1HKJA

Crystal structure of human chitinase in complex with methylallosamidin
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
total genus 123
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkjA01
4AZCB 2VVNA 1E56A 3UR7A 2DT3A 6TAAA 1JF5A 2BY2A 1E6NA 1ZL1A 1B3YA 3T09A 3W25A 3WIJA 4LYPA 2YBTA 3WDJA 3PZUA 3LPFA 3VINA 3AS1A 2X05A 3WD4A 3WQWA 1CXEA 3GXMA 4BQ3A 4KRTA 5DT5A 2VC9A 5E6YA 1UH2A 2BVYA 4M29A 1M03A 4PSRA 3GNRA 2Q8XA 1E5JA 2DH2A 1BAGA 4KMQA 4W5ZA 3N04A 2AMGA 3ZMRA 3N9KA 1MVYA 1E6RA 2J4GA 1A3HA 3VDBA 1UR8A 4PRWA 3WH8A 1UR9A 3U57A 1Q6GA 4UFLA 1DWFM 2FGLA 3B9EA 1CGUA 3JUGA 3WNPA 1K9DA 2DSZA 3AHXA 2A3BA 1H0GA 3AXIA 1H09A 2VZVA 4IISA 2VCCA 9CGTA 4W87A 3WEMA 4RE2A 1JZ8A 1W1TA 4P7QA 2X8RA 3N1AA 3TTQA 4HOWA 4AD5A 3WNNA 2OLHA 1ZBKA 3WL0A 2D20A 3ARXA 2J25A 4QCFA 2GFTA 3WBAA 4AEEA 4JCLA 2WKGA 3WQVA 4Q22A 2OSWA 3NSMA 3VIGA 1XV8A 3TA9A 4UQCA 5ABHA 1GOWA 3A4XA 4P8UA 3VPLA 5A8MA 3CMGA 5AC5A 2W4XA 1QI5A 1R8LA 1H49A 3WDHA 2OWXA 4UR9A 1HX0A 1OGBA 1US2A 3U7BA 2D23A 3M6DA 3WF0A 4AZGA 1TCMA 5A6AA 3WBEA 4HMCA 2XFYA 4MPKA 3VDHA 5BCAA 1UWTA 4PMVA 3FNDA 4JCMA 5IXEA 3ZQ9A 4EKJA 1RD6A 1UZ4A 1KXVA 2WMIA 1KCLA 1UD6A 3T2QA 3G6LA 1WKYA 5ECUA 1E6XM 1V02E 3RM4A 3WNMA 1GVYA 1NARA 4D6JA 3AROA 2V5DA 1ZU8A 2WK2A 2NW0A 2W63A 3RJXA 2O9OA 3MMDA 2XGIA 4XB3A 4B9YA 1JXJA 4WSKA 1BPLB 1PX4A 2WHLA 3I3DA 3AMDA 1AVAA 2EXOA 4D1JA 2CETA 2CBVA 1V6XA 5I5RA 3VNYA 2O9PA 3A4AA 2XVGA 5A6KA 1VEPA 2C8NA 4U2ZA 4M1RA 1PX8A 2YBUA 1JDDA 5GNZA 4H8VA 1X6NA 4N42A 2HVMA 1WCGA 2CPUA 1VF8A 2VX7A 4GQQA 4XZWA 1CYGA 2VZUA 3PZGA 3ZT7A 4P8XA 3I3BA 3ALGA 3WD2A 1FHLA 3DYMA 1HXJA 1ZJBA 2VJXA 3MSGA 1VEOA 3IK2A 2YOCA 3MV11 1M7XA 1K9FA 1V6YA 4H8UA 1IV8A 3GBEA 2WKLA 1HL8A 4U3AA 4MNKA 5A2AA 1GNXA 4PMNA 1J0ZA 1HKJA 4LPCA 5CLTA 3EMCA 1JAKA 1E0WA 2O9TA 3QHOA 1QHPA 4GO8A 1E55A 3PZVA 4MJ4A 3POHA 3WD0A 1VJZA 4BCEA 1EO7A 5HDRA 5CG0A 4YHEA 2J7HA 3PZ9A 4PUEA 3WEZA 3AJ7A 1DWIM 4W8LA 4E8CA 4GPNA 4H8HA 3EYPA 1V6VA 2VR4A 2WVVB 1BYAA 3APGA 3B9AA 2WVUA 3RO8A 1Z32X 3PZIA 1NOFA 5JUVA 4J27A 3QOMA 2DT1A 2Y2WA 1BVZA 2YLAA 4L4PA 4J3TA 5I3DA 1CXIA 2E3ZA 4IM4A 1UA7A 4HTYA 2EJ1A 3CHDA 2ZICA 5A8QA 2V3FA 2DIJA 1E6PA 5GQBA 3MO4A 4MADA 4W84A 2VCAA 1X6LA 3BLPX 3K46A 4AZHA 1ZBWA 3WUBA 4P8VA 1ISXA 2C7FA 2MANA 3ZR5A 3VD4A 2X2YA 4Y7EA 2D2OA 2VX5A 3SUSA 2BFGA 1L0PA 2FHCA 2EPLX 3ALFA 2GK1A 3S2CA 4HMEA 3VILA 4AZ7A 5C70A 5JIWA 1FFRA 1JL8A 4HMDA 2CBUA 1CXFA 1BQCA 2EPNA 1W3HA 5IDIA 4AY1A 5CLWA 1K6AA 3OGRA 3IAPA 2X0YA 4JKMA 3UETA 4ML4A 1CLVA 1UHVA 4W7WA 4MDPA 1V3JA 4CCDA 1UWRA 5ABFB 1GHSA 1EOMA 1EO5A 1NM9A 4MB3A 3THDA 5HOSA 2J62A 1NWRA 2VI0A 5EFDA 4UQBA 4CD6A 1JZ7A 5JBEA 1KGUA 4Z2LA 3WL1A 4JFVA 3CGTA 3IJ9A 4ZXOA 1UG6A 4URIA 3AXXA 1C90A 2X0HA 1GZJA 4AZBA 3DYPA 1OB0A 1UKTA 4F8XA 1W9BM 1SMAA 4CD5A 2E9LA 1C91A 1E0VA 5CPQA 2DSUA 3SCQA 1HF6A 4PMRA 3BH4A 3WELA 1GOMA 5FIPA 3B9DA 1H4PA 3BAIA 4KRUA 5CXPA 4AD2A 1UOKA 1ISYA 2E9MA 3AZRA 4UQAA 1KR1A 4J3SA 3CLWA 2ZX8A 5BRPA 4GZIA 1KGXA 1G9HA 1HJUA 1F4AA 1KGWA 4J3XA 1WDRA 5TD4A 4TVCA 1PIGA 5GNYA 5ABGA 2VT0A 1QNOA 2J8FA 3AMLA 3DC0A 3GYCA 3CHCA 1W9VA 2VOTA 3AIRA 4UQEA 2YL6A 4KH2A 2CKRA 4W88A 1RPKA 3VGGA 1QNRA 2D0HA 2X09A 4R5EA 2YA2A 3AMKA 4KGLA 2J7DA 3E1F1 3OG2A 4DM1A 5A69A 3MUIA 1WAWA 4L4OA 4QDMA 1KXHA 1P6WA 1QI3A 1YQ2A 5I77A 3M7SA 1HL9A 4MB4A 1OBAA 1UD5A 1C7SA 2FGZA 4PN2A 2BV9A 3OZPA 2ZXBA 2ZOXA 1M04A 1EH9A 4E2OA 5CSUA 1L8NA 1DWAM 4K68A 4TX8A 4XX6A 1E1FA 1E73M 1WNOA 2BHYA 2J7FA 2VX4A 4WK9A 3BCFA 5A8PA 3CBWA 4CKQA 2DPEA 5KZ6A 4HU0A 4H7VA 1MW2A 4D6FA 1FP8A 5A2BA 5AYIA 4HOZA 1Q6EA 5I79A 3WMBA 1IZKA 4M82A 3WSUA 2XFRA 3L2MA 3F5JA 4ZEPA 1ZBVA 4BQ5A 1NOWA 4DWSB 1BF2A 3RILA 4ACZB 4C7GA 3N12A 4W85A 2WM0A 4BA0A 4AMCA 1VIWA 4A3HA 5JH8A 1LQ0A 2D3NA 4D6IA 1J11A 4PUDA 2E40A 1UWIA 4HP5A 4XV0A 4AIEA 4AC1X 2O92A 1E4LA 4TUFA 3VD3A 1QNPA 1RP9A 2ZXQA 4P7OA 1QW8A 1V0MA 2YL8A 5IFTA 5HXMA 4CUCA 2PB1A 3RMEA 4Z2GA 1OWQA 4RE4A 2VRQA 3K8LA 3KZSA 4BF7A 3ZJKA 1GQKA 1Q6FA 3SURA 1JG9A 1V0LA 2OYKA 5LA2A 4W5UA 3IAQA 1KWKA 2W5FA 3D5HA 4RE3A 3VMPA 5JBDA 3L4YA 2XVPA 1V03A 1JDCA 1G1YA 1PAMA 4LQ1A 2AOSA 1JIBA 1KXQA 4LYRA 2XM1A 4U31A 1TVNA 3BAXA 3AYRA 1ECEA 1UD3A 2J8GA 2J74A 4WLCA 5DFAA 1I75A 3VMOA 5A1AA 1QI4A 3ZOAA 3BAKA 4HPGA 4U2YA 2WVSA 1PIFA 1BTCA 1V0KA 1FH9A 2VQUA 3MUY1 1PJ9A 1W2VA 3PZNA 4OKDA 4JFSA 2CBJA 1B3ZA 3EBVA 3T0AA 1E4NA 1E4MM 2VNCA 2WMGA 1Y7VA 1WZLA 4MNMA 4PYSA 1EDGA 3DHPA 1FP9A 4JFWA 2A3AA 4CD4A 2V3DA 1GONA 3ARVA 3CHEA 1V6WA 2D0GA 5DF0A 2CKSA 2G3NA 4CVWA 1SR0A 1J10A 3TP4A 4H2CA 3PZMA 2DIEA 4FLOA 1IT0A 4ATDA 2G41A 4OOZA 3WF1A 2V3GA 3OIHA 2JF6A 2XSAA 4WKHA 4E8DA 3AQUA 3VD7A 3L4ZA 3PTQA 2WHMA 1H5VA 1LJYA 1HJSA 1EGZA 4ATLA 3ZJ8A 2OSYA 3QOKA 1O7AA 4M80A 3L4TA 1WDPA 3UEQA 5ABEA 4HU8A 3GXIA 2D3LA 4Z2IA 1JXKA 3SCNA 1ZS2A 2BHUA 3SCSA 3KWXA 2E8ZA 1LF1A 1UWSA 1BSIA 1NH6A 1LG2A 3ZIZA 1ODZA 3VIIA 3II1A 1JZ6A 3OB8A 3VGHA 1V02A 3BAJA 1QHZA 1PX3A 4UQ9A 3MANA 3PTMA 3FN9A 3PZTA 3ZJ6A 1B90A 7A3HA 2WLZA 4ZE5A 1C8YA 3VOCA 3BSGA 2Y8KA 4PCSA 2VURA 2PWHA 1PPIA 1EQCA 1WZKA 4V28A 4EAMA 4HA1A 4GXPA 5ABFA 1CWYA 5LA0A 1GOOA 4WSJA 4HPHA 3THCA 1EXPA 1FOBA 2VZTA 3HJEA 4GINA 3T2OA 4NSBA 4GO9A 4W93A 2WC7A 3GZAA 3A4WA 3CTTA 1ZB5A 3VIJA 4HOXA 1R87A 3IANA 3RIKA 1M01A 1WDSA 3OLEA 2BY3A 4LYQA 2WCGA 2OYMA 3AHYA 4CN6A 1GJWA 4LX4A 1BVNP 4PMUA 2YLLA 2V3EA 1WO2A 4AZIA 3VVGA 2A3EA 1XH0A 1XCWA 1WPCA 2VQTA 1QNSA 2WW5A 1LL6A 4DUVA 3UG3A 1FA2A 2ZWYA 3AS2A 2WZIA 3QHNA 1KQYA 4GZJA 1XSJA 4CCEA 1YHTA 1NWUA 4ZFMA 1H0IA 3T0BA 1HKMA 2OSXA 1W3LA 4PTXA 1JYWA 1TE1A 2WC3A 2WHKA 2CHNA 3ARWA 1UQZA 1LL7A 2DEPA 5IFPA 4A3YA 1CXLA 1ODUA 5EBAA 4UTFA 3AHVA 4YHGA 1BG4A 3MUZ1 1HT6A 3N17A 2RGMA 1OCQA 1QBBA 1H1NA 3RM9A 3SCOA 2VCBA 1EHAA 4W89A 4M8UA 1QI0A 3W53A 1V3MA 5E70A 1DWJM 3WH9A 1GHRA 5A6BA 5EMYA 3WNLA 1Q6DA 1K9TA 2XVKA 3EDFA 2VMFA 4NRRA 1QI2A 1E40A 5IHSA 2ZUUA 3VMNA 2BY0A 2XM2A 3L4VA 2ESCA 3ZR6A 1TA3B 4ACYA 3VD9A 2DSVA 2YL5A 2ZXAA 5I24A 3ARYA 1G01A 1OT2A 3L4UA 3VX0A 2VL4A 2WCSA 2PC8A 1JFXA 4NI3A 1KCKA 2EPOA 1CDGA 1JZ3A 4UCFA 3M46A 5D9MA 1FFQA 1M53A 2VO5A 1BGAA 3VUPA 1I1XA 2A3CA 4ACZA 1DWGM 4JZ5A 4MAZA 1VRXA 2VRJA 4CU7A 3K4AA 4WKAA 5M17A 4OUEA 1D3CA 3CZKA 2EEXA 1XH2A 4AW7A 5BXTA 2ZX5A 3WNOA 4D71A 3SCTA 4CD8A 1E70M 2GJXA 3OLGA 5A3HA 4CCCA 2D22A 4P7LA 2EPMX 3F4VA 1FH7A 3CZ8A 4X9YA 1PBGA 1QHOA 2E0PA 2XIIA 3T2PA 2XVNA 2WSKA 3LMYA 3VIKA 3HN3A 1HIZA 5D9PA 2GUYA 1AQ0A 4M81A 3CUHA 2XG9A 2HISA 1XRVA 1NWTA 1B3VA 2JEQA 5FKYA 3GNPA 4BZYA 2CYGA 1E71M 4UFHA 2Y8VA 4D6CA 3VDCA 4KWUA 1U33A 1W3JA 1H11A 1W9XA 3GDBA 2XFFA 4JFUA 3L4XA 1S46A 1VFFA 4TXEA 5LA1A 1H3GA 5D8ZA 1E5NA 4OIFA 1HP5A 5CGTA 1EHNA 4WJXA 3SUUA 2DDXA 3WN6A 3FW6A 3GNOA 1TUXA 2WANA 3AIEA 3AIVA 2WSPA 3WDQA 3CIVA 1OGGA 3LPPA 1J0YA 2CHOA 3BAWA 2G4FA 4F9JA 1J0IA 1NP2A 4QCEA 3ECQA 4PMYA 1CTNA 2NT0A 4IPLA 2UY3A 4AD0A 2J79A 4F66A 2YA1A 1GJUA 2EPKX 2W62A 2WAGA 2G3MA 3EDEA 3N18A 4UNIA 1O6IA 1HP4A 4TTGA 4AZCA 5JBFA 3PTKA 3SCPA 3NSXA 2VR5A 3S6TA 5FOOA 1W1VA 1V0NA 2OYLA 8A3HA 3WENA 1OT1A 1CXKA 2CCRA 1W9DM 1EDTA 3BXWA 3OGSA 5EB8A 1V6UA 1TMQA 1JDAA 2BXYA 1UR4A 3GTNA 1LWHA 1RP8A 3BMWA 4HZ8A 4D1IA 1XHGA 1V3LA 3GXFA 1UR1A 3A3HA 2BS9A 3UCQA 5CJ5A 1UKSA 2DGAA 2DT0A 4Z2HA 3VKKA 1JYNA 1GCYA 1C8QA 1MXGA 5BROA 1BHGA 4GQRA 1AQHA 1XSIA 1UH3A 5BXRA 1TVPA 3SCUA 1MFVA 4CGTA 1BGGA 4CN1A 2EBNA 1N82A 3MUAA 5C71A 5DMYA 1XYZA 3OZOA 1OIMA 4Z2KA 3AOFA 2FDMA 3CZEA 2VZOA 1TR1A 2JALA 2QMKA 2PWGA 8CGTA 5E0CA 4AXNA 2FH6A 3W27A 3RM8A 2CXGA 3BC9A 1J0HA 1WZAA 3MKKA 1PEZA 2YL9A 1UA3A 4QAWA 1UQYA 3OA5A 1VB9A 4GKLA 2ZIDA 3CHFA 4MAVA 1HJQA 4UFKA 1FH8A 3AIQA 5FL1A 3B8SA 1UWQA 1JYVA 4ZXLA 3KL3A 3EDDA 1V3HA 3ZT5A 2YJQA 4D72A 2FHBA 3FAXA 3J7HA 2ZUMA 5A6SA 1QOXA 5CQ1A 4HA3A 1DP0A 2G3IA 2ZE0A 3PN8A 2ZXDA 3RDKA 1MYRA 2J7BA 1JFHA 4J3WA 1BYDA 4GIAA 2CERA 2BY1A 5A6BD 1J9YA 4IPNB 1SMDA 3WF3A 3TTYA 2XHYA 3PHAA 4BQ4A 3AZSA 3W28A 2DSKA 1R7OA 3SCVA 2D1ZA 3UG4A 2W66A 1DTUA 1DHKA 2B31A 2RGLA 2J7GA 1UD2A 4Z2JA 3GH4A 4W7UA 3OBAA 4B15A 4D6HA 1AQMA 3BAYA 2QLYA 3AS0A 2F8QA 3WF2A 4TVDA 2WLYA 3POCA 3WFZA 1JGIA 3L4WA 1JZ5A 1MW3A 1QBAA 3VO0A 3SUVA 2FH8A 3WUFA 4PMDA 4TVUA 1C3FA 3SCRA 4AD3A 1AMYA 2WNWA 4UZUA 1GQJA 4B3LA 4UZSA 1JZ2A 1B2YA 4FLSA 2F2HA 4FMVA 4MB1A 3CUGA 2ZUWA 2ZUVA 1B3XA 2X1IA 1VJSA 2CIPA 3W24A 1JNEA 1B1YA 1LWJA 1UKPA 1DEDA 2PWEA 2WCAA 4ZENA 1UUQA 5HPOA 4ATWA 1XD0A 1E6QM 4QP0A 5HNNA 5M03A 4M24A 1OM0A 1V08A 4AIUA 2GK1B 3CH9A 2V38A 4V27A 2WBGA 2BVTA 3WDPP 4C7FA 3FHQA 2WMKA 2XPKA 3AIWA 3FAWA 3TONA 4U3CA 1CIUA 1UKQA 1TA3A 3CMJA 1QPKA 1HVXA 4S3JA 5DEZA 2GVYA 1ITXA 4OBSA 3WDRA 5CPSA 4TX6A 1J01A 1J0KA 2J47A 1XGZA 2PF0A 1ITCA 4HZ6A 1LLOA 1B30A 4UFMA 2WMJA 3AYSA 3U7VA 1NWSA 1VBUA 4GI8A 4E4PA 3EMQA 1H2JA 4AWEA 2WVVA 1UD4A 1GOQA 3BSHA 3NJ3A 5AC4A 3BCDA 2CEQA 2F61A 1UD8A 2JFEX 4XZBA 5A94A 2ZX6A 3VGFA 3WNKA 2WMHA 2BHZA 1XYFA 1W32A 5M3WA 2WVTA 1R85A 1EOKA 5A6LA 2J78A 2D24A 3A47A 1WDQA 2JF7A 5AY7A 1C8XA 4F9DA 3ZJ7A 3A6OA 1JF6A 1E6SM 4AYSA 3VIMA 4UOZA 3FXYA 1GORA 3AIBA 1VFMA 4PEEA 3KL5A 3ARPA 2QPUA 2WC4A 4W8AA 1MWOA 2E4TA 4UFJA 2QHAA 2GDVA 3O6AA 2AAAA 5A95A 1R86A 1WE5A 1CGXA 3W0KA 3LPOA 3CZJA 1CXHA 5BXPA 1G94A 4OZOA 3N13A 3W29A 2ZUSA 2XIBA 3UR8A 3SIMA 1KBBA 3VGDA 1DWHM 3CUFA 1D7FA 1VENA 3WD1A 1XC6A 3AIUA 2EQDA 2IUZA 4DUWA 1HVQA 1HJWA 4MTVA 1BYCA 3MU7A 3IJ8A 2WZEA 2E8YA 1K9EA 1PZ2A 2UWFA 3ZM8A 6A3HA 4DM2A 3ZO9A 4QLKA 1G5AA 2XUCA 3VNZA 3O9NA 3M07A 3W6MA 4Q7NA 2WZHA 3VGBA 3GH5A 2WMFA 4PMOA 1HJXA 3VIFA 2QMJA 3VGEA 1QVBA 2ZX9A 1E4IA 2XSBA 1CBGA 1TFVA 4XUYA 1E1EA 3K4DA 3IJ7A 2BVDA 3RCNA 1XSKA 4UOJA 1LL4A 2XWEA 4WKFA 3AMCA 1W9UA 1B0IA 1OGSA 2WYSA 4JL1A 3WFLA 5CPTA 1KQZA 4BS0A 2YKKA 3WH7A 4P8WA 2QF8A 3CPUA 4U5IA 1UZ1A 3W26A 3ARSA 4R27A 1VAHA 4J3VA 2NSXA 3AHTA 3QHMA 2J7EA 1B3WA 2JIEA 2XJ7A 3AS3A 5DT7A 1BYBA 2CESA 4H04A 3AHZA 4P7NA 4DUXA 1EDQA 3NUKA 1SYTA 2QPSA 5D4YA 4JKKA 3U5YA 2EO7A 1CZ1A 1GVIA 1GQIA 2ZX7A 1ESWA 1KR0A 4V2XA 3K8KA 3MMWA 1EIBA 7CGTA 1GOKA 4LXFA 3WD3A 4UQDA 4NRSA 5BRQA 4CD7A 2DH3A 3K1DA 2W92A 1BLIA 2C0HA 1E72M 5E9AA 2JE8A 4QFUA 2PBOA 1MQPA 3FHAA 4B3KA 5C8BB 2UY4A 5BXSA 1E9LA 1QNQA 3VTRA 3NIYA 5FL0A 2A3HA 1EA9C 4S3KA 4AEFA 3PZOA 4D6GA 3PBGA 1CGYA 2W67A 1W3KA 2UY5A 5I23A 1G0CA 1VFOA 3F5LA 7TAAA 4NF7A 1MW0A 3WMSA 3VIPA 3UG5A 4DWSA 3ARRA 4JAWA 1W91A 3WQ8A 4CU8A 4PMQA 3CUIA 5I2UA 4FF5A 4PTMA 2GJRA 1RH9A 4C7DA 2W61A 2WXDM 4PBGA 1UWUA 4U5KA 4PSPA 3QR3A 3N11A 2OWCA 1W1YA 3AISA 2ZUNA 3N15A 4GI6A 1V3KA 1V3IA 1NOUA 4UFIA 3WUGA 1OSEA 4H41A 1KFWA 2Y4SA 1NP0A 5D9NA 3HU7A 3NDYA 3VIHA 3T08A 2JEPA 3SUWA 1EQPA 3NCOA 2ZUTA 1BFNA 2XYLA 2VVSA 4BQ2A 5FD0A 4HZ7A 4YPJA 3U5UA 3WMCA 1NQ6A 3G6MA 2DT2A 4U33A 2V5CA 1C92A 1LG1A 1W9PA 2PWFA 3HMCA 4AISA 5AYBA 1JAEA 3ZSTA 5DO8A 1E0XA 1MFUA 3BLKA 3KEHA 4IUGA 3CZGA 2J7CA 2TAAA 4MB5A 1CGVA 4W8BA 4MJ2A 1MXDA 2BXZA 2E9BA 3AZTA 3W4RA 1E6ZA 2Z1KA 5D8WA 2DQXA 1CGTA 5BYWA 1JZ4A 3MSDA 1OD0A 3L2LA 2VZSA 1OIFA 1J18A 4QLJA 1U30A 1WZMA 3I3EA 3VDAA 1JI2A 1HKIA 3SUTA 5E09A 1XH1A 1XD1A 3F5KA 2YDRA 4J3UA 4J7RA 1KBKA 5A6MA 3K8MA 3NYDA 2WHJA 4CU6A 4AZ5A 1OD8A 4QLLA 3KE0A 3SCWA 4EANA 3ARZA 2NT1A 4OBRA 4WIWA 1JNDA 3BGAA 1Q4NX 1U2YA 3LPGA 3GH7A 1MQQA 5HPCA 4FLQA 4EE9A 2VX6A 4N0RA 1TZ7A 4HA4A 2FHFA 4WF7A 4PTWA 5FCZA 4X0NA 4JIEA 5KEZA 4JFTA 1E43A 1CECA 3TTSA 5HBFA 2WBKA 1JD7A 3WQ5A 1I1WA 3WQ4A 2GJPA 1CPUA 2WMIB 3SEPA 1JYXA 4MNLA 2CNCA 1IZJA 1VBRA 4JHOA 4GZEA 4OOUA 1W2PA 3W82A 3ZSSA 5JIPA 4M56A 2YIHA 5CGMA 5IHRA 2OWWA 4UOQA 2PI6A 2XTKA 3T0DA 2BNJA 5A8OA 3GM8A 1CLXA 3NDZA 1B31A 4JKLA 3DHUA 3WH6A 5F7UA 3MS8A 4W7VA 3EDJA 3D3AA 2UY2A 5GPRA 2PBGA 2J77A 1VEMA 2YDQA 4PMZA 4PMXA 4EK7A 3WEOA 3WDIA 3CUJA 4CN4A 1UKOA 3W81A 1WB0A 4P7RA 5E0FA 1MW1A 4JL2A 2IXUA 4X0VA 1Q6CA 4MNJA 2Y5EA 3AMGA 1GPFA 2D0FA 3OGVA 4D6DA 1E3XA 2VTFA 4D6EA 2PWDA 1E3ZA 1KWGA 5EFFA 1B9ZA 1GOIA 3UESA 1F4HA 4JHZA 1C93A 5M5DA 4TTUA 2GSJA 3DYOA 3MMUA 1C7TA 3VM5A 3VX1A 3WH5A 5D9OA 4A4AA 3FY1A 5I0DA 3PZQA 3TTOA 4MDOA 2YA0A 2W91A 3W37A 1HN1A 3OLDA 1PZ3A 2XWDA 3VU2A 4RL3A 3CZLA 1GUVA 3W6LA 3EMZA 3OLIA 3KL0A 5BWFA 2GDUA 1JI1A 1UYQA 1ZJAA 5LYRA 3GXDA 1UH4A 2Z1SA 2DSWA 1HJVA 1A47A 4J28A 1XCXA 3DECA 4W86A 1FHDA 5GNXA 4B16A 2JIWA 1QW9A 2WB5A 4GI9A 2VUYA 2Y24A 2XVLA 5A2CA 1D2KA 2XGBA 3WY1A 4DWSD 2ZWZA 4AIOA 3GBDA 1BG9A 2GJXB 5A8NA 1MQRA 1VFUA 3VIOA 4OJYA 4AZ6A 4CVUA 1J12A 1HKKA 2G3JA 1H41A 2CBIA 3RPMA 1R7AA 3ARQA 1UR2A 4AD4A 5A6JA 1SFSA 2J75A 3ARUA 1KXTA 4ZE4A 4LGXA 2YDSA 3AICA 1HNYA 4FK9A 2QV4A 3AI0A 4PTVA 1ZBCA 1JD9A 5I6SA 3BMVA 3CO4A 3ARTA 3VD5A 5E6ZA 1X1NA 3WF4A 1GQLA 4KGJA 3WQ6A 2WPGA 3WUEA 4B9ZA 4NZCA 1GW1A 3VM7A 4DWSC 1OINA 1UR0A 2O9RA 2WWCA 4FLRA 5I78A 1US3A 1CNVA 1ISVA 1KB3A 3EDKA 3RJYA 3TOPA 1WP6A 2WWDA 1J0JA 1ISZA 3MV01 4AD1A 3WKZA 4YN5A 5CSYA 1CENA 3AXHA 1CGWA 2VRKA 3O2LA 3QGVA 5CZKA 2CITA 1CEOA 4PCTA 6CGTA 1ISWA 3NSNA 2IXVA 3W38A 2G8ZA 4F79A 1W1PA 3AFBA 3UERA 3ZT6A 4TOQA 1E15A 1TG7A
chains in the Genus database with same CATH superfamily
2J27A 1DJIA 2DT3A 2XIJA 4KCUA 1E6NA 1ZL1A 1B3YA 2R94A 3WIJA 1XLHA 4LYPA 2YBTA 3MW7A 3LPFA 3VINA 3GKFA 1NVMA 3WD4A 3WQWA 3IK8A 2QAFA 4KRTA 2VC9A 2BP1A 4UTLA 3RLVA 4CCZA 1UH2A 4YTQA 1JCXA 1HGYA 4UIOA 4HNCA 4WUIA 2P88A 2Q8XA 2DH2A 1BAGA 1TR9A 4KMQA 1EGVA 5K2ZA 4JX5A 3W73A 3UWVA 3OU8A 4ZB0A 2YSWA 5DMNA 2GVJA 3O5GA 1UR9A 3U57A 4AIBA 2HE8A 1G4TA 4B5SA 1F6PA 3B9EA 3WNPA 3HPFA 3TV8A 2DSZA 3M0IA 3AXIA 3LCIA 1H09A 1S3TC 2QJNA 1EGMA 4W87A 4G2PA 3W1MA 1E9ZB 2WOQA 1OF6A 4LUJA 3UWQA 3R13A 2OLHA 1QK0A 2D20A 3ARXA 4YCOA 1OFPA 4NAEA 3S46A 2IKGA 3WQVA 2LGOA 3VIGA 3WLRA 5AHFA 3AYTA 1T40A 2CLIA 1J5TA 5K3VA 4UQCA 3V5OA 5LIXX 4L80A 4P8UA 1SSDA 1J4RA 1RALA 3CMGA 1TUFA 2E6FA 2BX7A 1H49A 4QRNA 4UR9A 4YL2A 3OTRA 4O1FA 4JEJA 3URNA 2H3BA 1PUDA 4GY7A 4U85A 1MO0A 4HMCA 4HU3A 2WZMA 3FYPA 4CNTA 1O5RA 1TMHA 3LYEA 2GPTA 4HK6A 3LTSA 3O0FA 5HWNA 1RD6A 5LGZA 2WMIA 3QEZA 3T2QA 2P76A 3G6LA 3PBWA 3S1XA 4HCLA 1MXSA 4XO7A 3CU2A 4D6JA 3A3XA 2V5DA 1ZU8A 2CZEA 4KKXA 3UJEA 3FA3A 2W63A 1D8CA 2LLEA 4DBEA 3TFCA 1A0CA 3MZNA 4GUFA 4L61A 2IF4A 3MWAA 2EXOA 3WQCA 5GPGA 5TIMA 3M0XA 1V6XA 2Z2UA 4GA8A 3EWWA 1R6WA 1JDEA 3A4AA 5TAOA 2XVGA 2XP3A 2NLIA 3ABXA 5GNZA 4XG1A 1Q13A 2HVMA 2VX7A 2J6VA 1F9CA 4XZWA 1E0TA 1IEIA 3O6DA 3I3BA 3B3DA 1TTIA 3CV7A 2PZNA 1ZJBA 2VJXA 3TC3A 1OEPA 3MSGA 1EP2A 2YOCA 2X1TA 1E1CA 3GNXA 4REQA 1IV8A 1H5YA 3SY5A 1HL8A 3JYJA 3LTPA 4PMNA 5ABTA 2ETNA 3EMCA 3QMTA 1E0WA 1ROUA 3G1AA 1QHPA 3PZVA 3STCA 3POHA 1GVOA 3ANVA 1VJZA 3OYXA 2QJHA 2OXNA 3O0KA 3KLLA 4Q6JA 4ZOEA 3WEZA 3AJ7A 4R9OA 4E8CA 1W3TA 2CLKA 4H3DA 4ZVJA 4HB7A 4R85A 1VLIA 2UZ5A 1RCXB 1OX5A 1GRJA 3O5PA 2Z1XA 2V5KA 4EIVA 1GK8A 2DT1A 2YW4A 1RLDA 3M0YA 1F3WA 3KDNA 1G7UA 4HTYA 2GYIA 1UP0A 2V3FA 2DIJA 5GQBA 1RLCL 4MADA 3SFKA 3BLPX 3W2UA 5CZSA 4DRJA 3PBUA 1NTHA 2I9UA 4EWJA 4LS0A 3WUBA 2GWGA 1XBYA 4LAKA 3ZR5A 3VD4A 4V1XA 1OYAA 2X1RA 5FEXA 2BFGA 3SGUA 2FKEA 3UWEA 4AZ7A 4BKNA 1FFRA 3NDOA 5CSRA 4O1AA 4G7EB 3H9RB 4HNVA 3RRAA 4L9ZA 3S9ZA 1BQCA 4JIRA 4ZOAA 3OGRA 4ML4A 5I02A 1OCBA 4ECLA 1MNSA 1C9HA 3T05A 1V3JA 2XPAA 2YXOA 1GG0A 2E5BA 3HGSA 3NQFA 3H2MA 3UZYA 4AY8A 2D2JA 2WNZA 3THDA 5EFDA 1AUSL 4ITZA 5JBEA 3WL1A 3TC7A 2G95A 4URIA 3GIPA 2X0HA 1GZJA 3DYPA 1PKYA 1ZJIA 3S42A 3L5LA 3UI4A 1SMAA 4IH3A 3LV6A 1U5HA 3SCQA 2ZA2A 3WQFA 2PDMA 2MNRA 1W1ZA 5IDZA 1GPWA 1H4PA 1UOKA 2E9MA 1A49A 1KR1A 2VFGA 1KGXA 2NSOA 3ELFA 4S38A 1J8VA 1Q2RA 4IX0A 1IEVA 4CNUA 5ABGA 2ANUA 3G5EA 1UW9A 5AC6A 4P5UA 1HGWA 1QXLA 3UQNA 3WZ0E 4LNCA 2KI3A 2ZKMX 1QNRA 1ZQ5A 2CLOA 5REQB 2ZRZA 3RCYA 2D0HA 5AC7A 3C0QA 2PPPA 3ERPA 2X09A 3V1HA 4KGLA 2J7DA 4K37A 4DM1A 3MUIA 2ZZ6A 4QDMA 1V51A 3R79A 4MFDA 2NUWA 1TCDA 3M7SA 1XRFA 4PH6A 2GSEA 4M19A 1UD5A 3ITXA 5BW6A 1V5XA 2BV9A 3OZPA 1BSLA 2ZOXA 1EH9A 4AF0B 5CSUA 1VH7A 4LU0A 4J4OA 4TX8A 4XX6A 1E1FA 1E73M 2RAGA 1YNPA 2FZDA 4DWDA 2VX4A 2CWXA 3CBWA 4XZMX 2AL1A 1PIIA 2BG5A 1Q6EA 5I79A 4C6DA 1IZKA 3WSUA 4LVDA 3V4BA 4ZEPA 1KRAC 4Q6XA 3LS9A 4WGXA 4ACZB 3QFEA 3H70A 1UC4A 2Q6ZA 2WV8A 1VIWA 1J11A 4PUDA 4ZQPA 4ERAA 3BDKA 4JX4A 3HPXA 4FXJA 4L6HA 3TVAA 3OP2A 4TUFA 2ZXQA 4KFNA 5C9RA 1UC5A 2YL8A 5IFTA 3Q58A 1PB0A 2PB1A 1S2VA 4RW5A 1IIGA 1F76A 2AQWA 3MP4A 4RE4A 3K8LA 3KZSA 3FJNA 5LIKX 1OFEA 4K39A 3NOEA 1AD4A 1JG9A 1Q66A 4Q8QA 2OYKA 3ME3A 3MYPA 2XVPA 4KBXA 4I7VA 3NNTA 1JIBA 3TX9A 3SY1A 2XM1A 3I7QA 1TVNA 2HWGA 3BAXA 5LHEA 4C5ZA 2PUZA 1K8YA 1JUEA 1GQNA 1I75A 1QPNA 4W9TA 2FLIA 4U2YA 1PIFA 1Y5WA 3UPMA 2I5QA 1FH9A 3E0IA 4C60A 4JFSA 2CBJA 1H62A 1E4NA 3BLLA 1EDGA 3DHPA 1FP9A 4JTDA 4GVIA 4ZB2A 3EWCA 5CAHA 3L67A 2V3DA 3NO5A 4WHBA 1BKFA 1LRTA 4UTUA 2XP6A 2Y88A 4XAZA 3S2NA 2Y63A 1VP5A 1J10A 2C71A 3IEBA 1Q7QA 3GC5A 5EKYA 3PAOA 3NEVA 3OIHA 2JF6A 4WKHA 3AQUA 3V5CA 3S5OA 1LCOA 4PA8A 2ISVA 3L4ZA 3KFTA 2WHMA 5G1MA 2M1IA 4ATLA 3NA8A 4MWAC 2OSYA 4Y9PA 2BBFA 3LCGA 5FJRA 5J04A 4Z2IA 1L2UA 1K70A 3K5XA 1O94A 2BHUA 2HZGA 2GSHA 3N14A 4O0KA 4L6DA 1RCOB 1LT7A 1V02A 1R0MA 4YYCA 3BAJA 4H19A 1PX3A 3ITGA 4OECA 4HZMA 4UQ9A 4HHHA 3FN9A 4NIRA 3BOLA 3LLFA 4G7EA 3RX4A 4RR4A 1QT1A 3QV7A 3HGJA 4IPXA 3F2DA 7A3HA 1KT0A 2WLZA 3L5MA 4M3PA 1C8YA 1I2QA 3NL5A 4DO7A 2DG9A 2Z0IA 3YPIA 2F38A 2VURA 4BEQA 1EQCA 3GG0A 3U4AA 1EBGA 4EAMA 1CWYA 3G1DA 2ZQUA 1NDZA 1EFZA 3ATZA 2VZTA 3HJEA 4GINA 4X63A 3EA2A 1W56A 4IX2A 1R5YA 2WQPA 4KCTA 1XC4A 2ISFA 2XH2A 4GD0A 4MY1A 1R87A 2Z00A 1M01A 1SO3A 5AHMA 4BWLA 4YYFA 4QS5A 4XSMA 3INPA 3A5FA 2BZNA 1RK6A 1GW9A 5DO2A 2ASHA 2YW3A 3GC4A 1BVNP 4JNYA 2YLLA 4PMUA 4DY1A 2V3EA 2TYSA 1GZGA 3BV4A 1XH0A 1XCWA 2VFDA 1WPCA 2X30A 3N25A 4FNQA 3DUGA 3CNYA 2XH0A 1SSGA 4WDWA 2DG3A 4ORIA 2RURA 4DJEA 2HXTA 3I6EA 2ZWYA 3JU2A 2HPIA 4WXZA 5CZJA 1JQXA 1XPGA 2PZ0A 4CCEA 1S2CA 3MJMA 1NWUA 2CZ5A 1H0IA 2XP9A 3WYZA 4TQTA 3CEPA 3BSMA 4QE1A 4FXRA 5AHLA 4PTXA 2QUUA 1TE1A 2WC3A 3CGNA 3ARWA 1LL7A 4AQLA 4A3YA 4B3ZA 1CXLA 1ODUA 4IT4A 3KLKA 1RHCA 2FGBA 2PDUA 4UTFA 2J8TA 3STGA 3OZMA 3FFSA 3LGDA 4XTIA 2RGMA 4LH8A 1OCQA 1H1NA 3RM9A 1W5OA 3AALA 1EHAA 1P0EA 3EB2A 1QI0A 4ICCX 1V3MA 3MUXA 4I9MA 1K9TA 2XVKA 2C15A 4BY3A 3IJQA 1RQHA 4I8DA 3Q65A 3H21A 4L7ZA 3L4VA 1JRCA 3ZR6A 3ZWSA 1PYFA 3VD9A 4MPQA 3GVWA 3NO3A 2HBXA 1FBAA 1DPMA 3VX0A 4BI7A 2ODOA 3GU0A 2WCSA 5EMLA 1JFXA 4ONVA 3EX6A 2QAPA 4PB4A 2EPOA 1TWDA 2QIIA 4UCFA 5D9MA 4LVAA 1BGAA 3VUPA 1PINA 1YRRA 1N1AA 4ACZA 4ZPTR 3LXBA 2Q09A 3Q67A 4ADSA 2I56A 1JUBA 1D3CA 3RGCA 3CZKA 1A5NC 1S1PA 2C6QA 4AW7A 5BXTA 1CX9A 1IIHA 3SCTA 4C6FA 1TQXA 1E70M 2GJXA 4JTAA 1I9CB 3ITCA 1OVDA 1QHOA 1VFTA 4MVAA 3T2PA 4GY0A 1F6KA 4YTSA 2GUYA 1PWMA 4GC4A 2ZA3A 2XG9A 3DXIA 1NWTA 1B3VA 1DL3A 4ZR8A 2JEQA 2MNTA 1VBJA 2V9DA 3H7RA 1TV8A 4PCFA 3UXDA 4UFHA 2Q8LA 2FTYA 1YTKA 4HCDA 1W3JA 2VEGA 1G4PA 3GVQA 1DV7A 5H6HA 5G1TA 3HGRA 3NQEA 1RY8A 1VFFA 4TXEA 5D8ZA 3VA8A 2NQHA 3PJXA 2A2IA 1EHNA 2DDXA 4GGHA 3WN6A 3AIEA 5GJPA 1OFBA 1AODA 3AIVA 1J0YA 2PPNA 3WLOA 1JCLA 1J0IA 5DIVA 1PKNA 3QH2A 2UY3A 4AD0A 2J79A 3RX2A 4YCPA 2C16A 1XIGA 2FB3A 6REQB 5C5YA 5H91A 3N18A 5HWJA 4TTGA 3WLMA 4AZCA 5JBFA 3PTKA 4Q8NA 4CQCA 5C9XA 2VR5A 3S6TA 5FOOA 1W1VA 1QASA 3CAQA 2OKOA 1CXKA 1NELA 3EX1A 1TPEA 1JCJA 1KCXA 1V6UA 4F0HA 1TMQA 5D2XA 1P6BA 1JDAA 1NSJA 3ITTA 3A4JA 3MVIA 1XW8A 1RP8A 1TTJA 3L5AA 3BMWA 3GKAA 1V3LA 1UR1A 4HJWA 3UCQA 5CJ5A 1UKSA 2DT0A 1KM4A 3UW6A 1DJXA 5BROA 1BHGA 3V3WA 1XSIA 2ACQA 3RYSA 1GYMA 1TVPA 3SCUA 3B8TA 2EBNA 4WRHA 5DMYA 4MGVA 4LUTA 5D04C 3CZEA 4DBUA 2QULA 2WO5A 3G8RA 2PWGA 4GYJA 4AXNA 3I4KA 2QCFA 3VNLA 1WZAA 3R1ZA 4GKLA 2ZIDA 4M7TA 4MAVA 1UPPA 5CBBA 2GJLA 3O5EA 1HJQA 4WQ6A 3QYSA 1IXQA 3QPYA 3DOPA 5I06A 2PP3A 1SZGA 2YJQA 2R8WA 5T8GA 2ZUMA 3O5MA 1SJBA 1QOXA 4H7ZA 3IK4A 5CQ1A 1DP0A 4C6EA 3TXVA 3F4CA 3U4FA 3CK5A 1HG3A 1UASA 3IUDA 3QKZA 5A6BD 2BY1A 2YZ5A 4GVFA 1J9YA 4IPNB 5DELA 1CI1A 3AZSA 5E9XA 4IGHA 2DSKA 3SCVA 2D1ZA 1LBFA 3UG4A 4N4QA 1UIOA 1UD2A 4ZQNA 1KLZA 3BAYA 3LI1A 2F8QA 1A5AA 2CU0A 3NEHA 6XIMA 2P8BA 1H1ZA 4NZ4A 3GWQA 3AXKA 3L4WA 3GFXA 3OJGA 3ZZ1A 5KINA 1MW3A 4O19A 1LRNA 2FH8A 3WUFA 1XGDA 3CYJA 4JTSA 4MKVA 4PZVA 1AMKA 3FA5A 2WNWA 4B3LA 4DLMA 1HQTA 5E1QA 4E2BA 5C6MA 4MB1A 2ZUVA 1VJSA 3BMBA 3D47A 3GVGA 1LWJA 1ELSA 4D2JA 1XL9A 5FJOA 1XD0A 2NVCA 4M24A 2E6YA 2GK1B 3QFWA 3ES8A 1K8ZA 5HWCA 1FCVA 2WBGA 3KZPA 1WA3A 3CQHA 3FHQA 3FAWA 3AIWA 4AHQA 4UTIA 1UKQA 4XZHA 1XLIA 1FQ0A 1HVXA 5TNVA 4S3JA 4IPIA 1X1OA 3UPWA 3G77A 4TX6A 5AOUA 1J0KA 2BGSA 2J47A 4TMBA 3FSTA 3V0SA 5XINA 1QDSA 1NWSA 3KBJA 1UMYA 2I16A 1UPMB 3HB9A 2NVAA 1UD4A 1XLGA 1I8JA 5G2IA 3BSHA 4MYXA 5E0KA 1VYPX 2JFEX 1LORA 1T96A 3TA6A 3S2JA 1W32A 4AX6A 2MLYA 2NQ5A 2WVTA 1EOKA 2PDNA 3A9IA 2D24A 1R2SA 1VR6A 4RZ6A 3TYBA 3KAGA 4MSSA 1JF6A 1E6SM 2QCEA 3FXYA 1PBKA 3AIBA 4PEEA 3KL5A 3ARPA 4W8AA 5I07A 4HNLA 2DZWA 2QHAA 2CFFA 2GDVA 2JKPA 3O6AA 2AAAA 2FFCA 1MEWA 1O66A 1R86A 3IRDA 1K7EA 1WE5A 3T7VA 3LPOA 4FZIA 2EJAA 1CXHA 4LF2A 4HNUA 2ZZ4A 5DBTA 4YTTA 1G94A 1KTBA 3N13A 4ZQCA 5HWMA 2XIBA 3ES7A 3SIMA 3DH7A 1UP3A 3STEA 1DWHM 3CL7A 3CUFA 1P5BA 1D7FA 3QLLA 3WD1A 1XC6A 2C3ZA 3SDOA 2DQWA 2IUZA 4L6OA 4DZ2A 3PANA 1HVQA 2AKMA 2L5HA 2WQDA 5GJMA 5C2XA 1BYCA 3MU7A 4W9PA 1PZ2A 1T99A 4K1GA 3ZVIA 5PTDA 1M7PA 3QZEA 4QLKA 2XUCA 5CKSA 3O9NA 4P2VA 1P43A 4JTRA 2B5UB 3QM3A 6REQA 1J5SA 2POTA 3B8UA 2GZXA 2QMJA 3VGEA 1FJDA 7ENLA 3CV6A 4LAWA 2AQOA 5XIMA 3HPZA 3GG7A 2BVDA 3RCNA 4GYFA 2HNEA 4O4VA 1HFBA 1V77A 2GQAA 2OX4A 3AMCA 3NZPA 1OGSA 2WJEA 4Y8FA 1Y5VA 3WH7A 1NDYA 3CPUA 1XINA 3QSTA 3PRBA 4U86A 4DYEA 4IMDA 1VAHA 4J3VA 3QHMA 3SIZA 5CBIA 4XISA 3O15A 3AS3A 1BYBA 3SGZA 1MNZA 2NXIA 3BMXA 4H04A 3NUKA 1SYTA 1J6PA 1KLYA 2QPSA 5BMXA 3CWNA 3GD6A 4GUHA 2EO7A 3NG3A 3NR0A 4W4QA 4RDVA 4NJGA 1KR0A 4O14A 1EIBA 3H24A 1L6SA 7CGTA 1E9YB 2MLXA 3UWYA 3XISA 3UVIA 4NRSA 3K1DA 3C2OA 2W92A 2O7QA 2VEPA 5EBUA 3MCNA 4JD4A 1NF0A 2C0HA 4UTJA 5FJIA 2JE8A 2PBOA 3FHAA 1HL2A 3VTRA 1RXOB 3VKBA 2HMCA 1CLKA 3W7GA 3RK8A 2NV2A 3V0TA 4S3KA 1B4KA 3QYQA 4YIWA 3L65A 4KCVA 5EPDA 4V1YA 3EKZA 4ODNA 1R47A 3VAVA 1BXCA 1QMLA 2HEJA 3T1GA 4HK7A 3U3HA 3W7QA 4DWSA 4E4UA 1ZY9A 2YYTA 4Q4MA 4KEZA 4PTMA 4IMEA 1RH9A 1UWUA 1H63A 2QR6A 4PSPA 2OWCA 4UB9A 4GRSA 1NOUA 4UFIA 1OSEA 3PS7A 2Y4SA 1YATA 1ECQA 5HMFA 2R1LA 4KERA 1B9BA 3EB3A 3VIHA 2R9RA 3T08A 3SUWA 5EGRA 1BFNA 3ZFHA 2QJJA 1UJQA 3IV3A 3VC5A 3RHGA 4US5A 3IJDA 1NQ6A 1LT8A 1W37A 3T78A 2PWFA 3C2EA 1JUKA 1RQBA 2A3LA 1M6JA 2VWTA 1XDJA 1Q6HA 2ALDA 4IUGA 2P8CA 4NT0A 1U83A 1OC6A 4MB5A 5D02A 4W8BA 2J13A 2YBVA 4MJ2A 4Y96A 3S5YA 5J5DA 4K1WA 1HTIA 1YDNA 4NX5A 1CGTA 3KW3A 5BYWA 3MSDA 3L2LA 1Y0OA 2ICSA 1WZMA 3I3EA 3GVVA 4XKMA 4HIBA 2HBVA 2OU4A 4LAYA 2QNEA 4AWUA 5G4WA 4J7RA 3Q37A 5A6MA 4CU6A 5HJYA 3SJ3A 2W79A 1D7IA 4MUZA 1RVKA 3KUMA 2GDQA 2NT1A 5B8IC 5H8UA 5AHIA 3LPGA 1LTDA 3C3NA 3UJSA 2VX6A 4N0RA 4X2PA 2X41A 4JN7A 3EWBX 1LUCB 4X0NA 4Y9AA 5HAOA 3M0VA 3O8AA 1OFOA 2F6UA 8TIMA 2PLMA 3UA3A 1CECA 2NV9A 3WQ5A 4HBOA 1I1WA 3WQ4A 4ADUA 5JMUA 1CPUA 5I3KA 3SEPA 1JYXA 3KS5A 4XK2A 2PP0A 4JHOA 3NI6A 4RDZA 3E74A 3H53A 1K4HA 3SR7A 4IIGA 4WDTA 2PI6A 2FZ9A 2XTKA 2PEVA 3G2GA 3BURA 1EP1A 3SFWA 3DHUA 3NQ6A 3THQA 3P3BA 4W7VA 5AHNA 4UC5A 1K1DA 1VEMA 4PMZA 4EK7A 4GOAA 3WEOA 3O5FA 2P3ZA 4K3ZA 3WDIA 4A05A 3D0CA 5HK4A 3W81A 4FSAA 4P7RA 1MW1A 2Z26A 4JL2A 4X0VA 1MUCA 2F2DA 3AMGA 4L3NA 3M0KA 1E3XA 2VTFA 1XLLA 2HCVA 1B9ZA 3UESA 2ONEA 3WQGA 1ML1A 4O50A 3U48A 4GISA 1WBJA 1C7TA 3MMUA 3WH5A 3P61A 1P48A 3SRKA 3EWDA 3DFTA 3TTOA 2O56A 2YA0A 4RL3A 1GUVA 2PV3A 3W6LA 3OLIA 1VCFA 4HVXA 4DBWA 1JI1A 3T6CA 4ZTYA 2R24A 1UYQA 2VP8A 2DSWA 3ONCA 2CW6A 2RDWA 4LCQA 4W86A 1FHDA 3OA3A 2JIWA 4PB3A 2DFAA 4GGBA 1TPWA 3PPCA 3O07A 1AW2A 4B91A 5A2CA 3QW4B 1D2KA 1ZHAA 1SO6A 1BG9A 3W71A 3N6JA 1N8IA 2PRHA 1HKKA 2FJUB 2CBIA 3TJIA 1P0NA 3G1FA 3ARQA 2A21A 1S5VA 1WDDA 2J75A 4UNKA 1KXTA 2XZ9A 4G9PA 1FWWA 1BWLA 4BI5A 3H2FA 4ASTA 5I6SA 2DORA 4GVHA 1W1B1 3WF4A 1GQLA 1VFHA 3KVLA 2WPGA 3GIYA 4FAMA 3WUEA 4YJ5A 1L6YA 2I14A 1NFGA 3BTNA 1JQVA 1OINA 2O9RA 2WWCA 2F9RA 4JTUA 4H9ZA 4E0CA 4HN8A 1ISVA 1KB3A 3QGAC 4PEKA 3M16A 3EDKA 1EF2A 2DV0A 3NL6A 1TIWA 3CQIA 2WWDA 4KW2A 2P50A 1TTPA 4AD1A 1L6WA 4KQNA 4YN5A 1EEPA 1CGWA 2BSLA 4J3ZA 3PUOA 3W7DA 6CGTA 3CYVA 2FVLA 5D2YA 1OFRA 1TG7A 2OR2A 1Q7MA 3R4IA 2GVEA 5DRCA 2QYGA 3Q45A 4U28A 1K3UA 4HCHA 3UG8A 4JPGA 3E49A 3HG3A 1I4NA 3V75A 3WDJA 2J9ZA 3PZUA 3B05A 4F0LA 4H6KA 1CXEA 4NAFB 2R1PA 5DT5A 3XINA 1DJHA 3S1UA 3RMJA 1DJGA 5E6YA 4DBDA 2RJHA 4ML9A 1KFKA 4MLJA 2EPHA 4B5UA 4GYKA 3W7IA 3ZMRA 1EJVC 3DG7A 3C52A 1E6RA 3CGMA 2J4GA 2E67A 6ALDA 3RLGA 3WH8A 3EY6A 1OZMA 1YDOA 1Z41A 2RHGA 4X60A 1LLZA 4UFLA 2FGLA 2ZQ0A 3BGGA 4HNTA 1CGUA 3UJFA 2CHRA 3AHXA 1H0GA 2OODA 2VZVA 3I4EA 4RE2A 1JZ8A 1VFSA 1KM2A 2X8RA 3N1AA 3TTQA 4XBJA 5CBJA 1TJPA 3LRKA 3W1RA 3WNNA 1DJQA 3QSRA 2XU2A 3M47A 4Q22A 2B7OA 4MHBA 4XZIA 4GABA 5I3IA 1UP2A 3SSZA 4ODRA 3TA9A 1JPIA 3GDLA 5ABHA 2V5LA 4K7YA 3A4XA 3VPLA 1OYCA 1F73A 2W4XA 3U7BA 2W6RA 2D73A 3WF0A 4DO5A 5DANA 1VPYA 3SECA 5H1WA 4BF8A 1XI3A 3WBEA 1CB7B 4HYWA 5MHBA 2XFYA 4MPKA 4XQ6A 4CNNA 5BCAA 2Q3OA 4PMVA 1U1UA 4N9CA 3W1TA 2WSQA 4LBSA 3P84A 3N2CA 3FNDA 1IWBA 5IXEA 2E5CA 3CL6A 1UZ4A 1KXVA 3VZZA 1KCLA 1UD6A 4ODOA 1LOQA 1THFD 3ZVHA 3I7SA 5ECUA 5I00A 3UZZA 3HJZA 1V02E 4F0MA 4AVOA 3AROA 2WM1A 5KETA 2E1WA 1G4EA 4F4RA 3TZNA 2H9AB 5DBUA 2XGIA 1JXJA 3VUSA 5XIAA 1TV3A 2CETA 4LV9A 1XYBA 5CC5A 3W7KA 3EKGA 4MJMA 4DRKA 2BGNE 4M1RA 1PX8A 2YBUA 2DY3A 1I2RA 3WJWA 4KWWA 4PE8A 2Y5SA 5BXJA 4EPDC 2PDKA 3GAYA 2XDFA 2QVHA 3GZ3A 4UR8A 1FXPA 2VZUA 1FWAC 3OZYA 1UUOA 2ZDSA 3WD2A 4PMJA 4HYRA 3MQTA 3PUDA 1NDVA 1LYXA 1R46A 4DRPA 1SZEA 3W07A 3TCZA 4LFYA 3IK2A 3E9AA 4PRTA 3GBEA 2GL5A 1KFBA 3VOHA 4GACA 1J0ZA 1HKJA 5CLTA 4ILSA 3FK4A 3QHOA 5AKQA 4GO8A 4YS1A 4MJ4A 3CLMA 3U0HA 1YPIA 3GTYX 4BCEA 4IMCA 3QC0A 2NX9A 4UNLA 5CG0A 3PZ9A 2NX1A 1EJWC 2G0WA 2TRSA 3G3MA 3EYPA 3M0ZA 2WVVB 1GT8A 2Y7GA 1M5YA 4GY1A 1Z32X 3NL3A 3KBSA 4IQCA 5JUVA 5LXEA 3QOMA 2HJPA 2BLEA 1BVZA 2YLAA 4XAGA 4L4PA 4E2VA 2EJ1A 3VKDA 4W84A 2VCAA 1X6LA 1ZBWA 1QAPA 1ME9A 4NQ1A 3OG3A 4PTNA 2MANA 2NQJA 4QDPA 2X2YA 2EHHA 1J4HA 4MWAA 3BE7A 3O6YX 1QPFA 4ALDA 4TV5A 4QSHA 9RUBA 2FHCA 2PDJA 2EPLX 2C79A 1VHCA 2GWNA 2CBUA 4H9TA 5I09A 1HZYA 1CXFA 3LUOA 4O10A 5HMEA 4JTFA 2F6XA 4GI4A 3W7NA 4S3DA 2X0YA 4JKMA 1EUNA 3UETA 3HPSA 3BANA 1ADDA 1CLVA 1ZP4A 3B0YA 1UHVA 1WDWA 3QR1A 4MDPA 2FIQA 4AXKA 2ACSA 1UWRA 1AZ2A 1R9XA 3CAKA 1GHSA 1VCVA 1NM9A 2EAWA 2NLYA 1K03A 2J62A 1FKJA 4UQBA 2IKHA 2L2SA 4TIMA 4CQDA 3V7PA 4Z2LA 1HO1A 3CGTA 1ZZMA 3BWWA 1XWYA 5A6TC 1C90A 4AZBA 4RJEA 1X39A 1OB0A 1UKTA 4QG9A 4KEUA 4CD5A 2CWNA 1E0VA 2E9LA 3H8AA 3BV7A 4NAFA 2BTMA 1TYGA 1KW1A 2ZZ3A 4Q8TA 2RDXA 1HF6A 4PMRA 3WELA 1TPUA 3RCMA 3B9DA 3O6CA 4IQEA 1ISYA 5EMUA 3AZRA 2OJPA 1KFCA 1TRDA 4JXCA 3ZR4A 1HJUA 4J3XA 3DCPA 4XSLA 1OABA 1PIGA 3UT0A 1XYLA 2UBPC 2VC7A 1O1ZA 2JK2A 3DC0A 4ZQRA 1W9VA 4EXBA 2RUCA 3N2TA 4QQUA 5LIWX 3C86A 2CKRA 2H8ZA 2P10A 1RPKA 3H6OA 3R10A 4HMNA 4JIQA 2MUCA 3JRKA 1JVWA 2G5WA 3HF3A 3A22A 1WAWA 1O5QA 3LHZA 3UXAA 1KXHA 4GXWA 1F6YA 4C1LA 3TYAA 4N2YA 1P5QA 5I77A 1V93A 3PNUA 3IPWA 1HL9A 4G50A 1EC9A 4O13A 3S9IA 2TMDA 4HHPA 3KRZA 1YE6A 3TYEA 1QW7A 2OQHA 1M04A 2DZSA 1L8NA 3W2LA 3TAOA 2VDHA 4M6VA 4NXKA 2BHYA 4IZGA 2A7NA 2OPJA 5D75A 5A8PA 2DPEA 1PSCA 4H7VA 4DYJA 3VZXA 4GJJA 1TJ2A 4IGMA 4M82A 3L2MA 2RFGA 1ZBVA 1NOWA 2HSAA 4DRHA 3RILA 4E4FA 4RE0A 4NZ5A 3CJPA 5DRIA 4LS1A 3N12A 1YX1A 3KZ7A 5LNSA 2VEMA 3WG6A 3VFLA 1KO0A 3V16A 2GVGA 4GBUA 4NNBA 4HP5A 4Z1YA 4AIEA 1QOQA 2VN1A 1YBQB 4Z1AA 5JH1A 4LSBA 1TX2A 1R3WA 3OO2A 3VD3A 2OFNA 1QNPA 3GPKA 1RP9A 4P7OA 3GR7A 4CUCA 1GOXA 1ZP3A 4UMBA 1NQKA 4PUWA 1FAPA 3UWWA 2I17A 2VRQA 3KHDA 4IIBA 1OCJA 4LCSA 1Q6FA 3SURA 1V0LA 1W5NA 3PY2A 4L5ZA 3QTGA 3D5HA 5JBDA 3L4YA 3L0KA 1R2TA 1JDCA 3VOFA 1PAMA 1XLFA 1MZRA 2AOSA 1WXZA 5DCDA 1KXQA 4LYRA 4XVEA 2VEIA 4U31A 3M5VA 3KACA 1AL7A 1ECEA 2J8GA 3L7RA 3DFQA 4RXGA 1SFLA 2HRWA 1TO3A 1VBHA 2P5NA 5DFAA 4I5XA 4NI8A 1V4YA 5A1AA 5IBXA 3BAKA 4HPGA 2WVSA 3HURA 1XBXA 1V0KA 2VQUA 2YPIA 1V6TA 4OKDA 1L6GA 4ZPWR 4JFMA 3T0AA 4WSHA 2WMGA 3GDRA 3R12A 4PB5A 4JFWA 2PODA 4IMAA 4DLFA 1PCWA 5DY2A 3GTFA 3MPGA 3G1HA 1V6WA 1O95A 1US0A 4Q4SA 4N02A 1KM0A 4FR6A 4TX0A 4H2CA 3C0JA 4DF1A 1Y65A 1XDMA 4FLOA 1AJ0A 4G2DA 3TYDA 3EGJA 3PB0A 4JYFA 5CH9A 2XSAA 3TC6A 1VLWA 1W1IE 4XWUA 4HBEA 3PTQA 3CL8A 3EWYA 1H7WA 2RUSA 2EF9A 1NEYA 3ZJ8A 3JZUA 3QOKA 4K36A 1B3OA 2CLEA 3H4GA 1WDPA 5M1TA 3UEQA 3W9ZA 4FXFA 3QZ6A 4O0QA 3HO8A 4H1ZA 3UJ2A 4LT9A 3S6OA 1ZS2A 5FSEC 4GQGA 2KE0A 5B7ZA 1VYRA 3SCSA 2CLMA 3HBLA 1LF1A 1ZUAX 1LG2A 1ODZA 4F40A 1SQ7A 3W1XA 1W0MA 2H6RA 3OB8A 1QHZA 3EX2A 4C65A 3MANA 2VXNA 3ODKA 1Q6OA 3B40A 3TMQA 4ZE5A 4ERIA 3SAZA 4HQVA 1OF8A 1EJXC 4RZ4A 4QG6A 3QV8A 4RCXA 1U5VA 2WZTA 4HD5A 3IUIA 4V28A 3MHFA 2ZZ2A 3UNDA 5HNTA 4GHRA 4S1FA 1EXPA 3T2OA 4UDMA 3NQ2A 4GO9A 4W93A 2WC7A 3CTTA 4HOXA 3RIKA 1DJYA 1PO9A 4PGLA 4KCWA 1EZWA 2BY3A 1QZ2A 2VCDA 1FCBA 4JYSA 2OYMA 4CN6A 4HK5A 4L9YA 1PE1A 3NM3A 3VVGA 4LC8A 1I0DA 5IM51 2A3EA 1HKVA 2WW5A 3MI6A 1LL6A 4DUVA 4ZA0A 1FA2A 4HA0A 3RG6A 4WY0A 4J1OA 1JVNA 2DZXA 4QAIA 3QHNA 3TW7A 3TC5A 4GZJA 1YHTA 3BW4A 4P61A 1HKMA 3GC2A 3IARA 2QVNA 4JDBA 4LW7A 1O60A 4Z1BA 1FKFA 1JYWA 5HA7A 3EWXA 1RV8A 2CHNA 3JZEA 2DEPA 4Y9OA 5IFPA 4Q8PA 3TLLA 4H2HA 2HNHA 4X22A 2INFA 1YDYA 1HT6A 4A21A 2BASA 4LY8A 3W53A 4C6CA 4N7QA 5EMYA 3LHVA 4DROA 3PNZA 2VMFA 1QI2A 3AAMA 1BRLB 3D3FA 3VMNA 4QGCA 2OB3A 1SW7A 4NUWA 2ESCA 2A6NA 3WQOA 3OVRA 5EMJA 3NVTA 2G97A 4ACYA 3WH0A 2ZDRA 1XLJA 3M1ZA 3ARYA 3JYMA 3WLPA 4OBTA 1QR7A 1OT2A 2VL4A 3TXZA 1VQTA 1XM3A 3MB9A 3NQMA 4NI3A 1KCKA 1CDGA 1Q6IA 3M46A 3N34A 3H55A 3GDMA 1S2TA 4R53A 3W7OA 4L1XA 3DC8A 1EUAA 3LERA 1FWDC 1RVGA 2DP3A 1RJPA 2X0SA 5KZDA 4ODMA 4JZ5A 1VRXA 4A8NA 4JFJA 3WFAA 2OELA 1TPVA 3LUTA 4PCPA 4U10A 2C1IA 4DF2A 4PUUA 5M17A 3BLOA 1W6TA 4MKNA 1HKWA 1K02A 3KADA 2ZX5A 3S47A 2O7SA 1HXVA 1YBQA 2GJNA 4I8YA 4LNYA 3SRHA 1LOSA 3APTA 1Q1CA 3S2LA 3LXCA 2Z24A 1Q8AA 2VFFA 1EJRC 3LMYA 3HN3A 4C6QA 5D9PA 2LPVA 2D69A 2OZ0A 2ZADA 4L9XA 1AQ0A 4M81A 3CUHA 3PR2A 3NAVA 1XRVA 4HNOA 5IOBA 4O54A 1DXFA 3BL3A 4BZYA 2CYGA 1Z7AA 1XYAA 2Y8VA 3AC0A 2AGKA 3W02A 4GKTA 1TV4A 2FTWA 3GDTA 4ZGYA 3KCLA 4JFUA 1PL9A 3L4XA 1SW3A 5LA1A 4RDWA 4LB3A 1E5NA 3UF8A 3A24A 3VNKA 3GU2A 3GE7A 5CGTA 2OLAA 4DH0A 5JU6A 4Q3MA 1TUXA 4LC6A 4XTDA 1PS9A 3WDQA 3CIVA 1OGGA 1ONWA 3LPPA 2WPBA 1IYXA 1O4UA 1J6OA 2G4FA 1QU4A 1RSCA 3S8HA 3ECQA 4PMYA 3I68A 4NAEB 4IPLA 4OVXA 3T9PA 1DOSA 3W00A 4QIUA 3C61A 3UI6A 3DDMA 1GJUA 3UU0A 5F2LA 2G3MA 2HTMA 2R82A 3U2OA 1U22A 2NQZA 3N3MA 3PBVA 2PTZA 1HP4A 1AJZA 3KAOA 2Y6ZA 5CC6A 1FKIA 3IUHA 1ME8A 3DFNA 3SCPA 1SFJA 2P53A 1V0NA 3G1XA 2J9XA 2OYLA 8A3HA 1VPQA 1W9DM 3N4FA 1EDTA 4L1GA 5EB8A 1FRBA 4AB4A 5AFDA 2A1YA 3TJ4A 4Y9MA 3FEMA 3GTNA 1LWHA 1XHGA 3GXFA 4WDUA 3P8IA 5DCBA 2ZTJA 3VOGA 1YPFA 2DGAA 5AECA 4Y9NA 4Z2HA 2XH7A 3S5NA 3R0UA 4B2DA 1D3HA 4K6AA 3O5KA 1AQHA 1Q6UA 2XP7A 2BOEX 3TN4A 3TH6A 3O5QA 2PTYA 2W27A 1OG0A 2P4VA 5H2ZA 4CGTA 1BGGA 4Q8UA 4AMAA 3N2OA 1F05A 4U4MA 3MUAA 5C71A 4IUOA 4G8TA 1M41A 4E2DA 3GR4A 4Z2KA 4JTIA 2VZOA 3MY9A 4LVBA 4IQJA 2JALA 5E0CA 4DJED 2ZRWA 2R1NA 3U8GA 1BL4A 3BC9A 3B0UX 3PFRA 2H90A 1XIIA 2YL9A 1UA3A 1VGAA 3OA5A 1UROA 1OX6A 4GFIA 1WX0A 4H9UA 4EXQA 2BODX 4GG9A 4UFKA 3TCSA 1M1BA 3W85A 3B8SA 1OFQA 1UWQA 1JYVA 1JCYA 5DX7A 1V3HA 1W8SA 5JXQA 1EPXA 2FHBA 3J7HA 3OQ8A 4D72A 1KM5A 1E1CB 4ZL1A 2G3IA 4REQB 3KTSA 2ZE0A 4CQAA 3KOZA 2ZXDA 1N8WA 2J7BA 1JFHA 2YCJA 4J3WA 4NNAA 5A8GA 4GIAA 2YDAA 2CERA 1SMDA 2VKZG 3DERA 2ACUA 4K2SA 3T8QA 3MWCA 3PHAA 4BQ4A 1XFCA 3PSVA 4EX4A 1AL8A 2ZZ7A 1D3GA 5CJMA 1DHKA 4FIRA 2RSEA 1W5QA 1EJSC 2RGLA 2J7GA 1F40A 3VDGA 3P67A 5K4XA 2V67A 3OBAA 2YXGA 3FOKA 4DI9A 3BW3A 3P6LA 4LAUA 4HPJA 3WFZA 4CEXC 4KFOA 1Q6LA 1JZ5A 2XPBA 1XLMA 3S4TA 2PGFA 3KDOA 1F5ZA 3DESA 3NZRA 2VDGA 1ADOA 3K1GA 3CM4A 3FSUA 1B2YA 1C9WA 1X7FA 3R8RA 1EZ2A 2OEKA 2ZUWA 2X1IA 1JNEA 2HVNA 1IE7C 3DFPA 5JQ9A 1UKPA 3C4UA 3UR2A 4ZENA 2OQYA 3SQMA 1UUQA 3EOLA 3UJRA 4ATWA 1E6QM 4QP0A 4MG4A 5M03A 2GLKA 4GUIA 2P0OA 1OM0A 1V08A 2JBMA 2ZTKA 4B90A 1KFJA 4GIYA 3CH9A 1QFEA 3LHTA 1BRLA 4ZO7A 3FA4A 4LVGA 2WMKA 3QR0A 2PDCA 3JVAA 4GYPC 2XP8A 1M65A 2GVYA 4KFPA 1XLEA 5CPSA 3W1QA 1X96A 1FWSA 4O8RA 1U5JA 2F7FA 1LLOA 4JFKA 2YB4A 2WMJA 3LX9A 3FAPA 4C90A 2Y7FA 3TWAA 3EOSA 1VBUA 1NMVA 3ORWA 3O5DA 1DTNA 1MDRA 4GJ1A 5G4EA 5FF4A 2OOFA 5AC4A 3BCDA 4L4LA 4N6EA 4XZBA 2GGJA 2ZX6A 1KT1A 2BOGX 4LEFA 4H6RA 4XVDA 5DXXA 1EYMA 4KWSA 5CCZA 1J4EA 2X16A 1X8CA 2YYUA 3C2FA 2J78A 3GUGA 1W54A 1PV8A 2BMBA 2FPTA 2UZ9A 4EPBC 3CEUA 4JBRA 4DN1A 4K8EA 3A6OA 4IGSA 4Z1DA 1OFAA 4AYSA 3EPNA 1GORA 4EACA 4GMEA 1MWOA 3KABA 3R58A 4HU4A 3S9YA 1EP3A 3P62A 4ZB5A 4JHMA 1W31A 3QBUA 3PC0A 4GBDA 3F03K 5SWUA 5LIYX 3RU8X 5KSWA 2DG4A 3EPMA 1KCZA 3M0LA 4IF2A 5RUBA 3KVMA 2JGQA 4GZ7A 5G2HA 3BVJA 2EQDA 1D8WA 1RBAA 4XZ9A 3E0WA 4DIAA 4DUWA 3G1RA 3KXQA 1VBGA 4GGQA 4MTVA 2DVTA 5KITA 3IJ8A 3L9CA 1IR1A 1KNWA 4BF5A 3KVJA 2UWFA 4JDYA 3URQA 1K8CA 6A3HA 1QPQA 5K9XA 4DM2A 1G5AA 1RPXA 1N55A 1KD0A 3ABQA 2WZHA 2IS7A 2WMFA 4FI4A 4NVTA 1HJXA 3CMFA 2XP4A 3VNMA 3RAOA 2QUMA 1E4IA 2XSBA 4X9SA 3C5QA 4MZ1A 5D05A 3SY8A 3E0FA 3HOJA 1E1EA 3K4DA 5JVLA 1XSKA 1RBOB 3BQ6A 1P0KA 4O18A 4QSFA 4WKFA 3W88A 1W9UA 2WYSA 4IMFA 3G8EA 5CPTA 1A5BA 1LWIA 3NYZA 4U5IA 1AZ1A 5HATA 3P81A 4I7UA 3W26A 3ARSA 4R27A 1GZ1A 3SQSA 4J40A 4DJFD 2VDIA 2NSXA 5J6EA 1B3WA 1TWZA 4QIBA 2XJ7A 4ES4A 5DT7A 1GYNA 2C18A 3OOQA 3SO7A 4P7NA 2Z2BA 3HFTA 4L56A 3U5YA 4DRNA 1R30A 1CZ1A 3E02A 1RA5A 4MM1A 2G3FA 3NXFA 1ESWA 8XIAA 3K8KA 1T7LA 1GOKA 4LXFA 3WD3A 4C02B 2Z7GA 4UQDA 5BRQA 1ZPTA 1TX0A 2XIMA 5EMKA 3R8GA 2R1MA 1DE5A 3EXSA 4A2RA 5GJNA 4QFUA 1F3EA 1Z69A 1MQPA 5C8BB 4RZ5A 5EY5A 2V2HA 3MTWA 1IWAA 1BQGA 3SADA 1QNQA 2Z6IA 3NIYA 5FL0A 3OOBA 2C0AA 1XIEA 5KTLA 2Y85A 1LP6A 1CGYA 2VFEA 5D03A 4FB7A 2UY5A 4GIEA 1SM9A 5LNUA 3IACA 3OBEA 2ACRA 3K4WA 1YIXA 4NF7A 1PXGA 2NQLA 3DHFA 4YVPA 2KFWA 3CB8A 3VIPA 2IKJA 4JAWA 4HSNA 4PMQA 3CUIA 4IOTA 1ZNNA 4A3RA 4I9JA 4FF5A 2PDGA 4NILA 4U5KA 2F84A 4F48A 3QR3A 3N11A 3N15A 1V3KA 1V3IA 1NP0A 5D9NA 3DU0A 2AQVA 3NDYA 3DFOA 7PTDA 3WQDA 3NQVA 2JEPA 4LAXA 2ZUTA 2XYLA 4ZSUA 7ODCA 1K7XA 2Y89A 3U5UA 4LCRA 3RNDA 3MCOA 4U33A 2DT2A 1C92A 3TQPA 1REQA 1XJBA 4AISA 5AYBA 2NUYA 3W83A 1XYCA 1A4LA 3H7UA 1EC8A 1E0XA 4X2RA 3TQVA 1I2NA 3M5YA 2J9YA 2TAAA 3TYZA 3AUOA 4JY8A 4FN2A 2X7VA 3AZTA 1RJQA 4IXXA 2OCZA 1E6ZA 4S2BA 1MDLA 3AWOA 3RN6A 1OD0A 5G5IA 4QLJA 1U30A 1IGWA 3VDAA 2IMRA 4NU7A 1W1A1 5E09A 2C1GA 4YMZA 1XD1A 4QNEA 2YDRA 1FDYA 4QJ4B 4J3UA 1KBKA 3NYDA 2WHJA 3K13A 4QLLA 2CLFA 3GHSA 4XAYA 1WOBA 5HR6A 6TIMA 4DI8A 4EANA 4QJ1A 4D8LA 3C3UA 1Q7ZA 4OBRA 4WIWA 1QWGA 2X42A 4MF4A 4E6MA 3GX9A 1EX5A 3GH7A 3MI3A 1MQQA 1GVRA 2NZLA 3LG3A 4HKPA 1OG6A 4WF7A 1TKKA 4TX9A 4JNZA 1XISA 4JIEA 1E43A 2WBKA 1JD7A 4Z0SA 2XN2A 3IJLA 4DO4A 4LRTA 2PURA 1R3VA 2CNCA 1IZJA 1VBRA 4CNOA 4GZEA 4OOUA 4PFMA 3M0MA 3L2IA 3ZSSA 5JIPA 2YIHA 1T5AA 3IJ6A 4D9PA 3V18A 4LUIA 5IHRA 4UOQA 3LD5A 3LENA 3CPGA 5A8OA 1CLXA 1FCUA 1YNQA 1B31A 2ISSA 3MS8A 4W9QA 3BJFA 2UY2A 1EJ7L 4S3GA 3UI5A 4Q8WA 2J77A 1N7KA 3G22A 2YDQA 1NIUA 4PMXA 3AU2A 2HK1A 3CUJA 4ICNA 3UGRA 4DJDC 3HZ3A 5E0FA 2IXUA 1TWIA 1Q6CA 4BWLC 4MNJA 1M68A 3LEPA 4C1KA 1GPFA 4D6DA 3ENLA 5HJXA 3UWZA 1E3ZA 3UXLA 2FJKA 3TTEA 2YB1A 4JHZA 1B6CA 3OQEA 5M5DA 2K8IA 3DYOA 3MO7A 4AHOA 3VM5A 5D9OA 5LGXA 4RNFA 1KBJA 3DAQA 4DJEC 4E5TA 4FOJA 4G7FA 3OLDA 3W37A 4XIAA 2PA6A 2XWDA 1NSGA 3CZLA 3EB4A 4G5DA 2IPJA 1WBHA 2KO7A 1Z89A 1TQJA 2MLZA 3GXDA 1D7KA 3O5LA 1UIPA 3DHDA 5M2FX 2OFJA 2Z1SA 2FZ8A 4LJ3A 1FUYA 1RQEA 1R3YA 3DECA 1GYLA 4G6CA 4B16A 3GU1A 3W1UA 1SO4A 4GI9A 2Y78A 2H8XA 3HPAA 3ABOA 4O16A 2XGBA 3WY1A 4DWSD 1IR2A 2ZWZA 3P60A 2GJXB 3USZA 2PDXA 4S3FA 4LB4A 4AZ6A 1UZHA 4RV3A 2G3JA 1AD1A 3R94A 1LDCA 3RPTA 3LMZA 4GVGA 2ATSA 5A6JA 1UR2A 3HGOA 3S1WA 4BEUA 1H60A 3BICA 1IT8A 3ARUA 3AICA 1HNYA 4QG8A 4FK9A 1IGSA 3F7JA 1JD9A 3KRBA 2FZNA 2WJFA 5FF0A 1X1NA 1KFLA 4F2TA 4JIHA 1PZ1A 4WZHA 1GW1A 3VM7A 1N2VA 4OQVA 4US5D 4CQ9A 1R2RA 4LAOA 1GKRA 4C6OA 4BFAA 3BG3A 3EZ4A 3RX3A 3LNMA 4GNVA 5D2VA 3RJYA 3PF3A 4IIDA 1WP6A 2OGJA 4GCXA 3TWBA 1ISZA 5MKGA 3LLXA 1YXDA 2EG6A 3WKZA 3EA1A 4Y2WA 5CSYA 1CENA 1DIEA 2VRKA 2QGYA 3O2LA 3QGVA 4PUNA 3OVQA 3DIPA 2ADAA 3LN3A 4QS6A 2IXVA 3W38A 4F79A 1GKPA 4TOQA 4B5NA 4AZCB 2V81A 2VVNA 3UR7A 4C6LA 6TAAA 2BY2A 5DQPA 1DBTA 5I98A 9XIAA 5D38A 3L23A 3WO8A 3I6TA 4J2MA 4UMAA 1K77A 1XBZA 2Y7EA 2I1OA 2RDTA 5HUOA 3CO8A 4M29A 3IVTA 2GGEA 3SN1A 3M0HA 4PSRA 3TE9A 1TV2A 3GNRA 1E5JA 1S39A 4XAFA 4W5ZA 3N04A 1ZTVA 1MVYA 1C9DA 3C6CA 3V35A 3TYCA 1P0DA 4FF7A 4MY9A 1X97A 4PRWA 3QQWA 1H50A 2WSRA 1Q6GA 2PDHA 1DWFM 3LM3A 3JUGA 3BJTA 2A3BA 4LUTB 4IISA 2VCCA 1EF3A 2C13A 4C6MA 9CGTA 3CPRA 4RNIA 3WEMA 4ADTA 1W1TA 3I65A 4P7QA 1FKSA 4GH1A 4H9MA 2BGQA 3O5JA 4HOWA 1DXIA 1O12A 1ZBKA 3B0XA 2PTXA 3MCMA 3WBAA 4AEEA 4YXGA 3S2MA 6XIAA 3W1PA 2WKGA 3GK0A 1Z44A 3NSMA 2O4QA 2FKPA 3KX6A 3P8JA 2NX3A 1BWKA 1PHQA 1GOWA 3QTPA 3NFUA 1DIKA 1W3NA 5AC5A 4AUBA 1YXYA 1I60A 1OGBA 1US2A 1K8XA 3M6DA 1DYSA 4Z0JA 4NJJA 1PCKA 2ZC1A 3CASA 3M41A 4HGXA 3VDHA 4DNMA 1GWJA 1UWTA 4ZMGA 3Q4DA 3SB0A 3DG6A 4FPSA 3ZQ9A 4JTTA 1EWDA 2RDUA 2UV8G 3NZ1A 1F2JA 2OZ8A 4FP1A 1GG1A 2G37A 4IHCA 1WKYA 1FWRA 1H7NA 3RM4A 5C9UA 1GVYA 4I90A 4GLEA 1TREA 5G4HC 2WK2A 4Q4PA 2NW0A 4IICA 2OEMA 3RJXA 4WSKA 1BPLB 1V79A 1H51A 5D32A 4D1JA 4R3UA 4JTJA 2ZR4A 3VNYA 2O9PA 1T8XA 1JPKA 5A6KA 1ONXA 2C8NA 3DGRA 3GLCA 3L68A 1X6NA 3IV8A 4DUOA 4IGNA 2QDEA 4N42A 1WCGA 2CPUA 4I9TA 1CYGA 3R5EA 4AWTA 3G18A 3IGUA 3ZT7A 4P8XA 3R11A 5FAJA 1TV7A 1KTCA 1OQFA 1FHLA 3M4HA 3N9RA 3DYMA 1SZFA 1HXJA 1S3HA 4OUIA 5CGQA 4LALA 3E0VA 1V6YA 1K9FA 4H8UA 4ZZ9A 1FDZA 3QPEA 2HROA 4MNKA 1R3SA 4YTRA 3NQCA 3MHUA 3P0WA 4LPCA 1J93A 1JAKA 2INZA 2O9TA 3TJLA 1ONEA 1E55A 3W7LA 1P4CA 4IJRA 2VEFA 4TU1A 5HDRA 3UF9A 2J7HA 4PUEA 3VKJA 1TJ0A 4I7WA 2QV5A 1FDJA 4CNSA 4W8LA 4GPNA 3UR5A 2VR4A 2B4GA 1FTXA 3IKGA 1BYAA 3APGA 3QQ0A 5DIUA 4MJZA 3UCDA 1ZLPA 1UCWA 2Z28A 5CPLA 2Y2WA 1PDZA 3CIWA 4J3TA 5C2CA 2E3ZA 5I03A 1UA7A 3PBYA 2QDDA 3E96A 3WLKX 3LSBA 3MO4A 3KBVA 4O15A 1ISXA 3I6RA 1F3XA 4ZODA 5HULA 3TN6A 3PUEA 4JEQA 3P82A 3BUVA 1VFLA 1KM3A 1L0PA 2V5BA 3MUCA 1TIMA 4MZYA 5CPOA 5C9WA 1JL8A 2X1UA 3P74A 4HMDA 2VC5A 2GUUA 3OVGA 2VM8A 4O53A 3TNOA 1K6AA 3FKKA 5C2GA 1UZDA 4Q7BA 4TW8A 4CCDA 2OTDA 5ABFB 5FEZA 3T44A 1EOMA 1EO5A 5DLCA 4HYVA 1XIFA 4MB3A 5HOSA 1ZCOA 1NF7A 2OOGA 4F2UA 4FALA 2DZAA 1KGUA 1YTEA 3OHMB 4JFVA 4I9AA 4ZXOA 1UG6A 5HMSA 4DPPA 4F0KA 3NGFA 2QUVA 4NHVA 5AC8A 4S39A 4F8XA 1W9BM 1I0BA 1QWKA 3R2GA 1C91A 1RD5A 1Q63A 3UZXA 4YLWA 5CPQA 2DSUA 3NWRA 2NWRA 1MRQA 2Y7DA 3BH4A 1VIZA 1GOMA 5FIPA 4KRUA 5CXPA 4UQAA 3FCPA 2W3ZA 3CLWA 2ZX8A 2X1SA 4GZIA 3EWUA 1G9HA 1KGWA 2BVWA 5TD4A 1KKOA 3N4EA 5GNYA 2E5DA 1QNOA 3AMLA 2VD9A 4ZO8A 4J9JA 4J5NA 1A0DA 2QCHA 4UQEA 3T4CA 2YL6A 4KH2A 4W88A 1S2WA 2WKJA 2PP1A 2Z1WA 4WR3A 3CUZA 1IX5A 1BXNA 2YA2A 3AMKA 3RRXA 3OG2A 1CCWB 2XH4A 5HTGA 4RK8A 4JS3A 1BVWA 1A5CA 1P6WA 1QI3A 1YQ2A 3L0GA 4ZQOA 4MB4A 3NM1A 1ZCNA 2QXWA 1C7SA 4XBKA 2FGZA 2TPSA 3GYEA 4MMWA 3PB2A 1KC7A 4QISA 4GUGA 4UR7A 2QCGA 2XFWA 2M08A 3FS2A 2PLCA 4M0XA 3VNIA 4XO6A 1WNOA 2GGIA 4WK9A 3BCFA 3QPZA 1XRSA 1KKRA 3S3GA 5KZ6A 5DITA 5I7GA 5J5RA 4D6FA 1FP8A 5A2BA 5AYIA 4HOZA 2GQ8A 1SR9A 3LHWA 4DAIA 5LHFA 2QCLA 3TW6A 3WMBA 4DJFA 3AYVA 4DWSB 1ITUA 2POZA 3OW1A 4PBEA 1SU5A 4JN8A 2YCLA 4M5PA 2Z2AA 5KZEA 4MSPA 5HW6A 4AMCA 1XXXA 4A3HA 3N29A 1XLDA 5JH8A 3OVPA 3PBMA 2QJGA 1RA0A 1K7FA 3G1YA 5HQMA 3SQLA 1Y8BA 1X8FA 3UXKA 2O92A 4FNSA 3MC5A 3PULA 3QKEA 1QW8A 1S2UA 1V0MA 4O2TA 5DN1A 3KWSA 1AW5A 3GTHA 1OWQA 1WOAA 3ZJKA 2G4JA 2Y8UA 1WXJA 5LA2A 1KWKA 3BOXA 3SJNA 1JDFA 2W5FA 4RE3A 3VMPA 4KT2A 2ITKA 2V30A 1D7JA 1V03A 3VFCA 1WUFA 4JY9A 2GUBA 4LQ1A 1MEIA 3HTWA 3LM7A 3PRDA 4M6PA 1KM1A 3AYRA 1UD3A 2W9MA 1M5WA 4UCGA 4DZIA 1EL3A 2AMXA 3VMOA 3PSWA 4KIRA 7TIMA 5BMWA 3ZOAA 2F2KA 1BTCA 4WGHA 3RLUA 1SJDA 3U2CA 2RJGA 4R7JA 3PZNA 1RK5A 1XS2A 1PTGA 2Z6JA 3H2NA 1E4MM 4MWAD 2VNCA 1Y7VA 1OADA 4MNMA 4PYSA 1DQXA 2VC6A 4C6PA 4CD4A 1ZFJA 3FLUA 3HG4A 3UPBA 4RZBA 4MY8A 3ARVA 1OYBA 1PTDA 2D0GA 3STFA 5DF0A 2CKSA 2CXEA 4OV9A 3W75A 4CVWA 4DZ5A 1SR0A 1CB2A 2EG7A 2ZR5A 1ME7A 2QEZA 2FTPA 4A8LA 3GU9A 4C6IA 4JYDA 4Y90A 4E8DA 3VD7A 2PPOA 5EU9A 1DKWA 3CQKA 2Q3RA 4UWMA 3IIZA 4X61A 1RAKA 2VHLA 3N2BA 1XF0A 5F1UA 2Y1HA 2VEKA 4O11A 3WLTA 3RF9A 3E5BA 4M80A 3L4TA 5HW7A 3WJZA 4JOMA 4HU8A 3GXIA 1JNSA 3E2RA 3SCNA 4HSHA 2ZYFA 4B5VA 3LGGA 4BHYA 3UY7A 1XIHA 3KWXA 2E8ZA 1UWSA 3FEQA 1BSIA 3QJAA 1RUSA 3O05A 3II1A 1JZ6A 4Y8EA 1TPC1 1FWCC 1F74A 4MFEA 1TWSA 5BNKA 2I5GA 4Q4RA 2PV2A 4QITA 3UZJA 5FJPA 9XIMA 3N9SA 1TMLA 3NQGA 1B90A 3BSGA 1XQLA 3B97A 2ZZ5A 2Y8KA 2PWHA 1PPIA 4EF9A 3R7MA 2HS6A 1H7PA 4JTEA 4HA1A 1NU5A 2PTWA 5ABFA 5LA0A 5CSSA 3WK3A 1GOOA 3JXVA 4HPHA 5K4ZA 4QNWA 3PM6A 5HNUA 2OMAA 3AWNA 3GZAA 3A4WA 1ZB5A 2C1HA 3IANA 4EP8C 2DVUA 3WBXA 4LYQA 4E3TA 2ISDA 5FESA 2WCGA 3PTDA 3AHYA 1GJWA 2DIKA 4LX4A 3KCJA</