1HKJA

Crystal structure of human chitinase in complex with methylallosamidin
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 123
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkjA01
2O9TA 2WW5A 1YQ2A 1GNXA 3WF4A 3UEQA 1HJXA 2G3NA 2IXVA 4CU8A 4FLQA 2D22A 3J7HA 5C71A 1WDPA 2A3EA 3IJ9A 5CXPA 3ALFA 5CLWA 1M04A 3FNDA 2VOTA 2DIJA 1CECA 1WDQA 5EB8A 1C7TA 1SMDA 3L2LA 2O9PA 1E3ZA 2G41A 1B31A 4OBSA 3SCUA 1JAEA 2X1IA 1CLXA 4P8WA 1V6WA 3N12A 1C8QA 1OIFA 2X09A 1PX3A 3KEHA 1E6XM 1G94A 4GI8A 2W4XA 4ZE5A 3AXIA 4AZBA 1TE1A 2MANA 4MAZA 2EPKX 1W9DM 2XFFA 1JZ5A 1J9YA 2TAAA 3SCQA 4QDMA 3ARUA 1UYQA 1LG2A 3NJ3A 2YDRA 4HU8A 4M29A 3W24A 5M17A 1BYCA 2F8QA 3N04A 4AZCA 4H8VA 2YBUA 3DYMA 4AD2A 4BQ4A 1E6SM 3MSGA 4TUFA 3AHYA 1LLOA 5M5DA 1C91A 2XFYA 2X05A 1US3A 2W92A 3JUGA 5EFDA 1UUQA 1FP8A 2WHMA 3W27A 3WEZA 1BYBA 2CCRA 2BVYA 5I24A 1PX8A 1XD0A 5HBFA 1FHLA 1BVNP 4AD5A 4E2OA 1JDDA 2EO7A 2XHYA 1TUXA 2OWCA 3MO4A 1KR1A 2WAGA 1VEOA 2AMGA 3A4AA 3SCWA 3GBDA 1DWHM 1XC6A 1HNYA 1GQKA 1UZ1A 4CKQA 3K46A 4UFHA 1XCWA 1J0HA 4BQ2A 3T2PA 3FHAA 1GOKA 5LA0A 3F5JA 1TVNA 1HIZA 4W5UA 4Z2KA 1JI1A 6A3HA 3WQ5A 1CTNA 3WQ4A 3VVGA 3SIMA 3WDJA 2J7DA 3I3BA 1C8YA 3CUHA 3ARWA 4Q22A 2QMJA 1ODZA 4UFMA 4U33A 4CU6A 3VO0A 4A3HA 2QPUA 3WD2A 2WMFA 2VZOA 3VTRA 2VZSA 3T09A 3WDQA 3QHNA 4B9YA 5BXPA 1UR9A 4RE4A 3MUY1 1GZJA 4UQDA 4WLCA 3CZJA 3WDIA 1BQCA 5BYWA 5CGMA 3WMBA 1BYAA 1NOUA 2V5CA 1WZMA 1E70M 1W1TA 4W84A 4W7WA 2EPNA 4DUVA 1L8NA 1XV8A 3FAXA 1VRXA 2J7FA 3TTSA 1EXPA 4DUWA 2WPGA 1NWTA 1QI2A 3MUZ1 4HMCA 4HPHA 3VD3A 5EMYA 4CUCA 2J7HA 4WIWA 1JF6A 4U31A 4Z2JA 1E73M 3SUSA 1WDSA 3OZOA 3WENA 2EQDA 4OIFA 4MB4A 1JYNA 2ZUWA 1I1WA 1V3IA 2OYKA 4S3KA 1TA3A 1GQJA 4F8XA 1N82A 1AQHA 1W9PA 4FLSA 3VDHA 1JXKA 2V3EA 1HJWA 3CHEA 3G6LA 2W63A 1W9XA 1V3HA 1GOQA 4V2XA 1R86A 5AY7A 3FXYA 2V3FA 1V6YA 2CBVA 2OSWA 4J3VA 1UHVA 4ZXLA 2VTFA 2Y8KA 3L4YA 1Y7VA 4JCMA 3E1F1 3LPPA 5A8MA 4IPNB 3ZSSA 3QHOA 2CHOA 3WFLA 3L4WA 2ZUVA 3BCDA 5JBFA 3OIHA 4PUEA 1MXDA 1TG7A 3ZT6A 4D6CA 5AYIA 4X0VA 1K9EA 3BH4A 3VIHA 3VGFA 3ALGA 3WDPP 4ACYA 1CENA 1B2YA 2BXZA 3WL1A 2V5DA 4D6HA 1I1XA 1J0KA 1E0XA 2DSUA 2J7GA 3N11A 3ZJ6A 3L2MA 2QV4A 3CZKA 2Q8XA 3WF1A 1EQPA 1KXQA 2VCBA 1QI3A 2ZOXA 3W53A 5GPRA 1PAMA 3NUKA 3WEMA 1HJUA 4LGXA 3ZJKA 2D24A 1KWKA 3HU7A 1E4LA 5IFPA 1Z32X 2WZIA 2XM2A 2ZX5A 4HOXA 2ZX9A 4BQ3A 1W1VA 1GVIA 1MQPA 4D6GA 3O9NA 1W1PA 3K8LA 3WH5A 4NZCA 5E6ZA 3WN6A 1JZ2A 2PI6A 1QI4A 3CH9A 2DT0A 1GCYA 3GZAA 4LXFA 3ZT5A 1OT2A 2IXUA 3DC0A 5I77A 1OIMA 1E5JA 1UQYA 2PBOA 4EAMA 5D9OA 3PZUA 4AYSA 3IJ8A 1ODUA 2ZXQA 3WH9A 3CPUA 3T0AA 3W29A 4PSRA 4PMRA 5CSUA 4JL2A 1LQ0A 2XWEA 2DGAA 2WZHA 4PMQA 3O6AA 3EMZA 5DT5A 3WD0A 3PZQA 1CPUA 3SCVA 2WVSA 2PBGA 2DPEA 1H41A 2JEPA 2JIEA 1EOKA 6CGTA 1O7AA 4JCLA 1VEMA 3WNLA 3BAWA 2XIBA 3ZJ8A 2PWEA 5CLTA 5AYBA 3UETA 3BSHA 2E9BA 3ZT7A 1QW9A 1QW8A 5E6YA 4HZ7A 4GQRA 1W9VA 1CXLA 2F2HA 4CD6A 1GQLA 1SYTA 2G4FA 2GK1A 5E0FA 1H49A 5JUVA 2CITA 3PZIA 1UKOA 4RL3A 1OGBA 1J0IA 1GVYA 4KGJA 1LJYA 1MXGA 4LQ1A 2ZUTA 3SURA 3NIYA 1OCQA 1G0CA 4QP0A 2A3CA 4MB3A 1BLIA 1C3FA 1E6NA 3II1A 5GNZA 5D4YA 1GOIA 2J7EA 4RE3A 2CPUA 1NM9A 2VVSA 3K4DA 1V02A 4D72A 1E1FA 4PN2A 2E40A 2D3NA 1GHSA 1TVPA 5IDIA 2C7FA 1JG9A 4TTUA 4J28A 3VNYA 1E4NA 4KMQA 3BAKA 3W82A 2VZTA 4HZ6A 3VIIA 3W38A 2VI0A 3WNNA 3VIMA 4KGLA 4WSKA 4NRSA 1RP9A 1EHNA 4V27A 1NOWA 1BF2A 1UR8A 5DF0A 3VILA 3VGDA 1ZU8A 2HVMA 3D5HA 2WKLA 3VUPA 1GONA 4P8XA 1B90A 3CGTA 1WDRA 3T0DA 5HDRA 4QFUA 5CGTA 1V6VA 3AIQA 2XYLA 2J74A 2ZXDA 1DWJM 2WWCA 3TP4A 7TAAA 1C7SA 5HOSA 2W61A 1QI0A 4AD0A 2DT1A 2VQUA 2XG9A 2VJXA 3WF2A 3RO8A 2VCCA 3OB8A 2J62A 1JNEA 2X2YA 1V0LA 1HKIA 5BRPA 4WK9A 3WQVA 4Z2IA 1WAWA 2OLHA 1B30A 2XGBA 2YA1A 1QI5A 4UFJA 2XVGA 4ACZA 1QHOA 1VBUA 3AXHA 5ABFA 3ZJ7A 2WLYA 1JYWA 1FH8A 3AIUA 3WD1A 2CYGA 3PTQA 4ATWA 5I6SA 3AIWA 5D8ZA 4EKJA 2D2OA 4OZOA 4IPLA 1BGAA 2WC3A 1ZL1A 1FP9A 4OOUA 2BHUA 1HL8A 3WDRA 3B8SA 5BXRA 3GXMA 2JALA 3WQWA 1JZ6A 2VX6A 3T08A 1H09A 2QF8A 4HOWA 3VINA 2EBNA 2XSAA 2F61A 2YOCA 1OINA 3N13A 2GSJA 4CD4A 2V38A 5A6BA 1TFVA 5I23A 1I75A 4AZ5A 4DWSA 4TVDA 4H41A 1WB0A 5JH8A 5CG0A 1K6AA 4UOJA 2DT2A 4J3SA 3WUEA 1RP8A 4GPNA 4M8UA 3A3HA 3AS3A 3BLKA 4QLLA 3AOFA 3VM5A 1CXFA 1E56A 1PZ3A 2A3AA 2BY2A 4W8AA 1DWIM 1BFNA 2IUZA 1V6XA 1UA7A 3ZO9A 1HJQA 3M7SA 2PC8A 4AD1A 4U2YA 2BHYA 5JIPA 3BGAA 3WELA 3AS1A 2YL5A 4E8DA 4TTGA 5E70A 3HN3A 3RDKA 4BF7A 3RM8A 2ZUUA 4PEEA 4NSBA 3MV01 2EEXA 3WDHA 2YLLA 1US2A 3W25A 2ZXAA 3BSGA 5A2CA 3SUUA 4CVWA 1CDGA 1JYXA 1BHGA 2GK1B 4M24A 1XSJA 1E1EA 4PMOA 5C8BB 2VZVA 4HZ8A 2ZX8A 2WVUA 2YDQA 1HKMA 1CBGA 1KB3A 3EDDA 4BA0A 4K68A 1GJUA 4P7QA 2NW0A 2DSVA 4UNIA 2CNCA 4W88A 4B15A 2FH6A 1W3KA 3APGA 3T2QA 4TOQA 5GNXA 1HKJA 1EHAA 3QR3A 1GUVA 1EDGA 2ZUMA 3PZOA 4U3AA 3ARPA 3CMGA 4PTWA 3DYPA 2BNJA 3VGEA 2J25A 1JXJA 3KWXA 3WH6A 2WCSA 3PN8A 4GXPA 1IT0A 3NDYA 3UR8A 4JFVA 4GZEA 4QLKA 3OZPA 4D1IA 1E71M 1VFOA 4J7RA 3CZ8A 2G3IA 2UWFA 2D0GA 1CYGA 3CMJA 1H11A 3KL3A 3AICA 2PWGA 3WFZA 2WYSA 2XM1A 2WANA 3GNRA 4GI9A 3MMUA 4M56A 3VX0A 3VMPA 2RGMA 2D23A 1HJVA 2DEPA 1HL9A 3IAPA 3VGBA 1WPCA 3ZIZA 4MDOA 4XX6A 1J18A 1NP2A 2DSWA 1UH2A 3CHFA 4D71A 3T0BA 1J0YA 3EDKA 1GJWA 4W7VA 4L4OA 1Q6GA 1KCKA 3AXXA 3ZQ9A 1E6RA 4ACZB 2CKSA 1ZS2A 2A3HA 2WM0A 1CXIA 1TCMA 3UCQA 2J8GA 1E0WA 4JL1A 1TZ7A 3CUGA 5DFAA 1OWQA 2ZWYA 3RPMA 2ZX7A 1NWSA 3PZNA 1CLVA 1QPKA 3WUGA 1EA9C 9CGTA 3LPOA 4KRUA 1M03A 4PYSA 1XSKA 1W2PA 3OGVA 1E72M 3U5YA 1J10A 1C8XA 3PTKA 5IXEA 1B1YA 1MQQA 4PMVA 4H8UA 3CIVA 2CEQA 4AZHA 1W2VA 3VDAA 5CSYA 2WXDM 4AMCA 2XVNA 4AD4A 2EPMX 4A4AA 1UG6A 1ZJAA 3GNPA 3IAQA 5F7UA 5C70A 4ZE4A 3ZR5A 4UFIA 4D6EA 3G6MA 1B3YA 3K8KA 2ZXBA 1C92A 1HJSA 3L4ZA 4PMXA 1J11A 4W8LA 1FFRA 1V0KA 1B3WA 1K9DA 3WL0A 3VNZA 4GI6A 2X0YA 1MVYA 1QBBA 1A47A 1LL7A 3VU2A 4HTYA 3U57A 1JF5A 1CXKA 5I78A 1BTCA 4KWUA 4BS0A 3VIKA 3UR7A 3UG3A 1DWGM 1VENA 5A8QA 2YA0A 2VMFA 5CZKA 1KQZA 5A1AA 1VFMA 1WCGA 1AQ0A 6TAAA 1XH2A 3OA5A 1U33A 2JE8A 4NI3A 5A6LA 2JF7A 3LPGA 2J78A 1UD5A 4ML4A 4H8HA 1VFFA 3ARQA 3MANA 4CN1A 4AW7A 3MMWA 3RMEA 1Q6DA 4WKAA 2GDUA 1O6IA 4Z2HA 4OJYA 5TD4A 1R8LA 4GINA 3LPFA 3OG2A 3EYPA 4FF5A 4MPKA 2WMIB 4PSPA 2YLAA 4U5KA 4ZXOA 3THCA 1UH3A 1QOXA 3AFBA 4M82A 4MNJA 1HF6A 3SCRA 1HX0A 5BWFA 2WWDA 1M01A 2GFTA 2X8RA 1EQCA 2G8ZA 4J3UA 4W86A 1V3JA 3O2LA 4B3LA 3MV11 1JZ4A 4R27A 3WBEA 4CCCA 1FOBA 4D6IA 1KBKA 4C7FA 2GUYA 4GQQA 2ZIDA 4DWSD 3POHA 2GJPA 2BV9A 5A6BD 1V3LA 3F5LA 4MNMA 5FIPA 2CBJA 4OOZA 1BSIA 3DHPA 4JKLA 5A6SA 1H2JA 5E09A 3HMCA 4WKHA 2C0HA 4DM1A 3BMVA 4LX4A 2E0PA 1ISVA 1ISZA 1M53A 1VJZA 2QHAA 4DWSC 1EDTA 3U7VA 2ZWZA 4JAWA 5I3DA 4AIEA 2Z1SA 4W5ZA 2FDMA 3CHDA 3F5KA 1RD6A 1UKPA 1DHKA 3AIVA 4MDPA 1WNOA 4QCEA 4P8VA 1W3LA 1M7XA 1UWIA 3OLEA 1QNRA 1DWAM 5IHRA 1UD2A 4JFTA 3B9AA 3WNKA 1V6UA 3AISA 4D1JA 5BXTA 2QLYA 1HP4A 3ZM8A 1QHPA 1FH7A 2OSXA 4Q7NA 2FHCA 2VR5A 3KZSA 1H0GA 1QNOA 1H5VA 1R7OA 1UH4A 3KE0A 4HU0A 3U5UA 2J7CA 2XVKA 1W32A 5DT7A 2PF0A 1K9TA 3MUIA 3EBVA 1UA3A 4GIAA 1TR1A 3PZ9A 3B9EA 2QMKA 3ARSA 1CXEA 2G3MA 2BS9A 3EMQA 3S2CA 1LF1A 1RPKA 2GDVA 3WY1A 3AHTA 2YJQA 2BVTA 3GH7A 3GYCA 4D6DA 1ZJBA 3VGHA 4PTMA 1UWTA 1CNVA 4PMYA 1QNQA 2JEQA 1VEPA 4WF7A 2Y8VA 1WZAA 2J79A 3ECQA 3UERA 1V3MA 3MKKA 4TX6A 5AC5A 3TTQA 2EPLX 1VB9A 4FK9A 1TA3B 4GZJA 2RGLA 1J01A 2DSKA 3THDA 1GOWA 4KH2A 3CZGA 3ARRA 3MSDA 4MJ4A 1W91A 4HOZA 4TX8A 4P8UA 2BXYA 1KXTA 2WCGA 3LMYA 4C7DA 4M1RA 3PZVA 4W85A 5I79A 5JBDA 3PHAA 4UZUA 2J75A 4WKFA 2XGIA 3AIEA 3PZGA 2WMJA 1TMQA 1C93A 3WF3A 1QNPA 3K4AA 4IISA 4UCFA 3RJYA 3WEOA 4URIA 2VR4A 4Z2GA 4MB1A 3NYDA 2W67A 3TOPA 3CZLA 2Y4SA 1ITXA 5ABFB 2YL9A 1VFUA 5DO8A 4PMUA 2CESA 4F9JA 2O9RA 1PX4A 3GDBA 1KFWA 2VCAA 3VM7A 1QNSA 4J3WA 4UTFA 1IZKA 4UQEA 3L4UA 1ESWA 3PZTA 3FY1A 2PWHA 3BMWA 1MYRA 2UY4A 4UOZA 1R87A 2WKGA 1XYFA 3WD3A 1OT1A 1GHRA 2YDSA 2Y24A 3W26A 1X6NA 2PB1A 1LL6A 1XRVA 3VIOA 2VQTA 4S3JA 1H3GA 3AS2A 2DQXA 2XVPA 4UQAA 8CGTA 5A94A 2D20A 5E9AA 4HA4A 1U2YA 4RE2A 4PUDA 2OSYA 2VX4A 3VIFA 3MUAA 1E4IA 4PCTA 5I5RA 3EDEA 2FH8A 2AAAA 1VBRA 1QBAA 3FHQA 1G5AA 1PIFA 4TXEA 1KGXA 3ARZA 4NF7A 2FGZA 5I2UA 1B9ZA 1H0IA 4HPGA 1JZ3A 3N1AA 1OD0A 4W93A 3MS8A 2VNCA 1V08A 3PBGA 4TVUA 2WBKA 1G01A 3WSUA 4ZEPA 4AZGA 5A8NA 1MFVA 4EANA 4PTVA 2DSZA 4EE9A 1H4PA 1PEZA 1UWRA 3RILA 1ISYA 1MW1A 1BPLB 2XVLA 3MU7A 1UZ4A 4L4PA 3IANA 3DYOA 4ZENA 1Q4NX 1CEOA 3ARVA 4AY1A 5BROA 1Q6CA 2GJXA 2WSKA 3EMCA 4UZSA 1CGUA 2VUYA 1X1NA 2WMIA 2DT3A 3VMNA 4E4PA 4F9DA 4AXNA 3CHCA 4XZBA 3W28A 4M80A 1XGZA 4LYRA 4W87A 3M07A 1AVAA 1NWUA 1ZBVA 1SMAA 1FA2A 3RCNA 1F4AA 2YA2A 4U3CA 2BY1A 3VD9A 4CN6A 5I0DA 1GOMA 3DECA 4XV0A 2CETA 5CPTA 3AIRA 2EJ1A 1E6ZA 2XFRA 2WVVA 3SCNA 3WNPA 2WC4A 3GM8A 3VOCA 3ARTA 3BC9A 4IM4A 1E43A 1UR1A 5A2BA 1SR0A 3GBEA 4ATLA 1XD1A 1UWSA 4TVCA 1EH9A 1UD4A 3KL5A 3WIJA 1CGWA 1IV8A 4UFLA 4PMDA 1KXVA 7CGTA 2WHLA 1R7AA 1JFXA 3W37A 1G1YA 3W6MA 4UQ9A 4JFWA 3WUBA 2DH2A 2E4TA 4CU7A 2DDXA 4ZFMA 5KEZA 2VT0A 1J0JA 2J7BA 5ABHA 1U30A 5BRQA 4IUGA 2Y2WA 3AYSA 2G3JA 5D9MA 3B9DA 1KR0A 2FHFA 3WKZA 4UQCA 2WCAA 5DMYA 1AQMA 3N18A 2WHKA 5BCAA 4AISA 1MW3A 4MNKA 4GO8A 1HP5A 4BQ5A 3CO4A 1PBGA 3VGGA 2AOSA 2DIEA 1BG9A 1XSIA 2GJRA 4NRRA 1DWFM 1ECEA 1SFSA 8A3HA 3K8MA 4J27A 3NSNA 1P6WA 4E8CA 1EOMA 3SCTA 5LYRA 4B3KA 3AZSA 2Y5EA 3AI0A 3AMDA 1QVBA 3GXIA 1NH6A 3L4XA 4MTVA 3I3DA 5HNNA 4CGTA 5FL0A 5CJ5A 5A6KA 2WHJA 3VKKA 3GH5A 5LA1A 1KBBA 5FL1A 3CLWA 3BXWA 4Z2LA 2YL6A 5CPQA 4HA3A 2D3LA 4FLOA 2Z1KA 1UD6A 1JAKA 1WKYA 3M46A 5A6JA 1KQYA 4EK7A 2XUCA 3VD7A 5A95A 3VDBA 4HA1A 5M03A 1NP0A 3ZOAA 3IK2A 3UG4A 2XIIA 1E3XA 3VMOA 3AMLA 4PMNA 4PTXA 1GOOA 4AIOA 1KGUA 4GZIA 4UOQA 3UESA 2EXOA 3GXFA 4AWEA 3VD5A 3A47A 4DWSB 3AHVA 1JYVA 2WVVB 1GW1A 4YPJA 4F79A 3BAIA 4LPCA 1B3XA 2UY5A 4XUYA 4KRTA 5GNYA 2YIHA 1NARA 1W9UA 1FFQA 3U7BA 1EGZA 1J0ZA 2VX7A 2NT0A 1ZB5A 4FMVA 5GQBA 2BY0A 2E8YA 3NCOA 4P7OA 5EBAA 1UR2A 4D6FA 4PBGA 1JZ8A 3GNOA 1CGYA 2V3DA 2VRQA 1CIUA 1B3VA 3CUIA 3HJEA 4J3XA 3OGSA 2W5FA 3CBWA 2XSBA 4QLJA 3AS0A 3RJXA 3ZSTA 3SUVA 2D1ZA 2E9MA 1MFUA 4YN5A 1V03A 3PTMA 3WF0A 3ARYA 4AZ6A 2CBUA 3VIGA 3BLPX 2VURA 1Q6FA 1HVQA 1JI2A 1MWOA 1UD8A 5A6MA 3AMGA 2V3GA 2GJXB 5ECUA 3RIKA 3TA9A 3QOMA 4W89A 2XTKA 2CHNA 1DP0A 1CZ1A 1E6QM 1CGTA 1EDQA 1NOFA 3IJ7A 4OUEA 1W3HA 1AMYA 3TONA 3W6LA 3VD4A 3AIBA 4AEFA 3WH8A 1VF8A 1XYZA 4WSJA 5AC4A 4V28A 2CXGA 2WK2A 2XJ7A 2VZUA 1UKSA 4FLRA 2OYLA 1K9FA 5HPOA 1FH9A 3EDJA 2WBGA 2WMHA 1UQZA 5ABEA 4N0RA 3AHZA 2BFGA 1BAGA 1IZJA 2JF6A 1OSEA 2E9LA 4CN4A 5M3WA 2WMGA 1RH9A 1ZBWA 3SCSA 3AQUA 2W62A 1JIBA 5DEZA 1E40A 1EO5A 2B31A 5IFTA 4W7UA 4PMZA 3GXDA 3VX1A 2NSXA 1PZ2A 5FKYA 4MADA 3WQ8A 3CTTA 1UOKA 1VJSA 4DUXA 4GO9A 2ZICA 2JIWA 4LYPA 2YL8A 2J8FA 2ZUSA 4CD8A 3FAWA 2JFEX 5HXMA 1F4HA 4JIEA 2J77A 4U2ZA 2BVDA 1E5NA 3EDFA 3SCOA 3AJ7A 4DM2A 3BCFA 4A3YA 1JDAA 2D0HA 1NWRA 1HVXA 4AIUA 3SCPA 4D6JA 1CXHA 2PWFA 3WH7A 3PZMA 5D9PA 4JHZA 1WZLA 1JD9A 4W8BA 1BGGA 3GTNA 2J47A 1CGXA 1Q6EA 2FHBA 2QPSA 1JFHA 4H2CA 3N17A 2XPKA 5D8WA 4JZ5A 4PCSA 2NT1A 5ABGA 1D2KA 4AZ7A 3OBAA 1EO7A 1V3KA 1KGWA 3ZMRA 4YHGA 5FCZA 2WC7A 3GH4A 1BYDA 1J12A 4MJ2A 2W91A 3W0KA 4UFKA 1JDCA 1NQ6A 2OWXA 3FW6A 3D3AA 1UWUA 3WBAA 3WD4A 1CWYA 1LL4A 2BHZA 1WE5A 2J4GA 4LYQA 2VVNA 2YKKA 3A4XA 4WJXA 4MAVA 3BAXA 2ZUNA 3VIPA 3F4VA 3TTYA 4CCDA 3MMDA 1S46A 1B3ZA 2VL4A 1V0NA 1ISWA 1ISXA 2OYMA 5A3HA 4QCFA 4ATDA 1OBAA 3N9KA 4U5IA 5A69A 4BCEA 4B9ZA 1WZKA 5JIWA 2DH3A 2UY2A 4HMDA 4X9YA 3QGVA 3NSXA 3WUFA 1DEDA 1QHZA 3WNOA 3L4VA 1W1YA 5A8OA 1HXJA 2CKRA 3TTOA 2C8NA 2E8ZA 3N15A 1PJ9A 1OGSA 1V02E 1LG1A 1UKTA 1UR0A 2VX5A 3AHXA 3NDZA 3SUTA 3RM4A 4PRWA 3QHMA 2WVTA 4N42A 4GKLA 1WP6A 1V0MA 1XHGA 1JD7A 3OLDA 2WSPA 2WZEA 3AYRA 1GORA 3KL0A 3OLIA 3VDCA 2CERA 5BXSA 1JZ7A 5FOOA 4P7NA 3POCA 4AZCB 1JNDA 1E55A 3CUJA 1D3CA 1GQIA 5IHSA 4XZWA 1GPFA 3SUWA 3SEPA 2CIPA 1HN1A 2HISA 3M6DA 1E9LA 1UR4A 4AZIA 3W81A 2WLZA 1CGVA 1OGGA 1E15A 4H7VA 4JKKA 4H04A 1ITCA 1PPIA 1R85A 4P7RA 3QOKA 1MW0A 4JFSA 3CZEA 2UY3A 4HMEA 5HPCA 1YHTA 1X6LA 1ZBKA 3WQ6A 3AZTA 3AMCA 3AZRA 1BG4A 1B0IA 4AEEA 1PIGA 3DHUA 4CCEA 1ZBCA 2W66A 2GVYA 4YHEA 1OD8A 1G9HA 1H1NA 4CD5A 1E0VA 4UR9A 4Y7EA 3I3EA 3A4WA 3WMCA 1W9BM 5A2AA 1C90A 2WMKA 1LWHA 3K1DA 1JGIA 4CVUA 3WNMA 2VC9A 4JFUA 2O92A 3W4RA 1KCLA 5D9NA 4F66A 5KZ6A 1DTUA 2WB5A 1A3HA 1E4MM 1MQRA 4UQBA 1MW2A 1XCXA 2X0HA 4X0NA 2D0FA 3L4TA 2E3ZA 1KWGA 3VPLA 2VO5A 4BZYA 4AD3A 1JL8A 3RM9A 7A3HA 1D7FA 4CD7A 4AC1X 2YBTA 1W3JA 1OM0A 1XH0A 5CPSA 3BAJA 3ZR6A 2VRKA 3CUFA 2ZX6A 4J3TA 1E6PA 3OGRA 4JKMA 2CBIA 5CQ1A 2ZE0A 4P7LA 3AROA 1LWJA 5A6AA 1BVZA 4OBRA 5EFFA 3WMSA 4MNLA 3VIJA 2XWDA 2ESCA 2OWWA 3FN9A 1VAHA 2A3BA 3OLGA 1KXHA 3AMKA 2VRJA 2O9OA 5A8PA 4OKDA 4B16A 1EIBA 3ARXA 1UWQA 1UKQA 4QAWA 4C7GA 2FGLA 2EPOA 2WNWA 2BY3A 1OB0A 4XB3A 3A6OA 5LA2A 3NSMA 3S6TA 1HT6A 4M81A 3T2OA 1XH1A 3BAYA 1VIWA 4HP5A 4MB5A 3UG5A 1HKKA 1FHDA 2PWDA 5JBEA 4R5EA 5FD0A 4JHOA 1UD3A 5E0CA 1L0PA 1WO2A
chains in the Genus database with same CATH superfamily
3YPIA 1QASA 2WW5A 2BBFA 1GNXA 3L12A 4E0CA 1DJNA 3R2GA 4JTHA 1XC4A 1HJXA 2G3NA 4CU8A 4IQ2A 4FLQA 4UC5A 2D22A 5K9DA 5C71A 2OQYA 3ALFA 3O63A 1M04A 3FNDA 1CECA 2J88A 1SM9A 1C7TA 3RAOA 3RPDA 1E3ZA 1B31A 4JQ3A 4JNZA 1F3TA 2ALDA 1JAEA 3RK8A 2J9XA 3HA1A 1C8QA 2Y62A 2QUVA 2CZEA 1OIFA 1G94A 2VEMA 4DRIA 1H7RA 4MAZA 1X38A 2EPKX 2XFFA 1JZ5A 2PN0A 4MLRA 1DXFA 4EXQA 4QDMA 3TCEA 4DRSA 4TV5A 1LG2A 2Y61A 1MO0A 4HU8A 3GY1A 3W24A 2IPGA 2F8QA 3DYMA 4AD2A 3MSGA 1ADOA 2J9ZA 4QG6A 4NUWA 5HNRA 1AL7A 3GHSA 3AHYA 3R43A 4ORIA 3SZ8A 1C91A 1UUQA 4ZZ9A 3C2FA 3NGFA 4UTLA 1ADSA 1R3WA 3W27A 3WEZA 2CCRA 4JICA 1PX8A 4JEJA 4KR0B 3E96A 3TAKA 1BVNP 5LSMA 5HT1A 3TYBA 1GKQA 1TUXA 3EWUA 4R9OA 3W2KA 1DVJA 3E6EA 1VEOA 2AMGA 1HNYA 3DBPA 4CKQA 3K46A 4UFHA 3UPBA 2FB3A 3KBVA 4MY9A 1XCWA 5CBBA 4BQ2A 3T2PA 3EA3A 3VNJA 3F5JA 3L0GA 1TVNA 1QAPA 4Z2KA 3ODKA 1B54A 3WQ5A 3VVGA 2VDGA 1YW5A 3WDJA 4ZMGA 2J7DA 3IGHX 4GQGA 5D2XA 5EMKA 2FZMA 4IGNA 1XLKA 4S2CA 4GUJA 3TSBA 4QT2A 3QRHA 4A3HA 3CGNA 2QPUA 3WD2A 3VTRA 3T09A 1KT0A 4PE8A 2IS7A 1Z6KA 4LVGA 4F0LA 3VOFA 4NAEA 3OTRA 2Y89A 5BXPA 4H8NA 2WZMA 3IJDA 4RE4A 3MSRA 3MUY1 1GZJA 1XPYA 1YXYA 3WDIA 7REQB 5BYWA 5CZ0A 3F4DA 3JU2A 3N6HA 2LJ4A 3B0UX 1W1TA 5J8LA 2PURA 2CXEA 1FWWA 1ZJIA 3NPWA 4O16A 3P8JA 2A2IA 4BY3A 2HJPA 4HMCA 3KZPA 3LERA 1AJ2A 5EMYA 2FZDA 2ITKA 4X2RA 5FJUA 3OO2A 4QG9A 4C1KA 1EL3A 4AX6A 4DBSA 3UI5A 5G4HC 4RNIA 1Z41A 1GQJA 1GQNA 1HL2A 3LHTA 4FLSA 1A7XA 1Q6IA 1JXKA 2V3EA 1HJWA 3G6LA 4B4HA 4HKPA 3MO7A 5FF4A 4MOZA 3WQOA 2UZ9A 3VNIA 2QKFA 3OBEA 3FXYA 4JFLA 1Q6RA 6TIMA 1LUCB 1XKYA 4QEHA 3DFHA 4J3VA 1UHVA 4ZXLA 2Y8KA 5AC6A 5A8MA 3ZLHA 3F4WA 3WFLA 2QIWA 2BOGX 2ZUVA 3BCDA 3KAFA 3GDRA 1SW0A 4MZ8A 1K9EA 3BH4A 3P6LA 3VIHA 2JZVA 4AAJA 3WL1A 1J0KA 1XXXA 3BTNA 2J7GA 1W5OA 2QV4A 1SVDA 3CZKA 3M5ZA 5L9FA 3WF1A 1QI3A 2TSYA 2VCBA 4TO8A 5DY2A 3W53A 3M47A 2I17A 4DH0A 4JTQA 3NUKA 3WEMA 3NZPA 1W1B1 2VUNA 3DAQA 1GK8A 2PDPA 3W7GA 5C6MA 4JN6A 1E4LA 1Z32X 4OGZA 3W2LA 2WZIA 3SGZA 2XM2A 2ZX5A 2R91A 1W1VA 1JDFA 2DORA 3LSCA 3ISIX 4A3UA 4Z17A 4NZCA 3EPMA 3WN6A 2QCMA 3Q2DA 3V75A 2EG6A 1OT2A 1P5QA 4ODQA 1YEYA 2PBOA 4EAMA 5HUPA 2ZDRA 3RCYA 2HCVA 3NTYA 4PCFA 1DKWA 2RUQA 5FACA 3W84A 2C91A 2PAJA 1EJTC 3G1SA 5FEPA 3T0AA 4XSLA 2A7PA 3W7LA 2QCDA 4LNYA 3CYJA 3O5IA 3EMZA 3QKEA 2PBGA 3E5BA 1EOKA 2F23A 4S3BA 3I10A 3BAWA 3ZJ8A 4FF7A 1RXOB 3UETA 3VOIA 1UUMA 4HNUA 3BSHA 3W01A 1QW9A 4QE4A 4J1OA 2ZA3A 1YLVA 1ZZMA 2A6LA 4G8TA 2G4FA 4JDYA 2GK1A 3ABRA 3NOEA 3NEHA 4AHOA 4DRQA 4A3RA 1GVYA 3U48A 4S3FA 3SURA 3ZFHA 2ABAA 2YB1A 4HN8A 2PF8A 1MNZA 3W86A 4L9YA 5HJXA 4MZ1A 5IM51 1FKLA 4LBRA 1L6FA 1FXPA 3II1A 4WX2A 2QVHA 1XLFA 4YTSA 3L21A 2R24A 3CV2A 2GQ9A 2OGYA 3K4DA 2Q02A 3UXDA 1KM4A 1EA0A 3WX7A 1MUWA 3KBMA 4C6KA 5H8MA 3W1QA 4FNUA 4XQ6A 1WKDA 4TTUA 3VNYA 3IWPA 4WDWA 1ME7A 3ANUA 1VYPX 3MVTA 3VIIA 3W38A 1YMYA 4EF8A 2VI0A 5GJNA 3WNNA 3KVMA 4A8RA 4WSKA 4NRSA 2CLKA 1NOWA 4PUUA 1LZOA 1TJ0A 3VGDA 5A8GA 5LGXA 2NLYA 2HVMA 3PJUA 3VUPA 1PTDA 3CGTA 3T0DA 1POJA 1V6VA 3O5DA 2WQDA 7TAAA 4MJZA 2XG9A 3PA7A 1JNEA 2X2YA 3GU9A 3PULA 1HKIA 4ZR8A 3RF9A 4ROQA 2AGTA 1WAWA 3Q58A 2XGBA 4UFJA 1Y0EA 1XGEA 1FH8A 1TPEA 2FJUB 3WD1A 2VYOA 5I6SA 3AIWA 4EKJA 5HW6A 2M08A 4OOUA 1FP9A 3WDRA 4KESA 2PDXA 3B8SA 5BXRA 2D69A 3GXMA 3NVTA 5LHFA 3GAKA 3EOOA 1JZ6A 2VX6A 3T08A 2PEVA 4HOWA 4ODRA 2F61A 1OINA 5KINA 1EF2A 3N4FA 3OZYA 1MUCA 3BOFA 4TVDA 1WB0A 4FAMA 5F1VA 1H7PA 4FXFA 3WUEA 2XIOA 3SY1A 4M8UA 3AS3A 2AWGA 2ONEA 1EYEA 1PZ3A 1E56A 4MMWA 2A3AA 4NZFA 3M5VA 1TYGA 4AD1A 2PC8A 2FFCA 3W7RA 4DIAA 3VKAA 1G4SA 1S2UA 3TW9A 1J4RA 3C2OA 3BGAA 3WELA 1OC7A 2ASHA 2NXIA 3M4HA 3M0KA 5DRIA 2YL5A 4EVZA 4TTGA 3W7HA 3DFOA 5E70A 4JX4A 3RDKA 4BF7A 1SGJA 2EULA 1I9CB 1US2A 3AYVA 1VFSA 5F4XA 3LYEA 3SUUA 1R9XA 3HF3A 1JYXA 3LHYA 3BURA 1EIXA 1KM2A 4V1YA 1LOLA 3DKLA 5C8BB 5IBXA 4HZ8A 4NU7A 3JZUA 3P8IA 5C9UA 3QV6A 4LUJA 1OABA 4K68A 1SZEA 3TFXA 2PC4A 4UNIA 2PZ0A 2CNCA 1FHUA 1XGDA 4Y9AA 1OFEA 3UWYA 2FH6A 4I6KA 4TOQA 1HKJA 3HPAA 1FBAA 1LORA 2IPJA 2NWRA 1Z44A 4R7OA 4V1XA 1KC7A 1IYXA 4MFDA 1A0EA 2CLPA 4LW7A 2ZRXA 3NO1A 4I5XA 3N19B 1VBGA 3MHUA 3E5PA 2W79A 2IF4A 2PGEA 4C1NB 1IT0A 4RUBA 4JFMA 4GZEA 1KM0A 3OZPA 1E71M 1JVNA 3NVDA 4J7RA 1REQA 4LEFA 3EX6A 1R9HA 1J5TA 4XAFA 3RX3A 3CMJA 4RW3A 3KL3A 3AICA 1WXJA 2CWXA 2WJFA 3LS9A 5TAOA 4NNRA 3FYPA 3GNRA 4M56A 4O13A 2QAFA 1J96A 2VKZG 1LRTA 2RGMA 4AF0B 3E0IA 2DEPA 3ZIZA 1NP2A 4KCVA 2PU1A 4UNLA 3T0BA 1J0YA 3Q4DA 3EDKA 5B80A 1I2PA 1UJQA 1GJWA 3AWOA 1Q6GA 1KCKA 3AXXA 1XLDA 1JPMA 3E0FA 2UZ5A 2CLLA 1WBHA 1Q45A 2OT1A 2TPSA 2HDJA 3LNPA 1SSGA 4JL1A 1TZ7A 1OWQA 3WLRA 1P7TB 2AAMA 3PZNA 4J4KA 1EA9C 4KRUA 4DN1A 3B97A 2I5QA 3CT7A 1VPYA 1W2PA 3R0KA 4UIOA 3V0SA 3BL3A 1YX1A 1K03A 1B1YA 4H8UA 3SRFA 2CEQA 3ABZA 3VDAA 4AMCA 1QK2A 2ADAA 5DMLA 4AD4A 3ITOA 3B8TA 1VPXA 2VC6A 3MUCA 1DJYA 3UYIA 2AQOA 2REQA 3GXNA 4IIEA 2PD5A 1KFLA 2HVNA 2ZXBA 1RJPA 4NJJA 1V0KA 3KAHA 2PTWA 3UJSA 3T0CA 3FXGA 4XBKA 4GI6A 1TPVA 1FCUA 3VCCA 1LL7A 3H7RA 3LN3A 4JTFA 3C8NA 5I78A 3LV5A 4KWUA 1HFBA 2BVWA 3BLLA 3KOFA 1DWGM 2R14A 4G7EB 5CZKA 1PIIA 1D7JA 2UBPC 1KQZA 1VFMA 1AQ0A 2AQWA 3R4IA 3QXBA 1XH2A 3BLFA 1KLZA 1XCFA 2GJNA 4A3QA 4REQB 1XBZA 4Y96A 3ANYA 1A0CA 4IICA 5CSSA 1ELSA 3LPGA 4WZHA 3MANA 4IMCA 3WLIA 3NXFA 5REQA 3SRKA 3MSYA 3EXTA 5AHIA 3W7MA 3LCFA 3OODA 3ZWSA 3UYCA 1R8LA 4RNJA 2Q01A 3EYPA 4IFRA 4C5YA 4A05A 4CNUA 4B5XA 3THCA 4M82A 4MNJA 4EPEC 1KM6A 1M01A 3V18A 2G8ZA 4J3UA 1EWDA 4JIQA 2CLMA 1IWAA 3DDMA 2PPOA 1JZ4A 3KP0A 3WBEA 4FN2A 1JCMP 5FJOA 1KBKA 1P6CA 4GQQA 2HE5A 4DWSD 3POHA 3GX9A 5AYYA 3UCCA 4IZGA 4PCNA 4ZO8A 2REQB 3G24A 4WDTA 1P48A 2E67A 4WUIA 3HG2A 1LBMA 5DCDA 5DRCA 4XAYA 2E5CA 1ZPTA 3W75A 2A4AA 1VJZA 2FKEA 2VWSA 3M5XA 1EEXA 5EU9A 2YCLA 3A64A 1TPH1 4WJEA 2XZ7A 4IIFA 4LC6A 4C1LA 4AC7C 2FLIA 3KDOA 3GIYA 5IHRA 1UD2A 3K13A 1V6UA 1DV7A 4H2HA 3DI0A 4QE5A 1ZLPA 5BXTA 4QJ1A 4IFOA 3LCXA 3KVKA 3R58A 1TELA 4H1ZA 4GY1A 1KV5A 5J6EA 2HBXA 3LD5A 3GTHA 1JRBA 2IQDA 1W32A 4GQ0A 1JUEA 3OG3A 1UA3A 1Q2RA 4M6UA 2OODA 2QMKA 4C6LA 3K5XA 3SN0A 4Q33A 4F0RA 4DJDD 3TJ4A 5HNTA 1AW1A 1FWGC 1CXEA 3EMQA 3IACA 1LF1A 4IXHA 2GDVA 3WY1A 4PRRA 2FMNA 2PDUA 4YLWA 4F2TA 3H6OA 3GH7A 1JQVA 3NTPA 1ZJBA 2JEQA 2E6FA 4DXXA 3CAWA 1TPUA 3V16A 2Y8VA 5XIAA 3WLJA 1V7YA 4KEVA 1NSJA 5FSEC 1WQ5A 4S38A 3DX5A 1PSCA 4ODNA 3BSMA 3GNDA 1GTHA 1K3UA 2GGJA 2RGLA 3EWXA 3QFWA 5F1UA 4KEUA 4KH2A 4MJ4A 1W91A 4TX8A 4C7DA 4PRTA 4M1RA 1YDVA 1OX6A 1OADA 2XDFA 2ZZ7A 5I79A 5JBDA 1PTGA 2J75A 3I6RA 4L56A 3S4TA 3PZGA 4O57A 4BFAA 4FB7A 2XN2A 1OFBA 1KFBA 3K4AA 4PUWA 1HQTA 4YVPA 4JFJA 2C1HA 3RJYA 3WEOA 3W1PA 2VR4A 1FAPA 4Z2GA 4MB1A 3M0YA 2QUNA 4ADSA 4FR6A 3TOPA 4ZB2A 2ZZ5A 2XH0A 4RNHA 1XBXA 4HTBA 2F2DA 4YTQA 1S3TC 4ECLA 4QROA 5MHBA 1M65A 4LY4A 4IQLA 4JTEA 2J8TA 3TYEA 4UTKA 1AH4A 5H6HA 3E0LA 2OKOA 4Q4SA 2PBCA 1VJIA 1QOPA 3TFCA 5JH2A 3IJ6A 1OFOA 2G3FA 1A4LA 3TDFA 3LBCA 5BNKA 4DRNA 4F0SA 4FIRA 1LBFA 4UOZA 4O19A 4WQ6A 1PKNA 4HU4A 3WD3A 4FR1A 3DESA 3LTSA 1RCQA 2R6OA 3W26A 1C8VA 1R46A 3H7UA 4DJFD 4M3PA 3BZGA 1QNVA 2BSLA 2HE8A 1SFTA 3AS2A 1WOAA 2XZ9A 4I9JA 4OVXA 2GYIA 3BJSA 4UB9A 4FIQA 2CLOA 3UI4A 1XLLA 2OSYA 2RSEA 4PCTA 1LDCA 1I0BA 1UB3A 3G22A 3ZLFA 1G5AA 4TXEA 2PDBA 3NO3A 3CTLA 2ZQUA 1JZ3A 1XINA 3A3WA 3MS8A 3PBGA 1ZJHA 2C1IA 4AZGA 3APYA 2VGFA 2DSZA 4EE9A 1ISYA 3PRAA 4S2BA 4YL2A 2XVLA 4R9XA 3QY8A 4XZ9A 3W02A 1XWYA 1CEOA 5BROA 2HMCA 2GJXA 4UZSA 3NQ7A 3BQ5A 1HG3A 1OX4A 2GSEA 4XZBA 1XGZA 1BKFA 4W87A 1S2CA 1SMAA 3UZXA 1G69A 3N29A 2HS6A 2OQLA 3VD9A 2BY1A 3OEXA 3IEBA 4N02A 4GLEA 4C60A 2CETA 4WHBA 3AIRA 4I9MA 3TXVA 1W3NA 3R12A 1M1BA 3N4EA 4O17A 4DAFA 1TPB1 3W7CA 2XFRA 4V33A 2WVVA 3RLGA 1M41A 4EPKA 1F61A 4RV8A 1EZ2A 4ODLA 2C1GA 3ARTA 4IQCA 3BC9A 4IM4A 1F8IA 1SR0A 1RUSA 3N2MA 1UD4A 2I57A 3WIJA 3FA4A 2B7OA 1KXVA 4GG9A 3W37A 1EX5A 1EJWC 1XLEA 3TN6A 2DH2A 4J4NA 4ZFMA 1GG0A 1J0JA 3NQBA 1U30A 1AUSL 5EA9A 2Y2WA 3TW7A 1R38A 3B9DA 2FHFA 4HHPA 1AQMA 3N18A 2WHKA 4IFKB 3ZVHA 3VYLA 4MY1A 4AISA 2QUMA 4GO8A 2XISA 2DIEA 3H2FA 3HGOA 1VRDA 2QUUA 1Y8BA 1SFSA 1ECEA 2Y63A 4J27A 4WDXA 3M0HA 4RKAA 3AZSA 1XLGA 3VZZA 1KNWA 2Y5EA 3AI0A 3DU0A 2Q5AA 4I3GA 4YCOA 2TODA 5HQEA 3I3DA 5HNNA 4CGTA 5FL0A 3FYYA 4FNPA 2WHJA 3GH5A 4ODMA 2J13A 4OHQA 4FI4A 2ISWA 2D3LA 1FKWA 2OO6A 1UD6A 4HYRA 1QPNA 1BF6A 1JAKA 4LB4A 4AHQA 2I7GA 4EK7A 1H1ZA 1HKWA 3VMOA 3AMLA 4PTXA 2PGFA 3VXGA 3GB6A 3UESA 3VAWA 3O5GA 3FIGA 3DN5A 3S1WA 4N6FA 2WVVB 1VLWA 4HJFA 4KEZA 3WK0A 2GVGA 3BAIA 2I5IA 1A4MA 2YIHA 4K36A 3U7BA 4ZS6A 1EGZA 1F8MA 3C3NA 3PTDA 1SJBA 1BQGA 4HNCA 4FMVA 3MI2A 4E6MA 4P7OA 4DJEC 1PV8A 1TRIA 1N1AA 3DBNA 4KFPA 1CGYA 1LUCA 3BLDA 4JPGA 3HJEA 1FWJC 3OJGA 1YE4A 3UWZA 2W5FA 3JRKA 3LA4A 1TUFA 3AS0A 5FEZA 4HNTA 4M5PA 3DC8A 1KBJA 2E9MA 3UGVA 1NQKA 3N6QA 4RDVA 5DXXA 3NURA 5HJLA 4YN5A 1XFBA 3WF0A 3ARYA 5BMWA 3VIGA 2RUDA 1HVQA 1W1IE 4EF9A 2RHGA 3GKAA 1I2NA 2HROA 4LVFA 3RIKA 3EA1A 4W4QA 5EPDA 3MJMA 3ITLA 2YCJA 2Y0FA 1O94A 1LOQA 1QW7A 3E38A 5KITA 2PP0A 5F4SA 1AFSA 2DVXA 1XYZA 1S5VA 2CLIA 5CSRA 4I5UA 2VFHA 3KCJA 4TIMA 3CPGA 4ZTXA 2WK2A 1DE5A 3HGRA 1LP6A 3H7VA 2X42A 4UTJA 4FS9A 3IKDA 1BAGA 2BGNE 3M43A 1IZJA 2P10A 4HPJA 2PDJA 2O56A 2Z28A 5AN7A 1DJIA 2W62A 5KZEA 5DEZA 2V5KA 4PEKA 3GXDA 1PZ2A 4ZQPA 5EY5A 5FKYA 3PC0A 3CUXA 2Q6ZA 3C6CA 1YE6A 3Q37A 2QJIA 1VJSA 3W2MA 2DZTA 2V5LA 3H12A 2EJAA 4BHYA 1KCZA 5CCZA 4DRMA 2OJPA 2YL8A 4D2JA 2ZUSA 4AY7A 4NJKA 2ATSA 2C19A 2QYGA 2PDMA 1ZAJA 3QKZA 2JFEX 2KI3A 1A49A 4DVOA 2M2AA 2J77A 4IXXA 5I3GA 2NVDA 2D0HA 3ZYZA 1N8WA 1I8JA 3EKLA 1WZLA 1JD9A 3KRUA 4NHVA 4W8BA 3W1UA 5H8PA 3N17A 4J2PA 3VCRA 3SGGA 4B5UA 2NT1A 5ABGA 5E1QA 4NJIA 3LXBA 3TX9A 1MI3A 1L2UA 2JGYA 2LLEA 3ATYA 1ME8A 5FCZA 1KFJA 3NPXA 1P5BA 2R94A 3TTEA 4PFMA 1BWLA 3N4AA 3HPZA 1NQ6A 3D3AA 1Q7MA 3TIMA 4TNSA 1YTEA 2BDQA 3H2MA 1D3HA 3UZ5A 3H4WA 3A4XA 3BAXA 3VIPA 1A5SA 4MSPA 4O0ZA 2FZ8A 3O5QA 3TTYA 1IE7C 1B3ZA 3ELFA 4RZ5A 3U2OA 4Y2WA 4J3ZA 5A3HA 2FZBA 2YCIX 1OBAA 4U5IA 2FPYA 3KW3A 2UY2A 4JTTA 4H9TA 4OE7A 2OZTA 3FEQA 3G1VA 4AMAA 1VHNA 2CZDA 4O0QA 4Q8QA 3TJXA 2C3ZA 1DEDA 2P53A 3QQWA 3WNOA 1DBTA 1QT1A 4IT6A 4PTNA 1PJ9A 3TR2A 3LM3A 2VX5A 3MTWA 3LCWA 5BMXA 4B2DD 1KKOA 2I9UA 2WVTA 4GKLA 1WP6A 1JUKA 1QUMA 2ZRUA 3KZ7A 3VNLA 3TU9A 4KKXA 4DO7A 1SR9A 2CERA 1JZ7A 4F4RA 4NZ3A 3PB2A 2KE0A 4P7NA 1XLJA 1E55A 4LY8A 1GQIA 3AWNA 4XZWA 1EPXA 4GFIA 4N2YA 4HK7A 5CGQA 2HISA 1UR4A 1Q6HA 4IP7A 2PLMA 1EFZA 4RLIA 4P7RA 4LF1A 5MF5A 2UY3A 1DXIA 4HMEA 3TCZA 1X6LA 3TW6A 1ZBKA 3AZTA 3AZRA 1BG4A 4DUOA 2GVYA 4YHEA 1DJGA 3SECA 2OELA 3L67A 3M5YA 3WMCA 3OOBA 1W9BM 4EIVA 2L2SA 1YIXA 2J6VA 1C90A 2C13A 2GQ3A 3F4CA 1GT8A 3L68A 4R34A 1JGIA 3KBJA 3LUTA 3MY9A 4OV9A 4JFUA 4MY8A 4F66A 1BXNA 2WB5A 2XSXA 3GZ3A 5CG7A 1X7IA 5SWUA 5HUAA 3SR7A 3H54A 2VO5A 1ALDA 2GQ8A 3AUJA 1S3HA 4ZO9A 7A3HA 1D7FA 4XISA 3CUFA 4W9PA 2Z27A 5AC7A 1TKKA 1OJXA 3L2IA 4UTWA 2OLSA 1UWAA 1TPC1 4XAGA 2XWDA 1BEUA 2EAWA 3B8VA 2A3BA 8XIMA 5DMNA 3WLMA 3CPRA 2FYMA 2VRJA 4GOAA 5A8PA 3UBPC 3PM6A 3O07A 1EIBA 3ARXA 4QAIA 4MLJA 5LHEA 1ONXA 1UWQA 3PJXA 3THUA 1UKQA 4QAWA 4C7GA 1TPWA 4IIDA 2VC7A 2WNWA 4H19A 2XP3A 5D37A 5LA2A 3NSMA 2F38A 2OGJA 2CZ5A 1XH1A 1UP3A 1VIWA 3G1RA 4HP5A 4D8ZA 4S3EA 1HKKA 1DXEA 1FHDA 2PWDA 4KCWA 2OG9A 1ZFJA 3L9CA 3ANVA 1XDLA 2O9TA 4H01A 4CNPA 3S47A 1YQ2A 2OCZA 3NQ2A 3WMLA 1W37A 3WF4A 3UEQA 4TX9A 3UZJA 3KOWA 4DJEA 4V15A 3KLKA 2A3EA 1OFRA 1F8AB 4MUZA 5CXPA 5LIXX 1TX2A 1WDQA 4QX4A 1SMDA 3L66A 3CWHA 3L2LA 3WJYA 1CLXA 1V6WA 1JNTA 2WOQA 4HNNA 4GI8A 3H4XA 1KM1A 3OU8A 3TQVA 3TYZA 4AZBA 2P5NA 3KVLA 1W54A 2PTDA 1M6JA 3NJ3A 2AL2B 5JXQA 4FALA 1BYCA 1YDNA 4OECA 4TUFA 2PS2A 1LLOA 2XFYA 3W71A 1FP8A 1TPDA 4IG2B 5C9ZA 4LVAA 2CLHA 4AHPA 1FHLA 4ASTA 4E2OA 2EG7A 4FXRA 2XHYA 3HMJG 3OHIA 1GVQA 2CZVA 1XC6A 1GQKA 1UZ1A 1TTJA 4G50A 4LAMA 3FAPA 3FHAA 1EP3A 1X6UA 1GOKA 4L3NA 2DUAA 4XIAA 1QRQA 4ICNA 4MWAA 1BKSA 3SIMA 4PUNA 1R3SA 4IFKA 3UR2A 3TUUA 1GKRA 1TJ1A 3I68A 3ARWA 2B0MA 3KACA 1VYSX 2PRMA 1LTDA 3EAUA 1KM5A 1ODZA 1B4KA 4UFMA 4FX6M 4CU6A 3NPUA 2YCKX 2HK1A 4EWJA 2Y7GA 3WDQA 4KFNA 5H8UA 1KRAC 3WLSA 4DZHA 2E68A 4WOZA 4WLCA 3GO2A 3TZFA 2RDTA 1NOUA 1W6TA 4GH3A 1VHCA 3M44A 2PDWA 3NEVA 3S9IA 2QDDA 4W84A 3QQ0A 1PWLA 1X8CA 1XV8A 3COTA 2HNEA 4BF8A 4DUWA 2WPGA 2GVLA 4HPHA 4DNMA 1XLBA 3QZAA 1Z9AA 1PKLA 4WIWA 4H6KA 2R1NA 4U31A 1C9WA 3SQMA 1L6WA 4IUOA 4E2DA 3WQEA 4QQUA 2PWVA 4E8GA 3WENA 4OIFA 1UROA 4IP5A 2ZUWA 1V3IA 4GGQA 1XL9A 3N2BA 2QIIA 4S3KA 2ISFA 1TA3A 4IP4A 1NVMA 2E09A 3U4AA 4F8XA 1N82A 3NA8A 3AU6A 3HQ1A 2W63A 2VR2A 1IR1A 1V3HA 5AY7A 2H6RA 2V3FA 3GAYA 4HYWA 1V6YA 2CBVA 5K9XA 2M1IA 4AQLA 1KBLA 1QCWA 2VTFA 3T6CA 3L4YA 1IHIA 4JCMA 4UTIA 4IPNB 2PWUA 3QM3A 3QHOA 2ISVA 3TC5A 3GQYA 1F5ZA 3PWIA 5J5RA 1JPIA 4PUEA 4DO4A 1TG7A 3LGGA 4L6DA 4BK9A 4L1GA 3WDPP 4UMAA 1K77A 4LBSA 3LEPA 3L2MA 2NX3A 1H7OA 2C18A 3IPWA 3HB9A 4RW5A 2Q8XA 2YXOA 3LXCA 3SRDA 2ZOXA 2JBMA 3QVQA 4NNCA 4LAUA 4CNSA 3S5YA 1T96A 3VNDA 3UWQA 4FSAA 3HU7A 2XPBA 2XP4A 5IFPA 5I7GA 2H9AA 1CX9A 2ZX9A 2HXUA 3FV9A 2OX1A 3CEPA 3BW2A 4K38A 3GVQA 3UF9A 1IWBA 1JNSA 5KETA 4RPQA 3NGJA 3S1UA 3EGJA 2PI6A 1O4UA 3PAOA 2IXUA 1PBKA 5U4NA 3B06A 1OIMA 3CYVA 3O1NA 1DJWA 1IF2A 4ODKA 3CC1A 4AYSA 3IJ8A 3EKZA 3T4CA 1QPFA 4KS0A 4O18A 3UFYA 1RHCA 3I6CA 1GEQA 3W1AA 3DZ1A 4GHRA 4YYFA 3G5EA 4PSRA 1XS2A 1WDDA 3LCGA 4Q4OA 2WZHA 4BWLC 1XLIA 3GK0A 3PZQA 1CPUA 1XYBA 3SCVA 2DPEA 1H41A 4UTMA 3W2JA 6CGTA 4HHHA 1VEMA 2FVKA 2XIBA 1GG1A 5CLTA 3LI0A 3SBFA 2VFFA 4IWWA 1QW8A 5E6YA 3BW3A 5D30A 1W9VA 3STGA 3O6YX 1Y65A 1NTHA 1GQLA 5K4XA 1SYTA 1C9HA 2P8CA 5E0FA 1S5NA 1H49A 1GVRA 1Z42A 2CITA 3PZIA 1OX4B 4PTDA 3UNDA 3NIYA 1OCQA 1G0CA 1O5QA 1C3FA 4KBXA 3BG3A 5GNZA 3GS6A 1GOIA 2VEKA 4RE3A 2D73A 3W7QA 1S5WA 2QAPA 2VVSA 4L61A 1RBAA 4JNMA 3QV7A 2YW4A 1W56A 5IDIA 2C7FA 1JG9A 5B8IC 1KKRA 3VAVA 3RUBL 3GDKA 4J28A 1FDJA 3W82A 1NIUA 4C91A 1RA0A 5CPLA 2E6DA 3EXRA 1A0DA 3OZMA 3AXKA 1H51A 3V5OA 1EHNA 4W9OA 1BF2A 2AGKA 5DF0A 3VILA 1VH7A 3IUIA 1GONA 4PC8A 1B90A 4QNWA 4TMBA 5HDRA 5PTDA 2XYLA 2J74A 2ZXDA 1Z89A 4GACA 3TP4A 1XUZA 1TJRA 1FWFC 4CQ9A 1QI0A 3TMLA 3EPOA 3FJ4A 2RJGA 1HGWA 1V0LA 2LKNA 4LAZA 4ZSUA 4AG0A 3EZ4A 1TMLA 2DZVA 4NP7A 2OZ0A 3L7RA 4WGHA 3BPWA 4WK9A 3WQVA 3STPA 4M6VA 2FDSA 3MWAA 2YA1A 1VBUA 2Z1VA 7XIMA 3ZS4A 4JTJA 3AIUA 3UGRA 4ATWA 3RPTA 3NQEA 2D2OA 3BV4A 4OZOA 1ITQA 4IPLA 4NT0A 1BGAA 2V0TA 2WC3A 5HWMA 1AD1A 3QH2A 4X63A 3KLLA 4ALDA 4JHMA 4QG8A 3GIPA 1QU4A 2QF8A 4DRJA 2FIQA 4HYVA 2XSAA 2I5GA 3N13A 3GNNA 4CD4A 2V38A 4MWAD 2FTYA 4DWSA 3PAJA 5CC5A 4H41A 3BZJA 3W88A 1FJDA 3IJLA 2FKPA 5LIUX 1V4YA 4UOJA 3R89A 5AFDA 1VR6A 4GY7A 1NDVA 1RP8A 4GY0A 3IGXA 3A3HA 3BLKA 3ITGA 4X3ZA 4RR4A 3AOFA 4JYFA 1DIDA 3P81A 2WKJA 1SUXA 1TCDA 4W8AA 1LROA 1DWIM 1XUUA 2IUZA 1V6XA 3NDOA 2W0UA 4HSNA 3O5MA 4N7QA 2BHYA 3S5SA 3KTCA 3FVDA 1Q65A 3S6DA 2DUXA 3H22A 1K02A 3ZXWA 2XGZA 4NZ5A 3RM8A 3OQEA 3V1PA 4YTUA 5ECVA 2YFNA 1GYLA 5CZTA 3B0VC 4XVEA 4GUGA 4NYYA 2XIJA 2ZXAA 3BSGA 4FAPA 3L5MA 1NFPA 3C2RA 1BHGA 3W7OA 1VIZA 2GK1B 2A7NA 4XBSA 3BARA 1PCWA 5I02A 3KBNA 2ZX8A 1DL3A 4AWTA 2YDQA 1KB3A 2DV0A 3EDDA 3N14A 1FWDC 3VC5A 4Q4MA 1SJDA 2NW0A 3CQJA 1EC8A 1RQEA 4NNAA 3T2QA 2JGQA 3TAOA 3T05A 1EDGA 4PTWA 5AVHA 3JXVA 2J25A 1JXJA 4HBEA 3KWXA 3CV6A 2WCSA 3W1TA 3GDTA 4QLKA 4TW8A 3CZ8A 2G3IA 5LZLA 4MFEA 4Y9PA 2D0GA 3MW7A 3WK3A 3PFRA 4LAVA 1F3EA 1H11A 1B6CA 2ZCGA 2WYSA 3PPHA 1XIHA 2VGGA 2PDIA 4Q7IA 1XRSA 2WANA 4K39A 3MMUA 1UC4A 1NDYA 1ZK6A 3NPVA 3VMPA 1UUOA 5D03A 1XG3A 3L0NA 3IAPA 2ZQSA 4MDOA 4XX6A 2RUSA 2Z1XA 3SY8A 1J4EA 3UPWA 2DSWA 4D71A 1JR1A 4REQA 4GBDA 1Q5MA 4R7JA 2HTMA 3RR1A 3NZRA 4NAEB 2DVTA 2IKIA 4KWWA 5KSWA 4RXGA 3UPMA 3C2VA 2YW3A 1AG1O 2NSOA 3S9ZA 4ZTYA 1CXIA 1TCMA 3UCQA 3VE7A 2J8GA 1UPPA 3E74A 2A0NA 3TE9A 5LIYX 3RPMA 2ZX7A 2RDWA 1TV3A 1XIEA 3GHUA 1QPKA 9CGTA 4PYSA 5BW6A 1XSKA 3OGVA 2NV2A 1E72M 1I6NA 4GIEA 1KD0A 4DZ3A 3PTKA 5CH9A 3UWUA 3LDVA 3G18A 4PMVA 1Y5XA 1V77A 3CIVA 3IIOA 5EMLA 3UZWA 2A3LA 4A4AA 2EPMX 2XH2A 1ZJAA 3IAQA 3S2MA 3KOXA 3MWCA 2HSAA 1HUVA 4HN4A 2VEIA 3SADA 3H2CA 4UFIA 4D6EA 3G6MA 3K8KA 1B3YA 3B9NA 4QIUA 3L4ZA 1UJPA 2PTZA 3UJEA 3WQCA 1QPLA 3WL0A 4O1EA 4TR9A 1IEVA 3GC4A 2YXXA 3ZLGA 3FDGA 1SJCA 4UR7A 1PDZA 2X0YA 1K4HA 4G9PA 4JD4A 2O55A 4POCA 2XP9A 3LQGA 4HTYA 1JF5A 2ODOA 1CXKA 1TX0A 4BS0A 3VIKA 3UR7A 2WJDA 3D47A 1FHVA 1ZALA 1VENA 5FSDC 2BP1A 2YA0A 4OQVA 6REQA 3KBSA 3LI1A 1SPQA 3C61A 1WCGA 1VLIA 1YADA 4UCGA 4HHLA 4LS0A 1U33A 4I90A 2DG3A 4OT7A 2Y5SA 4HVXA 1T99A 3UT0A 2J78A 3ITTA 1UD5A 4ML4A 1VFFA 1XKJA 4H8HA 3ARQA 3L65A 4CN1A 5I07A 3OPSA 4U86A 5AOUA 3HPSA 4IMGA 5G2WA 3ZWTA 1V7AA 3E2QA 1TWWA 4PSPA 5H1WA 2OZ8A 1QOXA 2AL2A 1BVWA 1HX0A 3A9BA 3QR1A 1ECQA 2X8RA 1XIDA 4W86A 5BXJA 5EMMA 2BODX 4LB3A 1FDYA 1Q6OA 3V0UA 4JX6A 3REQA 4OTKA 4C7FA 2GUYA 3CV1A 2ZIDA 2XN1A 4N4QA 3W76A 2R1KA 3WQFA 1IXQA 5JQ9A 4XWUA 2BV9A 5CZSA 3UU0A 1JRCA 4R33A 3GXPA 3DG6A 5FIPA 1LT8A 1SO5A 4OOZA 1BSIA 1F9CA 4DEFA 6ALDA 1XLAA 4Q4KA 1H2JA 2OFNA 3HMCA 4WKHA 3EWWA 3CL8A 4XBJA 5K3VA 3STEA 2YB4A 1GZGA 3R0UA 3EWZA 4YIWA 3E3HA 4DWSC 3U7VA 3DFYA 3QMSA 4GK8A 1TO3A 2E1DA 3MHFA 5C7HA 4AY8A 4QS5A 4MYXA 4QISA 4PL2A 2Y70A 1UKPA 1VKFA 3VK5A 1DHKA 1TIMA 3AIVA 3PR9A 3OVRA 1WNOA 4MDPA 4QCEA 1D8WA 3N25A 3UG8A 2IKJA 3N9RA 3W1RA 1EP1A 1UWIA 3HPXA 1DWAM 1FKDA 3B9AA 3F03K 3BLIA 4D1JA 2GSHA 3C56A 3A24A 2H3DA 1HP4A 1QHPA 4Q7NA 2Q3RA 2Q09A 2VR5A 4QR6A 1H0GA 1QNOA 3C0QA 2XVKA 1VQTA 2PF0A 3MUIA 3EBVA 1IIHA 4GIAA 3PZ9A 1XF0A 3B9EA 4H4IA 1JCLA 2VGIA 2QDGA 4PGLA 2PLJA 3HG5A 1PXGA 4NIRA 3IK4A 4HK6A 2YJQA 4QXIA 2WQPA 2BVTA 1AQFA 4JTDA 3VGHA 4PTMA 3FFSA 1QNQA 4LSBA 3URAA 1VEPA 1TPFA 1WZAA 1WAUA 1KRBC 3UERA 3VKDA 3W7PA 3MKKA 4TX6A 5AC5A 1MZHA 3P5ZA 2V69A 3EOSA 4GZJA 1GOWA 3GU0A 4K1GA 3CZGA 3ARRA 3MSDA 4Z1DA 3O5LA 2WCGA 2BXYA 1KXTA 3H2NA 3LLFA 4XZHA 4C6JA 4XZIA 4RDYA 2J66A 3PHAA 3D46A 4WKFA 4KQNA 1J79A 2XGIA 1R47A 3AIEA 2WMJA 3NR0A 2OFJA 3UXAA 1QNPA 2VHLA 3WJWA 4O11A 2FGBA 1A5NC 4UCFA 4QT3A 1BWKA 4URIA 2W67A 2Y4SA 4JQ4A 1KTNA 3P61A 4LOCA 2HZGA 2D2JA 2P0IA 3T4WA 1NJJA 2W3ZA 4F9JA 2O9RA 4B4FA 4BI7A 3GR7A 1KFWA 4RPPA 3LHVA 3GR4A 4N9DA 3JZEA 4NJHA 2Z2BA 2P3EA 3L4UA 5EMUA 3QN3A 2Z7KA 3FY1A 1FCBA 3MYOA 1XRTA 4QHRA 2QCFA 3LLDA 3B8IA 1MYRA 1R87A 2O4MA 4ADTA 1XYFA 4W9TA 3P74A 2YSWA 4DYJA 4BWLA 2Y24A 3AC0A 3ICJA 7PTDA 1I2OA 2PB1A 1LL6A 2CLEA 4UMBA 3WJXA 1E9ZB 1XYLA 3G1YA 1UC5A 2SFPA 3LCHA 1H3GA 1L8PA 3K30A 4UQAA 2KGJA 3HV8A 3MI6A 4E2BA 1V8EA 2GGHA 3QPZA 4GVFA 2VX4A 3VIFA 1E4IA 4NX5A 2FH8A 2X1UA 1U5HA 4WDUA 1KV8A 2CU0A 1MXSA 3URNA 4K1WA 1OQFA 1QPQA 1J6YA 4HPGA 1XP3A 3CH0A 3N1AA 1RBOB 4W93A 2VNCA 4EPDC 4EOUA 1G01A 3WSUA 4ZEPA 5A8NA 2QGHA 5JVLA 4C90A 3GYEA 4K37A 1H4PA 4B5NA 3GWQA 3WO8A 5FEWA 3W3OA 1BPLB 3IANA 4X2PA 1TZZA 4AY1A 3TYDA 2I16A 1G7VA 3LHUA 4JX5A 3TJIA 1JCJA 1RCOB 3I7QA 3E9AA 3C0SA 1A5BA 4F9DA 3CHCA 4AX7A 3W28A 4NILA 3M07A 3CL7A 2X7WA 3M0VA 4D8LA 5DCBA 4TW7A 2YA2A 4U3CA 1T6MA 3N34A 4DT4A 2Z0IA 5I0DA 4B5WA 1E6ZA 5M2FX 3W85A 1CCWB 1R3TA 3W83A 4R7WA 3WNPA 5T91A 1TCOC 4ROPA 3HTWA 1E43A 3PWAA 2GWNA 4ATLA 1UWSA 2BX7A 4LVBA 4QEEA 1L2QA 1IV8A 3LK6A 4MYAA 1KRMA 7CGTA 1GGOA 2PPGA 2NQ5A 4UQ9A 4JFWA 4O50A 1AD4A 2E4TA 2DDXA 5ABHA 1G7UA 5BRQA 2ZQVA 4IUGA 2VEGA 4GA8A 3AYSA 2NXHA 5D09A 5D9MA 3TN5A 1D8CA 2WCAA 1RD5A 3CO8A 1OCBA 3M0MA 3GVVA 3HQOA 3QGKC 1BWVA 1VGAA 1MW3A 3M1ZA 1HP5A 1XBVA 2VEFA 1PBGA 1BG9A 2GJRA 8A3HA 3K8MA 3NSNA 1RK5A 3SSJA 1P6WA 3NXLA 3SCTA 2DUZA 4DYKA 3GXIA 3L4XA 1MZRA 4NL1A 4GGBA 5CJ5A 4QTGA 5A6KA 3V0TA 5F2LA 5FL1A 3B3DA 3VUSA 3DXIA 3W74A 3GRIA 3CLWA 1GKPA 3BXWA 3TN4A 4HA3A 3D3FA 4H9MA 1Y5WA 1WKYA 3M46A 4Z1CA 3BG5A 5A95A 3VDBA 1PCKA 4HA1A 5M03A 3UG4A 2H8XA 3NZQA 1K8XA 2VELA 4O1BA 2EXOA 1NMVA 1LOSA 4WRHA 4AWEA 4A8IA 1G4TA 3AHVA 3LZ3A 4MWAC 4I5RA 3PBMA 1GW1A 4YPJA 4F79A 2RFGA 3RR4A 1SO3A 2ZA1A 1QFEA 2P4VA 2BGSA 4P5UA 4XUYA 1K8YA 2C6QA 5GNYA 1FDZA 2QPXA 1NARA 1FTXA 5HW8A 3I6TA 2NT0A 4PULA 4H9XA 3PG9A 4JS3A 2TYSA 3W22A 2ANUA 3D6NA 1W1ZA 5AECA 1WV2A 1K70A 4PBGA 1KCXA 4LUYA 2D2GA 2Z29A 1B3VA 5G1TA 2XSBA 2IQ0A 3W7DA 4AZ6A 2CBUA 4EPBC 2ZQ0A 1Q6FA 1JI2A 3OYXA 3R0DA 2V3GA 4FHAA 2GJXB 2ZZ1A 3ES8A 3QOMA 2R1MA 4Q8OA 1A5OC 4LUSA 3OP2A 2XTKA 2CHNA 2C14A 1DP0A 3ABOA 5JU6A 1CZ1A 3V1HA 1E6QM 1NOFA 4BR1A 1DTNA 1RQBA 3IJ7A 5BZAA 4FOKA 5LNWA 3TONA 3VD4A 2XN0A 3AIBA 4AEFA 4B5SA 1VF8A 3P80A 3RGCA 2Y1HA 3O0KA 4WSJA 5AC4A 1O60A 2XJ7A 2YR1A 4FLRA 2OYLA 5HPOA 3EDJA 2WMHA 4N9CA 5I06A 4GUFA 3TOYA 3AHZA 4A22A 2BFGA 4C1NA 2PPNA 2E9LA 3LZ5A 1QK0A 1D7IA 2ZR5A 3QBUA 4HPXA 4DLFA 3AQUA 4MPQA 3B0XA 1JIBA 1EO5A 1P0NA 5IFTA 3UP8A 2D9FA 4W7UA 4PMZA 5TF0A 2NSXA 3P84A 4MADA 1S2AA 1ICSA 3HPFA 2POZA 3CTTA 1XW8A 3FJLA 4GJJA 1FKGA 2E77A 1OG0A 2Y7FA 3BGGA 4DJDA 2ZICA 3C8FA 3GU1A 2J8FA 7ENLA 1E1CA 4HHMA 4KCUA 1VBJA 3WYZA 3P0XA 3FAWA 4L6OA 4JIEA 2KZHA 3GUGA 3N2TA 2AL1A 7REQA 2OQHA 3MZNA 3EDFA 4DM2A 3BCFA 4DAIA 4A3YA 3BLEA 4IPJA 1JDAA 3HFTA 3DFPA 1HVXA 4AIUA 3PUOA 2HK0A 3BJFA 4NXSA 4ORMA 1CXHA 2OTDA 3WH7A 5CC6A 3QPEA 5D9PA 1TMHA 2MLYA 1KLYA 3USBA 1UCWA 4UUIA 4GKTA 1V51A 2P1FA 1BGGA 1CGXA 1Q6EA 4DBEA 2QPSA 3FX4A 1JFHA 2NQ9A 3A23A 4JZ5A 1P0KA 4H00A 4PCSA 3VC6A 1IXPA 1W0MA 1P1XA 2YFOA 3OBAA 4AZ7A 4KQZA 2VEPA 4AU0A 4ZPTR 1V3KA 1GVSA 3ZMRA 4K8EA 1F7BA 3GH4A 1BYDA 1J12A 3S2JA 2W91A 5IOBA 4DBDA 1JDCA 4LAWA 2WSQA 3LRLA 1UWUA 4XKYB 3WBAA 4TW6A 3EEZA 3UXKA 4QM1A 1XIJA 4BF5A 2BHZA 3KWSA 2G4JA 2J4GA 2RAGA 2YKKA 4QZVB 4DXVA 5CAHA 2ZUNA 5FF7A 4F0MA 5AC8A 3P62A 1JCXA 1IR2A 3MMDA 2DZSA 1EUNA 4Q8UA 1V0NA 1ISWA 1ISXA 2OYMA 3S2NA 3KM8A 1PTAA 4IIHA 5HQLA 3JVAA 5FJPA 3N9KA 1NEYA 4BCEA 4I7WA 4EWND 4AYGA 2XINA 1WZKA 4C65A 5JIWA 2DH3A 3OA3A 1ZRQA 4HMNA 4DI9A 3QGVA 3NSXA 4Q8NA 1B4EA 1A53A 4IGMA 1QHZA 1XX1A 1VCVA 2CKRA 2XP5A 2QT3A 3N15A 5AHFA 1LG1A 4MSSA 3T81A 3NDZA 4ENLA 5LXXA 3RM4A 4KWVA 1XYAA 4O1DA 1VBHA 3N6JA 3QF0A 2ZBTA 2WSPA 2HWGA 2DIKA 3I4KA 1IXNA 5DELA 3BMXA 5HWCA 3POCA 1U1HA 1JNDA 4G7FA 2WSYA 2ZVRA 5IHSA 3SUWA 3SEPA 3TC3A 2P76A 2CIPA 3MB9A 1DQXA 3PRBA 4RDWA 3SIZA 1E15A 4JKKA 1J6OA 1JCTA 3QLLA 1PPIA 1MW0A 3EX2A 2FZ9A 4BKNA 1TWDA 1N7KA 3CZEA 4G1NA 3P82A 3MDUA 4DYEA 2GGGA 4DBUA 3AMCA 4GFSA 2PZNA 2F6UA 2XH7A 1VPQA 2HVOA 1ZBCA 3UWWA 1F6PA 3A4WA 3T1GA 1YXDA 4D8AA 3LLXA 5A2AA 5AHMA 1O95A 4F2BA 3O6DA 4LBUA 2ZRWA 1FKHA 1G6CA 1NF7A 2V68A 9RUBA 1MRQA 3K1DA 4W9QA 3NQGA 3WNMA 3B4UA 4O4WA 4PODA 3RFWA 4IF2A 4ERIA 1EJRC 3A4JA 4UQBA 1SFJA 2X0HA 4DPPA 3L4TA 3QTGA 3BICA 2IKHA 1R30A 3SFWA 3QYSA 3HQNA 3VPLA 3NQDA 1CW2A 2BB0A 4KIEA 1JL8A 3SDOA 3RM9A 3TR9A 2YBTA 3IV3A 4GIRA 3E2RA 2AQVA 3I7RA 3ZR6A 1OFPA 4J3TA 4DO6A 4GC3A 2CBIA 2ZE0A 1X1ZA 3DGBA 1EPVA 3MHGA 1A50A 4DROA 5EFFA 3WMSA 3W72A 4PCPA 2ESCA 2IW0A 2OWWA 3PPCA 4HNOA 3EX1A 1VAHA 3UQNA 1T0OA 4FNRA 4XAPA 3FOKA 2EKCA 4OKDA 1EF3A 3LRMA 4ZOCA 4DO5A 3F2CA 4EXAA 4KF1A 2FGLA 3OYZA 5A6TC 2EPOA 2PLCA 3S6OA 4XB3A 3CMFA 5AHLA 4RZ4A 5CJNA 1HT6A 2VDIA 3KAGA 1ZGDA 4F40A 2F84A 5CPMA 4MKSA 5JBEA 3H26A 3MMTA 3RLHA 3FJNA 1BTMA 2DZWA 3B40A 4F3HA 5HINA 4CQCA 1NY1A 3LBMA 3EB3A 4HT3A 1THFD 1OFAA 4S3DA 3PP7A 4L7ZA 1MEHA 4S3AA 5C7VA 3AJXA 1EP2A 4IPXA 3EOUA 1YW1A 5E0KA 4HBOA 4IMFA 5CLWA 2VOTA 3RLVA 1EC9A 1W5NA 4AF0A 1LT7A 1S2VA 2V67A 4US6A 4G2PA 2GL5A 5DCEA 3SCUA 4P8WA 3N12A 4LUTA 5F2GA 2QXWA 3KEHA 2RDXA 2W4XA 3LENA 4ZE5A 3O5JA 2AMXA 4P61A 3TN3A 3KAOA 1TE1A 2MANA 1SZGA 1W9DM 4FNTA 1V5XA 2OMAA 3SCQA 2Z24A 2A85A 4R88A 3N3TA 3GG8A 3ZR4A 2YDRA 2HQAA 3G1AA 5M17A 1XDMA 2C79A 2WSRA 3N04A 1O1ZA 3O0FA 4AZCA 1HXVA 1RAKA 3LU2A 1Q8AA 2X05A 5EFDA 3EOEA 1FWTA 2WHMA 5I09A 4RZ6A 5I24A 1K4GA 5HBFA 3I65A 3F4NA 3HV9A 2EO7A 3AXMA 1E0TA 2OWCA 2E1WA 1KR1A 2WAGA 3SCWA 3WFAA 4LS1A 1QR7A 1U79A 2NX9A 1J0HA 4PBEA 2CZFA 3VNKA 1JI1A 4PA8A 6A3HA 4DRKA 4X61A 5LNSA 3Q45A 4Q22A 2QMJA 4ERGA 5FJJA 4U33A 3M0JA 1NMWA 2WMFA 5TNVA 1RVKA 2Y7DA 2OOFA 3U3HA 2P8BA 4I8DA 4ZO7A 4B9YA 1RJQA 3PJTA 2X1TA 4MJMA 4HNVA 1Q3NA 5ENLA 1BQCA 1G67A 3QC3A 1TJPA 2V5CA 1WZMA 1L8NA 1WUEA 1RZMA 3TTSA 4C02B 1EXPA 3NM3A 3DGRA 4ZPWR 5HWBA 2ZR6A 3F2DA 1RQHA 1A80A 1NWTA 3MUZ1 4XTDA 3RXZA 1B57A 3PSVA 4IGSA 3EPNA 3VD3A 1YKWA 4CUCA 2J7HA 3F1QA 3UD6A 1UPMB 1DJQA 1E73M 3SUSA 5TIMA 1WDSA 1IEWA 1AH0A 3S42A 5FA5A 3O05A 5AKQA 4MB4A 1CB7B 1BXBA 2OYKA 4ODPA 4S1FA 2WNZA 2INEA 3VI2A 4DLMA 1OK4A 1AQHA 1W9PA 5I3JA 3VDHA 3C5QA 3RGTA 3R7MA 1W9XA 3V7PA 5AVNA 3VOGA 1W5QA 4V2XA 1R86A 1Q6QA 4DZAA 4LH8A 2ZZ6A 4JYEA 4A21A 1XYCA 4Y9OA 2H90A 3VOHA 1VZWA 3E1F1 3M9YA 4Z0SA 1JCNA 3ZSSA 2CHOA 4IMDA 3FKKA 4M51A 3VFLA 5DIVA 3L4WA 1XFCA 4C6MA 5JBFA 4HB7A 5EYWA 3KDNA 5AYIA 3VGFA 3ALGA 1CENA 1X98A 1B2YA 2V5BA 3QGAC 2V5DA 1I1XA 2DSUA 3GG1A 2PUZA 1I2QA 5I98A 4S3GA 2P0OA 1EQPA 1KXQA 3HOJA 5GPRA 1PAMA 7TIMA 3UI6A 4GX8A 3B0YA 4KPLA 1TR9A 3HURA 3S0CA 3W1MA 1HJUA 1GRJA 1Q8JA 1QPRA 4L4MA 2D24A 3W7NA 3OOQA 2X0SA 1Q4WA 4NZ4A 5L6UA 4H6QA 5I3KA 3FA3A 3WLTA 4BQ3A 1GVIA 1MQPA 2F6KA 3QR0A 4Z0JA 1W1PA 3K8LA 3WH5A 3TMQA 3T7VA 2PGRA 4IMEA 1UMYA 3E12A 3K4WA 4GVHA 1D3GA 1QI4A 3CH9A 3GZAA 1HO4A 4HSHA 5B7ZA 4K8HA 3DC0A 5I77A 1Q63A 4QQ3A 1EB3A 1E5JA 3AALA 3PZUA 3HGJA 4WXZA 4O53A 3WH9A 1TSIA 2EPHA 3CPUA 1IT8A 4RJEA 3EWBX 3NL5A 4PMRA 4NASA 3NAVA 2KR7A 3BOLA 1LQ0A 6PTDA 2XWEA 1XM3A 3TC7A 3NYZA 3WD0A 5G2HA 2JK2A 3UXLA 2WVSA 1QO5A 2JIEA 2JEPA 4XAKA 4LNCA 2ISSA 4MKVA 1TV4A 4JCLA 3WNLA 1NDWA 5BOEA 3GVGA 1W8SA 3VKCA 1ZAHA 2E9BA 3ZT7A 4HZ7A 3E02A 1CXLA 4IPIA 2XIMA 2F2HA 4MGVA 2V81A 3DENA 4CD6A 1TTIA 3KFTA 5JUVA 4RL3A 3V36A 4KGJA 1MXGA 2ZUTA 5T9CE 2ZFAA 2E28A 1BD0A 2DW6A 1EKOA 1E6NA 5C55A 5D4YA 3I6EA 1ONRA 1KFEA 4IHCA 3V5CA 5FEXA 1NM9A 4GMEA 1V02A 4PN2A 2E40A 5CKSA 2D3NA 3WK2A 1GHSA 1FWSA 1TVPA 1V79A 3P0WA 1E4NA 4KMQA 3VABA 2PCEA 4DZ5A 4U85A 5HWNA 3C4UA 3M64A 2B81A 2PU0A 3PR2A 3FGCA 1G4PA 1YRRA 3S8HA 1UR8A 3G1XA 1ZU8A 4L65A 2POTA 4I9TA 5H91A 1WDRA 3LCIA 4QFUA 5CGTA 3IJQA 4HIBA 4IQDA 5DXYA 3EXSA 1Z69A 4AD0A 2DT1A 1EWEA 2VQUA 1KFCA 1T41A 1S2TA 4NG3A 3WF2A 3RO8A 2VCCA 3CB3A 3BV7A 3KP1A 3R94A 5BRPA 4Z2IA 1B30A 4XD5A 4H7CA 1JULA 4NNBA 1QHOA 3AXHA 1JYWA 1G4EA 4LUIA 4Z42C 5FF3A 5D8ZA 4PB5A 4LAXA 1A5LC 4J5NA 4K2SA 5LXEA 1R3QA 2BHUA 3C86A 1PS9A 4IQJA 1UMLA 2NZLA 2JALA 4BEQA 3RX2A 3M0LA 1H09A 1U1JA 4CQDA 4H83A 2EBNA 3B4YA 3PVFA 2YOCA 2QEZA 3IRSA 2GSJA 1OVDA 4RX0A 3QMTA 3RCMA 1TFVA 2Z7GA 3LHWA 2CFFA 4AZ5A 3U6WA 4DF1A 3EB2A 3RX4A 3U4FA 4L9ZA 1EXBA 2NVCA 1FWRA 1K6AA 2DT2A 4XSMA 1B5TA 3VM5A 1VP5A 3LGEA 2BY2A 4LEQA 1BFNA 2X7VA 4PB4A 2HNHA 3K1GA 3W73A 3WJZA 3UXIA 2X2GA 1OFQA 1Q7QA 3M7SA 2VOMA 4U2YA 3HQPA 3R1ZA 5JIPA 4KW2A 3UY7A 3AS1A 4C6IA 5I3HA 1J93A 3KXQA 4ZQMA 4HCLA 1R3YA 5A5WA 4L5ZA 2CW6A 4NXKA 1N8IA 2ACRA 4O0KA 3MV01 2EEXA 4YS1A 3SJ3A 3WDHA 2ZZ4A 4CVWA 4ML9A 1CDGA 1Q6LA 4CEUC 1K8CA 4M24A 1XSJA 1E1EA 2VFEA 3R11A 2VZVA 1P6BA 2RH9A 3ITVA 2FZNA 2WVUA 3LM7A 1CBGA 1L6YA 2GZXA 4ODOA 4EACA 4BA0A 2DSVA 4QRNA 2Y8UA 4W88A 4B15A 1W3KA 3H2EA 1B3OA 4ZB0A 4IIGA 2MUCA 4RZBA 1EHAA 1PL9A 3BOXA 1GUVA 3QR3A 1RJRA 3PZOA 2ZUMA 4A35A 4U3AA 3ARPA 3CMGA 4DJED 1QWKA 2BNJA 2FFIA 1X8FA 1ZENA 1X96A 4GXPA 4DZIA 3NDYA 4IOTA 4D1IA 1VFOA 3KTXA 3TZNA 4KERA 4C6QA 1A5UA 2NXGA 3QYQA 1DYSA 1PYFA 1XPGA 4JN8A 2HEJA 2X16A 2PWGA 3TSMA 4DIPA 2XM1A 3WLNA 4B91A 4ZOEA 2ZZ3A 2Q3OA 4Z1YA 4LF2A 4PBFA 3GR8A 2PV2A 5LNVA 2GOKA 1HJVA 1Q85A 3I4EA 1HL9A 4XD6A 3VGBA 1M5YA 1WPCA 1W1A1 4QIBA 1M7PA 1UH2A 1DPMA 1TTPA 3CHFA 4MF4A 2QCHA 4L80A 3PUGA 4TMCA 3CIXA 1MDRA 2B7QA 3MC5A 3WK1A 3N3MA 3A5FA 3BG9A 1JPDX 2DZPA 2CKSA 4JIPA 4L72B 2XU2A 2F4EA 2A3HA 2WM0A 4HBKA 4JFKA 1E0WA 3CUGA 5HANA 5DFAA 4QITA 4J4OA 2ZWYA 3VKBA 5AZ1A 3QQ1A 1MNSA 1CLVA 3WUGA 3LPOA 1M03A 2I9EA 5I3IA 3CQIA 4F0KA 5FF0A 3FSUA 1XDJA 3U5YA 3N9SA 2BGQA 3QW3A 3EX4A 3RMJA 3W7IA 2XPAA 1MQQA 3RN6A 4AZHA 3WBYA 2WXDM 2QCEA 4US5A 3ITCA 1XG4A 5CZJA 1UG6A 1S5MA 5F7UA 5C70A 4ZE4A 3W1XA 1K6WA 3K2GA 1M9HA 3UCDA 4LWWA 2ZVIA 4Q8WA 4M6QA 1ZSXA 4IH3A 1C92A 1HJSA 1FFRA 4GVGA 1B3WA 2H8ZA 4ITZA 4RNFA 2TMDA 3VNZA 3WBXA 4F2UA