1HKJA

Crystal structure of human chitinase in complex with methylallosamidin
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
365
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHITOTRIOSIDASE
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
total genus 123
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkjA01
3CPUA 4CCDA 2FGLA 5A8PA 2VR5A 2Y8KA 4IM4A 4D6GA 4P7OA 4D6JA 1F4HA 1ZS2A 3UR7A 5A6SA 2G3NA 1K9DA 4NSBA 1UKSA 2BVDA 3GXIA 5A2CA 4PMZA 6TAAA 2V5DA 5JBDA 1BTCA 2JEPA 3VX0A 2CXGA 1UQZA 3AYSA 4PMVA 2OYKA 1JDCA 1BF2A 1EDTA 2GFTA 3PZOA 3ARVA 1US2A 2WKGA 3J7HA 3AHXA 1PBGA 3U7BA 1H2JA 3VIGA 1CGWA 2ZX9A 3MV11 3ZR5A 3AXHA 1MVYA 4DM2A 3BAJA 1GHSA 3VGBA 1W32A 5DEZA 3VDAA 3U7VA 1HVQA 3CZLA 3RJYA 1EHNA 4MJ4A 3O6AA 2ZXQA 1CPUA 1C8YA 3ZT5A 1ISZA 4HPHA 1GNXA 2XFFA 3RIKA 5HXMA 1NOFA 3NDYA 1B9ZA 3FAXA 4RE2A 2E8YA 1VEMA 3OLDA 3ZJKA 4PSPA 3AOFA 1VAHA 1UKTA 1LLOA 2CNCA 2JEQA 2WYSA 4HMCA 3VOCA 1MW3A 2VRQA 2ZWYA 3CUJA 3BGAA 4C7GA 1UH4A 2CYGA 4UQAA 3KL0A 3GNRA 3AQUA 4P8VA 1V6UA 5D9OA 4GKLA 5IDIA 1UG6A 1UR8A 5A8MA 3AIUA 5FD0A 1M03A 4OIFA 1CTNA 1NP2A 3VIHA 3AHZA 4XZWA 3WD3A 3T09A 4K68A 5EFFA 1V6WA 2A3AA 1H1NA 4B3LA 1JZ5A 4Z2LA 1KXTA 1R7OA 1CGUA 1A3HA 4MDOA 1HX0A 2O9TA 4WIWA 2PB1A 3EMCA 3SCNA 3L4WA 2OSXA 1PX3A 2V3DA 3OLGA 1MW2A 1WO2A 2QF8A 1CNVA 1GW1A 4AYSA 4J3UA 1JD9A 4PMXA 1G9HA 1WZAA 2J8FA 1VBRA 4EANA 4D6CA 3AI0A 4XUYA 1HP5A 2A3BA 3AIBA 5DT5A 4AZCA 1ODZA 2CCRA 3SCVA 1X6NA 4WJXA 1V3LA 2E40A 1MW1A 2WMGA 5CZKA 1JNDA 5ABHA 3HMCA 4BA0A 1E6NA 1JD7A 3CZ8A 2O9RA 1VEOA 5IFPA 3ARQA 2PWDA 3W29A 1IV8A 4AD4A 1KXQA 5KEZA 3L2LA 4LX4A 4U5KA 1PJ9A 4Y7EA 3WUEA 3G6MA 4CU8A 3VD4A 1NM9A 3WH5A 2YL6A 1QHOA 4MNMA 1QBBA 5CXPA 2XFRA 2XPKA 1OGGA 1GUVA 3W6MA 2B31A 3ZSSA 1EOMA 2J77A 5CPSA 3WH8A 2MANA 1NARA 3VGGA 2WMFA 3N04A 3FNDA 4ZE4A 4UZUA 3UESA 3WH9A 3TP4A 3GM8A 2D0FA 3GXDA 1PX4A 1HKJA 3KZSA 4D6FA 1XC6A 4AIOA 3VIKA 5I77A 1JXKA 4QLLA 2CEQA 2YJQA 3K8LA 4CCEA 3EDEA 2OWWA 3OGVA 1FFRA 3MMDA 1ZU8A 3MV01 1U33A 3PTMA 5FKYA 2ZX6A 3WNOA 3PZMA 4H7VA 1WZLA 1TFVA 2WLZA 2DSUA 3T0DA 2X8RA 2YOCA 3MSGA 1C92A 3DYOA 3RM9A 1W3KA 1E4NA 4V2XA 1JYWA 3W28A 1VJSA 3AHVA 5A6KA 4OJYA 3RDKA 4CCCA 1C90A 1BHGA 3CZJA 3RCNA 5A6JA 4BF7A 3OGRA 2XG9A 4TX8A 3ZT7A 1CIUA 4OOZA 1UH3A 2VC9A 3IJ9A 3I3DA 3N1AA 3VMPA 2VNCA 1JZ3A 1V03A 2DH3A 1BYAA 3CO4A 4ZXLA 3GDBA 4LGXA 3W26A 3WENA 1DEDA 1HJQA 1B3YA 3IJ7A 3WEOA 4JCMA 1LL6A 5I23A 1E4LA 2VMFA 3PZTA 4ACZB 1S46A 2OWXA 2QMKA 2PBOA 2WC7A 5FL0A 5AC4A 1W1TA 3AMDA 1LWJA 3VUPA 1I1XA 7A3HA 4TUFA 1OD8A 1E6SM 2UY5A 5A6BD 3II1A 3FW6A 2V38A 5CPTA 4W93A 1OGSA 3D3AA 5D9NA 3T0AA 1K9TA 3GH5A 1BGGA 1Q6EA 3FN9A 3WMSA 4B16A 1W1YA 1WNOA 4UQBA 1RP9A 1JG9A 2O9PA 2EEXA 5M3WA 3ARRA 1NWUA 2V3FA 3TA9A 4UFMA 3AIWA 1VEPA 4A3HA 2F61A 4ZFMA 2UWFA 4P7NA 1NWTA 4PMYA 3BH4A 4XB3A 3MU7A 4OZOA 5AYBA 1XSJA 1PEZA 3T2QA 5A8NA 2CBUA 4AD2A 1XV8A 4EE9A 1V6YA 3SCRA 3WY1A 3SCSA 1LG1A 2EBNA 1CXHA 3WFZA 5GQBA 1JFXA 2D0HA 3TTYA 3ZR6A 2WCGA 4J3WA 3LPOA 2ZX7A 3VIFA 4UCFA 5DMYA 4PMRA 4FMVA 1ODUA 4CD7A 3WQWA 2VL4A 3KEHA 1JZ4A 1CXIA 3IANA 3NUKA 2DQXA 1B3XA 4GZIA 5CLWA 1FHDA 2TAAA 4QFUA 2A3HA 3WDJA 2WHKA 5JIWA 5IHSA 5CQ1A 5A6AA 1J0YA 2BY2A 1M7XA 3WMCA 2ESCA 3VO0A 2C0HA 1Q6GA 3UCQA 4LYPA 5I24A 1QNQA 2J74A 4XZBA 3PBGA 3ZO9A 3FXYA 1VFFA 1CGXA 1KQYA 1Q4NX 3K1DA 3BLKA 1HJUA 3E1F1 4ATLA 1B2YA 3CGTA 5DF0A 3WQVA 2CETA 1E4IA 4R27A 4PMQA 1WE5A 5LYRA 1UR0A 4HP5A 1HJSA 1QNSA 1CZ1A 1H49A 5CGTA 3OIHA 2CIPA 1W9VA 1XD0A 4D72A 2DPEA 3T2PA 4KGLA 1B3WA 2WBKA 3VKKA 3O2LA 1BAGA 2BY3A 1SFSA 3ARPA 1EIBA 3VD3A 1SMAA 2W4XA 4AD1A 5I2UA 1V3JA 5HOSA 2CBVA 2WWCA 5A2AA 4RE4A 3B9AA 1EHAA 1HNYA 2PF0A 4IPLA 1CXKA 4AIEA 1W9PA 5LA2A 1GQKA 2XWDA 4YHEA 5BROA 2AAAA 3GNPA 3WH6A 5A8OA 3PZVA 4M80A 4KRUA 4AZ5A 3S6TA 2C8NA 4W7WA 3GXFA 4UOJA 4CUCA 2WHMA 2JALA 5FIPA 4W89A 3WD1A 5CG0A 2RGMA 1VIWA 2EPOA 3AZTA 3L2MA 1QNOA 1DWGM 3W27A 1KR1A 2E0PA 4AISA 3WUBA 3EDFA 4D71A 2YDQA 1UWUA 3DECA 4DUWA 4CD6A 2D22A 1J11A 2XFYA 3B9DA 3WD4A 2DIJA 1TMQA 1Y7VA 3GNOA 2E4TA 2Y4SA 3THDA 1XCXA 1GHRA 1EXPA 2WNWA 2Y24A 1JI2A 3OBAA 4PMOA 1GOIA 3HU7A 5KZ6A 4GINA 3M7SA 3OLEA 1O7AA 4QLJA 2NT0A 1Z32X 3CZKA 1E5NA 3T0BA 3PZNA 1UR1A 1Q6DA 1BQCA 1R8LA 2W66A 3MO4A 1UD8A 5A94A 1JYXA 2BXZA 5FL1A 3WEZA 1L0PA 2ZX8A 1X6LA 1U2YA 2EJ1A 2GDVA 1MQPA 5AC5A 2VJXA 3ZJ8A 4V28A 2J7CA 3AS3A 2Y5EA 3ARZA 1KXHA 3BMVA 2FH8A 4FLRA 4NF7A 3CMGA 3PZQA 2DDXA 1VBUA 3OZOA 3CUFA 2CESA 1C91A 1QNRA 4UQ9A 1J0KA 6CGTA 3EYPA 2CERA 3B8SA 1DP0A 2XVGA 5FCZA 1JYVA 2JE8A 4JHZA 1V3IA 3AZSA 1VFUA 2Z1SA 1DWAM 5I79A 2DSZA 4J3VA 1GPFA 3FHAA 8A3HA 2GSJA 4GPNA 3CUHA 4YPJA 1LJYA 2ZXDA 4IPNB 4S3JA 3AHYA 1KQZA 2J8GA 3CUIA 2ZE0A 3RILA 1TG7A 4DWSA 3ALFA 2X09A 2VO5A 1QOXA 1QW9A 2D0GA 3WBAA 3VDCA 3THCA 4MTVA 5BYWA 3SUVA 2E9MA 4ATWA 4Z2KA 4JL2A 1W9BM 4W87A 1HP4A 5CGMA 3VVGA 2WZHA 1UWIA 1HJVA 4L4PA 3N11A 5EB8A 2WK2A 2YBUA 1XD1A 2VZSA 3W6LA 4F66A 3N12A 4XV0A 2DT3A 3WNLA 1TE1A 3FAWA 2WXDM 2EPNA 1WZKA 3W37A 3GBDA 3W82A 2JIWA 4UFJA 4ZE5A 1PZ2A 1HVXA 3GH7A 5EFDA 3NDZA 2E9BA 4ZXOA 1TVNA 3A4WA 3O9NA 4U31A 1C8QA 1UD5A 3SUTA 1Q6CA 2J79A 1UD4A 4WLCA 2W61A 3RPMA 3TOPA 3TTOA 3BAXA 4W5UA 4P8XA 3AS1A 1E40A 1QHZA 4DWSC 4JL1A 4AXNA 3VNYA 3RM4A 1JGIA 1PAMA 5A6LA 2WCAA 3AZRA 1A47A 2DEPA 2XSBA 3NCOA 3UEQA 1GJUA 4JZ5A 4OUEA 4HPGA 1WKYA 2BXYA 3AS2A 1OB0A 4AD0A 1W9UA 4QLKA 4W8LA 1IZKA 3CZEA 3D5HA 1TCMA 1K6AA 4RL3A 3RMEA 4HU0A 2VVNA 2ZUNA 3HJEA 1US3A 3KE0A 4JFWA 1KBBA 4AEFA 5GNZA 4PEEA 4GI6A 1M04A 3UR8A 3WSUA 1ZL1A 4C7DA 3BAIA 2BVTA 4JFSA 3WNMA 4ZEPA 5A8QA 4MPKA 1HL9A 2WW5A 2G3MA 5M03A 1H09A 4AIUA 3L4VA 3A47A 4WK9A 4UZSA 2PI6A 2A3EA 6A3HA 3AMGA 2DSVA 4KH2A 2WM0A 1ZJBA 1ESWA 1PIGA 4E4PA 4V27A 4FLSA 4JKMA 1E43A 2YLLA 4TTUA 3VU2A 4WF7A 4KRTA 3QOKA 2XWEA 1ZJAA 2VR4A 3VDHA 1JDDA 1B3VA 2FHFA 4CVUA 3CHFA 4TVDA 3ECQA 4W7VA 4HTYA 5D8ZA 1WDRA 5ABFB 1H5VA 1NWSA 4GZEA 4BQ5A 1OIMA 2J7HA 2VCCA 1GQJA 1W9XA 1JYNA 1KCKA 2VOTA 1H3GA 4QCFA 1KCLA 1WPCA 1V6VA 4W86A 2WHLA 5E70A 3W53A 2VZVA 3SIMA 3WQ5A 1V3KA 5BRQA 5FOOA 3ZMRA 2DGAA 3JUGA 2G3IA 4HA1A 4J3TA 1MWOA 4UOQA 4H8VA 4YN5A 4UOZA 3OA5A 2Y2WA 3LPFA 1K9EA 3ZIZA 4AZ7A 4H8HA 1JF5A 3I3EA 4M8UA 1VENA 3AICA 3CHDA 4U33A 1FH9A 3QR3A 5HBFA 2EO7A 4AZBA 1CENA 4HMDA 3MMUA 1BG9A 2X0YA 4U3AA 4Z2IA 4QP0A 2QPUA 4R5EA 3BC9A 3ZSTA 1J0ZA 1BPLB 1CGTA 1CLVA 2JF6A 4AZIA 2XVNA 2QLYA 2VI0A 3AS0A 1DHKA 1QI3A 5BRPA 1DWFM 1N82A 5E9AA 2G8ZA 4JFUA 3N17A 1GONA 1OD0A 3QHOA 5I0DA 3EDJA 4CKQA 3ARTA 4U2YA 1TA3B 4A3YA 2XJ7A 3VIPA 1JDAA 1UA7A 2NW0A 1HIZA 1J0HA 3OG2A 4U5IA 3DHUA 1V0KA 3VX1A 2DH2A 3GTNA 4M29A 3PZGA 4EK7A 1PX8A 4X0NA 3WKZA 3UG5A 1VFOA 3IAQA 2DIEA 1KR0A 5AYIA 2ZUSA 4HZ7A 4D1IA 2CHOA 2FDMA 3POHA 2GJPA 3VINA 1BYCA 4H8UA 2YKKA 4UNIA 1HKIA 3GYCA 1FA2A 5DFAA 3BCDA 3M46A 3AMLA 3WNNA 2IUZA 3WL0A 4UFHA 3S2CA 3OZPA 3A4AA 2ZUUA 2JFEX 4F9DA 2OSYA 2ZOXA 3K4DA 4CD5A 1ZBWA 5ABFA 2WVUA 3WNPA 5EMYA 4PTMA 1J0JA 2WB5A 4GI9A 4CD4A 4PTWA 3LMYA 3CHCA 2VQUA 2WVVB 5A3HA 4CU6A 2J47A 1FH8A 2OSWA 3WUFA 1WDPA 3MUAA 1XYFA 1E15A 5C71A 1CBGA 5BXRA 2OYMA 3AXIA 3NSXA 2D3NA 4E8CA 3APGA 1D7FA 1E6QM 3BSHA 3VD5A 4CN1A 1GOMA 3VGFA 3SUWA 4D6IA 3BAWA 1XGZA 3VM5A 1WDSA 2D24A 4AWEA 1XH0A 5M5DA 4OBRA 2WMIB 5E09A 5HPCA 1UR2A 3N18A 1GQIA 2EPKX 3ZJ7A 2ZUMA 3IJ8A 1UHVA 3WFLA 1WCGA 1HJXA 4LXFA 1ISXA 1MQRA 4IISA 3AFBA 2E9LA 3K4AA 1DWJM 5AY7A 3AIVA 1CEOA 1E6ZA 1E1EA 3SUSA 2BHYA 3W4RA 1UR4A 3ZJ6A 2WAGA 3UETA 3WN6A 2WC3A 1E56A 4DM1A 2W92A 3IK2A 2DT2A 1B90A 1JZ6A 1KB3A 4UFIA 2EQDA 2VX7A 4W85A 2X05A 1LQ0A 5JIPA 1TA3A 3CHEA 1U30A 4JHOA 2BNJA 4MB1A 5M17A 3AMCA 3F4VA 5E0FA 2Z1KA 1KGXA 4W88A 3EMQA 5ECUA 3W25A 2CKSA 2ZUWA 4DWSB 4CU7A 2UY4A 4B15A 3CBWA 4IUGA 4OOUA 1YQ2A 4MB5A 5A69A 1UWSA 4UFLA 1UZ4A 3EDDA 4NZCA 5BCAA 2V3EA 1JIBA 2ZICA 4ZENA 3PZUA 5HNNA 4KWUA 2VX5A 3L4YA 4C7FA 3RM8A 2WMHA 1CECA 1AMYA 3TONA 3BXWA 2WZIA 3VILA 2BY0A 1P6WA 1D3CA 4NRSA 2BFGA 4PRWA 2WCSA 4MNLA 3AYRA 4HOXA 1GVYA 2JF7A 5D9PA 1C7SA 4B9ZA 4B9YA 3SCPA 3VGDA 1QW8A 1D2KA 2WKLA 1KBKA 2XM2A 2ZX5A 3VGHA 4L4OA 2WVVA 2O92A 4TXEA 5D8WA 2WWDA 4A4AA 3TTQA 3OGSA 4MNKA 1MXGA 4W5ZA 4J28A 3VM7A 1KWKA 3SCUA 1TR1A 2OWCA 4S3KA 3VIIA 3VDBA 1JI1A 2V3GA 1RD6A 4PTVA 1CXFA 3SCQA 4HZ8A 1EQCA 4JKLA 1V02A 4WKHA 1W2PA 5TD4A 4LQ1A 2WMIA 4AY1A 5JUVA 3AROA 2VRKA 4AZ6A 2AOSA 1TZ7A 2D20A 1OWQA 3EBVA 4DUVA 1BSIA 3NSNA 1HT6A 4NRRA 2XIBA 5GPRA 5JBFA 3K46A 3EMZA 3WMBA 2YDSA 4DUXA 3DC0A 4M1RA 1EQPA 4B3KA 1W9DM 2D3LA 3GBEA 3VIJA 4UTFA 1XH1A 1CGVA 3ZQ9A 3F5JA 8CGTA 3I3BA 2XYLA 1WB0A 3SCWA 4CGTA 2GK1B 1JF6A 1KXVA 1F4AA 1RPKA 1NQ6A 4PYSA 2ZIDA 5E6YA 4GO8A 4TOQA 1BYBA 3PN8A 1OGBA 1CWYA 1LG2A 2BY1A 4D1JA 1E1FA 2J75A 2AMGA 4TX6A 1QBAA 1AQHA 4X9YA 1ISYA 1QI0A 3AXXA 1OSEA 2CBIA 3WELA 1IT0A 3PTQA 2PC8A 3OB8A 2YA1A 1XSIA 3CUGA 2FHCA 4JAWA 3RJXA 1CXEA 4Z2HA 3BLPX 3NIYA 2EXOA 4OKDA 3WQ4A 3KWXA 3LPPA 3ARUA 4PBGA 3AMKA 1UUQA 1VF8A 1BG4A 2BHUA 2G3JA 1E70M 2RGLA 4PCSA 4D6DA 3NYDA 1C8XA 3WF4A 3RO8A 1C7TA 5IHRA 2VQTA 4JIEA 1E6RA 1ZB5A 5A1AA 2HVMA 1JAEA 4HZ6A 2WC4A 4MB3A 5BXSA 2J4GA 1W1PA 2WPGA 2D2OA 4J3SA 4M24A 1NWRA 3UG4A 3VNZA 1HXJA 3WF1A 3G6LA 3A3HA 1G01A 4Z2JA 3WQ6A 1W3LA 1UKOA 2WMKA 5CJ5A 2G4FA 4MNJA 2YL9A 1E6PA 1SMDA 3AIRA 1B1YA 1UA3A 4M81A 3U5YA 3AHTA 4HOZA 2W63A 4P7LA 3N9KA 2WBGA 1H4PA 4MB4A 1B0IA 4EAMA 4HMEA 1FP9A 4F9JA 1R87A 5E0CA 4GI8A 4GIAA 1L8NA 1KGUA 3ARYA 4TTGA 1B30A 4CD8A 5I78A 3PTKA 1E0XA 1MFUA 4PCTA 1V0LA 4AEEA 2IXVA 1NOUA 2J7GA 2BV9A 1V0MA 4WKFA 2C7FA 2WANA 1UWRA 3FHQA 3AJ7A 1B31A 2QHAA 2X0HA 2EPLX 1BYDA 3L4TA 3WF0A 1BLIA 3T08A 1BFNA 3GXMA 3CH9A 3VD7A 3CMJA 2GK1A 2YBTA 3WDRA 2NSXA 3B9EA 1W2VA 2VX4A 3SEPA 1OCQA 5C8BB 2CPUA 1V6XA 4UR9A 2XVLA 1ISWA 2J7DA 3WF2A 2BVYA 2GUYA 1EDGA 4H41A 1FH7A 4EKJA 2UY3A 1M01A 3K8MA 4CN6A 1XCWA 4MJ2A 3U57A 1G0CA 1W3HA 2W67A 1K9FA 2FH6A 4GO9A 1CXLA 2E3ZA 4GQRA 2ZXBA 3CZGA 4AW7A 4Q22A 3L4UA 1GVIA 3BSGA 3M6DA 5CLTA 1W1VA 3PZ9A 1H11A 4J7RA 3F5KA 3MS8A 3QHMA 4HU8A 3ARXA 1LL7A 1H0IA 1BVZA 3ARWA 1QVBA 1OINA 3WDQA 3U5UA 5A6MA 5DO8A 1GOOA 1EOKA 4W8AA 1VB9A 2PWGA 1V3HA 2WLYA 1RH9A 2FHBA 2OYLA 3VIOA 1J0IA 5E6ZA 1OM0A 3ALGA 5A2BA 4FLQA 4PUEA 1GQLA 4M56A 2BHZA 4LYRA 1J12A 3DHPA 2EPMX 5LA1A 4KGJA 1E0WA 2ZWZA 4BZYA 1NH6A 4F79A 4URIA 4AD3A 7CGTA 5JH8A 1TVPA 3EDKA 4CN4A 1WZMA 1CGYA 1WP6A 4TVUA 3MMWA 2XVPA 2VX6A 2DSKA 3PZIA 2VT0A 4N42A 1CDGA 1X1NA 2QPSA 3WBEA 1ITXA 3QOMA 1HKKA 2YA2A 5D9MA 3POCA 1QI5A 4WKAA 3WDHA 1G1YA 2D23A 1PIFA 2F2HA 2VZUA 3K8KA 4MADA 1GJWA 1E71M 1EGZA 4BCEA 4YHGA 4NI3A 1FFQA 3ARSA 3VMOA 4UQDA 1UD2A 1RP8A 1JZ2A 4P7QA 1E72M 2X1IA 4PUDA 5I3DA 2XTKA 1C93A 1QI2A 3AISA 1ZBCA 1UKQA 1B3ZA 3L4ZA 3BMWA 5I6SA 3BCFA 4J27A 1JNEA 1HJWA 2PBGA 1MYRA 3WD2A 2HISA 4HA3A 1VJZA 1JZ8A 3KL5A 1O6IA 2VVSA 1C3FA 1V3MA 2XSAA 1UKPA 1UOKA 5D4YA 2XM1A 5ABGA 3TTSA 1DWHM 1XH2A 4P7RA 4CVWA 2GDUA 3BAYA 3WDPP 4WSKA 3PHAA 3ZOAA 2CKRA 1R85A 1J9YA 2YLAA 3UERA 3FY1A 1H0GA 1UD3A 5GNXA 3MUY1 2XIIA 1OT2A 1Q6FA 4RE3A 1HN1A 4HA4A 2UY2A 2PWFA 3WNKA 3AIEA 2J25A 5A6BA 1GZJA 3SCTA 1MW0A 5LA0A 4XX6A 2CITA 1QHPA 3L4XA 4ACYA 1EO5A 2J62A 4PTXA 4PMUA 4QCEA 1DTUA 3SURA 4P8WA 5HPOA 4AZGA 4BQ2A 2XHYA 4J3XA 5IXEA 2J7BA 1JXJA 3VD9A 3VIMA 2W5FA 3VMNA 2YA0A 3VPLA 2GVYA 2XUCA 3SCOA 4FK9A 3W38A 1UWQA 4E2OA 3ZM8A 2WZEA 2W62A 1GOWA 5IFTA 3IAPA 1JAKA 3T2OA 2D1ZA 1QPKA 3MUZ1 2O9OA 2GJXB 4M82A 2F8QA 4MAVA 1J10A 3A4XA 1AQMA 3WF3A 2CBJA 4UFKA 1UD6A 1ZBVA 2OLHA 1NP0A 1AQ0A 3VTRA 1DWIM 5C70A 2Y8VA 2VURA 1R7AA 4MAZA 4JFTA 1MQQA 4JCLA 1R86A 4H04A 5CPQA 2ZXAA 2XVKA 3GZAA 4N0RA 1JZ7A 1IZJA 1EDQA 2FGZA 4F8XA 4U3CA 2VCAA 5CSYA 1YHTA 2J78A 1UR9A 5A95A 4X0VA 1TUXA 1WDQA 3A6OA 4AZHA 1AVAA 4UQEA 1MFVA 5I5RA 1ZBKA 1E5JA 2IXUA 1OT1A 4TVCA 4LYQA 4FF5A 3CTTA 3OLIA 9CGTA 1XRVA 1XHGA 3N13A 3VGEA 4JKKA 1GOQA 2QMJA 5JBEA 2QV4A 5BXPA 1UQYA 2VZTA 1E55A 1E6XM 4QDMA 3UG3A 1J18A 3BAKA 1OIFA 1JL8A 3M07A 2A3CA 3NSMA 3CIVA 4PMNA 4ACZA 3W81A 1E9LA 3WD0A 2PWHA 7TAAA 4HOWA 5HDRA 1M53A 2X2YA 4H2CA 1I75A 1SYTA 1G5AA 3MKKA 5F7UA 2W91A 2VUYA 1MXDA 4AC1X 1FP8A 1JFHA 2J7FA 1VRXA 2YDRA 1E3XA 3LPGA 4QAWA 3W24A 1G94A 1ITCA 3WUGA 4BS0A 1UYQA 3KL3A 1PPIA 4JFVA 2JIEA 1V02E 2ZUTA 1QI4A 2DT0A 4U2ZA 1HKMA 1BVNP 3MSDA 2VZOA 3ZT6A 1I1WA 1EH9A 4GZJA 4GQQA 4D6EA 1UWTA 1QNPA 4Q7NA 2WVTA 1LL4A 2YL8A 3GH4A 1E73M 4E8DA 3MANA 4GXPA 1FOBA 2VTFA 3DYMA 2WMJA 1FHLA 4W84A 1ECEA 4BQ3A 1E0VA 1UZ1A 2CHNA 2WVSA 2YIHA 4PSRA 4WSJA 1KWGA 1KGWA 2GJXA 4AMCA 2J7EA 4BQ4A 5GNYA 4PMDA 1XYZA 4KMQA 3SUUA 3WL1A 1PZ3A 4ATDA 2WSPA 3QGVA 1OBAA 3NJ3A 5BXTA 5ABEA 4P8UA 4FLOA 1GCYA 4Z2GA 1J01A 3MUIA 1W3JA 4ML4A 3QHNA 1H41A 1GOKA 3WIJA 1EO7A 1GORA 1NOWA 5BWFA 3DYPA 3WDIA 2XGIA 2V5CA 3WQ8A 2Q8XA 2WSKA 1SR0A 5DT7A 4W7UA 5CSUA 3HN3A 1E3ZA 1CLXA 2E8ZA 1XSKA 2DT1A 1LF1A 1CYGA 4OBSA 1KFWA 4PN2A 2PWEA 3WH7A 2NT1A 3WEMA 4UQCA 5EBAA 2WHJA 3N15A 1VFMA 1ISVA 1WAWA 4DWSD 1V08A 1E4MM 4LPCA 1BGAA 1LWHA 2VRJA 4AD5A 4D6HA 2G41A 1EA9C 2YL5A 1HL8A 3F5LA 2BS9A 4W8BA 2VCBA 2XGBA 1UH2A 3CLWA 3AIQA 1V0NA 3W0KA 4MDPA 2GJRA 4AZCB 2ZUVA 2DSWA 1W91A 1HF6A
chains in the Genus database with same CATH superfamily
4JICA 3AALA 2FGLA 4HIBA 3H2NA 4N6FA 2DZVA 3COTA 5FEPA 3M64A 3PBUA 5HQLA 3KAGA 3EX6A 4P7OA 4EP8C 4AMAA 5A6SA 4GK8A 1K9DA 2BVDA 3W2LA 4ZA0A 4C60A 4JTUA 1RK5A 3DU0A 4PUWA 2CXGA 3WJZA 1EYWA 1LWIA 1FWBC 3PZOA 4JHMA 1AL8A 3TQKA 3N2CA 1B54A 3WO8A 1MVYA 2R1PA 2PD9A 3BAJA 4ZB0A 5DEZA 2GVLA 3UNDA 1W17A 1ELSA 1GNXA 1W8GA 2ZZ1A 1G6CA 1I8JA 1ZCCA 1VAHA 1UKTA 3W71A 2FB3A 4HMCA 1VYPX 2VRQA 2ZWYA 2CWXA 4C7GA 3GQYA 2H3BA 1D3HA 4MM1A 3AQUA 5D9OA 1BSLA 4E0CA 1TWIA 5IDIA 5A8MA 1T99A 3G2GA 3C0QA 5HW7A 1YXYA 4FS9A 2Y7DA 3RLGA 1H7WA 4IMAA 4LTSA 1PKNA 3AHZA 4F0SA 4PL2A 1QW7A 5EFFA 1VLWA 4C90A 2EGZA 4Z2LA 4UBPC 1CGUA 4MDOA 1MMFA 4NXKA 2H8ZA 2PDUA 1MUWA 5I3FA 4IQDA 3RPTA 4WIWA 2FZMA 1SO4A 2OCZA 3UVIA 3IK4A 3BUVA 3PWIA 1WO2A 3NL2A 3QW4B 3KVKA 4HYRA 5F2LA 4O18A 3B0PA 2VC6A 4KCTA 4ZL1A 5HUAA 2J8FA 3W83A 5HWJA 3IIZA 4LS2A 4EANA 2M2AA 3P2VA 2E6DA 3HQ1A 3WBWA 4FXJA 2CCRA 3GR8A 4WJXA 1S2UA 1XYLA 3H2AA 1MW1A 4QAIA 3M0ZA 1GVOA 4BA0A 1RVKA 2CWNA 3MYPA 4GX8A 2FKPA 4LVGA 1GYMA 1KXQA 1XL9A 4QS6A 1KKOA 4H7CA 4Y7EA 3NXLA 4N19A 4O8RA 1QBBA 3GS6A 1Q6UA 3DG6A 1OGGA 4G1NA 2PRMA 2B31A 3ZSSA 1UPPA 4ZTXA 3ITCA 3GB6A 1RBOB 3CQIA 3TNOA 2MANA 2Q5AA 1RA0A 4HPXA 4KWVA 4I7WA 4O28A 3LOTA 1DV7A 4KS0A 3UESA 2XH0A 4IPIA 3EB4A 3ELFA 3TP4A 3GM8A 1M7OA 1HKJA 5I77A 5DO2A 3W72A 2CEQA 1XIBA 4IIGA 1MNSA 3OGVA 3OEXA 4PTNA 2R1LA 1U33A 3CAWA 2XN1A 3W74A 3PZMA 1WZLA 3DFTA 3MSGA 4O8AA 4U10A 1KCZA 5A6KA 2C13A 4OJYA 2XPBA 4CCCA 1XKYA 5D32A 2XG9A 1XG3A 4E2DA 4OOZA 3I3DA 3N1AA 1DIOA 3VMPA 2VNCA 4INFA 3S1VA 1M1BA 3HTWA 4H9TA 3HPSA 1D9EA 2PA6A 5H2ZA 2WKJA 3SI9A 2BTMA 3GDBA 3KTCA 4UMCA 3W26A 3H2MA 4LAMA 4XTIA 1DJGA 4JCMA 5I23A 5H6HA 5DRCA 4IMEA 2VMFA 1JNSA 1H7XA 1W3NA 3Q37A 2OWXA 5T8GA 1CB7B 2WC7A 1RV8A 4JTIA 4QR6A 1VD6A 4HCLA 4HYVA 3FA3A 3SR7A 3W01A 5AC4A 3GHUA 1I1XA 3P82A 4O11A 3E0FA 4TUFA 5CSRA 3G3DA 3MCMA 5MKGA 1SVDA 3H7RA 3PG8A 3II1A 4HSNA 2TRSA 5CPTA 2R1MA 4JFKA 1XG4A 2OEKA 2WM1A 3G1RA 3FN9A 4JY9A 4ERAA 2QCFA 4RNJA 3I6RA 1H63A 3IV3A 2EEXA 2X1SA 1DIEA 3AIWA 3IUDA 3R11A 2UZ5A 3G0SA 3BH4A 1PTGA 4H9ZA 1WOAA 5AYBA 1PEZA 5LIUX 2XIJA 1M9HA 4AD2A 2AKMA 2GWGA 3NDOA 5C9XA 1V6YA 3WY1A 1FCVA 1LG1A 3WFZA 2D0HA 2LKNA 3TTYA 1TWDA 4F0MA 2WCGA 4GIEA 2ZX7A 5DMYA 1FKIA 4E2BA 2Y0FA 1Z89A 3E49A 2XSXA 2HXUA 1ODUA 1XR2A 3QPYA 4CD7A 4WQ6A 3WQWA 1JZ4A 1CXIA 3EY6A 3PM6A 1GEHA 4HNLA 2DP3A 2DQXA 3GVQA 1FHDA 1KO0A 1FWRA 2TAAA 2WHKA 2YCLA 4GQBA 5A6AA 1R3YA 2BY2A 3UI5A 3WMCA 4EPKA 4X2RA 1CB2A 1UIPA 3M6YA 5TAOA 3PUOA 1JCYA 4LYPA 5ENLA 5I24A 2VWTA 2ZZ3A 1CGXA 1KQYA 2CLEA 1Q4NX 3BLKA 3E1F1 2J9XA 4ATLA 3VOIA 2CETA 3CYJA 1E4IA 1R2SA 3W7RA 4BKNA 5LYRA 3BICA 4Q8VA 1QNSA 5CGTA 1EPVA 3TXZA 3T2PA 4KGLA 5CC6A 1BAGA 2BY3A 3UA4A 1SFSA 2PPOA 3ARPA 3M0VA 1RHCA 1SMAA 3TSDA 2NLIA 2NX3A 1E9YB 4RE4A 3UJEA 3UQNA 1EHAA 1VHCA 1EP2A 3M4HA 1YIXA 3VCRA 4AIEA 2PDJA 3B0VC 1GQKA 2QCCA 4YHEA 5BROA 2AAAA 1KFBA 3GNPA 3WH6A 3GXNA 3UR2A 4WSHA 3S6TA 4DZAA 4W7WA 3GXFA 4UOJA 1WXZA 4R7OA 1W6TA 5FIPA 4PTDA 4W89A 3ID7A 3K5XA 2RGMA 1VIWA 4LUJA 2QZRA 3AZTA 1YADA 3W27A 2YGYA 3MDUA 4LVBA 1KR1A 2BOEX 1VYSX 1TIWA 4HPJA 4LCRA 2YDQA 3VAVA 1T41A 4LVDA 4XO7A 5LIKX 4CNSA 3DECA 2FFCA 4DUWA 3SFWA 4JFIA 3N6HA 3RPDA 1J11A 1XGDA 2DZAA 3MSRA 1Y7VA 3W1MA 2E4TA 1XCXA 3EWDA 1EXPA 2HTMA 1QZ2A 1JI2A 1QJWA 3KBMA 3C5QA 3HU7A 3M7SA 1A4LA 1TTQA 4BF5A 3PJWA 1O7AA 3T7VA 4O4WA 3GW0A 5DLCA 1Q6DA 3FJNA 4O1DA 2DY3A 5B80A 2W66A 1R8LA 4O10A 5FL1A 3DFPA 3TYZA 5EPDA 3W2KA 2EJ1A 5AC5A 2ZTKA 3B0XA 1IWAA 3A4JA 1SFLA 5LNWA 4NNAA 2DZTA 3CMGA 1EXBA 2YX0A 3FDGA 3T05A 2EJAA 4BR1A 2VFDA 1XYAA 2CESA 1C91A 1J0KA 1R30A 4RK8A 1X38A 3MI3A 2OKOA 3STGA 1OYAA 2EG8A 1DP0A 2JGYA 3NQCA 2WJFA 5FCZA 1JYVA 2GPTA 2PF8A 3I7RA 1ROUA 1XPGA 1GPFA 2VEKA 1KRBC 4K7VA 4GPNA 1ITUA 2GYIA 3TEVA 2HEJA 1KRCC 2J8GA 4UMAA 3RILA 1YX1A 1Z9AA 2F23A 3S8HA 4I9TA 3NXFA 2E9MA 3NPUA 1A0CA 1R2RA 3SUVA 4ADUA 4IG2A 3NQDA 3I7SA 5HNUA 2WZHA 3CXOA 3TE9A 1I0BA 4QJ3B 2YB4A 3E9AA 4L4PA 2XH7A 5EB8A 3DBPA 5H91A 2YBUA 1JUBA 2VZSA 1FDYA 4WHBA 2P3EA 5JXQA 3LBMA 3WLTA 2JBMA 1XLDA 3B05A 2AGTA 4ZO8A 4UTMA 3LZ3A 2JGQA 1CI1A 4PL1A 2JIWA 3FYPA 4UFJA 4JFJA 2PDCA 3STCA 2Z1VA 1R3TA 3U2CA 3S9IA 5FJTA 3IGXA 3LU2A 3NDZA 5IRPA 3JYJA 3H53A 2IKGA 1C8QA 1YE6A 3QYSA 1Q6CA 1U1HA 4R7JA 3GKAA 3TOPA 4JDBA 3W2MA 2JQXA 4LEQA 4P8XA 3AS1A 1E40A 3C2VA 3A3WA 1TCOC 3M5YA 3EXRA 4MZ8A 3OBEA 4V33A 3RM4A 4I5UA 1PAMA 3V3WA 3AZRA 3M5VA 3NCOA 3UEQA 4JZ5A 4HPGA 1OB0A 5C7HA 4PULA 1KFKA 1PZ1A 1YYAA 1K6AA 2R14A 3FYYA 3V16A 4HU0A 4DQWA 5GNZA 3Q2DA 4ZO7A 2OQYA 1P5QA 5TIMA 3NZRA 1EJVC 3BAIA 3GPKA 3BJFA 3G77A 3KOZA 1QK0A 2PPNA 4M5PA 1LUCA 1WKFA 1FWDC 2NUWA 3UPBA 1Y65A 3BTNA 6PTDA 1XBVA 3NA8A 2A3EA 6A3HA 2X1RA 1ESWA 1U5HA 5AYYA 3TN5A 3KAFA 3NQMA 1RR2A 4LH8A 2G96A 1F9CA 1DXIA 3E96A 1UZHA 4WF7A 3ABQA 2Z00A 1ZJAA 4K2SA 3IJ6A 2P8BA 4O54A 4IGHA 1TPC1 1E44A 3RX4A 4HTYA 5D8ZA 2WNZA 1O1ZA 1H5VA 1PDZA 3CT2A 2J7HA 3G18A 3N34A 1FX6A 3OZMA 1RCXB 1W9XA 1YDYA 3W84A 3BJSA 1ENUA 3HQNA 1H3GA 4TW8A 4XAKA 3W53A 4HSHA 3UBPC 2VZVA 4OECA 3NRKA 3ZMRA 2HVNA 3NQ2A 4HA1A 4J3TA 4UOZA 3LBCA 4LC8A 3LPFA 3LS9A 2HDJA 4H8HA 3PS7A 4IL0A 4CQAA 3E2QA 3LCLA 4HMDA 3MMUA 1OEPA 4QP0A 4DF0A 2OU4A 2O0TA 2NWRA 5EMMA 1BPLB 1XP3A 2C1IA 5DBUA 3PJXA 3QMSA 1L2QA 3TYEA 1DWFM 4ITZA 2G8ZA 1YXCA 3G0XA 4FA3A 2P88A 3V18A 1OD0A 5LNSA 2POZA 3LHWA 1R3RA 3UF9A 1AL7A 5I0DA 3EDJA 3ANUA 4Q4SA 5AKQA 1VPXA 4NYUA 4AWSA 4HD5A 3GG0A 3LSCA 3XISA 4C1NA 2PV3A 1HIZA 2ZZ5A 3OG2A 4NP7A 4U5IA 3KCLA 3VX1A 4FPSA 4MZ1A 3G1XA 2Z26A 1FWFC 1TJPA 3VNMA 1ADDA 1W1ZA 5JU6A 3HFYA 4D1IA 2YXOA 2CHOA 4UTKA 2FDMA 4H8UA 1B5TA 1EEXA 1U5VA 5KINA 1N7KA 4S3FA 1WKEA 1ZTVA 1HKIA 3BCDA 3R89A 3AMLA 3MBDA 2IUZA 4HK7A 2ZUUA 2CLHA 4F9DA 2FZBA 2ZOXA 3K4DA 2IPJA 1SGJA 3WMLA 5ABFA 4P5UA 3WNPA 4PTMA 4GI9A 4Z1DA 2DORA 1GVQA 4GRSA 5D05A 2ACUA 4JTTA 3MUAA 1E15A 5C71A 2OTDA 3VNLA 2M1IA 2D3NA 4GVIA 1ICSA 4Q6XA 3APGA 1D7FA 4V1YA 1QFEA 1FCUA 2IPFA 1E6QM 1M68A 4DJEA 4MWAA 1GOMA 4KETA 2D24A 1Z48A 3KBWA 4QISA 2NUXA 4OBRA 2WMIB 3FJ4A 2B81A 1UR2A 5HPCA 1KBJA 3RU8X 1BTMA 4A29A 3FKRA 1FKFA 3RGCA 1F8MA 1UHVA 1HJXA 4FIQA 3IJLA 1ISXA 2PLJA 2OEJA 1W1IE 1DWJM 1CEOA 1KM6A 4XVDA 3ZJ6A 4ZOAA 4ZZ9A 3V35A 1B4EA 2WC3A 1E56A 2W92A 4QS5A 1NF0A 1GVEA 2DT2A 3BW3A 4IIEA 2EQDA 3CIWA 2X05A 3GTYX 4LANA 4R33A 1F3WA 5M17A 5I3KA 4YTQA 1F5ZA 2PDXA 5E0FA 1A50A 3EXTA 4G50A 1EC8A 1K8ZA 2PAJA 2E6AA 3PJUA 4DWSB 4FIRA 4CU7A 2UY4A 4MVAA 4MUZA 2YXXA 4IGSA 1O12A 2YYUA 3KZPA 4C65A 4KFOA 4MB5A 1O68A 4HHLA 4B5TA 2DUXA 1I0DA 3RHGA 3H9RB 2CZDA 2QKFA 5T26A 3TQ0A 4XD6A 4LY4A 1JIBA 4S1FA 5HNNA 1S5WA 1AZ1A 4IX0A 3L68A 1AW5A 4KWUA 3M16A 4O53A 3EA2A 1AMYA 3TONA 2FJUB 1K7XA 3F4NA 2WZIA 3VILA 3TQVA 4NRSA 1P6WA 2PDPA 4B2DA 4DRIA 4MNLA 1JPKA 2E6FA 4HOXA 5HKGA 3LHVA 4C1KA 3SCPA 1QW8A 3M0JA 1Q85A 4DJDA 1R9XA 1TIMA 2O92A 2WWDA 3R1ZA 1NFGA 4MNKA 3QC0A 4W5ZA 4DXKA 3TR9A 7REQA 5C9RA 3SCUA 4AQLA 2XDFA 4XD3A 1DIKA 4ZPTR 2V3GA 3B97A 2IKJA 1XIMA 2QXWA 4BJHA 4DN1A 1ML1A 2WSYA 3RAOA 1A5OC 1XJBA 3W2UA 4JTKA 2D9FA 1ZNNA 2V8ZA 3KUMA 2XINA 2AOSA 1TZ7A 3UA3A 3CS2A 5C9UA 1JGMA 1D7JA 4FO4A 5HTGA 3AWOA 4GH3A 4DUVA 1BSIA 1SSDA 3KADA 2OT1A 3TSMA 3AO0A 4HMNA 2YDSA 2AL2A 4DUXA 4B3KA 1ME8A 3GBEA 1OVDA 4JTAA 1XH1A 4R9XA 3F5JA 8CGTA 3RMJA 4G7FA 1Q66A 2XYLA 2Y7FA 1WB0A 3LLXA 3SCWA 2IKIA 3GYEA 1UBSA 1F4AA 5E6YA 4GO8A 1CWYA 1LG2A 2J75A 3L5AA 3QKZA 2HS6A 4IIDA 1XIIA 1LOLA 3RUBL 4X9YA 2NXHA 1ME7A 4C6CA 1FWAC 4RZ4A 4A21A 1ISYA 2J9ZA 1OSEA 3N4EA 3WELA 3OB8A 1LOSA 2FHCA 4GISA 4DWDA 2HK1A 4IJBA 3LA4A 3N2MA 4Y9MA 1I4NA 3OIXA 4TX9A 2XP7A 2OJPA 2XIMA 4WY0B 3WQ4A 2FZ9A 4C5YA 4EVZA 1UUQA 4PCSA 3NYDA 3RR4A 4G5DA 3UP8A 3RO8A 1Q45A 5IHRA 5AZ0A 4HZ6A 3UWUA 5BXSA 3DEQA 4J3SA 1E9ZB 1A5CA 1R38A 4C1LA 2ZYFA 2OB3A 5FF3A 3A3HA 1GTEA 1J5TA 1G01A 3WQ6A 2PTZA 3RR1A 2OLSA 4EPEC 4X60A 1Z3NA 3ODKA 3BLLA 1B1YA 1H5YA 3DFSA 3MW7A 3QW3A 3BMXA 3TROA 3DDMA 2W63A 4P7LA 4HMEA 5KSWA 1ZZMA 4F9JA 2M08A 1TVLA 4IXXA 1R87A 1VBJA 5J04A 3LCWA 1EZWA 4P2VA 4JYSA 3WK3A 1E0XA 3OPSA 2P50A 1ZUAX 1FVPA 3LHZA 1EL3A 4LV4A 3LSBA 3IGSA 3VZZA 4WKFA 4US6A 3HPAA 2WV8A 3LCGA 4JX5A 4QZVB 3AJ7A 1B31A 3ONBA 4UTIA 3PBMA 3L4TA 3S1GA 4HHHA 2BZNA 3T08A 1GWJA 3P5ZA 3CH9A 3M9YA 2GK1A 3TC3A 3H22A 1MO0A 1M65A 3B9EA 1W2VA 2VX4A 2YDAA 1OCQA 4W9QA 3OYZA 3O16A 1V6XA 2GQAA 2OMAA 5HNTA 1ISWA 3CQKA 1ICPA 2G0WA 1FH7A 3OYXA 2UY3A 3A64A 4DELA 1YE4A 3QQ1A 3S5OA 4MY8A 4JNMA 1UUMA 1DKWA 3BW2A 5ABTA 4CNOA 3NWRA 1RD5A 3CZGA 4AW7A 4Q22A 4QE5A 3W23A 2QJIA 1H11A 1NMWA 1QOPA 1KFEA 4B4HA 4PH6A 3C2FA 3CMFA 1LL7A 1R0MA 4OUIA 1UASA 3ARWA 3DG3A 2QDGA 3U5UA 3JVAA 5DO8A 3MO7A 4W8AA 4K8HA 1UUOA 1V3HA 2DZUA 4O2TA 3S6DA 1OCNA 2DZSA 3UQIA 3VNDA 5E6ZA 2F2DA 3ALGA 5A2BA 3UXAA 3FVMA 4PUEA 4UB9A 4RXGA 1EB3A 1J12A 2MLYA 2AKZA 3WLPA 4BZYA 3DGRA 3W7EA 3RRXA 1CGYA 1WP6A 1ZALA 4TVUA 1F6KA 3P84A 3MT1A 5T9CE 4N42A 1CDGA 1DHPA 1ITXA 1RQBA 1HKKA 4JIPA 1R5YA 2V2CA 3STEA 4YTRA 5AHMA 2QDHA 3H55A 1A3WA 2F2HA 2VZUA 3K8KA 1KD0A 4U84A 4PRRA 3N3TA 1H1YA 2NLYA 4NI3A 1FFQA 4XSMA 3CV6A 3IIVA 4UQDA 2PS2A 4Q4MA 1RP8A 1K77A 2E5BA 3P5YA 4PUDA 1IEQA 4AHOA 2XTKA 3IIPA 1KKRA 3URQA 2LPVA 2WZTA 4F4RA 3AWNA 1JUKA 2Y63A 3BMWA 5I6SA 3BCFA 5LNVA 1RCOB 3LLDA 2OFJA 1HJWA 3NTYA 1MYRA 3IEBA 4EACA 1JZ8A 3KL5A 3VNJA 1UPMB 3D3FA 3RLUA 2KO7A 1UKPA 5D4YA 2XM1A 3TTSA 4DNHA 3M41A 4CVWA 2GDUA 3E6EA 3PHAA 3CWOX 1J9YA 4LUIA 1E1CA 3MUY1 2XISA 5LXXA 1HN1A 4HA4A 2UY2A 3WNKA 3AIEA 2ZC1A 2Q09A 3H12A 3RXZA 4FF7A 3B8TA 3QQ0A 3GIPA 1TO3A 4O12A 2OOFA 4WJ8A 4DF1A 3MTWA 4S3CA 4PMUA 1D8CA 4QCEA 3C0SA 4O50A 1QPQA 2XHYA 4MLRA 2W0UA 3QY8A 1GT8A 1W56A 2VGGA 3UG8A 1ITQA 3VMNA 3LM7A 3STPA 3UZ5A 3KHDA 3GUWA 2FKEA 1XQKA 3ZM8A 3KZ7A 5IFTA 4L56A 3MUZ1 5KMYA 5CZJA 2R6OA 1SW7A 2WQDA 3B03A 1AQMA 2PDYA 3I6EA 4EXBA 1U1UA 3QV9A 3BLDA 4UFKA 1BL4A 4IICA 4ZS6A 2ZR6A 4DNMA 1TV4A 4ECLA 4FX8A 2VURA 4MAZA 4XBJA 4Z08A 2QNEA 1MQQA 3PTDA 1IT8A 1VIZA 5CPQA 3GZAA 5HAOA 1RY0A 4U3CA 5CSYA 1YHTA 3MP4A 4WGHA 1ZCNA 3I65A 1GG1A 3O06A 4AY7A 4X0VA 1I2NA 3W3OA 4DJFD 5F4WA 1AVAA 5CPLA 5LIYX 3LCHA 4HJWA 1K8YA 1XXXA 3CU2A 3OLIA 3CEPA 1XRVA 1XHGA 1JRBA 3R94A 3N13A 3MSYA 3IGHX 3I4EA 4H9VA 4JKKA 1JUEA 4QBXA 2PCEA 3EWBX 5JBEA 2QV4A 2VZTA 3HA1A 3W07A 3UG3A 2Z28A 3EGJA 4K39A 1J18A 4JPGA 1JL8A 1XF0A 2PMQA 4FNUA 3WD0A 3APTA 1WAUA 3FEMA 4HA0A 5AVHA 3CEUA 5AFDA 3M44A 3ATZA 1I75A 4C6FA 2QQ6A 4AC1X 3KAOA 1ZGDA 2YDRA 3W24A 2KAUC 5JH2A 2V82A 7PTDA 4AEOA 2DT0A 1FWSA 7XIMA 1YTDA 3NVDA 3ANVA 4DRQA 3C3NA 1LROA 4HARA 3W6YA 1NSGA 2VZOA 1ONXA 1EH9A 4ODKA 3VCNA 3SECA 1S5VA 9XIMA 4JNYA 2XPAA 4LF1A 4Q7NA 3LI0A 2I9EA 1ROTA 1FOBA 3NQVA 1OFDA 4K6AA 2IW0A 1M5YA 5BXJA 3E38A 4ODRA 1FXPA 5D33A 4IJRA 2GJXA 7ODCA 1OCBA 2WSQA 1HO4A 5CZTA 5F1VA 3SUUA 1EC9A 3E2RA 2GGGA 3F2DA 5CPOA 3TA6A 1PZ3A 4ATDA 2WSPA 3BV7A 1OBAA 3EWWA 3NJ3A 2E25A 1XDLA 1GCYA 4Z2GA 3EOSA 4HK5A 3JS3A 3QHNA 1TV2A 4L1XA 5E0KA 3L67A 5FAJA 3WIJA 3EKZA 2YR1A 4MZYA 5BWFA 3DYPA 3WDIA 3OTRA 3TCSA 4JY8A 5DT7A 3NYZA 3TK7A 5CSUA 3HN3A 1SQ7A 2PTYA 3BOXA 3FYOA 2Z0IA 4L61A 3QFEA 3QLDA 1CYGA 2PBCA 2B7QA 4US5D 1KFWA 2FDSA 2DUZA 2V81A 1WV2A 2G4JA 4ICNA 3EZ4A 3FSTA 3K1GA 3N15A 3SBFA 3VZXA 4HU3A 4ADSA 1WAWA 4DWSD 2BP1A 1E4MM 2E09A 3CK5A 2VRJA 4D6HA 4LAZA 4NAFA 2VCBA 1EJRC 1UH2A 3CLWA 1V0NA 1V4YA 4MDPA 4PE8A 1W91A 3YPIA 1B3OA 3WJWA 3SFKA 2PSNA 1UC4A 5D2YA 2QJJA 2VR5A 4IM4A 1XUUA 3KXQA 3UR7A 3L5MA 1KCXA 4NSBA 1SZGA 1TZ9A 3LD5A 5F4XA 1ECQA 1VBGA 4NNCA 4PMZA 6TAAA 5CZSA 3EOLA 3VX0A 4H19A 4PMVA 3ARVA 2WKGA 3J7HA 5KTLA 1PBGA 2VEIA 1X97A 3F4CA 1RQEA 1CGWA 4XKYB 2ZX9A 1EBHA 5CAKA 3IUIA 4DM2A 2KZHA 2A4AA 1W32A 4JTJA 3VDAA 3FEQA 3NQGA 1EHNA 2ZXQA 1CPUA 4O0QA 5G2IA 3T81A 1ISZA 1OG0A 2HMCA 2XFFA 5IBXA 3RIKA 4XUGA 2JKEA 1H61A 4TV6A 2R8WA 3HO8A 3ITOA 2VC5A 3ZJKA 3S3GA 2HROA 2JEQA 4YCOA 3MBFA 1REQB 1MW3A 3CUJA 3BGAA 1UH4A 2GGHA 3VFCA 5H8PA 3LLFA 3T07A 1PL9A 1RJRA 3GNRA 4P8VA 1UG6A 5HJLA 4RNIA 1Q63A 4GXMA 1OX5A 2X2GA 3VNIA 3DHDA 5FD0A 4OIFA 4AY8A 1CTNA 1FWTA 3C0LA 3WD3A 3ITTA 4K68A 3VE9A 5CBBA 2Y7GA 4B3LA 1JZ5A 1R7OA 1GRJA 3WH0A 3N9SA 2C1HA 2J9YA 1KLYA 2O9TA 2PB1A 4IFKB 3SCNA 4PCNA 1EC7A 2C16A 2F9RA 1CNVA 3BOFA 4RLIA 4AYSA 3ITXA 4J3UA 1VFTA 2C91A 1G9HA 1WZAA 4IQJA 2PDWA 4GD0A 4TX0A 3GR7A 4IGMA 4I7UA 4NT0A 5FJUA 2A3BA 1MNZA 5DT5A 2P8CA 1ODZA 2HRWA 1MI3A 4M51A 3SCVA 4GE8A 1IHIA 4DBEA 3MCOA 1X6NA 2O7SA 1V3LA 2K8IA 3IS4A 2WMGA 1JNDA 4LVFA 3HMCA 4ZCWA 3TVAA 1E6NA 3LGEA 3GNXA 1JD7A 2ZZ4A 5IFPA 3ARQA 1IXPA 5G4HC 1TPVA 4DUOA 3VYLA 1TB3A 5KEZA 3L2LA 4LX4A 3V0TA 2QCNA 1SZFA 3G6MA 3L0GA 4CU8A 3VD4A 1QHOA 5CXPA 2XFRA 4MJZA 2E1DA 1A5NC 2AGKA 4JIQA 4JQ3A 2Y5JA 4GIRA 2WMFA 3NM1A 3TZNA 3NO1A 4AFYA 3FNDA 4ZE4A 3WH9A 2G97A 2YW4A 3RLHA 1PX4A 4I9AA 4D6FA 4AIOA 4QLLA 3K8LA 2BXVA 3EDEA 1FFRA 1AW1A 1R3QA 4XAGA 1A4MA 3H2OA 3C61A 3WNOA 4H8NA 3I68A 1NAL1 4H7VA 4ZBCA 3D6NA 2X8RA 3PSVA 1LRTA 1C92A 3RM9A 3JW7A 1W3KA 1E4NA 1XRFA 4V2XA 5TQLA 3TJIA 3UXIA 3AHVA 1P5BA 3W28A 4LS1A 3RDKA 4LUSB 1D6OA 3CZJA 5A6JA 3OGRA 1VGAA 1LOQA 3ZFHA 3BE7A 5C2XA 1UH3A 2VC9A 3E5BA 1TX2A 3IJ9A 3LGGA 1GG0A 4LB4A 1V03A 2NX9A 1BYAA 3CO4A 4HSOA 4ZXLA 1XIGA 5AYZA 3WENA 9XIAA 1IR2A 3VE7A 1QUMA 1XIHA 5I3JA 1D7HA 2ZA3A 3WEOA 1GGOA 4IP7A 4NJIA 1E4LA 3PZTA 4JQ1A 4WOZA 4ACZB 1S46A 2QMKA 2A7NA 3GXTA 3GVWA 1LWJA 2WSRA 3ZVIA 1OD8A 1DJHA 4WEVX 5AOUA 5IM51 1XBXA 2UY5A 2V38A 1J8VA 3D3AA 3LRLA 1XLAA 2GZXA 3GH5A 4O15A 3WZ0E 3WMSA 4DRHA 2R94A 3SW6A 4UQBA 4WXYA 3FV9A 1RP9A 3M0IA 5M3WA 2RDUA 3FA5A 2V3FA 4RNHA 2BGSA 3TA9A 3V0UA 4UFMA 1VCGA 1VEPA 3JRKA 4ZFCA 2UWFA 2VEPA 4P7NA 4PMYA 1U83A 4E3VA 4OV4A 4OZOA 1XSJA 1UBPC 4UNLA 4OTKA 3T2QA 5A8NA 4H6QA 3O5OA 2G95A 4NI8A 2Z24A 2PLKA 2OO0A 3SCSA 2VENA 3TFCA 3DFOA 1CXHA 3W7PA 3L7RA 1JFXA 3ZR6A 4J3WA 4FR1A 3LPOA 2Z1WA 1R3SA 4M7TA 3WLJA 1WUFA 4O19A 4UR8A 4Z0JA 3UPMA 3WQCA 3MP3A 1B3XA 2GGIA 1AD4A 4WUIA 3GIQA 2ZBTA 2A3HA 1OC5A 4WVXA 5I3IA 5JIWA 5CQ1A 4JQ4A 4ADTA 3F03K 3CQHA 3KS5A 1Q6GA 3UCQA 1TYGA 1POKA 4YU1A 3SJ3A 1QNQA 4XZLX 1XIFA 2ZA1A 4H3DA 3ZO9A 1VFFA 3EKGA 3ITVA 3K1DA 5DXXA 2B7OA 5BNKA 1B2YA 2C15A 3CGTA 3HV8A 4RW3A 3VZYA 2CLPA 4JYEA 2Y62A 1T8QA 4PMQA 1WE5A 1FCBA 3UQAA 2I5QA 4I8DA 3UQBA 4ZQOA 4O52A 1BXNA 1LT8A 4NJKA 5BU9A 4AU0A 3OIHA 3MMTA 2QUTA 4D72A 3UFYA 1B3WA 5G2HA 3B8VA 1YPFA 4DPPA 1JVNA 3B04A 3BSMA 1DYSA 2W4XA 3N2OA 1V3JA 2CBVA 3MKVA 1VCVA 3HQPA 3PBWA 4I6KA 4PUJA 1EQ3A 2PTWA 1K8CA 1PS9A 1P43A 4OGZA 6REQA 3W73A 5LA2A 2XWDA 2XGZA 3OOBA 3T40A 5A8OA 3BV4A 3CB3A 2V2HA 4KRUA 4AZ5A 2C8NA 5DELA 3LEPA 2JALA 1XLGA 3NVTA 4PBEA 4D9PA 2GQ3A 3HQOA 1AK5A 1O5XA 4QQUA 4ZOBA 3HGSA 4AISA 4GVFA 4KFNA 3PY2A 4NZFA 1NVMA 4GHRA 2PP3A 4GJ1A 3B4UA 3U8GA 2D22A 3PG9A 1FWIC 2VKZG 2P10A 3EIPA 4Z1BA 3TU9A 3WD4A 4Y96A 4QITA 3S2MA 3TC7A 1P0DA 3NFUA 4UTWC 1UB3A 4LVAA 2NWSA 3RX3A 3UXKA 4NASA 1H62A 1PDYA 2DJXA 4PMOA 1F07A 4C6MA 1RSCA 2V5LA 1JPIA 4I5RA 3KW3A 3T0BA 2F84A 1HG3A 1BQCA 3MO4A 4ZOCA 1U2YA 3CL8A 3EPOA 4C6EA 3DC8A 3Q4DA 3VK5A 2GDVA 4C6LA 1Z41A 4DLFA 3ZJ8A 4V28A 4DY1A 3NGJA 3ARZA 4C6DA 3ITGA 3RITA 1KXHA 3BMVA 4HBKA 3RX2A 2FH8A 4FLRA 4NF7A 1P1XA 4QIUA 2BASA 3R0KA 3LCXA 3WG6A 1DJQA 1QNRA 3V75A 2YCIX 2HE8A 3SY8A 3UJRA 2CERA 3B8SA 3USBA 3ZZ1A 1IT7A 3WLLA 3NL5A 2JE8A 1LRQA 2CFFA 3AZSA 2YBVA 2CC0A 2DSZA 3LBOA 8A3HA 4Q4OA 4YPJA 1LJYA 3GWQA 3VAWA 4S3JA 3AHYA 1KQZA 3LXCA 2ZE0A 2R1KA 4JN7A 3FX4A 3NL6A 2AWGA 3ALFA 2VO5A 3OA3A 1QOXA 1O5RA 1QW9A 3VDCA 3THCA 3A24A 2P0IA 4DZHA 2L5HA 1FKSA 3SB0A 1WOBA 4JL2A 2C71A 4QRNA 3C86A 2E77A 1UWIA 1HJVA 2WJDA 1Q4WA 3CYVA 2WK2A 5AN7A 4QJ4B 5KITA 2IF4A 4GC3A 2DT3A 3FJLA 3HPZA 4IMCA 3FAWA 4H6RA 2EPNA 2PGRA 3W82A 3N6JA 4DROA 4ZE5A 1PZ2A 1HVXA 3GH7A 4X2PA 3A22A 1A5SA 4ZXOA 3LERA 1TVNA 1IXQA 2GLKA 2DG9A 3GVVA 1UD5A 3W1LA 3IIXA 4QG9A 2J79A 3CASA 4W5UA 1X7IA 1L6GA 1DQXA 1UMYA 5TNVA 4JL1A 3FGCB 3L65A 1XYBA 4AXNA 3VNYA 1JGIA 1AH3A 4YIWA 2X42A 5HUOA 2DEPA 5D37A 4C6NA 4DT4A 3H2CA 3EWYA 3MWAA 3THUA 3V5CA 5FAGA 2BXYA 3W00A 5F1UA 1GPWA 1SJDA 3CZEA 3W7OA 3RMEA 2I1OA 2KFWA 2ZRYA 4AEFA 3O5RA 3TV8A 1J4HA 4PEEA 2NQLA 4PEKA 1I9CB 1Q6IA 1TPH1 3U0HA 2RUSA 4AXKA 3LUOA 1ZL1A 3TYUA 2Q02A 3WYZA 1LCOA 1KM1A 3E02A 1RLDA 2BVTA 4JFSA 1GW9A 4MPKA 3MVTA 1OF8A 2YFOA 2V30A 1H09A 5FF0A 1WX0A 1OX4B 3QLLA 1RBLA 2C19A 2QCEA 2WJZA 2Z7KA 3WLIA 4UZSA 3AMGA 2DSVA 2VCDA 4KH2A 1PIGA 4E4PA 1U79A 2QIWA 3V36A 3BG9A 4FLSA 1E43A 2YLLA 4DZ5A 4QG8A 3VU2A 3C2EA 1TSIA 2VR4A 1B3VA 2ATSA 2RUCA 1M41A 3W9ZA 4TVDA 1YPIA 1FCQA 1R9ZA 1G4TA 3S5NA 4BQ5A 1OIMA 1R3WA 3EEGA 2Z4GA 1GQJA 1UZDA 3TCEA 1KCKA 1YKWA 1SJAA 3GKFA 3BW4A 4W86A 4R88A 3HG3A 1QPRA 4KFPA 3JUGA 2G3IA 4JTDA 1C29A 2TODA 4H8VA 5HR6A 1K9EA 3UWYA 4AZ7A 4K3ZA 1VENA 4Q8QA 3R7MA 1FH9A 3RCMA 3L23A 2YCLB 1H7RA 2EO7A 3IWPA 1CENA 4Y6GA 1BG9A 2X0YA 1ZFJA 3NAVA 4R5EA 3N2XA 4NQ1A 1BRLB 4R85A 3ZSTA 1CLVA 4JEQA 3NZGA 1XM3A 4ZPWR 4AZIA 2UZ9A 1A80A 3LYEA 1LTDA 2D69A 2ACQA 2CXEA 5E9AA 4JFUA 1GONA 4O1CA 4A35A 4M0XA 2WQPA 4LSBA 3QHOA 3ZYZA 3GFYA 3M0XA 1L6WA 3CWNA 2DZPA 2XP5A 4CKQA 3ARTA 1OFPA 4U2YA 1TA3B 4A3YA 2XJ7A 1JDAA 1RXOB 1OK4A 1VS1A 2GOKA 3KHJA 1TPWA 1V0KA 2DH2A 3PZGA 4Z1YA 4X0NA 3WKZA 1BQGA 1JCTA 3UG5A 3IAQA 3W7JA 2DIEA 4LF2A 1A0EA 1KR0A 3GUGA 1J4IA 2ZUSA 4E38A 4HZ7A 3V1HA 4CEUC 2GVEA 3POHA 2GJPA 3LENA 1BYCA 1MUMA 1VJIA 4G8TA 1X8CA 4M6PA 4UNIA 4FXSA 4FNTA 3SGUA 2E28A 3IHZA 1FA2A 1O60A 4H2HA 4JFMA 1AH4A 3C8FA 1PWMA 4HCDA 4AX7A 3A4AA 1JCJA 4CD5A 5FF4A 1ZBWA 3LCIA 3CHVA 4YWIA 4DPQA 4TMCA 2AQOA 3UWEA 1J0JA 1KTCA 3ABZA 1XLCA 4AX6A 1FRBA 2VQUA 3IKGA 4JTQA 4CU6A 2OSWA 3WUFA 1WDPA 5C2GA 1EGVA 2Q6ZA 3KBJA 4RDVA 3UWQA 3SSZA 1Q3NA 2OODA 1EP1A 2B4GA 3BSHA 3VD5A 4CN1A 4IL2A 3SUWA 4AHQA 3VM5A 3TUUA 3BCJA 1JULA 3GVGA 1X39A 2ADAA 4IT1A 5E09A 1GQIA 1X8FA 3UW6A 3ISIX 3T44A 2PDHA 1WCGA 3GK0A 2ZRXA 3ITLA 2FVKA 4IISA 2E9LA 5AC8A 1KFCA 4CQCA 4IMGA 1FDZA 2BHYA 1UR4A 4S3EA 4C6IA 3UETA 3WN6A 3FK4A 4DM1A 2OZTA 5SWUA 2FPTA 4LAOA 5FA5A 1B90A 3ZWTA 2FTPA 4PBFA 1LQ0A 1WXYA 2Z25A 3MCNA 3CHEA 2BNJA 1XRTA 1K70A 4MB1A 3AMCA 2Y5SA 4UR7A 4DJFA 5ECUA 3W25A 2CZFA 1PE1A 2OXNA 1J6PA 1EJTC 1SR9A 2A1YA 2ZUWA 4NIRA 4B15A 5DN1A 4IUGA 1DPMA 1L6FA 4GY0A 1YQ2A 4PFHA 3PPCA 3GHSA 5A69A 3OQ8A 1UWSA 4IHCA 4UFLA 1Q6HA 3QV7A 3WBXA 4GJIA 4GCXA 3BZGA 1U22A 3KRSA 4N6EA 3PZUA 1P0BA 4L3NA 4KQNA 3TW6A 4C7FA 2FJKA 1ZP3A 1JRCA 2WMHA 2XU2A 1UIOA 2NX1A 3V5OA 1GQNA 3M47A 4OE7A 3BPWA 4PRWA 3UWZA 1GYLA 3UXDA 4O0ZA 2JF7A 4A22A 4B9YA 3PWGA 2XM2A 3RYSA 3LV5A 4BF9A 2F38A 2Z2BA 5D8WA 3O3RA 3TTQA 3UPWA 3VNKA 1KBLA 4JD4A 5TBOA 3S2JA 4PODA 3QVQA 1KWKA 1J2WA 3SZ8A 2YB1A 5A8GA 4JEJA 4HU4A 1VPYA 4TV5A 4F0HA 3NQFA 1VYRA 3TR2A 1RD6A 4WY0F 4PTVA 1CXFA 5HQMA 5CPMA 4RR4A 3HOJA 4AC7C 5TD4A 1S39A 4LQ1A 2WMIA 4NHVA 3W1UA 4B90A 3PUGA 1GVFA 4KRZA 1KFLA 3OHMB 3WQPA 1OWQA 3URNA 2XP4A 4FXRA 3FSUA 1EX5A 2A6LA 4ZODA 2XIBA 4O17A 5GPRA 3UI4A 5JBFA 3K46A 3LB0A 2XP9A 3WMBA 1OK6A 1PTDA 4M1RA 1EQPA 1F7BA 4ROPA 4G56A 2D3LA 1YLVA 3VIJA 4XIAA 1CGVA 3R58A 3BQ5A 1KM5A 1PB0A 1SO6A 1JF6A 1KXVA 1LUCB 2XIQA 1EA0A 2PN0A 1NQ6A 4PYSA 1A3XA 1BYBA 1LLWA 4E8GA 5LIWX 2BODX 2BY1A 3OO2A 1LRNA 1MSSA 2Z1BA 1B57A 4US5A 3GTHA 4TX6A 4YLWA 3W88A 4IMFA 3FVDA 3O0FA 3NI6A 5XIAA 5FJPA 4RKAA 4N4QA 5DQPA 4MGGA 1IT0A 1A5KC 3HIJA 2NVDA 3GZ3A 3RJXA 3VXGA 4CEXC 3PAJA 4Y9OA 4QXIA 4IT4A 4QGCA 1BKFA 3I6CA 4MFEA 1G7UA 1QO2A 4EPDC 2QCMA 2VEGA 1BG4A 2BHUA 2ETNA 1TUFA 3NQ7A 4D6DA 4H83A 5HR7A 1C8XA 1XKJA 1XLJA 3WFAA 3ZR4A 3VKJA 3ZS4A 1C7TA 4ZB5A 3QF0A 2GQ8A 4JIEA 1E6RA 2PDIA 4DEFA 1ZB5A 1JAEA 2WC4A 2WPGA 2D2OA 4KIRA 3CJPA 1HXJA 3WF1A 4W9OA 3MVIA 3JYMA 4Z2JA 1K02A 4LNCA 1E6PA 1SMDA 2AQVA 1R47A 3SQLA 1LLZA 3U5YA 3AHTA 4HOZA 1UOZA 5K4XA 1DORA 4H4IA 3G8RA 3B06A 3ES7A 5E0CA 4GI8A 4GIAA 4TTGA 4JFLA 4CD8A 5I78A 1C8VA 1MFUA 6XIAA 1WQ5A 3UI6A 4RPPA 4AG0A 2J7GA 4GX9A 1HXVA 2C7FA 4K1WA 4B91A 4MYXA 4GFIA 4A3RA 1P6BA 5G1TA 1BLIA 8XIMA 3CV2A 2Y85A 1MDRA 1BFNA 3VD7A 3WDRA 2YBTA 4ZQCA 2NSXA 1TWWA 3V7PA 2CPUA 4UR9A 5CZ0A 4H41A 2V2DA 2YZ5A 2PTDA 1E51A 3IPWA 4CN6A 4MJ2A 1H60A 2V9DA 2REQB 1G0CA 4H00A 2FH6A 4LAVA 1NDZA 4WDTA 2ZZ7A 1CXLA 4AYGA 2E3ZA 2ACRA 1JCMP 1T7LA 1GVIA 4L4MA 3M6DA 1W1VA 3LG3A 3PZ9A 4MOZA 4B92A 1MEIA 4FALA 1X7FA 3S46A 1BKSA 3QHMA 4HU8A 4XK2A 4XO6A 5CPNA 4GMEA 4K36A 4WY0A 4MY9A 1QVBA 4BI7A 1CW2A 2Z29A 1W0MA 5E93A 5A6MA 2EKGA 5KZMA 2OGJA 3W7IA 2WLYA 3Q58A 3VOFA 1DVJA 2FHBA 1SZRA 1RVGA 5HULA 3VIOA 1I60A 2VFFA 3L2IA 5AHFA 4M56A 1L8PA 4Y90A 2EPMX 2O55A 5LA1A 1TJ1A 1SO3A 3LX9A 4NU7A 4RDZA 4F79A 1A5UA 5JH8A 1TTPA 3W7KA 1WZMA 3CL7A 4IQCA 3EX4A 3MMWA 2J6VA 3BZJA 2C79A 2DSKA 2VX6A 5EY5A 3DKJA 3WBEA 2YA2A 2VD8A 5D9MA 4O14A 1QI5A 2KI3A 4WKAA 3WDHA 1G1YA 2W6RA 4MLJA 2MLXA 3O05A 4CNTA 1H7PA 2TYSA 4BCEA 2FZ8A 3PVFA 3UJSA 3TYBA 2OGYA 1T5AA 3W2JA 3ARSA 2I5GA 4UTJA 1S1RA 1E0UA 2NQJA 3O5QA 1F2JA 2QJGA 3SY5A 4QM1A 1JZ2A 4HNVA 4PA8A 4L7ZA 3PF3A 2YSWA 1TQXA 1ZBCA 3CNYA 1UKQA 3L4ZA 4A8NA 4J27A 1PKMA 1DE6A 5CKSA 5XINA 3O6YX 2PBGA 3WD2A 3CUXA 2J24A 4HA3A 1HUVA 1VKFA 4K8EA 3TZFA 3VOHA 2ABBA 4DXVA 2VVSA 2WO5A 2XSAA 3TLLA 1OX6A 3E0VA 5ABGA 4H6KA 4Q32A 1UROA 1XH2A 5DRIA 1R6WA 1Y0EA 4WSKA 1XFCA 3OQEA 2PDMA 3LTYA 5DMMA 1UD3A 2OPJA 1OT2A 4RE3A 3RN6A 1WA3A 2PWFA 4FXFA 4Y8FA 4GNJA 2ZDRA 2Z2AA 3H7VA 4MWAE 4WRHA 1QHPA 2QCDB 3QQWA 1TWSA 4ACYA 5I98A 1Q1CA 1YW5A 4AVOA 1EO5A 4PTXA 4JYFA 3OVPA 3QEZA 4GUFA 5HPOA 1BWKA 4EWND 1PHQA 4DI9A 2W5FA 2YA0A 3KM8A 3UWWA 2NQ5A 3VPLA 1OC7A 1OFOA 1YNPA 2W62A 3IAPA 3EXSA 5FF7A 1W3IA 3LXAA 5LGXA 3QJAA 3O63A 1JCNA 1WKDA 3A4XA 3UGVA 4D8AA 3WF3A 1Y5XA 1QT1A 2B0MA 2CBJA 4NX5A 3PA7A 2R91A 4KEUA 4B5VA 5EA9A 1J2BA 1W54A 4DO7A 3GC4A 4L6OA 3OBKA 2OLHA 3G5EA 3O5GA 3G22A 2FPVA 5KZDA 1NP0A 5C70A 4QT3A 1D3GA 1H50A 1RUSA 4FAPA 4LT9A 3EX3A 4PUUA 5GVJA 2RFGA 3H24A 3GIYA 5BOFA 2XVKA 1JZ7A 1IZJA 5HINA 5DANA 1R3VA 1EF2A 4RJEA 3RF9A 3G1SA 4IFOA 2PURA 3W70A 3FIGA 4O1BA 4IZGA 1FBAA 3A6OA 1F6PA 5LIXX 1ADSA 5I5RA 1E5JA 2BDQA 1B6CA 4TNSA 2IXUA 5E1QA 1OT1A 3L21A 4LYQA 9CGTA 3QGAC 2PU0A 4JTRA 3VGEA 3LHUA 4Q3MA 1IX5A 1UQYA 4AF0B 3H7UA 4G2PA 3KP0A 4NJHA 3NGFA 1NF7A 3P6LA 2PV2A 3NSMA 4PMNA 2V6AA 3I6TA 3PUDA 2PV1A 1JR1A 3H4GA 1GZ1A 1UC5A 5U7SA 4WCJA 1IGSA 2X2YA 1KLZA 1XX1A 4H2CA 2EG7A 1SYTA 2VUYA 2DJLA 3RGTA 4GJJA 1FP8A 4UCGA 2PC4A 3JR2A 2J7FA 2SFPA 1VRXA 3WUGA 1BD0A 1UYQA 1PPIA 2DIKA 3GW3A 5D03A 3M5XA 1QI4A 1UW9A 1SM9A 3MQTA 1HKMA 1RALA 2NZLA 1EGMA 3MSDA 3ZT6A 4GZJA 4GQQA 1HW6A 3TH6A 1QASA 3PR9A 5CEWA 3LNPA 3DFHA 3NQ8A 3DFYA 2YL8A 1O5QA 2V5KA 3WX7A 3GTXA 3MANA 4LAXA 2VTFA 2WMJA 1QPLA 3CV7A 1ECEA 2D2GA 5HATA 3TXVA 3WQFA 4NL1A 1R9HA 2OX1A 1V93A 1KWGA 1KGWA 1L1PA 4EOUA 4PMDA 1XYZA 2ICSA 3KTXA 3QGVA 1Z44A 3IK8A 4PUKA 2VHLA 5BXTA 1JDEA 2PGWA 3S0CA 3LRKA 4GUIA 1J01A 3S9ZA 4YTTA 2DG4A 1IEXA 3R2GA 3TSBA 1GOKA 1EO7A 1GORA 4L1GA 2V5CA 3O5KA 3WQ8A 2JKAA 2ONEA 3CPRA 1M7JA 2WSKA 5CBJA 3C6CA 4QHRA 4W7UA 4TQTA 1E3ZA 2ZR4A 1XSKA 2DT1A 3UVAA 1ZENA 4OBSA 4GWEA 4L65A 5EKYA 4CNUA 2Y70A 2PWEA 3QSTA 3O5DA 3WEMA 2I5IA 4UTHA 3NPWA 1ISVA 3A9IA 5DBTA 3PK7A 1V08A 1ZK6A 4PC8A 1Q7QA 3PRBA 2YYTA 3QR0A 2G41A 3M0KA 1A0DA 2YL5A 2PUZA 3F5LA 2BS9A 4W8BA 3VKCA 2NQHA 3AIQA 4AUBA 4KEVA 3W0KA 1FWHC 1OY0A 4AZCB 3TOYA 2HK0A 3CPUA 4FNPA 4CCDA 2NXGA 1XLBA 4NJJA 5A8PA 2Y8KA 2PE4A 3JXVA 4D6GA 4H9MA 3AXKA 1KBIA 1L9WA 1KC7A 3R0UA 1F4HA 3SN1A 1ZS2A 3TC6A 3M0YA 3QTPA 2G3NA 3BLOA 5GJNA 5A2CA 1JPDX 5EL1A 3W02A 2V5DA 1D7IA 5JBDA 4H01A 1BTCA 2JEPA 3THQA 1UQZA 1YTEA 3R25A 2OYKA 3DI0A 1EDTA 2GFTA 1US2A 3ZLHA 1UCWA 3AHXA 3C2RA 4MSSA 4A8RA 1H2JA 1M6JA 2DVTA 3VIGA 4JGDA 4XBSA 3TJXA 3BG3A 3ZR5A 4JTLA 2VOMA 4GG9A 1GHSA 3SQSA 4G2DA 3U7VA 4NZ4A 3CZLA 3N73A 3RJYA 4MJ4A 3RRAA 4KCWA 4DBUA 3P0WA 3ZT5A 5HXMA 1WBJA 5C54A 2Z7GA 1B9ZA 3FAXA 3WK0A 1VEMA 3G1FA 3OLDA 3GNNA 5DITA 3AOFA 1LLOA 2CNCA 2WYSA 3WQOA 4O1EA 3H21A 3VOCA 1UJQA 2VFHA 4WGXA 1RA5A 3ITYA 4O57A 1AD1A 1TV7A 1YPXA 3KL0A 4E4UA 3G0UA 3S4TA 1Y8BA 1JJKA 4AAJA 4GKLA 2IQDA 4X22A 3WLHA 3I4KA 1QU4A 1NP2A 1PXGA 4MKSA 1V8EA 3VIHA 4C6OA 4XZWA 4N9DA 1XGEA 5HWBA 1OYCA 2FZDA 2FYMA 3B8DA 1H1NA 4IQ2A 1ZQ5A 2MF9A 2BWGA 1Z8AA 3EMCA 3IVSA 4KR0B 1GKQA 1PX3A 1VFLA 1X1OA 2V3DA 4HNUA 5BOOA 4AWTA 1E1CB 2QF8A 3N2BA 1I6NA 4OV9A 2ZQ0A 3AYTA 5HJXA 3P93A 3NTPA 3DFQA 4DRMA 1QPNA 2IPWA 1Q7MA 4D6CA 3AI0A 1HP5A 3UD6A 5C2CA 4DRPA 1PVNA 3E5PA 3AIBA 3WJXA 4X3ZA 3F2BA 4ZQRA 1QAPA 5ABHA 3A21A 4DLMA 4JTEA 1AH0A 3CZ8A 1PYMA 1QR7A 3E2SA 3W29A 4HBOA 4AD4A 1TE6A 5REQB 2OQHA 2Q8ZA 1XLHA 4FP1A 3KLKA 3O5LA 3WUEA 1MZRA 3WH5A 4MNMA 4NG3A 2PDLA 2XPKA 4J3ZA 2UBPC 4DF2A 3LCFA 1GUVA 3W6MA 1GJPA 1EOMA 3S83A 5CPSA 4AHPA 3WH8A 4M6VA 4FI4A 4LALA 4XKYA 4RDYA 4QIBA 5IOBA 3NQBA 3SN0A 1FY6A 2C3ZA 2ZRWA 7ENLA 1K7EA 1PKLA 1XC6A 4G1KA 3VIKA 3QGKC 4ZMGA 5C6MA 4I7VA 3HPXA 4KWOA 3N4FA 3MMDA 5K9XA 1ZU8A 1X96A 1YBQB 2Z1XA 3PTMA 1O95A 5FKYA 3B9OA 2BB0A 1TFVA 3T0DA 2YOCA 4IF2A 1KM3A 2QJNA 4N9EA 3DYOA 4V1XA 1JYWA 4R3UA 1VJSA 2FMNA 1C90A 4Y8EA 3PANA 4BF7A 3ZT7A 5D2WA 3FKKA 1CIUA 4QEEA 2GUBA 2ON3A 3EOOA 5I3HA 3BVJA 1JZ3A 5BRBA 3WQDA 1P0NA 5HWMA 1YMYA 4GFSA 2ZKMX 1XIDA 3LHYA 5FEZA 2PU1A 4EWJA 4LGXA 1HJQA 4E5TA 5C0QA 3IJ7A 1LL6A 3CM4A 3CLMA 3IVUA 3U3HA 4IFKA 3N25A 2X30A 2PBOA 1QCWA 3VI2A 3UZJA 1XBYA 7A3HA 1E6SM 4S23A 2IS7A 3R10A 5A6BD 3NPXA 3T0AA 5BMXA 1ADOA 1BGGA 5AHIA 1Q6EA 2RDWA 2OOGA 3C0JA 4B16A 4AVNA 1LQ2A 1ZCOA 4QROA 1JG9A 1K4GA 1NMVA 3LUTA 2WOQA 3OZYA 1NWUA 2I56A 3KAIA 4N02A 1JVWA 3TW7A 3BDKA 1DQUA 3S5ZA 3MU7A 1J5SA 2CBUA 4IUOA 4YVPA 1XV8A 1TWZA 2ZRVA 4EE9A 3SCRA 4F0RA 4IPPA 2ZCGA 1TV5A 3R8HA 5GQBA 2OX4A 1FUYA 1U5JA 4BEQA 1NDYA 3R5EA 4UCFA 1RZMA 2Y7EA 4PMRA 4FMVA 1ZY9A 3R8RA 3EWZA 2DZWA 2OEMA 3NUKA 2FAPA 4GZIA 1FJDA 4NAEA 4LRTA 1EPXA 1XC4A 4QFUA 3WDJA 5TF0A 3NO3A 3VO0A 1EJWC 5FI8A 2C18A 4JN8A 1TELA 4BK9A 3OODA 3PBGA 3FXYA 1F73A 4C6PA 2V5BA 2Q01A 1O5KA 1HJUA 3G3MA 3VKAA 5D38A 4J4NA 1V7YA 5DF0A 4LYKA 1VZWA 4LUSA 3PUEA 4QJ1A 4R27A 2RJHA 4HP5A 1HJSA 2DFAA 2CIPA 1W9VA 1XD0A 3BANA 2DPEA 4MGVA 4CQ9A 2F6UA 2WBKA 3ZVHB 3LZ5A 4CNNA 2ZQVA 4U86A 1IWPA 3NOEA 2JKPA 3R13A 3BQ6A 4NUWA 3PFMA 3VD3A 4QG6A 3GDTA 4DJEC 4MWAC 4AD1A 3SAZA 4OWGA 5HOSA 2LGOA 1Q2RA 4GH1A 2XN0A 2O7QA 3P3BA 3CIXA 3PPHA 3W86A 1K3UA 3ABSA 1L6SA 1HGYA 2PF0A 4FX7A 3PRDA 4IPLA 5HMDA 2J27A 1W9PA 5J5DA 3M1ZA 4FHAA 3MZ2A 2HPIA 4M80A 4CUCA 4GBUA 2W3ZA 1MEHA 2BSLA 2Y89A 3VKDA 1F40A 3L2MA 1DWGM 1IE7C 3T1GA 1EKOA 2E0PA 3WUBA 3EDFA 1GK8A 4IQEA 4MHBA 1UWUA 1EX1A 1SJBA 4GOAA 4ZPVR 2W27A 3IJDA 2FLIA 4LJ3A 3KVLA 3CGMA 5D2VA 3B9DA 4LUYA 3T9PA 2FVMA 3WBYA 1KM2A 1PSCA 3U6WA 3Q45A 1W5OA 1ICQA 2Y4SA 3FCPA 3THDA 2P4VA 1GHRA 2WNWA 2Y24A 3OBAA 1ZSXA 1VRDA 2EHHA 4DH0A 4GINA 1UP3A 3EB2A 3DESA 1Z32X 3CZKA 1E5NA 4FN2A 3FOKA 4OQVA 2X1TA 3T42A 1EYMA 4GQ0A 2FIQA 1UD8A 1JYXA 2BXZA 3WEZA 5DX7A 3M0LA 4J9JA 3TN6A 3VABA 2VJXA 4DRKA 2YFNA 2J7CA 2Y5EA 3SGZA 4HNOA 4Z17A 4DBSA 3TTEA 3QKEA 1VBUA 3E0LA 3BLEA 3CUFA 4Z0SA 4UQ9A 3TAKA 2E68A 4M6UA 1DJIA 4L6HA 4DJDC 3BLIA 3EKLA 2QJHA 4YL2A 4XZMX 4JHZA 1QWGA 3OVRA 1DWAM 5I79A 4J3VA 3MB9A 2GSJA 3GU2A 2RQSA 3CUHA 3MHUA 4I3GA 2ZXDA 4NZ3A 5FSDC 3AXMA 1TG7A 2HJPA 1KM0A 4K7YA 2X09A 4M1BA 3V4BA 4MTVA 5BYWA 3QTGA 1T11A 1EUAA 3ABOA 2J66A 1W9BM 1T40A 4AWUA 5CGMA 3VVGA 3NM3A 3NPVA 4S3BA 1S2CA 3N11A 4PUMA 3GD6A 1W26A 1XD1A 3W6LA 4F66A 5FEXA 4GY7A 3N12A 1TE1A 2JZVA 1WZKA 4Q8NA 5BWAA 2H3DA 3PPFA 3STFA 3UT0A 1UP0A 4IPJA 3S2NA 2B5UB 4ZSUA 3UCDA 1PTAA 4DO6A 1B4KA 1OZQA 3A4WA 4U31A 2CZEA 3SUTA 2HQAA 3S1XA 1UD4A 4WLCA 3TTOA 2GSHA 9RUBA 2ISVA 3NO5A 4YNGA 3EPMA 2IKHA 1RCQA 4BI5A 2WCAA 2PRLA 4PB4A 4TU1A 1A47A 2OO6A 2XSBA 1TV8A 3CAKA 4JX6A 3RFWA 3WLSA 5G1YA 4OUEA 1WKYA 3KBVA 3AS2A 4AD0A 4LV9A 4W8LA 1IZKA 1TCMA 4RL3A 2VVNA 1UR3M 3HJEA 3C52A 1BEUA 1US3A 3KE0A 4JFWA 1KBBA 1M04A 3OJGA 4G9PA 3WSUA 1DBTA 2ATMA 4C7DA 5CH9A 3WNMA 4GABA 4ZEPA 4DO4A 1Z7AA 3APYA 5A8QA 4IFRA 1HL9A 2WW5A 4DIPA 4XD5A 3TYAA 2BOFX 5M03A 4XVEA 4AIUA 5A6TC 3A47A 2PDQA 4WK9A 1MZHA 2INZA 2G37A 3W1NA 2WM0A 1ZJBA 3S2LA 3WL