Z2KA 4TUFA 4WF7A 2WK2A 2XG9A 1V6XA 1BHGA 1UYQA 5GNZA 2D3NA 3D5HA 3CZLA 3G6LA 4LXFA 4KRUA 2E9MA 1KXHA 3PZQA 1UH2A 1BLIA 2DSKA 5D9NA 1UWTA 2YOCA 1R8LA 4HTYA 4P8VA 3WDIA 2XVNA 1PX8A 4JFSA 1KBBA 1W1TA 5GNYA 4J28A 5BXPA 1U30A 1C92A 5C70A 2WVVA 1V02E 4HMDA 4MNJA 4M29A 3TTQA 3NSMA 4FLOA 4AD5A 1H3GA 1E0VA 3ARTA 3DYMA 4Z2IA 3DC0A 1V08A 3TONA 2RGLA 3DYOA 4P8XA 4UFMA 3AZRA 1ODUA 2XSBA 4UQ9A 5BXSA 4N0RA 1RPKA 2EQDA 2J62A 4ATWA 2BY3A 3W26A 4J3VA 3K8MA 1NWSA 1MYRA 2HVMA 1SYTA 2YL6A 3ARXA 2WWDA 2V3EA 1C8QA 4DWSA 3OB8A 1VBRA 1VFOA 3PZUA 3VMPA 1W3KA 3ECQA 2W67A 5ECUA 2ZUNA 1RP9A 1JYXA 1G94A 1H09A 2DSZA 2D22A 1DWHM 4ZE5A 3W53A 1HT6A 3CBWA 1ITXA 1V6VA 4UOQA 2D0FA 5D9PA 1ZB5A 1BYAA 4GZIA 3BAIA 4JCLA 1KGWA 3APGA 2YDSA 3AHZA 2Z1SA 3PZVA 4NI3A 5I79A 3A4XA 4MADA 1QI4A 5GPRA 3EMCA 3VD9A 2D3LA 1UKQA 4LQ1A 1TG7A 4WKAA 4GI8A 2CIPA 1H49A 3BH4A 1XYFA 1UOKA 3A4AA 2WAGA 1GQJA 4DUVA 1GOKA 1VEPA 5JIWA 3WF4A 5CGMA 3B9DA 2WZHA 3A6OA 4JKKA 1W9XA 4HZ7A 2A3AA 3SIMA 3T0DA 3N04A 2CPUA 2VX7A 3VMOA 3W4RA 3A4WA 5E9AA 1W3JA 2CBUA 4AD4A 1VRXA 2JFEX 1OT1A 4R27A 3WMBA 1K9FA 5AC4A 3JUGA 2YDRA 5EMYA 1RD6A 4AZHA 4YPJA 1VEMA 2WZEA 3VX0A 1ZBWA 2GVYA 2J77A 1XSJA 4CD7A 2ZOXA 3GXDA 3GXFA 2Q8XA 2J7HA 3WL1A 1JZ8A 4B15A 3CUHA 1EDTA 1CTNA 3AISA 1R85A 4FK9A 4AZBA 1FP8A 4IM4A 3T09A 2JALA 1VJZA 2QMJA 2X0YA 1XH1A 1JNEA 5BRPA 3CO4A 3WF2A 4CD6A 4AD1A 1AMYA 1P6WA 1W1YA 2ZX5A 1JF5A 2NT1A 3AYSA 1E71M 2PI6A 2TAAA 1WE5A 4XUYA 1H4PA 1MWOA 3WEOA 1WAWA 4J7RA 1B3VA 4FLSA 5ABFA 4PUDA 1FFRA 3MV11 1VF8A 1JZ5A 1PPIA 1HL9A 3WH6A 3BCFA 1HIZA 3CZEA 1IZJA 3AIUA 2NT0A 1ISXA 2E9BA 4NZCA 2DT0A 3ZSTA 3T2QA 3GM8A 5FIPA 3CMGA 5EB8A 3W6MA 1PEZA 3PZ9A 2D0HA 3MUAA 4B9YA 1E5JA 1XSKA 2PWGA 2BNJA 4PMOA 3AQUA 3BMWA 4QFUA 4MAVA 5A8MA 2J75A 3VMNA 4X0NA 1JD7A 1Q4NX 2J7DA 3EDKA 1J10A 4JL2A 3OGVA 1H0GA 1JDCA 1QI5A 5BXTA 1UR1A 4JFTA 5C71A 1CZ1A 2FDMA 1WZMA 3PTKA 4TX6A 2WW5A 2D23A 3E1F1 3MUZ1 1V3JA 1TUXA 1EQCA 1BYDA 4JCMA 1O6IA 4P7QA 3WF1A 4FLQA 3VD5A 1DP0A 3MMUA 4CU8A 5A94A 3SUSA 1BF2A 2FH8A 4UFHA 3F5LA 3BAKA 5CPQA 7A3HA 3VDBA 3BGAA 4AXNA 4D1IA 2BHYA 3RMEA 2WMGA 4OKDA 3PTMA 1E3ZA 1JGIA 3MO4A 1ISWA 4J3WA 3RM8A 3F5JA 2JEQA 4S3KA 3NSNA 4D1JA 1D7FA 2WMFA 3L2LA 5GNXA 3UR8A 4LYRA 3WQ5A 3AIRA 5KZ6A 1XCXA 3WBAA 3AZTA 3AI0A 1JZ7A 5JIPA 1JF6A 1F4AA 2BFGA 1E6PA 2QF8A 4EK7A 3THCA 4D6DA 2YBUA 1VEOA 1YHTA 1DWFM 2J8FA 3GH4A 1NOFA 1HXJA 2BV9A 1QNSA 3T0AA 1XSIA 3N12A 4B3LA 4J3SA 5DF0A 4MB1A 1H41A 1G01A 3SUWA 2VX4A 4CVWA 4HPGA 1GUVA 1MFUA 1C7TA 1V02A 1KGXA 3SCRA 1LF1A 2ZIDA 1W2PA 3WH5A 1LG2A 4JZ5A 1W9UA 2V3FA 1OT2A 4A3HA 1OIMA 3WL0A 1GJWA 1B9ZA 2VX5A 3BCDA 3SCVA 3CPUA 2EPNA 3WKZA 4MB3A 4U2YA 2D20A 3NUKA 3VVGA 1E6NA 1R7OA 3MMDA 1LJYA 5CQ1A 5LYRA 2VC9A 3AIEA 4HMCA 3VPLA 2V3DA 1OBAA 2BVYA 4HA1A 1B0IA 4P7LA 3ARWA 4J27A 4CD5A 5AYIA 3CH9A 2WCAA 5M3WA 2E3ZA 3LMYA 2BHUA 5BRQA 4YHGA 3VM7A 3N15A 1W9DM 3L4YA 2WLYA 2VJXA 1HKIA 1UWQA 1JFHA 3CZGA 3QR3A 2VRKA 2ZXBA 3OLEA 1QHOA 1OWQA 3CGTA 2W62A 1OINA 3VOCA 2WM0A 3MS8A 2FHCA 1CXHA 4MDPA 3EDJA 3W82A 4BQ2A 2O9OA 2DIEA 1W91A 3DHUA 3WDQA 3MSDA 1ITCA 3WIJA 4PMUA 4U5IA 1WO2A 2OSWA 1WDSA 2O9RA 4Q7NA 2DT3A 1JDAA 2A3EA 4XX6A 4Y7EA 4H8VA 4PTWA 2C0HA 2WMIB 9CGTA 4U5KA 2ZE0A 3M46A 1KB3A 4QP0A 1JD9A 1VFUA 4PSPA 2XFYA 1WB0A 4E8CA 4UQEA 1KFWA 3RPMA 4PMDA 1B3YA 1E6RA 4NRRA 2OWXA 4UQDA 2W5FA 3I3EA 2OYKA 3WDPP 2A3HA 4PN2A 1QHZA 1KXQA 3IK2A 1WZAA 3NDZA 2YL8A 1UZ4A 2PWHA 4GQQA 2X1IA 1BG9A 3IAPA 1B31A 1QI2A 4AZCA 1GQIA 2F8QA 3CZJA 3SCTA 3GNPA 4FLRA 1QNPA 1VENA 4GQRA 1J0YA 2D1ZA 3ZR5A 1JYVA 4CU6A 2DPEA 4JL1A 2D0GA 5FOOA 4UQCA 1JG9A 5DT7A 1DHKA 1E3XA 1CGXA 1QBAA 2WHKA 1UR8A 1LQ0A 1EA9C 2QLYA 2OLHA 2BVDA 3RM4A 3GH5A 2G3JA 1TA3A 1UH3A 1PX4A 2CCRA 3T2PA 3QHMA 4UOZA 3LPGA 5CPTA 3UG3A 2PWEA 3WFLA 1M53A 1V3IA 1EDGA 2F2HA 3RIKA 3NCOA 3AJ7A 1H2JA 2XHYA 1OGGA 3ARQA 3AFBA 3WH7A 3RM9A 3BLKA 2W4XA 1BAGA 5D8WA 2OSYA 1XHGA 1HP4A 1UR9A 3OBAA 3WELA 2VCBA 1ISZA 1FOBA 4C7FA 5CG0A 4OBSA 1XGZA 2WKGA 4DM2A 3CMJA 1CGYA 2BS9A 4CCCA 1CXEA 4K68A 1UG6A 3SCSA 2ZX9A 2VQUA 5M17A 1EO7A 1B1YA 1HF6A 2GJXA 4X9YA 4AYSA 5I0DA 3SUVA 1AQHA 1WDRA 2VCAA 3UESA 2DSVA 2J7CA 4UFLA 1AQMA 2GJPA 4QCEA 2VOTA 4H2CA 1WCGA 4J3UA 1B3ZA 4CD4A 2ZX7A 1KCKA 4CCEA 2XVLA 1E9LA 5I24A 3TP4A 4H7VA 1G5AA 2GK1B 4EAMA 2WMHA 4PYSA 4JFWA 4WIWA 4BQ4A 1HX0A 1CPUA 4PUEA 1W2VA 1Z32X 2JF7A 3J7HA 1GOMA 1W1PA 3VKKA 3WD0A 3AICA 4W84A 1UWIA 1JYWA 3VDAA 4TTUA 3U7VA 4PBGA 1SR0A 3RILA 4ZFMA 2AMGA 1R86A 4PMZA 1J0IA 3OGRA 5LA0A 1V0MA 3SCUA 3SCPA 3WQVA 4BF7A 2OYLA 2WVVB 4H8UA 3VGDA 1V3MA 1KWGA 4W7UA 3SUUA 3ZJKA 1E1EA 1FHDA 2Y24A 2YKKA 4MB5A 3WBEA 1UA3A 4LYPA 4Z2JA 2O92A 5E09A 5A6JA 4QAWA 3VIPA 4HOWA 3WEMA 1BGGA 5CXPA 5CZKA 3ZSSA 2JIEA 4V27A 2V5CA 5D9MA 2IXVA 1W3HA 3NIYA 4F79A 2JIWA 4D6JA 3VM5A 1FA2A 3KL5A 2XM2A 3HJEA 1MW2A 4EANA 4OJYA 3VX1A 4DWSB 1HL8A 5FD0A 1KR0A 3NYDA 1GHSA 3FY1A 2VRQA 2XWDA 1MQQA 1G0CA 5I6SA 2VMFA 1JIBA 1V6YA 3BLPX 1NH6A 1CBGA 2VZSA 3SCNA 3U57A 3U7BA 3N13A 1UKOA 3UG5A 2FGZA 3CUJA 1JYNA 1K9EA 1I75A 3RCNA 4HU8A 3TTSA 4Q22A 4D6EA 2CHNA 3RJXA 1EHAA 4OBRA 4C7GA 2UY5A 4KGLA 2ZX6A 3AMGA 5BROA 2BXZA 4DWSC 3WMSA 5EFDA 1WNOA 4P8UA 5HDRA 4UFJA 4W7WA 3ARVA 5DT5A 4Z2GA 3QOMA 4HZ8A 2WNWA 2F61A 1Q6DA 1JZ6A 2WC4A 4UFKA 2V38A 1CIUA 5DO8A 1CGVA 3WNKA 3ZOAA 2VURA 2DSUA 3B8SA 1HJUA 1QHPA 1L8NA 4UQBA 2VT0A 1C90A 4M81A 4W88A 2GDUA 3GNOA 1V6WA 4TXEA 1QNRA 2O9PA 4XV0A 2OWCA 3MANA 3CHFA 3SCOA 4F9DA 4OOUA 3VUPA 4AC1X 1CENA 4W7VA 3PZIA 3L4XA 1OM0A 1WZLA 4MJ4A 3VIFA 1QI0A 2X05A 2YA0A 1UD2A 1BQCA 1EDQA 2W92A 3W28A 3WNPA 1LG1A 2VRJA 4MB4A 5D8ZA 2YJQA 1DWJM 3VGGA 1D2KA 2EEXA 1R87A 1GOQA 2ZUWA 1VFMA 4AZ6A 4MJ2A 2CNCA 4W5ZA 5D4YA 1E0XA 2PWDA 2EXOA 3OZOA 2NSXA 2YL9A 3SCQA 3THDA 1E40A 3QHNA 2W61A 5D9OA 1JAEA 3WDHA 3NSXA 2Y5EA 2WVUA 4P8WA 4CGTA 5IXEA 4AD0A 2WCGA 2WHMA 2WXDM 2ZXQA 2Y2WA 4KRTA 3ZMRA 3L4VA 3CTTA 1BGAA 3GH7A 3O6AA 4W8BA 1X6LA 1UR0A 3II1A 1HJWA 3ARUA 4W87A 3AS1A 1C8XA 3BAYA 3GZAA 3WDRA 4UCFA 3WF3A 5I5RA 4MNMA 3ALGA 4OIFA 1K9DA 1CLXA 4GZEA 4PMVA 3VD4A 1KGUA 5EFFA 2XWEA 2G3IA 2PF0A 2QPSA 4ACZB 3SURA 4FMVA 2G41A 3PN8A 2E0PA 1MVYA 2UY4A 1S46A 1QBBA 2EPOA 1K6AA 4U3CA 3M7SA 4AD2A 3GTNA 1J11A 2A3BA 1ODZA 3BAJA 5HBFA 2OYMA 4JKMA 1GQKA 3PZNA 2YL5A 3AXHA 3AMLA 2FGLA 3W25A 2VZVA 1Y7VA 1XD0A 5C8BB 3I3DA 1YQ2A 1UKSA 5FKYA 3ZR6A 1NOWA 2GFTA 1HN1A 1M7XA 1Q6GA 2VTFA 1TMQA 1BPLB 4CN4A 3SUTA 3WF0A 2ZWYA 1MW0A 2J79A 3G6MA 4W85A 1NWTA 4W93A 2WSPA 5JBEA 5JBFA 1D3CA 3VIOA 1KWKA 4PMXA 4PCTA 4AISA 1GHRA 3WDJA 4W8AA 5JBDA 3U5YA 1MQRA 5HPOA 4F66A 1SMDA 3LPFA 2E8YA 2X2YA 2G3NA 2EJ1A 3WSUA 4PMRA 1ZJAA 1OIFA 2Y8VA 4YN5A 3O2LA 2VX6A 1GCYA 3FHQA 1E4MM 2CBVA 2EBNA 1L0PA 2CBIA 4F8XA 1VJSA 1WKYA 2CYGA 4LPCA 3BSGA 3WUGA 4IPLA 3K4DA 4URIA 4KWUA 3VU2A 3AMDA 1K9TA 1E6ZA 2VUYA 2B31A 3S2CA 3WFZA 1TZ7A 1MXDA 3BMVA 3RDKA 1Q6EA 3GDBA 1FH9A 4P7OA 3WNMA 1LLOA 5HNNA 4D6GA 4UFIA 1CYGA 2XGIA 2ZXDA 3L4TA 1WP6A 4H04A 3WMCA 1W9VA 2VVNA 4PMQA 4W86A 3AZSA 2VR5A 1EOKA 5F7UA 4HA4A 4UQAA 1EQPA 4W5UA 1E1FA 1UHVA 4X0VA 5DMYA 4U31A 3IJ8A 1J01A 3LPOA 5BWFA 1PZ3A 2ZUVA 3AS3A 3AMKA 5HXMA 2BHZA 2FH6A 3OLGA 1Q6CA 3ZQ9A 5FL1A 2C8NA 2YA1A 4UZSA 1PBGA 2RGMA 3KZSA 2HISA 1BVZA 5ABGA 3VIKA 2W91A 5AY7A 1UUQA 5AYBA 1JL8A 2YDQA 4GO8A 1HKJA 5IFPA 1ZJBA 1OCQA 1HJVA 2D24A 1UKTA 3ZJ7A 4WLCA 3B9EA 3FW6A 2XJ7A 3FXYA 3WH8A 4WJXA 2BY1A 1V03A 1V0LA 3QHOA 3N17A 3ZIZA 1UD4A 2WANA 3N18A 4BQ5A 2EPKX 1OSEA 1E55A 3ALFA 3BC9A 4KMQA 1A47A 4ML4A 3AHYA 3CZKA 4PSRA 5DEZA 3ZJ6A 2GDVA 3GXMA 1W1VA 1U33A 4UR9A 4P7NA 2WBKA 4D6CA 1KQZA 4AZCB 3WD4A 4NSBA 3UEQA 1JI2A 4ATLA 1KR1A 2JEPA 2X8RA 3CUIA 4DUWA 3VNZA 3QGVA 4GXPA 5A69A 4QLJA 1I1WA 1JDDA 2WVTA 2DT2A 3VIMA 3IANA 3PZOA 1UA7A 1V3KA 2V3GA 4JAWA 3N11A 1OD8A 2VCCA 1QNOA 2XYLA 1C91A 2QV4A 2WVSA 4E8DA 1BSIA 5IFTA 1VAHA 1TA3B 2J47A 4V2XA 5A6LA 3W24A 4A3YA 5DFAA 2J7GA 3TOPA 3MUIA 1X1NA 3S6TA 1ECEA 4TVUA 1RH9A 5ABEA 3DYPA 5A2BA 5BYWA 1CECA 1GOOA 4OUEA 2ZUTA 1A3HA 4V28A 2BVTA 2YLAA 3AIBA 5I77A 5CPSA 4CKQA 4UNIA 3EDDA 1E56A 1E4IA 1UD6A 2PBOA 3TTYA 3WD3A 2X09A 1GVYA 3WH9A 1TCMA 4KH2A 3K8LA 1HVXA 2CESA 3VD3A 4PTVA 3ZT7A 3AS0A 3BXWA 4C7DA 3UETA 2JF6A 1E73M 1NOUA 3RO8A 1LL4A 3VTRA 4E2OA 1NARA 5CSUA 3ARPA 1B2YA 1JFXA 1EOMA 2XUCA 4B16A 4LGXA 1CXIA 3WD2A 3SCWA 1J18A 2CHOA 4M82A 3CHCA 4ZXLA 1DWAM 5BCAA 3N1AA 2CBJA 2ZUSA 4ZE4A 5CLTA 6CGTA 3EBVA 5ABHA 3NDYA 3EYPA 1JAKA 1QOXA 5IDIA 1C8YA 2CKSA 3VGEA 4UZUA 2OWWA 3AOFA 2G8ZA 4GI6A 1CWYA 4E4PA 3FNDA 1UH4A 3AHTA 3EMQA 2XTKA 1E6QM 2WZIA 2WWCA 1MQPA 4H8HA 4PCSA 5E0CA 5AC5A 1SMAA 2GSJA 1NP0A 3T08A 1B90A 3OZPA 4BS0A 4GKLA 1GVIA 4PMNA 5A2CA 1ZU8A 1G9HA 2XIIA 1C3FA 3KWXA 4J3TA 1UD3A 1QW9A 3ZT6A 4CN1A 4CVUA 3OLIA 4PEEA 1N82A 1GZJA 1VBUA 5I3DA 1HP5A 3WQWA 3F5KA 2XM1A 3L4UA 5A6AA 3WUBA 4LYQA 4ZXOA 4JFVA 4JKLA 2WMJA 2DH2A 3WUEA 8A3HA 2J7EA 3VGFA 1QVBA 3AIVA 1US3A 1WDQA 1ISVA 3OGSA 2EO7A 2A3CA 4TTGA 1CXKA 1VIWA 3D3AA 1J12A 2FHBA 3WN6A 2ZWZA 2IXUA 3BAXA 1XCWA 3ARSA 4AIOA 3W0KA 3ZO9A 4AIUA 4U2ZA 6TAAA 2Z1KA 5BXRA 1OB0A 2YIHA 1XRVA 1GORA 1V0KA 3CHDA 5M5DA 1XH0A 3VDHA 2UWFA 1C93A 4MAZA 2ZX8A 3VILA 3NJ3A 2VVSA 5GQBA 4PTXA 1J0JA 1SFSA 1KCLA 1CXLA 2XSAA 3A47A 3KL0A 1H1NA 3KE0A 4D6FA 1IV8A 2C7FA 1GQLA 3WQ6A 2YBTA 3QOKA 4MNKA 1US2A 4UOJA 2WKLA 1Q6FA 2Y8KA 3GXIA 4RE3A 1KXTA 3AYRA 5CGTA 1HJXA 1UQZA 2CITA 3OIHA 2ZXAA 5JUVA 4W89A 3EMZA 3MUY1 1LL6A 4D72A 3KEHA 4TVCA 1ZBKA 2CEQA 4AMCA 2QMKA 7CGTA 1BYBA 1JZ4A 3ARYA 1CDGA 4L4OA 3PBGA 4QLLA 3CUGA 4M56A 2WC7A 3AIQA 4M1RA 1NP2A 3FN9A 2EPLX 3AXXA 3KL3A 1J0KA 4CN6A 2E8ZA 1E4LA 4ZENA 2FHFA 3B9AA 5I78A 1ESWA 1HJQA 3K46A 4HOXA 1BTCA 3L4WA 3VDCA 4CD8A 3PZTA 2CXGA 1GOWA 1UR2A 1HJSA 5E70A 4PTMA 1WZKA 1UWUA 3GBDA 1XH2A 1DWGM 4F9JA 4TVDA 1DEDA 3POHA 4QLKA 2MANA 3EDEA 1E6SM 3POCA 1QW8A 4EE9A 4IISA 4XZWA 4GO9A 3U5UA 4HPHA 3VIGA 3I3BA 1UD5A 1KBKA 4S3JA 2QHAA 5CSYA 3PZMA 5ABFB 2E40A 1HNYA 1UQYA 3AHVA 5HOSA 1PIFA 2XFRA 1FP9A 4BQ3A 2JE8A 3K4AA 3VINA 1E15A 4CUCA 2XVKA 4AZIA 3MV01 3AS2A 5IHSA 4RL3A 1JNDA 3TTOA 2VI0A 4BZYA 1E6XM 2XPKA 3HMCA 1GW1A 1R7AA 4D6IA 2D2OA 1WDPA 3CUFA 3CZ8A 1H11A 1UZ1A 5TD4A 1NM9A 4ATDA 4Z2LA 2G4FA 2VQTA 4KGJA 1EIBA 5FCZA 1DTUA 1QNQA 4A4AA 5A8NA 1MXGA 1UR4A 1LWJA 2XIBA 1H5VA 4OZOA 1H0IA 3VGBA 2G3MA 1VFFA 1F4HA 1UWSA 4LX4A 4DUXA 2CETA 1X6NA 1MFVA 4MPKA 2CKRA 2WHJA 3A3HA 3HN3A 4AZ5A 3AIWA 1PAMA 3WNNA 4AZ7A 3UCQA 5CLWA 2WBGA 4MDOA 5A8OA 2E9LA 3M6DA 2E4TA 5A6SA 3FAXA 3UR7A 3W38A 3SEPA 1QI3A 1WPCA 2WHLA 3K1DA 3IAQA 1QPKA 4M24A
chains in the Genus database with same CATH superfamily
4LU0A 1GONA 2J74A 1LL7A 1BVNP 1FCBA 3JZEA 1EXBA 1QTWA 4G8TA 1K8CA 2OSXA 3LLXA 1F8IA 4ACZA 2FPYA 5AYZA 1BYCA 1S2TA 2A85A 2CWNA 1CEOA 3QC0A 4V1YA 4B3KA 4GINA 1E72M 4U3AA 2WSKA 4KQZA 2EPMX 1DE6A 4AWTA 1FCVA 5EBAA 3PR9A 4AIEA 5M03A 1FH8A 4QRNA 3QV6A 1J0ZA 7TAAA 3L2MA 1E70M 1VKFA 1ZCCA 2E6DA 3KX6A 4C90A 1YPFA 3NQFA 1Q6UA 4HB7A 4V15A 3M0KA 1PZ2A 3CB3A 3WQ4A 2O9TA 3AXIA 3G1XA 3IK4A 2UBPC 1KQYA 3MA8A 3VIHA 3A3XA 2HJPA 4XBSA 1VFLA 3C0JA 4KWWA 3N2TA 3PPFA 3CTLA 2E5BA 5BOOA 4DI9A 3WUFA 1FH7A 4WR3A 4QISA 3GBEA 4YJ5A 2E77A 2VL4A 3T07A 1FY6A 1MMFA 4FIRA 1SFJA 1FFQA 2HE8A 3NPXA 2IW0A 2XFWA 1KM0A 2G3FA 1EQ3A 2BXYA 4O0ZA 3FAPA 1XGDA 5F2LA 4C6BA 5AVHA 1K8ZA 4WK9A 2OT0A 1RR2A 3HG2A 3MKKA 3E2QA 4UTUA 2J6XA 1CXFA 5EKYA 3EKZA 4LS0A 3W37A 3LERA 3OODA 4ZEPA 4DJDA 4JHOA 2RDXA 3WENA 4DZHA 4R5EA 2A5HA 3IIVA 3G1VA 4XZMX 2VNCA 2XGBA 2CERA 2PV1A 3NZPA 3EKGA 1RPXA 1LWHA 5AYXA 4IUGA 3PTQA 1V79A 1IYXA 2FZ9A 4P5UA 3WK1A 4HHHA 4WGHA 4O4WA 3T44A 4ZPWR 1M68A 8XIAA 3UFYA 4FPSA 4IIFA 4NILA 4OOZA 5KTLA 4RE4A 1LUCB 4GI9A 2V5DA 1FXQA 2ZFAA 4AD3A 3OTRA 2XU2A 2PP1A 4M6VA 3VIIA 1B5TA 3RF9A 1JPHA 4JNYA 2WNQA 2ZRZA 3W7DA 2HBVA 2HWGA 1Q63A 5A95A 3QR0A 2Y6ZA 4IF2A 2FTPA 3A13A 1NQ6A 2BXVA 1AZ1A 2VKZG 5HWJA 3WQDA 1TVPA 1W5OA 1KV5A 1J9YA 3MMWA 2H6RA 5FI8A 3XIMA 4CQCA 3W81A 2JKPA 1DOSA 3RLGA 1D9EA 3MDUA 3WNLA 3O5FA 2GUYA 3PC0A 2E6FA 2VZOA 1ZK6A 3NOYA 1N8IA 4F40A 1RVGA 1H7RA 5CPNA 1TB3A 4IIDA 4HMEA 3MJMA 2QJJA 3GC2A 3VC6A 4LTSA 1ONRA 1IT7A 5HANA 3S46A 3OZYA 2KAUC 1ZS2A 4IPNB 1PL9A 2IQDA 1QNVA 2J4GA 3GIPA 3I4KA 4QDMA 1B3XA 1FWNA 5A3HA 3CEUA 4TR9A 1E43A 3N25A 2B7PA 3V16A 2GVLA 1EXPA 4DAIA 3C2RA 3T40A 1HKKA 3BSMA 1Q6QA 4MFEA 1TV3A 1UPPA 1YADA 2L2SA 4XKYA 4LUSB 3RJYA 2W27A 2RJGA 3O5KA 3G1SA 1EWDA 4GCAA 3TMQA 2GSEA 1XC6A 3EB2A 3MO7A 4LYKA 3QXBA 2PRHA 4F3HA 4HOZA 2YGYA 3P5ZA 4WKHA 3H7VA 1OFAA 2ZQVA 3NL5A 3BG9A 4ZQRA 3TMLA 3P74A 4Z1YA 4GPNA 4NZ5A 4GLEA 3S6DA 3GDTA 3KBSA 1OHLA 2VR2A 4Q7IA 5HWMA 1JCLA 1S5TA 1UYQA 2CLEA 3K4WA 4PE8A 3PZQA 1XLGA 1BLIA 3A24A 1NDWA 2DSKA 4JFLA 4DAFA 2PDYA 4P8VA 3UJRA 5C70A 2I16A 1V02E 5FAGA 4HMDA 4AMAA 1I2NA 1DYSA 3GTIA 4R7WA 4GMEA 4UBPC 3ARTA 1KTNA 3DYMA 4C6IA 5DQPA 4KEUA 4FO4A 3AZRA 1ODUA 4Q4SA 3W1MA 1XRFA 3OHMB 2BY3A 3W26A 5F2GA 4JDBA 1NWSA 3LBCA 1SYTA 1SSGA 4IX2A 3ARXA 1C8QA 3MUCA 3OB8A 1VFOA 1PVNA 3RITA 4RDZA 4L4LA 2ZUNA 1FKWA 1O68A 1LOSA 1I60A 3TC7A 3AUJA 1Z9AA 4F0HA 2XZ9A 4OBTA 1V6VA 1WKFA 1XYBA 3T0CA 1ZB5A 1KGWA 2VCDA 4NI3A 4AHQA 5FF4A 5HW8A 1UW9A 5I79A 2BDQA 2VFGA 2ZTJA 2ZZ5A 3A4XA 3IIOA 4J40A 3WQFA 2ZDRA 4XO7A 1FKIA 1VBGA 1XYMA 3GD6A 3FS2A 4Q8TA 2OPJA 2DZSA 3BUVA 1W54A 1UOKA 3A4AA 2WAGA 4DUVA 1VEPA 5JIWA 3GDMA 3WF4A 3GTYX 4FR1A 3U2ZA 8TIMA 2G50A 2KX9A 3B97A 4HZ7A 4D2JA 2YCLA 1OX6A 3W4RA 3CV7A 4G6CA 3A4WA 5E9AA 1W3JA 3E96A 1VRXA 1XINA 1THFD 4R27A 1IT8A 2ZZ6A 1OY0A 5EMYA 1RD6A 3DKJA 4ODKA 1SGJA 2QDGA 4G56A 4AU0A 1ZBWA 1XSJA 1NQKA 3BVJA 5FEWA 3ZS4A 1YX1A 4B15A 1GK8A 3C0LA 3CUHA 3NXLA 5IOBA 4FK9A 2F6KA 4GHRA 3BLFA 4UXDA 3T09A 3U0HA 3OEXA 4N02A 1N2VA 1VJZA 1IEQA 5HKGA 1XH1A 3N9SA 3WF2A 3M0ZA 4O54A 1P6WA 4D8AA 4JFKA 1ZAIA 2ZX5A 3TYDA 3AYSA 1G4TA 2PI6A 2TAAA 3UT0A 2NX3A 2CWXA 2J9ZA 3JVAA 2H3BA 1V93A 4J7RA 4PUDA 1LZOA 3MV11 3ES8A 1P7TB 1W1B1 2G97A 3G24A 3UY7A 3C56A 4YWSA 3GM8A 3KUMA 1AJZA 4S3FA 3CMGA 2VOMA 1O5XA 3CQIA 5EB8A 3RMJA 2V2HA 2BOEX 1ELSA 1NFBA 1E5JA 1TPB1 3IUHA 2PWGA 1FCUA 4O52A 4MAVA 1OEPA 1Q7QA 1TPEA 1TSIA 2EG7A 4O8AA 3VMNA 4X0NA 5LZLA 1JDCA 4MKNA 3V4BA 4WGXA 2NXIA 3W1AA 1UR1A 1CZ1A 5C2CA 1WXJA 4TX6A 1REQA 3O06A 3W7KA 2D23A 4H01A 1Q6RA 2Y7FA 1TUXA 2ZQUA 4AC7C 3DXIA 3WF1A 3KLLA 4CU8A 4X9SA 4HNTA 3F5LA 3IPWA 1ICPA 1ZENA 5FEZA 3VDBA 1XLBA 4Q4RA 3V0SA 1QO5A 1JGIA 4AWUA 1DJXA 3UNTA 4J3WA 1F7BA 1PKYA 3LGDA 1IWAA 3PF3A 1D7FA 3KACA 2E5DA 4ES4A 4LYRA 3L68A 3WQ5A 1H51A 3AIRA 4Y96A 3LTYA 2C0AA 3WQCA 1VJIA 3ENLA 3UWQA 5BZAA 3GVRA 3NG3A 2MNRA 2RQSA 3NPVA 1A53A 4OECA 5JIPA 5KETA 1FWWA 1SZRA 3NVDA 1YHTA 5H6HA 1Z6KA 5U7SA 4RNFA 1PE1A 3N12A 1V7AA 3ABQA 3LCLA 1OC7A 3EY6A 5DF0A 2VENA 2WM1A 3PFMA 2QJMA 4CVWA 1T0OA 3Q2DA 4HPGA 4L5ZA 1GUVA 1MFUA 3NQEA 4X2RA 4QG8A 3REQA 5DIVA 1GEHA 1W2PA 1J93A 3LRLA 5C9UA 1LG2A 5D30A 2M08A 3WL0A 3VNIA 3KOFA 1PBKA 3GC5A 3GAKA 4AVOA 1OK6A 3SJNA 1E6NA 5CQ1A 3NPUA 3VPLA 3T7VA 4KRZA 2D2JA 1OBAA 1O12A 3N2OA 2I9UA 2ZQSA 3BCJA 3ARWA 4J27A 4CD5A 1A5LC 3CH9A 3LMYA 1MDRA 3R25A 4PUJA 1HGWA 2BHUA 4C5ZA 3N15A 1QASA 3PUEA 3RR4A 5E9XA 3S1XA 2VJXA 4GCXA 1JFHA 3PK7A 3WQEA 2ZXBA 3CUZA 1FWSA 5LIXX 3SQSA 1QHOA 1OWQA 4Q8MA 2PDWA 4GQBA 1PZ1A 1R3RA 1JNSA 1U5VA 3B9NA 1TPVA 1BKFA 3W85A 5CAKA 1ZJIA 3MSDA 4MWAD 2ZVRA 4C6JA 4XIMA 2O9RA 5FSDC 4LY4A 4AF0A 1WQ5A 3DFOA 3R0KA 2DUXA 3ITVA 3GSMA 4XSLA 3TYZA 4HKPA 4XTIA 4NP7A 5KZMA 1EL3A 4PC8A 1FBAA 4MIMA 1DQXA 2R94A 5BOFA 1LP6A 1PKNA 1VFUA 3MWCA 4W9TA 1KFWA 3S83A 3S9ZA 4PMDA 4DBDA 3PFRA 1E6RA 2OWXA 3WDPP 2A3HA 1KXQA 1UBPC 4HNOA 1WZAA 2PWHA 6TIMA 4PCPA 1VH7A 1BG9A 4N6EA 4A3RA 3DX5A 4PUMA 4AZCA 3U3HA 1J0YA 1LT7A 4X3ZA 4B5VA 1QXLA 5FOOA 4UQCA 2XP9A 5DT7A 1E3XA 3NTPA 3DHFA 1CGXA 4L72B 2Z0IA 5I98A 1LQ0A 1EA9C 4Z0SA 2I14A 3LI0A 5BWAA 1FKRA 2YCJA 1PX4A 1W3IA 3T0TA 2ZVIA 3W7RA 2FB2A 1ZUAX 2OX4A 5AN7A 4E2DA 2PWEA 4UNKA 5I00A 1V3IA 2OOGA 2QDHA 3AJ7A 3UXDA 4JQ4A 2IMRA 5H91A 1OGGA 3P84A 1IWBA 1YW1A 3DZ1A 3HB9A 1Z48A 3WCZA 1XHGA 1R0MA 1UR9A 2VCBA 5EU9A 4RXFA 4JTUA 1YNYA 2QZRA 1CGYA 2BS9A 3D47A 2V8ZA 1CXEA 5H8UA 3HMJG 1TMLA 4MWAA 2ZX9A 3MDYB 1XLMA 1EO7A 1HF6A 4X9YA 1C29A 5I0DA 1AQHA 3NQCA 4ZSTA 4KFPA 2VOTA 1GYNA 2YYUA 3QZ6A 1NMVA 3M1ZA 4J3UA 1SFLA 1Y65A 3UZ5A 4MJZA 4C5YA 4Q4OA 4CCEA 2XVLA 1E9LA 4GYPC 4UTLA 5I24A 1G5AA 1QZ2A 3KOWA 3L12A 1RBLA 1AJ2A 5D32A 1HX0A 2P88A 2WO5A 3ITGA 4PUEA 1EFZA 4QDPA 2PDPA 2VGFA 4NYYA 2INEA 2JF7A 1GOMA 1KFEA 2ZRUA 3VKKA 4K1GA 3AICA 4W84A 5EMJA 3TCEA 3BG5A 3ATYA 3S1UA 1IR2A 2DJXA 1ONEA 3PBWA 4ZFMA 2AMGA 3C8FA 4PMZA 3W1NA 2IQTA 3IJQA 4R85A 3P14A 3DESA 3E5PA 3SCUA 5XIAA 4BF7A 1IEXA 3UWVA 4BEQA 4Y90A 4AWSA 1UZDA 3QZEA 4MB5A 2PZNA 1GVQA 1WKEA 4Z2JA 3TN6A 3SY1A 2DUZA 1BGGA 5BU6A 2JIEA 4E5TA 7TIMA 2J88A 2OQYA 3NIYA 3SRKA 3UZWA 3W1UA 4D6JA 2NWSA 1SU5A 3QW4B 4FNRA 4OJYA 3VX1A 3PJTA 3W70A 5DMLA 1KR0A 2ISVA 4ORMA 4Q8UA 3URQA 2HTMA 3FY1A 3L0KA 5HW7A 1Q45A 1TRIA 4O15A 5I6SA 3NRKA 3C61A 4AYGA 2VZSA 4FXFA 1POKA 1UKOA 3CUJA 2VFIA 4M1BA 3VFCA 3V0UA 3RCNA 1SFTA 4S2CA 3JS3A 3W7EA 5CSSA 1JUEA 4KEZA 1J4HA 2PGRA 2ZX6A 2BXZA 3HG4A 5TAOA 2H3DA 1YRRA 6REQB 4MY8A 4O1AA 1VPXA 1QUMA 4KIEA 3QJAA 3GQYA 1SZNA 3EB3A 1QAPA 4M7SA 2Y5JA 5HDRA 4UFJA 1TWWA 1D7KA 4Z2GA 4HZ8A 2WC4A 3B8DA 4LNYA 4J5NA 1G7UA 3GTFA 4ZB2A 5C55A 7ODCA 2DSUA 1HJUA 2VT0A 3E6EA 3H54A 3RYSA 1QNRA 1C9HA 1DTNA 3MANA 3NQ2A 1T11A 5MHBA 4H6EA 4OOUA 1CENA 3B04A 3PZIA 1OM0A 1XM3A 5CC6A 2YA0A 3A5VA 1BQCA 1OVDA 4DJFD 2PSNA 4O0KA 3QEZA 1LG1A 4MB4A 2QPXA 4ZTYA 4UMBA 3VGGA 1M6JA 1R87A 5AZ1A 3R58A 3V18A 2YX0A 2HMCA 2XDFA 3G3DA 1K03A 2CNCA 3A5FA 3BOLA 2F4EA 1O5QA 4TMBA 1TX2A 1T40A 3LI1A 5CZJA 1X7FA 3B0VC 3HFYA 3QHNA 2QJIA 5D9OA 1JAEA 2NVDA 3WDHA 2VFHA 3NSXA 4P8WA 2WCGA 1NY1A 4OQVA 2DZWA 1AUSL 1TPWA 3GR7A 4IL2A 3TDFA 3O6AA 3GH7A 4W8BA 1X6LA 1UR0A 2OTDA 2EULA 2VUNA 1HJWA 2EGZA 4PL1A 3NFUA 2JK2A 1YEYA 3M0VA 4HBOA 3AS1A 1C8XA 3WF3A 4MPQA 1A5KC 1CLXA 3V1HA 1W1ZA 1KGUA 2DG4A 4IL0A 5DY3A 3WLIA 1WOAA 2VEFA 4ACZB 4FMVA 4QNWA 4FNSA 5F4WA 2UY4A 1EC7A 1QBBA 2EPOA 1WV2A 4AD2A 3SRFA 3H6OA 4D8ZA 3BAJA 4LOCA 5E1QA 1EPVA 1TJPA 3PZNA 4IMGA 4PA8A 1AZ2A 4JTDA 2XN0A 3LM7A 3S47A 2Y0FA 5ENLA 1UKSA 3V5FA 1KT0A 2P4VA 4Y9NA 2FZDA 2GFTA 1M7XA 4KCWA 1Q6GA 2VTFA 1LYXA 1S3TC 1RALA 2ZWYA 4W85A 3G6MA 1S5MA 1NWTA 2VELA 1G6CA 3VZYA 4DJFA 3QZAA 1Y5VA 1GHRA 3WDJA 1SMDA 1FKXA 3LPFA 1VRDA 4EPDC 2E8YA 3S6OA 2ALDA 3O0FA 4I9MA 3SECA 3WSUA 3H12A 2ISSA 2Q02A 3IGHX 1G69A 4DHGA 2PDJA 4L1WA 4MOZA 2CBVA 3GHTA 4BF9A 5C7HA 1RAKA 4F8XA 4NNCA 2CYGA 4LPCA 1QDSA 1ZGDA 1XIJA 2NUYA 3WQGA 3SQMA 4Y9PA 1SZFA 3TIMA 3H4XA 2JKEA 2VUYA 3HG5A 1MXDA 4WDWA 1NF0A 2MNTA 1R3SA 1FH9A 5C9RA 5B7YA 2QW5A 3KCOA 3WNMA 1KCXA 4Z0JA 1CYGA 3TA6A 4NUWA 2DP3A 1WP6A 1M65A 3GY1A 4ZB0A 1PS9A 1XF0A 1DV7A 2OVLA 1W8SA 3KCJA 3AZSA 2FPTA 2WZTA 4JDYA 1UHVA 4W5UA 4J35A 5DMYA 2IKGA 3GDLA 2DVXA 4BR1A 5BWFA 3BV4A 4DXXA 2J6VA 4UUIA 1VYPX 5BU9A 4HU4A 5JXQA 1PYMA 2LJ4A 1EP3A 3UQNA 5FL1A 3QN3A 2RGMA 3ANVA 5F4SA 5AFDA 4IJRA 1BVZA 2W91A 3B8TA 1US0A 1P5BA 5CH9A 3C3UA 3ORWA 1ZJBA 2QCFA 5DIUA 1E9ZB 1HJVA 2D24A 1UKTA 3ZJ7A 4Q4QA 2ZADA 3W2UA 4X63A 1WX0A 3WH8A 9XIMA 2VEGA 1WKDA 4E6MA 2WANA 4A2RA 2EPKX 1OSEA 3ALFA 4RZ5A 2HNHA 4YTUA 1A47A 4NZ1A 5DEZA 3ZJ6A 1TVLA 3O5MA 1ZPTA 1U33A 4UR9A 3TC6A 2WBKA 1KQZA 3GWQA 3WD4A 4PTDA 1TIMA 1KR1A 3CUIA 3TC5A 3QGVA 1YATA 4GXPA 3C3NA 5A69A 4QLJA 2WVTA 4JN6A 3VIMA 3VNKA 1V3KA 4NYUA 4QS5A 2BASA 5I07A 3GG0A 2C14A 1GVOA 3MI3A 5AHNA 1VAHA 2J47A 1DIEA 5A6LA 4PFHA 4Y9AA 1RQEA 2I7GA 3DFYA 2FMOA 3MUIA 4KBXA 4F2TA 3APTA 2Z29A 1JJKA 3MT1A 3R8GA 3PUGA 3LHZA 1B3OA 3GW0A 4CNSA 3LN3A 5AYYA 1Q6HA 4UNIA 5DCDA 3AXMA 1E4IA 1M7PA 4GY1A 3WD3A 1GVYA 4C6CA 1FKBA 4KH2A 1XBZA 4DRQA 2X0SA 3UWZA 4PTVA 3OO2A 4C7DA 2VFEA 3UETA 2G0WA 1NOUA 1Q6IA 3V1PA 2R1NA 1NARA 1J6PA 3ARPA 2XUCA 3DENA 4QG6A 4B16A 3WD2A 5FJTA 5HUOA 3CHCA 1DWAM 4FXJA 1P0BA 3PR2A 4LVDA 2OWWA 3P3BA 2RUSA 3AOFA 4GI6A 4ICCX 3FNDA 3A64A 4CLMA 3FA3A 2XTKA 3MWAA 4L64A 1S1PA 4LUTA 2WWCA 1OYBA 3ITTA 4MWAC 4E2VA 4JTHA 4PCSA 3IGUA 3A3WA 1NP0A 1BKSA 3N34A 1VGAA 1B90A 1GPWA 2DV0A 4C6FA 4MYXA 4Q4PA 4IMCA 1ZU8A 1G9HA 1OX5A 5HQLA 1C3FA 3KWXA 3OVGA 3NQ8A 4FOJA 1EIXA 3L0GA 4DZ3A 3ZT6A 1GZJA 1AA1B 2P8CA 5CZSA 2GQ8A 2Y1HA 1K02A 1HP5A 3WQWA 3L4UA 4G7EB 5A6AA 2PLKA 1AW2A 3WUBA 3RU8X 3B7XA 4DRIA 3THQA 2J7EA 1KKOA 4GY0A 3AIVA 1ISVA 3TJ4A 4RJEA 4ADSA 1BD0A 4R88A 4A22A 1EEPA 1OCNA 4NXKA 3BAXA 1BWKA 3TAOA 5LNUA 4AIUA 4J1OA 5BXRA 1PDZA 2YIHA 3OBKA 1JDEA 4OV9A 4EPKA 1D8WA 1UUOA 2HDJA 3URBA 2HXUA 5J8LA 2GSHA 1H61A 4HU3A 2PMQA 3WQ6A 2YBTA 3CO8A 4DWDA 1US2A 2WKLA 4IFKB 1KXTA 1YBQA 4H00A 5DCBA 3ZWSA 1UQZA 3OIHA 4L9ZA 4DY1A 4BI7A 4CNPA 4D72A 2OLSA 4IMFA 1BYBA 1A50A 3ARYA 5DMMA 1ZZMA 4IT1A 1IIGA 4QLLA 3TSBA 5E93A 1NP2A 3FN9A 1B54A 1KM4A 1H7WA 5FJUA 3AXXA 5G4WA 3W07A 3G8RA 1AD4A 3QYQA 3L4WA 4PZVA 4XZLX 1K4HA 5DBUA 3TJLA 4DRPA 4H19A 1XH2A 1FKKA 4TVDA 3KAOA 1XIGA 4QLKA 4H7ZA 5CKSA 4I9JA 3IVSA 4DBWA 4EE9A 3ITOA 1IR1A 2WNZA 5K9CA 1UD5A 1WOBA 3H7UA 4LVBA 2R1KA 4ECLA 1UQYA 3W7OA 1YE4A 3B0UX 2JE8A 3IJIA 4CUCA 3W7IA 1F07A 2XVKA 4AZIA 3W1RA 2RJHA 1SJAA 3AS2A 3CNYA 1TPDA 4XSMA 3ODKA 1G4EA 5D04C 2VI0A 3U2OA 3G0XA 4D6IA 4QJ5B 2W6RA 3FSTA 2HBXA 3I7QA 4NJIA 3TCSA 4ATDA 3GNDA 2VQTA 1Q7ZA 2KFWA 4A4AA 2YW4A 5JVLA 5A8NA 1DHPA 1UR4A 2DZVA 3HQPA 3H26A 1AQFA 2A79A 1F4HA 3GNXA 2CETA 1X6NA 4C1NA 1JUBA 3UXKA 1D3HA 3AIWA 1YTDA 1N8FA 1PAMA 4LBUA 1QJWA 3N3TA 3ZVHA 4EVZA 1I0BA 2R8WA 3FAXA 4CQ9A 3LXAA 4M24A 3GU1A 2ISDA 3N4FA 2UY3A 4HN8A 1TV8A 2XVGA 2Z27A 4A21A 4FI4A 2X0HA 1XUUA 1E0WA 2AQWA 3LQLA 4I5RA 4NHVA 1EUAA 3V36A 3DI1A 2NX1A 4M6UA 1V3LA 1PTGA 3PZGA 4XTDA 3GKFA 1AG1O 2WKJA 4E2BA 5JMUA 1VD6A 4Y9OA 3VXGA 3WD1A 1PIGA 1GQNA 4JFJA 2J8GA 3NQBA 3TW6A 3STCA 2BWGA 2OQHA 1NWUA 1PB0A 3EDFA 1GWJA 1MEWA 4H9MA 3DEQA 1K8YA 1EX1A 1ZBCA 1NWRA 4ZCWA 3W86A 4NI8A 4KETA 1LBLA 1W31A 2LLEA 1GOIA 2A4AA 4IGMA 3TROA 1JCXA 1D7HA 3VIJA 4MNLA 4IQ2A 3F7JA 2NW0A 4FF5A 4H6QA 2L5HA 1SQ7A 3QPEA 5CSRA 5HR7A 1S2AA 4Y8FA 1F76A 1JPIA 1F6YA 1PTAA 3B3DA 2E67A 1ROUA 1X97A 3IKDA 4KF1A 2I17A 5C2XA 5IHRA 2B4GA 3R8RA 4ACYA 3LPPA 4Z2HA 3GDKA 4LBSA 4RLIA 3CEPA 5FEXA 3IJ9A 1TZ9A 3W6YA 2G96A 3SB0A 1MW1A 1A0DA 5E0FA 2J78A 3FAWA 3GVVA 5HWNA 4UC5A 1OD0A 2ESCA 3CLWA 3ZLFA 2CW6A 3K30A 3PHAA 1JXJA 4W8LA 1DORA 1E5NA 2XZ7A 3GU9A 1MUWA 1VYSX 3C2YA 1R9ZA 2BBFA 1XYLA 3F4VA 4MFDA 3VDGA 4ZZ9A 1TX0A 3AROA 4TW8A 1W9PA 1OG0A 3GYEA 1XIFA 1XV8A 1XC4A 3BE7A 2WMKA 2ODOA 3ONBA 1MZRA 4HJFA 3IV8A 3OA5A 3RCMA 3GZ3A 1Z44A 2EKGA 4G2PA 4RNJA 4ZOCA 3WEZA 4IHCA 2PC8A 3H2OA 4EAYA 1BEUA 3GLCA 2PE4A 4LY8A 1M1BA 2J25A 4ZOAA 2X42A 3GTHA 2B5UB 2WMIA 3TNBA 4J4OA 5D37A 4DIAA 2IKJA 3GG1A 1XP3A 4GNKB 1FJDA 1GYLA 1EC8A 3M6YA 5L9FA 3TKFA 2WCSA 4GIVA 3AWNA 4IXXA 1RY0A 2FPVA 3QPZA 3A12A 1Q7MA 3PA7A 5HATA 4GY7A 3FJLA 4KEVA 4N42A 1H5YA 1KBLA 3VD7A 1DJWA 1NSJA 4XB3A 4Q8NA 1ZAHA 3V35A 4F0RA 2FDSA 2WB5A 4J3XA 5E6ZA 1ZTVA 1OGBA 1YXDA 3UI6A 3IEBA 1CGTA 4J4KA 1V0NA 5A2AA 3EWDA 1IZKA 1JEZA 1GPFA 3HPFA 5REQA 1RP8A 3KFTA 3T0BA 1XKJA 3TEVA 3FYPA 4INFA 3P81A 3L4ZA 4KR0B 3PJXA 3CHEA 4RXGA 4DPPA 1FUYA 4JHZA 3C2EA 3D3FA 4B9ZA 5F1VA 3UU0A 5D75A 3W29A 3M0JA 5I2UA 4DWSD 1HKMA 4LVAA 4YIWA 1DWIM 1TQJA 2OKOA 3LSCA 1G1YA 2ZQ0A 4DRJA 4YTRA 3S5YA 1JZ2A 2DG3A 4D6HA 4ERGA 4FSAA 1T99A 5HMEA 3VO0A 3U4AA 4HSHA 1F8AB 1ZAJA 3H2CA 1FHLA 3M07A 1KRBC 3MYPA 4LB4A 1OZQA 1GW9A 2ZICA 1FKTA 2QUNA 1E4NA 1HKWA 2OXNA 1H7XA 1AQ0A 4AAJA 4IPXA 1A80A 5CJMA 5A6MA 5D02A 4UMAA 1V6UA 3HGSA 2GK1A 4CCDA 2OFJA 4O57A 2IUZA 3BWWA 4TUFA 3LM3A 4E4UA 2TODA 2XG9A 1BHGA 2D3NA 3CZLA 4LXFA 1FVPA 1YNPA 2WNNA 3CV6A 1KXHA 1UH2A 3BK0A 3E12A 2YOCA 1EYWA 4HTYA 4IXHA 3WDIA 1KBBA 1W1TA 3BGGA 4FZIA 4GNVA 5GVJA 3O8AA 4LS2A 2X40A 4IGNA 1HO4A 2ZRVA 3SW6A 4IQDA 3DC0A 2X1SA 1NF7A 3RX4A 4XBJA 1OQFA 4AY8A 4ZODA 3KS5A 3FA4A 4N0RA 1RPKA 1U83A 1QATA 2J62A 4PB4A 1WBJA 3NWRA 3UW6A 4IQJA 2ACSA 1AMKA 2VHLA 4J3VA 3K8MA 3NR0A 1E51A 3RX3A 4PRRA 3HOJA 3OU8A 3RGTA 5E0KA 1DJQA 4DWSA 3WLHA 4O14A 1UMLA 5ECUA 3L2IA 1ZFJA 5FJIA 2N87A 3I7RA 2B0MA 1P6CA 1H09A 2D22A 5D03A 1DWHM 4X61A 5JH2A 1HT6A 2EAWA 4ODNA 4UOQA 1NVMA 2D0FA 3VNJA 4KT2A 5D9PA 4ITZA 4IG2A 3GHRA 3APGA 1SJDA 3ONCA 5FJOA 1L1PA 2YZRA 1YTKA 1W26A 1RV8A 3UQAA 3UJEA 4MADA 3UZXA 2GJNA 1L2QA 4ODPA 1XIHA 2C3ZA 3EMCA 3W72A 1UKQA 2PLJA 2NVCA 3W1QA 2GUUA 7REQA 1H49A 5HMDA 1XYFA 1FWJC 5BMXA 1FWAC 4FNQA 2JQXA 3H2NA 5CGMA 4L9XA 1TTQA 3B9DA 2X16A 3PWIA 3A6OA 4JKKA 2A3AA 3EA1A 1SO4A 3N04A 3U9IA 2ZZ1A 4HMNA 2VX7A 2E5CA 4AD4A 3CAKA 5AOUA 5EPDA 4B5NA 3WMBA 1IXPA 2YDRA 3JUGA 2FGBA 3DU0A 4YPJA 4NZ3A 2W9MA 3VX0A 1JCHB 3IARA 3GXFA 3W75A 2P0OA 3LEPA 2AGTA 4H4IA 2GUBA 1CTNA 3LZ5A 3W7JA 4YLWA 4ILSA 4EWND 2QMJA 3WLQA 2XGZA 3T78A 1JNEA 1UROA 3CO4A 4CD6A 2SFPA 4AD1A 1ME7A 2NT1A 1E71M 3K5XA 1O94A 2QYGA 2PDMA 2XH0A 5G1YA 1WE5A 4IGHA 4XUYA 2PDLA 1Y5XA 4GGBA 3UA3A 4GZ7A 1PPIA 4NZFA 3WH6A 4QIBA 1HIZA 3BCFA 1IXOA 1IZJA 3W7LA 4YVPA 1MRAA 2PGWA 2MPHA 3VOGA 3ZSTA 2GWGA 4GE8A 2F21A 3LY0A 2Z1XA 3W6MA 1PEZA 1W5MA 5F4XA 2D0HA 3MUAA 5AHMA 3HQ1A 4PMOA 3QGAC 4QFUA 2MLZA 1RQHA 3E0VA 2J75A 1XCFA 1JD7A 2XP3A 2R82A 4LAWA 3OGVA 4NZJA 3T9PA 1H0GA 2QCDA 5LNVA 2AKMA 1QI5A 4JFTA 5C71A 1FKGA 2P0IA 2Y7DA 1WZMA 2ONEA 4B5TA 5LNRA 2WW5A 3HPAA 5LGXA 3IKGA 3T05A 1VBJA 3EOEA 3STPA 1EQCA 1O4UA 2FIQA 4QDWA 5AHLA 3LD5A 3B0PA 5M2FX 2WJDA 3VD5A 1DP0A 3NQGA 2HPMA 1M5WA 3SUSA 2OB3A 5HW6A 2F2KA 3IJDA 1FKJA 4IFRA 2FH8A 5LHEA 4UFHA 4OWGA 5CPQA 3UPMA 4AXNA 3QMSA 3RMEA 1EEXA 4B3ZA 3MO4A 4WOQA 1ISWA 4IMEA 2PPOA 4OV4A 4EF9A 4ALDA 3RM8A 3F5JA 4D1JA 4WXYA 5GNXA 3UR8A 2VEPA 4PFMA 3BPWA 4XD4A 5KZ6A 4Z1AA 3DC8A 2ATSA 1AL7A 1DIOA 1JF6A 1BL4A 2BFGA 1Y5WA 3THCA 3MZNA 3G0SA 1VEOA 1KT1A 1DWFM 2DU2A 3GH4A 2BV9A 4KS0A 4ZO6A 1UR3M 3T0AA 1JQXA 1BXCA 4B3LA 2OU4A 2PDIA 4XAYA 4MB1A 2VX4A 1V02A 1C7TA 1LF1A 4FAPA 4CEUC 2DZPA 1TELA 2V82A 1OT2A 4IIBA 5B7ZA 1OIMA 3KS6A 2F7FA 1JUKA 3E02A 3GXPA 2VX5A 3CPUA 2EPNA 3BJSA 4MB3A 4CQBA 4U2YA 3LB0A 2X30A 3NUKA 3VVGA 1FD9A 4LJ3A 1LJYA 3IVUA 2I5IA 3AIEA 4HHMA 2WSRA 4W9OA 4HA1A 1B0IA 3A21A 4LALA 2GOUA 5LIWX 3KAHA 3LUOA 4OTKA 4Z08A 1ZP4A 4CEXC 5AYIA 1UP3A 2WCAA 5M3WA 4P61A 5BRQA 3VM7A 5EL1A 5K9DA 1W9DM 1YXCA 3L4YA 1GKPA 4XZHA 3KM8A 1OFBA 2PDBA 1RLCL 4MLRA 4JYSA 3EXRA 2ZC8A 5I3FA 4Z17A 4N19A 3MS8A 2FHCA 2XIMA 3VOHA 2WV8A 1J4EA 4MDPA 5FESA 4JOMA 4BQ2A 2DIEA 1KM3A 2QUUA 1PO9A 2TSYA 2YW3A 1W91A 3BOXA 3WDQA 3UZJA 1ITCA 2R6OA 3WIJA 4PMUA 3DFNA 5TF0A 1Q2RA 2POZA 4Q7NA 4ZGYA 1C8VA 2A3EA 4Y7EA 4H8VA 4RZ6A 3WJYA 4PTWA 4N4QA 1L6YA 4PCNA 2C0HA 3LRKA 1KB3A 4HVXA 4QP0A 4C6MA 3GUWA 1FWRA 2V9DA 4HBEA 4E8CA 4AY7A 4GISA 1RVKA 5K3VA 1P43A 4H3DA 3CXOA 2W5FA 1KKRA 1T96A 5J5DA 5DX7A 2RFGA 1XYCA 4MMWA 3VK5A 3FX4A 3EEZA 1EJXC 3UGRA 3VOIA 3EX1A 1QI2A 3R79A 1EX5A 4LSBA 3O07A 1TZZA 3QLDA 4O13A 4HNUA 5C6MA 1J4RA 3G1FA 1VLIA 3EX3A 2D1ZA 4YXGA 4DNMA 2D0GA 3PTDA 3EXSA 3RRAA 1XIBA 2WHKA 2OR2A 3I10A 2BODX 1P6BA 2EG8A 3OW1A 1UP0A 2OLHA 3KDOA 1TA3A 4HNCA 4MUZA 4YYCA 3ABZA 2QF7A 1YTEA 3LPGA 3EAUA 4IPJA 1J96A 3WFLA 1M53A 1EDGA 2F2HA 3RIKA 2QJGA 1K70A 1IEWA 3ARQA 3LCFA 3PRBA 4NNBA 2EHHA 1LWIA 2PN0A 3WH7A 3EOUA 3H22A 3EGJA 1QO2A 5D8WA 3T4CA 4GBDA 4HNLA 1HP4A 4MVAA 2OMAA 4GC3A 3OBAA 5BXJA 4K1WA 2IKHA 1R3QA 1SW3A 1OADA 4QSHA 2WKGA 3P67A 3N73A 2OKTA 5CG7A 3G2GA 3CMJA 4QNEA 4CCCA 4K68A 4UWMA 4GX8A 5G4EA 4MKVA 3CWNA 2GJXA 3O5PA 3GO2A 5LNWA 1Y0EA 4QE5A 5XIMA 4H2CA 2ZX7A 1KCKA 2GGJA 2HZGA 3B4YA 3V7PA 2I5GA 2WMHA 2GGGA 4WDTA 1CPUA 4LCQA 4LUTB 2CLFA 2Z7KA 2C1HA 2VDIA 1L8PA 1W1PA 3WD0A 1UWIA 1JYWA 1VC4A 4FEZA 3O7UA 3I6EA 3U7VA 1N55A 1SR0A 1J0IA 1FKFA 4C91A 3W7GA 1V0MA 3CB8A 3C0QA 6XIMA 5DLCA 4QT3A 3DG3A 2WPBA 2WVVB 3VGDA 2RSEA 4Z42C 3TCZA 3M9YA 1V3MA 4DVOA 3Q94A 3ZJKA 1E1EA 3WBEA 2YKKA 1UA3A 4LYPA 4DO6A 1OC6A 3SAZA 5E09A 3KCEA 1NDYA 3F1QA 4LV4A 5CZKA 1O5RA 2QAPA 3NM1A 4V27A 5D9MA 2IXVA 3VCNA 3CIWA 4F79A 2JIWA 4KKXA 2XM2A 2YYTA 3HJEA 1R46A 1EB3A 4QG9A 4DBSA 2QV5A 1JULA 3NYDA 1GHSA 4J3ZA 2VRQA 2XWDA 3YPIA 1MQQA 1PKMA 1G0CA 1A5UA 4ZR8A 1JIBA 3GDRA 3SCNA 4A6GA 1LDCA 1WA3A 1YBQB 3UG5A 2FGZA 4QAIA 2ITKA 3WLMA 3GVWA 1YE6A 2PGFA 1JYNA 1JPMA 3WBWA 3S9IA 1K9EA 2LKNA 1I75A 4ZSUA 4Q8WA 4D6EA 1MI3A 3TN5A 2UY5A 1NAL1 1EYMA 3CQJA 5BROA 3FJNA 4DWSC 3LU2A 3L67A 3FDKA 1O1ZA 2H9AB 4MYAA 4B2DD 1X38A 3FLUA 4DYKA 4G2DA 4LUYA 3A9IA 2P76A 4GJ1A 4W7WA 3O6DA 4GUFA 3KAFA 3QOMA 3DERA 2F61A 2GL5A 2Z6IA 3CPRA 2OEKA 4CNNA 3FJ4A 5D2TA 2V38A 5CCZA 2ZA3A 1CGVA 4JICA 3WNKA 4WY0B 4C1KA 5I3JA 2HRWA 2PGEA 4RE0A 1B9BA 1XI3A 2TRSA 3LYEA 2GDUA 5FAJA 1KLZA 4H9UA 4JYDA 1V6WA 2O9PA 3QFEA 2OWCA 3CHFA 3UD6A 3I6RA 4W7VA 3L4XA 2F6UA 4MJ4A 1QI0A 2X05A 5LNSA 5HK4A 5I03A 2W92A 3LBOA 4JPGA 3WNPA 2VRJA 1R3WA 4S2BA 3PNUA 1GG0A 1XIDA 1MRQA 2YJQA 4QM1A 1DWJM 1GJPA 1KNWA 5DXYA 4AZ6A 2ZUWA 4W5ZA 2PWDA 1C9WA 2O7SA 1FDYA 2NSXA 5HWBA 3O5GA 4QGCA 3M5ZA 3NQAA 1YW5A 2O56A 2Z4GA 3QY7A 4S38A 3PWGA 1U5HA 4AD0A 4FA3A 3TK7A 2O4QA 4IJBA 3VNMA 2MF9A 3LENA 4Q33A 2Y2WA 4KRTA 1F3XA 5EMKA 3UYIA 1TV5A 3ZMRA 4U10A 1ZY9A 3MB9A 3II1A 3IUIA 3WK2A 3ARUA 5IBXA 3OVQA 4TO8A 4LNCA 1VHCA 4HCDA 3ALGA 4QT2A 4OIFA 2PZ0A 4GZEA 1M5YA 1XICA 4B2DA 3A9BA 2XWEA 2ZQTA 2QIWA 4FX6M 3UCDA 4UR8A 1YYAA 2W3ZA 3HQOA 3PN8A 3W02A 3EWUA 3F4CA 3TSMA 1S46A 1K6AA 3QQ1A 4Q4MA 4U3CA 3G1DA 3GTNA 3WX7A 5HBFA 5HUPA 3BLEA 3H4WA 3OVRA 2YL5A 5FJPA 3LV6A 1Y7VA 1XD0A 3I3DA 1YQ2A 1YDYA 2BGQA 1NEYA 3O3RA 5FKYA 2WQPA 1QPQA 1HW6A 4DRMA 1KM1A 1HN1A 1EJTC 3GC4A 3E2SA 3VOFA 1TMQA 4CN4A 3SUTA 3TE9A 3KHJA 2J79A 1P1MA 2J66A 2RDUA 4W93A 5JBEA 1KFCA 2CLPA 3TXVA 3UYCA 1A4LA 1KWKA 4PCTA 3TYBA 3G18A 1MQRA 1A5MC 5HPOA 2C19A 4PCFA 1PWMA 3M5XA 1RZMA 3W7MA 3CC1A 3RLVA 3PJUA 1TREA 5EA9A 2NXGA 4QS6A 2YXXA 3O2LA 3TNOA 3LHTA 1GCYA 3FHQA 3H23A 5D05A 2PU1A 1GZGA 1VJSA 3TR9A 4ZPTR 3ITCA 3WUGA 2F38A 3K4DA 3E0FA 4RV3A 1H7OA 4UB9A 3AMDA 3R5EA 3PB0A 3WFZA 1KA9F 4QXIA 4GABA 3RDKA 1Q6EA 2BZNA 1OF8A 1W1A1 3BARA 3LLFA 1UP2A 3CYVA 1LLOA 5TIMA 4A8RA 4UFIA 3HGJA 4DRNA 2ZXDA 4O16A 1EBHA 3QRHA 2XN2A 4G1NA 1HL2A 1XWYA 3BW2A 3CGNA 3G1AA 2QCMA 2NLYA 5F7UA 1H7NA 4BEUA 4HA4A 2Y63A 3PAOA 1F73A 5AC6A 2GJLA 3IJ8A 4DRHA 3LPOA 4HARA 1YKWA 5HXMA 4EIVA 2KI3A 2PRLA 2A0NA 3M0MA 2C8NA 2YA1A 4IGSA 5CPOA 2LPVA 2DZBA 5DCEA 3KZSA 4H6KA 3I6CA 2QCNA 1YPIA 2R1PA 2YDQA 3EA3A 1HKJA 1OCQA 1Z7AA 3NZQA 2JBMA 1E9YB 4B90A 3FFSA 3FW6A 2XJ7A 1R3TA 4JIQA 4OHQA 3QY6A 5FSEC 3DH7A 1U5JA 2VC7A 1SW7A 3VC5A 1UD4A 4JXCA 5EGRA 1E55A 3VCCA 4KMQA 3W2LA 5F2MA 3FCPA 1I2RA 2GYIA 1W6TA 3UEQA 1JI2A 4QROA 5T9CE 4DUWA 2X1RA 2PCEA 1EGVA 4L6DA 7XIMA 3UQBA 3LCWA 1GVEA 4KWVA 1I1WA 3NGJA 2QS8A 3PZOA 4JAWA 3N11A 2VCCA 2QV4A 4IOTA 1FAPA 3B0YA 5C54A 2VC5A 4GUGA 1M7OA 4I7WA 3W24A 2YXGA 3FEMA 2DW7A 2V0TA 1TYGA 3LHUA 2PEVA 3DG7A 4GJJA 4NQ1A 4TVUA 1BF6A 1RH9A 3DYPA 1EF2A 1GOOA 2QKFA 2ZUTA 3UJFA 1E44A 1A3HA 1YXYA 3MTWA 4V28A 3AIBA 2VWSA 5I77A 5CPSA 4CKQA 1E56A 3QQ0A 2TPSA 3WLTA 2GQ3A 2NUWA 3W23A 3EZ4A 4GYPA 4KPLA 4MGVA 4LUSA 3VD3A 1ROTA 4A8NA 2H8XA 3AS0A 3BXWA 2PLMA 4CCZA 4JNMA 1NU5A 3RO8A 1LL4A 1H50A 1XBXA 3GK0A 3O0KA 1JFXA 1CXIA 4DUOA 3RFWA 4M82A 1TWZA 3PRDA 5G2IA 7PTDA 2ZUSA 4GJIA 4ZE4A 5CLTA 1MXSA 5ABHA 4GRSA 5DY2A 1AH0A 4HJWA 2PD9A 3EYPA 5AHFA 3VGEA 2CZFA 2Z2UA 2G8ZA 1CWYA 4G1KA 2ACUA 1B4KA 1E6QM 2P3EA 2BOGX 4K36A 4H8HA 2NQHA 5AC5A 2GSJA 3NQMA 3OZPA 4BS0A 3IWPA 2Z24A 4GKLA 4C6EA 3M0YA 1K4GA 3QV7A 4O50A 1Q4WA 1BVWA 1QW9A 3NO3A 4RX0A 3BLLA 1QOQA 2J9XA 5I3DA 4RV8A 3GHSA 4ZXOA 4XKMA 2VDGA 1VFHA 1ITQA 1J6YA 3VGFA 2HXTA 2CLMA 3DFTA 4JHMA 3C5QA 3O5RA 1Q3NA 1W5PA 1KO0A 2Y5SA 4GK8A 1CXKA 1VIWA 4DLMA 1J12A 3D3AA 2FHBA 4DXKA 3WN6A 2ZWZA 1EJRC 2Z1KA 3LCIA 1OB0A 5MKGA 3NI6A 3UP8A 1GORA 1CX9A 1X6UA 3SDOA 3DDMA 3E2RA 2INZA 3VDHA 1C93A 3EPMA 5GQBA 2RDWA 1SFSA 1CXLA 2XSAA 4TV6A 3A47A 3KE0A 4D6FA 1P0NA 2IS7A 4JYFA 1IV8A 1A4MA 1GT8A 2D2GA 1QCWA 1Q6FA 2Y7GA 4AVNA 2IPJA 3AYRA 4UMCA 3EWXA 4ADTA 1G4SA 1XBYA 1HJXA 1F3EA 7REQB 4BI5A 3KWSA 3VAWA 4C1LA 3M64A 4W89A 3EMZA 4GUIA 2OZ3A 1LL6A 3KEHA 1ZBKA 2QMKA 5D2YA 1JZ4A 1I4NA 1EP2A 3WJZA 1CDGA 3Q45A 4HCHA 1KM2A 3PPCA 4C6KA 1VCGA 1AJ0A 3CUGA 4M56A 4Q6XA 2WC7A 3AIQA 3W1XA 1OFOA 2NV2A 4A8IA 3KL3A 4CN6A 2PTZA 3UR2A 2HE5A 2HS6A 3B9AA 5I78A 3JYMA 1J79A 3QKEA 4GIRA 4CD8A 2QCGA 3LK6A 3O15A 1GOWA 3FVDA 1KBIA 5E70A 1RCOB 1J8VA 5EY5A 4DF0A 1UWUA 4GIYA 3BTNA 1IWPA 4W9PA 2Y85A 1BWVA 1H63A 3L21A 3POCA 1QW8A 4XZWA 4GO9A 4HPHA 3VIGA 3I3BA 4S3JA 3PZMA 3ELFA 1HNYA 3MP4A 1XFCA 1JCNA 2NX9A 4E4FA 1DPMA 1V4YA 4ROQA 4MZ8A 2HK0A 4KIRA 3MMTA 2FKEA 3K4AA 1R3VA 2V5LA 2XPBA 3MV01 1P7TA 1RJPA 5IHSA 1KRAC 4DZAA 4S3GA 2XH2A 2YB4A 4BZYA 2CZEA 4UTWA 1E6XM 2XPKA 3HMCA 4F48A 1OC5A 1WDPA 1M3UA 1V8EA 4Z2LA 2G4FA 1O60A 1DTUA 1F74A 3EEGA 4ERAA 4CNOA 3ATZA 1H0IA 3OG3A 5RUBA 3H24A 4GUHA 1UWSA 4LX4A 3MVTA 4JIHA 2CKRA 1DIDA 3HN3A 2VD9A 1F6PA 3A22A 4AZ5A 1SO3A 3IACA 4YVXA 1DL3A 4AX6A 3WO8A 3WNNA 5CLWA 1KLYA 5H1WA 5A8OA 2GWNA 4FNTA 3M6DA 3B40A 1IGSA 3G1HA 2Q5AA 3SFKA 1I0DA 1S5NA 3K1DA 2WHLA 1V3HA 2QNEA 4Y8EA 3S4TA 3FGCA 4DN1A 2GJRA 1MNZA 1XD1A 4XAGA 4UTTC 1OGSA 1PCKA 1TE6A 5XINA 2QPUA 4NY2A 1KCZA 1VB9A 2WSYA 4WD0A 4FIQA 5IBXC 1UIPA 2QQ6A 1B30A 2FLIA 1CNVA 2VR4A 1X1ZA 4R0XA 1OF6A 3L7RA 3MSGA 3L66A 2XP5A 3UR5A 4BY3A 4DH0A 4ODLA 2YCEA 1Q65A 3HJZA 3GAYA 1UUMA 2YA2A 2CLKA 5FL0A 4M80A 1E1CB 2YCKX 4OE7A 2BY2A 4HSNA 3BO9A 4GVFA 2W66A 4L61A 1ZBVA 3RLHA 4M8UA 1F40A 3QY8A 3T4WA 3N9KA 3S2NA 4XWUA 2ZCGA 1F2JA 4FF7A 1U2YA 2ZUMA 3HU7A 1QU4A 2QDEA 4HU0A 3AMCA 3S2MA 4BCEA 4ROPA 4LCSA 5U4NA 1JZ3A 3QM3A 1W9BM 3E2VA 2GOKA 5ABTA 1O1HA 4D9PA 2F9RA 4I8YA 1EGZA 6A3HA 1XPGA 1MW3A 1VFSA 1W32A 4GIAA 3BQ6A 3NVTA 2P10A 4F2UA 1K7EA 4P7RA 4GGHA 1Q8JA 2ZTKA 3DHDA 1RCXB 1X98A 2ISFA 4LAVA 1OYAA 4N6FA 1B3WA 2DDXA 8XIMA 1KFKA 3QVQA 2BY0A 2OOFA 3OP2A 1RQBA 4AZGA 5TBOA 4AW7A 2BGNE 3AYTA 1G67A 1C7SA 1LQAA 4I3GA 3SGZA 3MI6A 1BG4A 1PJ9A 2ALRA 2YPIA 2Q71A 1LOLA 1WUFA 3TLLA 1IGWA 3H7RA 5JH8A 4PRWA 3PG8A 2PUZA 3CLMA 3LGEA 2DH3A 1AL8A 5KINA 3HV8A 1A0CA 3SM0A 4LAZA 3VYLA 3ZJ8A 1M9HA 2QVHA 5G5IA 1K7XA 3PSVA 2VO5A 4L6HA 1UWRA 4TX0A 3N4EA 1TFVA 1JCJA 3IVTA 3KCLA 4NF7A 4AEFA 4AWEA 3MBDA 2Y8UA 1OFEA 4KWSA 4EOUA 1E0TA 4Q32A 3W6LA 2DGAA 2UZ5A 3WY1A 4JQ3A 3UCCA 5GJPA 5LA2A 3QSTA 2HQAA 3TYCA 5DO2A 3BDKA 4US5D 4OGZA 2WPGA 5HQMA 2WOQA 1JXKA 1AW5A 3T2OA 3SZ8A 1KRMA 2PWUA 2KZHA 2VN1A 1PHWA 1S3HA 1U1UA 2VZUA 2V2CA 3HGOA 2QULA 2V68A 5LA1A 2VFFA 2RUCA 4U4MA 1O7AA 3PWAA 3MHUA 1F3WA 3HO8A 3G8EA 3K8KA 2PBCA 3ID7A 2DORA 1M04A 2MLXA 3GNRA 2DT1A 5AZ0A 2W0UA 1FDZA 4FX7A 1TR1A 2NV9A 3D6NA 2WJZA 2D69A 3UF8A 3MHFA 4JIIX 8CGTA 3ARRA 1JI1A 2PBGA 4TU1A 3XISA 4AY1A 5A6KA 4J2MA 5E6YA 3TR2A 2C18A 2QEZA 4UR7A 4RPPA 3NO5A 1LQ2A 1GJUA 4LB3A 1IF2A 1R3YA 4HHLA 5D2VA 4GNJA 3KTSA 4WZHA 3EPNA 2GJXB 1ZL1A 1OZMA 4ZB5A 2PP0A 4XD5A 4AEEA 4YHEA 4WSJA 1T8QA 1GNXA 3OVPA 3HFTA 4BA0A 4MJMA 5A8QA 1P5QA 1EHNA 1EH9A 1FWIC 4IZGA 3M5YA 2AAAA 3ARZA 3I65A 4JIEA 4C6DA 1W3LA 4H6RA 3KTCA 1M03A 1CGUA 3NO1A 2PAJA 2ZDSA 3MSRA 3E0LA 4WF7A 1H1ZA 2WK2A 1V6XA 3NGFA 3NDOA 4LC6A 3D5HA 3G6LA 2YXOA 4NJJA 4M3PA 4US5A 4MZ1A 6PTDA 1P0KA 1KTBA 4JN8A 1HKVA 3P5YA 1PX8A 1F8MA 5BXPA 2F23A 4O1BA 3BW3A 4L1GA 5AECA 1EJSC 1KW1A 4MNJA 4KFOA 3TTQA 3RCYA 2PTXA 1H3GA 1E0VA 4Z2IA 1V08A 3TONA 4BI6A 3W2NA 1KTCA 2XSBA 4IT4A 3TAKA 3W1TA 4WX2A 2EQDA 4ATWA 2POTA 2RHGA 4BKNA 3T8LA 1ZALA 5CPMA 4ZS6A 3EWCA 1TWIA 3V75A 5EBUA 2WWDA 2Z28A 4FR6A 2V3EA 4L80A 4NAFB 4QIUA 1VBRA 2Y89A 3KBMA 3HPSA 3VMPA 2AL2A 1OCJA 3ECQA 1RP9A 1JYXA 1G94A 4ZBCA 3W53A 2DZUA 3S2JA 3CBWA 2R24A 1ADOA 4JN7A 4RDVA 3TFXA 4DF1A 1BYAA 4GZIA 1TPH1 3BAIA 4O53A 2Z1SA 4LRTA 4CNTA 4MG4A 2ZKMX 1ICSA 2BTMA 1QI4A 4NAEB 4L6OA 3VD9A 4LQ1A 1UPMB 3S3GA 1TG7A 1W17A 4GI8A 3GFYA 2CHRA 2WJFA 3P0WA 2UZ9A 4O1CA 1TRDA 3S1VA 1P48A 3FYOA 2WZHA 4DO5A 4L3NA 4HN4A 1GKQA 3MP3A 3L0NA 4TV5A 3SIMA 1OX4B 4MZYA 4QTGA 3VMOA 5CZ0A 1MUCA 1S2WA 1K9FA 1UB3A 2QCHA 3PBMA 4AZHA 2PC4A 1VEMA 4CD7A 4NVTA 3LUTA 3R7MA 1G7VA 3AISA 4RR4A 4IM4A 5HJYA 2JALA 1XLCA 2X0YA 3KZPA 4MKSA 4NT0A 4MGGA 2HPIA 3B8IA 4LF1A 3H2EA 4JY8A 1MWOA 3IUDA 3SN1A 3JYJA 3SGUA 1WAWA 1B3VA 5ABFA 1FFRA 3NXFA 1JZ5A 1A5SA 5A5WA 3RR1A 4HZMA 5G2WA 3LOTA 3NL3A 3C2VA 5DRIA 3CZEA 5K7JA 2YSWA 3IIXA 2RUDA 3AIUA 1ISXA 4NZCA 3QMTA 2DT0A 4GYKA 3T2QA 3R89A 3E38A 1L6WA 3F4DA 4DBEA 2ABAA 4PL2A 1YMYA 2V63A 1F9CA 3PZ9A 1RBOB 4IIGA 2KR7A 4B9YA 4IX0A 3RGCA 4AHOA 4YCOA 3BMWA 5A8MA 3ZLHA 1UWAA 1H7PA 4CNUA 1Q4NX 2J7DA 4JL2A 1WDDA 3HV9A 5BXTA 1JPKA 1ZJHA 2FDMA 3PB2A 1B4EA 1NTHA 3KBWA 3WBYA 4ENLA 5D38A 2C71A 2ICSA 5CJNA 4AFYA 3MUZ1 3I4EA 1V3JA 1J6OA 3W74A 4UTWC 2CLOA 4JX5A 4HNVA 4XO6A 4JCMA 4NX0A 1PINA 5HR6A 2C79A 2YFOA 3PP7A 3KOXA 4IQEA 3T6CA 4QQUA 3RO6A 3BZGA 5A94A 3E3HA 4LAYA 1BF2A 5CC7A 3VKJA 4IJCA 7A3HA 2WMGA 4OKDA 5E5CA 1ADSA 4XBKA 1XLJA 3PTMA 1E3ZA 1VPQA 2CFFA 3CASA 5AKQA 2QGYA 3VNDA 3W3OA 1N1AA 4S3KA 3NSNA 1TJ1A 3NYZA 2EG6A 3RAOA 4NXSA 2WMFA 4EF8A 3GNNA 4EPEC 3AZTA 1JZ7A 1SJBA 3BZJA 2NSOA 3DBPA 1GVFA 1CT5A 4EK7A 4D6DA 1VS1A 2J8FA 1NOFA 1HXJA 1FWFC 1QNSA 1ZNNA 3WZ0E 2REQA 5FF2A 4J3SA 1C9DA 1WYIA 3T8QA 1G01A 3UF9A 1EPXA 1KGXA 3SCRA 3QKZA 3TQVA 4ZFCA 1ECQA 3WH5A 4JZ5A 4HCLA 1W9UA 2V3FA 4V33A 4HK6A 2Y62A 1LM1A 5LIUX 5CBBA 1B9ZA 1PCWA 1HZYA 1O95A 5A8GA 2D20A 4F0LA 3ZZ1A 3MMDA 4W4QA 3UWWA 2ATMA 4YTSA 1EJVC 2V3DA 2BVYA 1FRBA 1R2TA 1UC4A 3JZUA 3PRAA 4ORIA 4OT7A 2HK1A 1OFRA 4YHGA 3WLJA 5C0QA 1DVJA 2RUQA 4RPQA 4JFMA 3CGMA 3TN3A 3FIGA 5BMWA 4REQA 2WLYA 1JVWA 4FNPA 3QR3A 3FA5A 4B5WA 5DMNA 2W62A 1OINA 2HVNA 3TQKA 3TYEA 3VOCA 1XBVA 4GFIA 3EDJA 3W82A 2NUXA 5LKYA 2O9OA 3GG7A 2QT3A 2PS2A 2VYOA 1EA0A 4L1XA 4U5IA 3JU2A 1WO2A 1WDSA 3IGXA 1JDAA 2PDHA 2WSQA 4XX6A 3GPKA 4IMAA 5C9XA 1W8GA 3O16A 5AB3A 1V7YA 3ZYZA 4U5KA 2ZE0A 4I5UA 2OEMA 2DG9A 3KBJA 1NFGA 5AHEA 4PSPA 2B81A 7ENLA 1WB0A 3RPMA 3S1WA 2DJLA 4MY1A 4I9AA 3UBPC 4NRRA 4UQDA 1QOPA 3LZ3A 4WDXA 4PN2A 2OGJA 3IK2A 4QHRA 3CJPA 1OYCA 4K2SA 3DFPA 3P7YA 1UZ4A 4GWEA 4YU1A 2X1IA 4ZO8A 2V6AA 3IAPA 4FXSA 1B31A 5BNKA 1TJRA 1GQIA 2F8QA 3CZJA 3H2MA 3SCTA 1VIZA 4GQGA 4GQRA 3ZR5A 4JIPA 1JYVA 3MCNA 4JL1A 3NM3A 2BG5A 1QBAA 2OX1A 2VEKA 4GBUA 2OO0A 2BVDA 2DUAA 3RM4A 3GH5A 2CCRA 3T2PA 3S2LA 3R43A 3QHMA 1X8CA 4ODOA 3UG3A 4H9VA 1UC5A 3N29A 4DI8A 4Q8QA 2OZ0A 1H2JA 3SO7A 5KITA 2CZ5A 1EZWA 3RM9A 5I06A 3BLKA 4YCPA 2W4XA 1DXFA 1YDVA 3TOYA 4ZMGA 1GTHA 4XKYB 4C7FA 5CG0A 4OBSA 4LV9A 4ZA0A 4DM2A 4JIRA 4LAOA 1P0DA 4JTJA 4WQ6A 1IXQA 5HNRA 3TUUA 1EP1A 4QJ1A 3RNDA 1UG6A 2VQUA 1OFQA 2XINA 1R9HA 3SUVA 2VCAA 3UESA 3S5ZA 4LUIA 2FYMA 4PUNA 4UFLA 2G