1HKJA

Crystal structure of human chitinase in complex with methylallosamidin
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEQSGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Allosamidin Derivatives in Complex with Human Macrophage Chitinase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords CHITOTRIOSIDASE
total genus 123
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1hkjA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1hkjA01
2VZSA 5E6YA 3BCFA 3AI0A 3AHYA 1OGSA 2VURA 1OGBA 1BYCA 4MAVA 4HA3A 4XZBA 1E4MM 2CITA 3OLIA 1E0XA 1R85A 1J0ZA 1V3HA 4AZCA 2EPMX 5A6KA 1AQ0A 1E72M 2J77A 5A6MA 3EMCA 4OOZA 3VMPA 1V3IA 2VTFA 3N12A 2HVMA 2V5CA 4MB1A 1J01A 4CU7A 1Q6GA 2DIEA 4E2OA 2J47A 4AISA 4AEEA 2Y8KA 3N13A 2DSZA 1E9LA 2ZUTA 3W26A 5CGMA 5HDRA 3WQVA 3U57A 2E8ZA 3UG4A 2FHCA 4FLSA 3WEZA 1UD3A 4NRSA 3VTRA 1MQRA 2VX4A 4MJ2A 1E6XM 1GQJA 1JYXA 1E3XA 4AXNA 5I78A 3VD4A 1UD8A 3VUPA 5JIWA 1UD4A 4RE3A 1E0VA 5BYWA 4U2YA 4B9ZA 1KWKA 2WVUA 2GJXB 1ISWA 1VAHA 3GH5A 4IISA 4PMQA 3OB8A 1V6VA 2C0HA 4ACZA 3CUFA 1M7XA 4GKLA 1JAEA 3VGEA 4AD4A 2WSPA 2WK2A 4RE2A 4MB3A 2GDUA 5FCZA 3ZJ8A 2PWEA 1D7FA 4F9DA 5F7UA 3BAIA 2WNWA 2ZICA 3FY1A 2D2OA 1GNXA 3WNPA 4AW7A 3QOKA 3BSGA 3EDFA 4AD1A 3GH4A 9CGTA 2WAGA 1TZ7A 2E9LA 3W24A 2DGAA 2G3IA 1W3HA 7CGTA 4KH2A 4DUVA 2UY2A 1BF2A 1KXHA 1OD0A 2VR4A 5A95A 2BHYA 1GHRA 3AHVA 2GFTA 3WL1A 1KR1A 5I77A 1FOBA 2D1ZA 3MUZ1 4TUFA 1E6ZA 2J4GA 1I1WA 4LXFA 4M8UA 1CXHA 1W1YA 2AOSA 3GZAA 3TOPA 5CPQA 4AZIA 2YLAA 3G6LA 5IXEA 1TUXA 5CSUA 2WMFA 3F5LA 5D8WA 3ARZA 5I6SA 1JI2A 1Q4NX 4LYQA 2E9BA 4AMCA 1RPKA 2CCRA 2EPLX 3MU7A 1WZLA 1C8QA 1GJUA 2ZIDA 1NP0A 2PC8A 1CGWA 3WUBA 2NT1A 1JZ5A 3W53A 1GQIA 4ZXOA 2WMGA 5C8BB 1HX0A 3A4AA 1XH0A 4KRUA 1HJQA 1XCXA 4PEEA 1WP6A 1CBGA 3GXDA 5EB8A 2J7FA 2YL6A 1C92A 3UR7A 3WQ6A 4PMUA 3OGVA 1C8XA 2VCCA 1G0CA 2RGLA 1US2A 1KCLA 2X0HA 1NM9A 2BV9A 3RPMA 2XVLA 1UD6A 3KL3A 3HJEA 3L4ZA 1UOKA 1HJWA 5A6LA 1MVYA 1V3LA 1VFMA 1DWAM 1UWIA 2VMFA 5BWFA 3FHQA 2VRJA 1KGUA 3ZIZA 2YL9A 2A3CA 3AYRA 1MW1A 3I3BA 3GDBA 4HMCA 2YL5A 4QFUA 3QGVA 3NDYA 3UG3A 3O9NA 1EDTA 3VIGA 5BXRA 1DWFM 4MNKA 5DF0A 3BXWA 1A47A 3AMCA 1X6LA 3ZSTA 1JNEA 4ACZB 1K6AA 1V6YA 2ZUMA 3N1AA 4W7WA 3RILA 3MSGA 2VOTA 3SCUA 3ZO9A 2FH6A 2Z1SA 4HOXA 3VIOA 1VFUA 4D6FA 1MFUA 2J7GA 2X0YA 4MADA 4QP0A 4D72A 5IFPA 3AICA 2DPEA 2D23A 1UWSA 1EHAA 3VKKA 1JZ4A 2W67A 4JCMA 3OG2A 4X0NA 5M17A 2VO5A 3WEMA 3W38A 4FK9A 4LGXA 4M1RA 4H04A 3QHNA 1B9ZA 1QI4A 4XUYA 1E70M 1PZ3A 4GI8A 3MUAA 4V28A 4ATDA 1V0LA 1FFRA 5JUVA 5M3WA 2X09A 3IJ7A 2XG9A 1JZ3A 2E3ZA 3VIFA 3FXYA 7A3HA 2GJPA 2Y4SA 2PB1A 1OSEA 1VBUA 1J0YA 3VGGA 3TTOA 5JH8A 4PYSA 1KFWA 2QHAA 3A47A 3EDDA 4JCLA 4PMOA 3B8SA 3MUIA 4PMRA 2DSUA 1CYGA 4CCDA 3PBGA 2E40A 1NWTA 5D9MA 1JD7A 1F4HA 4KRTA 3T2PA 2IXUA 5GNZA 1QI2A 3DECA 4P8UA 4GIAA 4UQ9A 2UY4A 2FGZA 3CTTA 3UETA 1H5VA 4FF5A 2F61A 3BLKA 1FHLA 4JHZA 1R8LA 3BLPX 3WSUA 3NSMA 2WHKA 4W84A 1A3HA 1QNPA 3WUEA 5FL1A 1R7OA 3N04A 2RGMA 5EMYA 3MMWA 3SCSA 4CUCA 1W91A 5TD4A 3UESA 1KXVA 2XSAA 3F5KA 2CYGA 1HJSA 3JUGA 4B3LA 1IZJA 1XCWA 4GPNA 1LL6A 1E15A 1LL4A 1LF1A 3WH5A 1CIUA 5M03A 1TA3A 1QOXA 1XH2A 2CERA 1G9HA 1XSKA 5HPOA 2J79A 1NP2A 2ZWZA 1BYAA 1W9BM 3TTSA 1W9PA 2FH8A 3WUGA 5IDIA 1VB9A 1GOIA 5DT5A 1WB0A 2ZE0A 2D0GA 1W2VA 1O6IA 4UQAA 3MV11 3W6MA 4JHOA 4U31A 3DHUA 4H41A 4L4PA 3IAPA 1QI5A 1HJVA 1UH2A 1PAMA 2VQUA 5BRQA 1TG7A 2UWFA 1E55A 5CXPA 3THCA 3WN6A 2A3EA 2WKGA 2GJRA 2VRKA 4J3WA 1WE5A 1XYFA 1JZ7A 3WF0A 3WD2A 2GSJA 1XH1A 4CD5A 3AJ7A 3SCVA 1EGZA 1UH4A 3AOFA 2XPKA 4HOZA 3WMCA 3PZ9A 1J12A 3VILA 2HISA 4BQ5A 4AD3A 1B0IA 5A6AA 1LWJA 2ESCA 3NDZA 4WIWA 3BCDA 3W28A 2QV4A 3CHFA 3AS1A 1WZAA 3U5UA 1CXEA 4C7GA 1KBKA 3WH9A 1JIBA 3S2CA 5ABEA 5JBDA 2XGIA 2ZXDA 1AMYA 2XVKA 4XV0A 3WF2A 1GOMA 3GNOA 2YKKA 5A2BA 3AROA 1H2JA 3KL0A 2J75A 4PSRA 4EE9A 3EBVA 3II1A 3MANA 4CCEA 4CD8A 1XSIA 3GNPA 2VVNA 4CKQA 2WXDM 4F9JA 2W92A 3VD3A 5ABFB 1ZJBA 4P7NA 2A3BA 4WKAA 2V3DA 1ISZA 4P7LA 1QBBA 5GQBA 4Z2IA 4TTGA 1JD9A 1GUVA 1JFXA 1UWQA 2E0PA 4J3TA 4B9YA 2CBVA 5JBFA 4CVUA 1E1FA 1E6PA 1MYRA 4OOUA 3CBWA 1QHOA 2D0HA 4JKMA 2CBUA 1KCKA 2WYSA 4AZGA 1XYZA 2XUCA 1OINA 4URIA 1MXDA 3QHMA 4MB4A 2WVVB 4CD7A 2ZX8A 1C8YA 5KZ6A 4HZ8A 8CGTA 1D2KA 5IHRA 1LG2A 1HP5A 2XVPA 1W2PA 4H8UA 2J7EA 1EQPA 4D1IA 1V3JA 1UD2A 1EQCA 1CXFA 2CEQA 1VBRA 5EFDA 1QI0A 2YA0A 3CHCA 1DWIM 1KXQA 1ZBVA 4PMZA 2EJ1A 1MW2A 4QCFA 1PBGA 2E8YA 2BXZA 3GYCA 1Q6DA 1Y7VA 1E4LA 1B90A 2W62A 3OBAA 5I3DA 1E73M 3VPLA 1GHSA 2WANA 3AXIA 1BGGA 1GZJA 1VRXA 1RD6A 3CHEA 2NT0A 3VNZA 1JXJA 1NOFA 2O9PA 3AS3A 2A3HA 4YHEA 5D8ZA 2WC3A 3U5YA 4C7FA 1PX4A 1ZJAA 2WHJA 3N18A 3PZIA 2OWWA 1O7AA 2YBTA 3PN8A 1OT1A 3L4YA 4NSBA 3AXHA 3WMBA 2CIPA 1VJSA 2JIEA 5ABHA 5M5DA 3MUY1 4GQQA 3PZTA 5DMYA 2PWDA 2DT1A 2YLLA 2JEQA 1UKPA 2CKRA 1OIMA 3WELA 4TXEA 4PMXA 4N42A 5BXSA 3T0DA 1H0GA 2EO7A 1ZL1A 4D6DA 3ARRA 1V03A 2YOCA 1X6NA 4OIFA 2OSYA 2XGBA 3L2MA 2X05A 4FLQA 4U5KA 2VL4A 2VZOA 3M7SA 2WVVA 4U2ZA 4A3HA 3CH9A 4FLRA 4QLJA 3WDQA 3OZPA 1GOKA 4W5ZA 5BROA 1H0IA 1QBAA 4WJXA 2DT3A 1F4AA 3OLEA 3LMYA 4OBSA 3ALGA 1IT0A 1SMAA 3UR8A 3BAKA 3SUTA 5JIPA 3QOMA 3WDHA 2QPSA 1K9TA 2ZUNA 1E6SM 2WZEA 2CKSA 4TX8A 2BFGA 4JFWA 3K46A 4MDOA 3SUUA 4D71A 4MTVA 1BVZA 3ZT5A 3VX0A 4AZ5A 1UWRA 4DUXA 3SUVA 1E4NA 3WD0A 4UFJA 5EFFA 5GNYA 2D20A 1DWGM 1J0IA 4AZHA 3CHDA 1JG9A 3VINA 4Z2JA 1HT6A 5E0FA 4D6GA 4E4PA 2YL8A 3VIHA 3VNYA 3U7VA 5DO8A 4PCTA 1OIFA 2ZXQA 1BPLB 3WDJA 4MB5A 2CNCA 2CETA 3BSHA 3CIVA 1V6UA 1MQPA 2WB5A 4DWSB 4J3UA 3KZSA 3CZEA 2YBUA 5FOOA 3FAWA 4UTFA 2EPKX 4AD5A 3N15A 5AY7A 4HZ7A 4DWSD 3OGRA 4ACYA 1CWYA 1W1TA 1UQYA 3MSDA 4W7UA 1JXKA 2XHYA 4PMDA 4D6HA 3BMVA 3VVGA 3WBEA 2W66A 3SIMA 1ZBKA 1WDPA 3SCOA 1H11A 1EOMA 2VT0A 4H8HA 2F2HA 3AIUA 5I24A 1BG4A 4Z2HA 4MDPA 1ECEA 2FDMA 1H1NA 2J7DA 4C7DA 3RJXA 2JALA 1CDGA 3MMUA 1GVIA 3VMNA 4CD4A 3OGSA 4CCCA 3MO4A 4U3CA 4B15A 1ZB5A 2CESA 3ZT6A 2V5DA 4WKFA 3ZJ6A 1CXKA 4UFKA 1VFFA 1XC6A 5E0CA 1PIFA 3AIBA 3VDCA 3WDPP 3AIRA 3BAYA 2GDVA 4D6CA 2WHLA 1JI1A 2ZUUA 2W4XA 3WENA 5CSYA 3W81A 2VZUA 3L4VA 1E71M 1QHZA 4JAWA 3L4UA 2GJXA 4HPHA 1OCQA 1H3GA 2XWEA 4UZSA 4PMVA 1IZKA 1CNVA 1JZ8A 3AYSA 1G94A 4YPJA 1HJUA 3WD4A 4W85A 5CPSA 1DWJM 4M29A 2EPNA 4GZIA 4UNIA 2YA1A 4TVCA 2WMIA 1CTNA 1UZ4A 2BY2A 4PTMA 3VDAA 3WL0A 1ISXA 3FAXA 3IANA 1BQCA 1MW3A 1M01A 2WBGA 3UERA 1WPCA 1K9DA 4N0RA 2WW5A 4PTWA 1HJXA 3AZSA 3W0KA 3VMOA 3VU2A 4HOWA 4U33A 3D5HA 3VOCA 4BA0A 1CGXA 1E4IA 1E6NA 1PZ2A 2XM1A 1UG6A 4CN1A 1C91A 2D3NA 4L4OA 1B3ZA 4TOQA 5AYBA 2OWCA 1HN1A 1V6XA 6A3HA 4QLLA 3WQWA 4OBRA 1M53A 3VIPA 1CECA 2CBIA 5A2CA 4LX4A 3SEPA 4EKJA 2ZUSA 3WH6A 3I3DA 1G5AA 3WDRA 2WMKA 2VUYA 3AIWA 3TTQA 2JIWA 2V3FA 4UOQA 1CEOA 2W63A 1B1YA 5AC5A 4PTVA 1OWQA 5A8OA 5D9NA 1JYWA 2BNJA 3VD7A 3RM9A 3LPFA 2ZUVA 5FIPA 1PPIA 3T2OA 3L2LA 1BYBA 4JFVA 1UUQA 1PEZA 1B3XA 3PTMA 4MNLA 1H4PA 4H8VA 3VX1A 4DM1A 2WMIB 4W8LA 4J3XA 4ML4A 2XVNA 1BYDA 2ZXAA 1JYVA 3HMCA 3OLDA 4W87A 1KQYA 1W32A 3ZR5A 5D4YA 4NRRA 2J8GA 5A6BD 3CGTA 1UH3A 1E40A 4UFMA 2G3NA 1J10A 2VI0A 1H41A 1KWGA 2XIIA 1YQ2A 3MKKA 4HZ6A 2XVGA 4M82A 1GW1A 2G8ZA 3F4VA 1WNOA 2WBKA 1FHDA 2ZX6A 3BC9A 3A3HA 4J28A 1VEOA 1E6RA 2X1IA 5I5RA 1U2YA 1E5NA 1ZU8A 3AHXA 3QHOA 3PHAA 5AC4A 2QMJA 5HNNA 3W37A 2PWGA 3M46A 1V02A 1GJWA 1FH9A 1C7TA 1PIGA 2Z1KA 2BY3A 1SMDA 1JF6A 4HP5A 2UY5A 4TTUA 2WWDA 1UD5A 2BY1A 2D3LA 4YHGA 5AYIA 4W8BA 4P7OA 2TAAA 1W3LA 2Y5EA 5LA0A 1QI3A 1SFSA 4M81A 5LA1A 1EA9C 4PN2A 1E5JA 3TONA 1Q6FA 3WH7A 5CLWA 4PTXA 1WZMA 2DDXA 2ZX7A 2VQTA 3FNDA 4CVWA 3ARVA 1J18A 1V0NA 3ZM8A 3RO8A 3ARWA 2WZIA 4AD0A 1LWHA 4DWSA 3T09A 1UR2A 3ZMRA 3W29A 3N17A 3POCA 4BF7A 1JNDA 3VIIA 1E0WA 5GPRA 1W9UA 1N82A 4QAWA 2VRQA 2J7BA 4H7VA 5BCAA 1QNSA 4UQEA 3TP4A 1ESWA 3O2LA 3AZRA 2G41A 4GZJA 4UQBA 1MQQA 3OIHA 3T0AA 1UR0A 4J27A 1MW0A 3WKZA 2OYMA 3EDJA 1GCYA 4B16A 5D9OA 4GO8A 5IHSA 1JDAA 3S6TA 5KEZA 1FH8A 4JFUA 5CZKA 1GOWA 1K9EA 1M04A 1OM0A 1QPKA 1WDSA 2VCAA 3NUKA 3UEQA 3WD1A 2DH3A 1PJ9A 3L4XA 3ALFA 4TVUA 3AMDA 2CPUA 4AZBA 3N9KA 5E70A 1JZ6A 3K8MA 2O9RA 3IK2A 2QLYA 1JDCA 3TA9A 4NZCA 3CMJA 5E9AA 1EO5A 1UKTA 3RCNA 3PZUA 2D24A 4R27A 2PBOA 2DSVA 4EK7A 2YIHA 2ZUWA 4PCSA 3T08A 4Q7NA 1RP8A 1WDRA 1Q6CA 4R5EA 2ZX9A 4P7QA 4CN4A 2J8FA 4NI3A 3PTKA 2WHMA 3AIEA 3M07A 1VJZA 3WF1A 4S3KA 1JF5A 1VENA 4TX6A 1HKMA 1WZKA 1I75A 3A4XA 4QDMA 5IFTA 5CGTA 2Y2WA 1D3CA 2AAAA 2BY0A 3AQUA 1UKQA 1HKIA 4A3YA 3NSXA 3LPPA 4F8XA 3KE0A 2QF8A 3PZQA 1NQ6A 3WNOA 3ARXA 2CXGA 5FD0A 1BGAA 7TAAA 2XTKA 3K1DA 2V38A 1BFNA 4CD6A 2BHZA 5A94A 1E1EA 2DH2A 1XV8A 1W9XA 3PZGA 2EPOA 3LPGA 1CGYA 1FP8A 4ATLA 1BSIA 3A4WA 1E56A 4JL2A 1V3KA 3CUIA 3B9EA 2YDQA 3UG5A 3WDIA 1ZBWA 1VIWA 4XX6A 3AMGA 2W5FA 3HU7A 3FHAA 5EBAA 4LYPA 1TCMA 1DTUA 5ABGA 2YDRA 1C93A 1W9DM 3PZOA 5CQ1A 3RDKA 5A6SA 4W93A 1R86A 1V02E 3CZKA 4BZYA 4K68A 1E3ZA 1J9YA 1HF6A 2PWFA 1XGZA 3SCTA 1OT2A 1TMQA 3RIKA 2GVYA 1BVNP 3WIJA 4DM2A 4UOJA 5BXTA 1CGUA 1OD8A 4PRWA 3AXXA 5A8PA 1HVXA 2F8QA 1BLIA 1VEMA 3RM4A 1QW9A 3B9DA 3PZNA 3WQ5A 1TR1A 3F5JA 1U30A 1G01A 2WSKA 3VGHA 5A8QA 2B31A 2CHNA 1L8NA 2XFRA 4JKLA 3AMLA 5I0DA 5BRPA 1V6WA 4ZEPA 1J0JA 2JEPA 1RH9A 1WO2A 3VM5A 3FN9A 4IPNB 3GM8A 3VO0A 4LPCA 4UOZA 3VIKA 3WNMA 2WC4A 4OKDA 5C71A 4GO9A 4UFIA 4Q22A 1G1YA 3ARUA 3D3AA 3CUJA 4AIUA 5FL0A 5BXPA 1ZBCA 2OLHA 1RP9A 1BG9A 1ITXA 3AIQA 1NARA 5ABFA 3ZJ7A 2OSXA 5A6JA 2WZHA 2OWXA 3GXMA 3ZJKA 4J7RA 5CPTA 4PBGA 5C70A 4FMVA 3T2QA 4D1JA 2WMHA 1GOQA 2BVYA 4YN5A 2JE8A 4DWSC 3VGBA 2WCAA 3WH8A 1P6WA 3BGAA 3AIVA 1HIZA 1AQHA 3W82A 2EEXA 1AQMA 4EANA 2V3EA 5A1AA 4GXPA 4PUDA 1UHVA 2Y24A 2DIJA 3NJ3A 2VNCA 1V3MA 3PZVA 3AS2A 1K9FA 3ARYA 2X2YA 4PMNA 1VF8A 1EDQA 1JL8A 3VM7A 4MAZA 3AHTA 1TVPA 1UYQA 4HMEA 5A2AA 4AZ6A 3GXFA 2D0FA 2WWCA 3WNNA 2YDSA 3EMQA 1CXLA 3EDEA 4P8WA 4AYSA 4MNJA 1EDGA 5GNXA 3OA5A 4M80A 1B3VA 4MPKA 1CXIA 3VD9A 3DC0A 3WQ4A 4UCFA 5CLTA 3OLGA 4BCEA 2WCSA 3ZR6A 1EIBA 4P8VA 4AIOA 2J7HA 2VJXA 2XIBA 2JF6A 4TVDA 3GNRA 4UQDA 1KBBA 2O9TA 1JYNA 4IPLA 2VCBA 4X0VA 2QPUA 2WLZA 3SCQA 1JGIA 1UKOA 4KGLA 4KGJA 1HP4A 1SR0A 3AHZA 4D6EA 1CGTA 1TA3B 4WLCA 4F66A 1AVAA 4QLKA 3VDBA 4GI6A 4ZENA 5FKYA 1GPFA 2YA2A 2DQXA 1KGXA 4A4AA 3VIJA 4RL3A 1CLVA 4EAMA 1PX3A 4AD2A 1E6QM 3AISA 3RJYA 1W1VA 1NWSA 1BHGA 1ODZA 1EO7A 2EXOA 4B3KA 1R7AA 1C7SA 3AFBA 1GONA 4MNMA 1H09A 3ECQA 3GH7A 3K4DA 1V0MA 2CHOA 3QR3A 2O92A 3CPUA 3SCWA 1LLOA 1UZ1A 4E8CA 4HPGA 1UR1A 1QNOA 2XFFA 2YJQA 5HOSA 3FW6A 1GORA 2XWDA 1JAKA 1UR4A 1NOWA 3A6OA 8A3HA 1KB3A 2BXYA 3WNLA 1GOOA 1WDQA 2IXVA 1TFVA 3ARQA 5I23A 4P7RA 1ODUA 3VGDA 3B9AA 3RMEA 3GXIA 3J7HA 4OUEA 2X8RA 1EH9A 1KGWA 3WNKA 1J0HA 1XD1A 2WKLA 3ARPA 2WMJA 3CUHA 2EQDA 3EDKA 4JL1A 4JIEA 1HL9A 4WSKA 1HKJA 1DWHM 4AZCB 4XZWA 1B2YA 4M56A 2DSKA 1UWTA 5DFAA 2QMKA 2NSXA 4GINA 1JZ2A 4UFHA 4BS0A 2GK1B 4D6JA 3L4TA 2BHUA 3POHA 3GBEA 2WVSA 3WD3A 1CENA 1XSJA 2VR5A 1ISYA 2ZWYA 3BAWA 1NWRA 1KXTA 2FHFA 1W1PA 4LQ1A 3BAXA 3DYMA 2NW0A 3OZOA 2FGLA 3W25A 1EOKA 2ZXBA 3K8LA 5I79A 2J7CA 4W88A 3CZGA 4AY1A 1QVBA 2VX5A 3G6MA 1BTCA 4LYRA 1OB0A 1HKKA 2PBGA 4ZXLA 4W86A 1ISVA 3TTYA 1OBAA 3ZSSA 1EHNA 4JZ5A 4JFTA 4ZE4A 3BAJA 3E1F1 3BMWA 1J0KA 5LYRA 1HVQA 4AIEA 1X1NA 3CZJA 2PWHA 3SCNA 4AEFA 2D22A 4D6IA 4WK9A 1S46A 3ARSA 4AWEA 2E9MA 2G4FA 1BAGA 1SYTA 1W9VA 3KEHA 4KWUA 4KMQA 1DP0A 4F79A 4J3VA 1W3JA 3EMZA 1GVYA 5CG0A 2IUZA 2WLYA 4W8AA 1B30A 1I1XA 4V2XA 2FHBA 4M24A 3BH4A 3U7BA 2XSBA 1VEPA 1QHPA 3VIMA 2MANA 1GQKA 4J3SA 3MMDA 3WFZA 2WVTA 1KQZA 5E09A 1H49A 2UY3A 1Q6EA 3WF4A 5HXMA 1C90A 1FFQA 3PTQA 5HBFA 1FA2A 1B31A 2ZOXA 3HN3A 1XD0A 1WCGA 4S3JA 3KL5A 3WEOA 1NH6A 3K8KA 1UA7A 1LG1A 3ZOAA 4HU0A 2XFYA 2PI6A 3SCRA 5LA2A 1XRVA 4BQ4A 2DEPA 2J78A 4NF7A 3M6DA 2O9OA 2XM2A 3WUFA 2VZTA 1JFHA 4WSJA 1W3KA 1HXJA 4UZUA 4QCEA 1XHGA 2C8NA 2W61A 2A3AA 3ARTA 4OJYA 3W6LA 4FLOA 1HL8A 2DSWA 3W4RA 3CZLA 4Z2GA 2VZVA 1JDDA 1CPUA 4ZFMA 4OZOA 5DT7A 2XJ7A 2CBJA 1L0PA 4JFSA 3CUGA 2ZX5A 1WKYA 1HNYA 2GUYA 1U33A 4X9YA 2Q8XA 1CLXA 1FP9A 2AMGA 2VC9A 2G3MA 3CLWA 3WY1A 4IUGA 3AS0A 1C3FA 4CN6A 3VGFA 4CU6A 1TVNA 3NIYA 2E4TA 1OGGA 3O6AA 2W91A 1ITCA 3SURA 4WKHA 3GBDA 3CO4A 4HTYA 3WQ8A 3SUWA 4AC1X 4CGTA 4DUWA 1Z32X 1M03A 2WM0A 1DHKA 5A8MA 1IV8A 3CMGA 3ZT7A 2VX6A 1R87A 1UQZA 4RE4A 3ZQ9A 2JFEX 1UKSA 5A6BA 2JF7A 4WF7A 4IM4A 4V27A 5A3HA 4AZ7A 3RM8A 4U3AA 2VX7A 1QNRA 2J74A 2J62A 4UQCA 2C7FA 3UCQA 1E43A 4HMDA 1QNQA 1PX8A 5DEZA 3IJ8A 2Y8VA 1B3YA 3IAQA 2EBNA 3PZMA 1YHTA 1V0KA 1UWUA 3LPOA 4HA1A 1UR9A 3N11A 4UR9A 4HA4A 5I2UA 5D9PA 1B3WA 1QW8A 2G3JA 4P8XA 3WBAA 4E8DA 2BS9A 4ZE5A 1UA3A 1NWUA 3L4WA 2WCGA 4JKKA 1TE1A 3NSNA 1ZS2A 3I3EA 1GQLA 1LQ0A 4UFLA 4Z2LA 3EYPA 1CGVA 5HPCA 5CJ5A 1VFOA 3K4AA 3SCPA 3SUSA 4PSPA 2PF0A 2XYLA 1MFVA 5E6ZA 3MV01 4H2CA 6CGTA 2J25A 3DHPA 2V3GA 4U5IA 1WAWA 4GI9A 1LJYA 1NOUA 4GZEA 1MWOA 6TAAA 3KWXA 1EXPA 3WFLA 4XB3A 2DT2A 4ATWA 1UR8A 3MS8A 4GQRA 2GK1A 3NYDA 2BVDA 5ECUA 3GTNA 3T0BA 4BQ2A 3CZ8A 4W7VA 3APGA 3NCOA 3DYOA 4Z2KA 1CZ1A 3DYPA 2OYKA 4PUEA 4W89A 1V08A 1DEDA 2WPGA 5A69A 1MXGA 3AZTA 4HU8A 5A8NA 4W5UA 1J11A 3WF3A 3VD5A 4CU8A 2OSWA 2BVTA 1FH7A 5JBEA 1US3A 4MJ4A 4PMYA 4Y7EA 3W27A 1KR0A 2OYLA 3WMSA 2VVSA 3AMKA 2WC7A 3VDHA 1LL7A 2DT0A 3IJ9A 3THDA 4BQ3A
chains in the Genus database with same CATH superfamily
3QJAA 1GWJA 3EA2A 3BURA 2E6YA 3S2NA 4MAVA 4DVOA 4HA3A 2CITA 3C61A 5HA7A 3SGGA 1E0XA 1V3HA 5FSEC 3S83A 1AQ0A 1KM6A 2J77A 4LRTA 1QU4A 4H19A 2VTFA 3PRBA 2P8BA 1Q6GA 1F76A 4C6EA 1TMLA 4J4OA 4AISA 3U2EA 1IEIA 1GTEA 1E9LA 4O2TA 2FHCA 3G3DA 3M0KA 5DELA 3WEZA 1UD3A 3VTRA 2QS8A 1GQJA 3LK6A 1E3XA 3VD4A 4GYFA 1E0VA 4U2YA 2YW4A 4GIVA 1M3UA 4AU0A 1ISWA 3O0FA 1FKDA 3QKEA 3PJXA 1W1A1 4LBSA 3WLNA 2C3ZA 5MHBA 1PO9A 4OWGA 5H8MA 5F7UA 1GVEA 4JN6A 1TPVA 2WNWA 1FWGC 2D2OA 3HGOA 1G4PA 1VGAA 1G4TA 2WAGA 4E2VA 4Y96A 3W24A 1TJRA 2DGAA 2G3IA 1SGJA 4I3GA 1RUSA 5CBJA 1TJ1A 2BHYA 4UC5A 2QJIA 2IS7A 1KR1A 5DCBA 5I77A 1FOBA 4J4KA 4TUFA 3UFYA 2J4GA 5D02A 3TMQA 1B54A 3AALA 4XZLX 3T6CA 1C29A 2ATMA 3DAQA 2Z28A 3W3OA 3LOTA 3S2LA 2YLAA 5HW6A 3G6LA 2CFFA 1JI2A 3AYVA 5E1QA 5IRPA 2E9BA 1RPKA 4DQWA 2EPLX 1DJGA 5AKQA 1C8QA 1DYSA 4H7CA 1NP0A 3KAHA 2CU0A 4G2PA 2NT1A 3W53A 1GQIA 1HX0A 1P6BA 4KRUA 2G4JA 4TO8A 3CUXA 1ME7A 1WP6A 4GUJA 4WXYA 3MJYA 3OQ8A 1C92A 3IVSA 2CLEA 3RMJA 4NNAA 2VCCA 4DROA 1GYNA 1Q3NA 1ZP4A 1OX4B 4MWAA 4PC8A 2RGLA 1US2A 1KCLA 3PAOA 1NM9A 4MG4A 1XIEA 2BMBA 3O6CA 3RPMA 1W5QA 3HJEA 5A6LA 1W37A 5CPNA 2BB0A 4M3PA 5AHLA 3TQPA 1DWAM 2VMFA 3FHQA 3A9IA 1XR2A 3NQ7A 5DBTA 3QMTA 4QJ3B 1DJQA 1KM2A 2BX7A 1K77A 4LOCA 3NPUA 3M4HA 3VIGA 4A6GA 3BXWA 3IGXA 3HF3A 3NPVA 4DHGA 3MSGA 2Y70A 3F7JA 3ZO9A 4Q8MA 1QAPA 1VBHA 4ERIA 3IK4A 4GVFA 1TWWA 2IPWA 3VIOA 4O1EA 4QG9A 3E96A 2OZ3A 2DVTA 3HG4A 2XZ7A 3KAFA 4QP0A 1EGMA 4ODPA 1YPIA 1UWSA 3FGCA 3LA4A 4X0NA 4BEQA 4DXXA 3KBNA 1YW1A 3W38A 4FK9A 2QCCA 4LC8A 2BOEX 2G96A 2R8WA 2OZTA 1Z6KA 1QO5A 4QQ3A 2OFJA 4ATDA 1V0LA 2ZVIA 4CNPA 3S0CA 4QNWA 4ZPWR 1JZ3A 3FXYA 3W1LA 2IPJA 3RCMA 5LHEA 3EOOA 3ITLA 2QCFA 3Q4DA 4UTUA 3TNBA 1GKPA 2QVHA 3TJIA 3LDVA 1KFWA 1R2SA 4ODKA 1XIDA 2JBMA 3F2BA 4JN8A 3UVIA 4BWLC 4PB5A 2ZDRA 1VR6A 1M7JA 4YS1A 1F4HA 3GYEA 4QM1A 1K4GA 4CNNA 4HBEA 3LENA 3DECA 4P8UA 4GIAA 4UQ9A 4PUNA 1KFCA 2VFGA 2FGZA 2PDBA 3XIMA 5HMSA 4FF5A 2F61A 3BLKA 2OG9A 2WSYA 1X39A 4ROQA 3CB3A 4R9XA 1XKJA 4C6DA 1MO0A 3EEGA 1A3HA 4JQ2A 1SQ7A 3KZPA 3AO0A 3T55A 3SQLA 2NQ9A 3PSWA 1R7OA 2DZPA 1KTNA 2ZRWA 3E38A 1IEQA 2PDCA 3F5KA 2OVLA 2CYGA 1FWWA 2VGIA 4S39A 2A2IA 1YXYA 4UDMA 1LL4A 1EUNA 2QR6A 4KFNA 4DBUA 5M03A 1TA3A 2NQ5A 1XSKA 2IQTA 1GG0A 5HPOA 3NEHA 3TTSA 2XISA 3TROA 4TW8A 2Y88A 5DT5A 1WB0A 2D0GA 1W2VA 3R0DA 4MJMA 1YXDA 1O6IA 4JHOA 4H41A 2OO6A 1XDMA 1B9BA 4O16A 4RKAA 2VQUA 4KF1A 3VCCA 3BW3A 4PCFA 1G69A 5CXPA 3QW3A 5D03A 4J3WA 1WE5A 4I9JA 4GMEA 1JZ7A 4BI6A 3BG5A 3WD2A 1N1AA 4MWAE 3H2NA 1FJDA 3WMCA 3PZ9A 5HNRA 3M5ZA 1MMFA 1J12A 3QYSA 4MYXA 2PTXA 3BQ6A 1B0IA 5A6AA 2YCEA 3NDZA 4WIWA 3BCDA 1ITQA 1SM9A 2Q5AA 3AS1A 1WZAA 6TIMA 4LAMA 3THQA 3GRIA 1JIBA 2Z6JA 4PCNA 5CC3A 3I6CA 1AK5A 4MUZA 4X9SA 3GNOA 5E93A 3TE9A 1UC5A 4EE9A 3BGJA 4OGZA 4YVPA 3SO7A 1Q5MA 3PNZA 4UXDA 4CKQA 2EJAA 4GBDA 3RGTA 3SQSA 4S3DA 3VD3A 1ZJBA 4H9VA 2A3BA 2Q8LA 1NJJA 4IJRA 2J6XA 2V3DA 1QBBA 1HZYA 5GQBA 4TTGA 1JD9A 2AL2A 4M6VA 1GUVA 4B9YA 4GIEA 3TN4A 4KT2A 4TV5A 1OYAA 4PUWA 1H51A 4OOUA 3EKZA 1QHOA 2D0HA 4JKMA 2CBUA 2WYSA 1XYZA 2YW3A 1OINA 4URIA 1T41A 3QHMA 1BXCA 4KR0B 2WVVB 2ZX8A 4NZ1A 3RNDA 1C8YA 3OW1A 4HZ8A 4XVDA 3A23A 2ISSA 2XVPA 4LF1A 3W7LA 4IPIA 3NZQA 1EQPA 1UZHA 3KCOA 3U0HA 1EQ3A 4IIEA 5LNWA 1EQCA 5HR7A 1PWLA 3OVGA 2YA0A 2VGBA 3RX2A 1MW2A 5BU9A 1HGYA 1PBGA 2P50A 3B8UA 1E1CB 2E8YA 3TVAA 3TZNA 5BXJA 2FZBA 1Q6DA 4L6DA 1Y7VA 1RSCA 5I3DA 3KW3A 4S3BA 4HARA 2QCDA 3W02A 4YWSA 3AXIA 1BGGA 1RD6A 3VNZA 1NOFA 4IF2A 2WC3A 4KEUA 1IGWA 1ALDA 3N18A 1UROA 2YBTA 5H8UA 2Z24A 1UJQA 4EF9A 4GUFA 4NVTA 2A6NA 3AXHA 3WLPA 5IDZA 4DAFA 2FZDA 2CIPA 4B5NA 3W1UA 5HANA 3MUY1 1R47A 3C8FA 1P7TA 3W00A 2PWDA 2YLLA 2KFWA 4O17A 1UKPA 4QGCA 3WELA 2ZC1A 2PU1A 3CO8A 3QFWA 1ZL1A 3C86A 1UPMB 3L2MA 4U5KA 1UP3A 3FEQA 4MUPA 3OYXA 3CH9A 1XYBA 2KX9A 3OZPA 1XPYA 4W5ZA 1H0IA 1QBAA 3WMLA 1F4AA 3LMYA 3ERPA 2OOFA 4O12A 1W54A 4NJJA 3BAKA 1IR2A 1VYSX 3QOMA 1GVRA 2MF9A 2QPSA 1K9TA 3PFRA 1E6SM 3H70A 2BFGA 2F4EA 4GD0A 3IIPA 2GGJA 4MDOA 3SUUA 4DJED 4K2SA 1PHWA 1BVZA 5G2IA 4DUXA 3SUVA 1Q4WA 5HWBA 3DOPA 2D20A 4NHVA 4JTEA 3VINA 2Z0IA 4D6GA 4QG6A 1P6CA 4DWDA 4DI8A 1LUCB 1BEUA 1QJWA 2CNCA 1D6OA 1QZ2A 3BSHA 3CPGA 3CIVA 1V6UA 1MQPA 2WB5A 1R3SA 1W1IE 4UR8A 1IIGA 2XP7A 1TWSA 1H7RA 3JZEA 4GYPA 2F23A 4E0CA 3O5KA 1OFAA 1KA9F 1PZ1A 4GCAA 2E5CA 1M68A 5J5DA 2YBVA 3XINA 1JXKA 1BTMA 4D6HA 3BMVA 3VVGA 2HE5A 2PUZA 2W66A 1ZBKA 3KVLA 1S1RA 1OC5A 2OLSA 2FDMA 1ECEA 1ZAJA 4JNMA 3VMNA 3MVTA 2QJJA 4CCCA 4S1FA 3RLVA 1V51A 3IS4A 1ZB5A 5TNVA 3S5OA 2CESA 3ZT6A 5B7YA 2V5DA 3DKLA 1Q6IA 2OX1A 1F40A 2QGYA 1XC6A 5E0CA 3R25A 1Y5VA 3GU2A 4M0XA 2VM8A 3MA8A 4YL2A 1B6CA 3GXNA 4RPPA 4HU4A 5HJXA 1QWGA 2ZUUA 4LUTB 3LCLA 3MSYA 4JAWA 3UY8A 1Q45A 3QTGA 4DJDD 1PYFA 5J6EA 1AFSA 2VENA 4HPHA 3W1QA 3SI9A 3TXVA 1RR2A 3ITXA 3MJMA 3AUOA 1G94A 2ETNA 1PINA 3WD4A 4W85A 5CPSA 2EG6A 4K38A 2DY3A 3EXRA 3MDYB 4GGHA 2H6RA 3JU2A 4MHBA 4C6NA 4BI5A 4YVVA 4QQUA 1DJIA 3V5CA 3WL0A 4B5VA 1BQCA 2QJNA 1MW3A 5K4XA 2BGSA 6ENLA 1KV5A 1WPCA 4MWAC 2PGRA 2F6UA 4N0RA 5F2IA 4CQDA 7ODCA 3PK7A 3VU2A 1KNWA 2PWVA 4BA0A 4QAIA 4QX4A 4CN1A 2DIKA 4Z0JA 4PRRA 3NQVA 3UI5A 4TOQA 3OVPA 5AYBA 2ZRXA 2PDXA 1HN1A 3EY6A 1RCQA 3R12A 3MTWA 3DCPA 4FSAA 5C5YA 1Q1CA 4EKJA 3QYQA 3F2CA 1E0UA 2RDUA 1R2TA 2WMKA 3K4WA 3EPMA 3AIWA 1JPHA 1C9HA 4DEFA 2ACUA 3K5XA 3T9PA 5L6UA 1XLCA 4LALA 2KZHA 2NVCA 3ZXWA 2BNJA 4ZA0A 3LPFA 3RG6A 2ZQSA 5FIPA 2DUAA 1PPIA 2WO5A 1EFZA 1H4PA 2XN1A 3W01A 4YYCA 1H7OA 1ADDA 1BYDA 1JYVA 2GVGA 1M9HA 3OLDA 4J1OA 3B8VA 3CT2A 5H2ZA 1KQYA 3ZR5A 3HG2A 3R94A 1PE1A 5D4YA 4NRRA 1Q13A 3WLQA 3NL5A 4AVFA 3CGTA 3NA8A 1J10A 2PODA 2EKCA 2VI0A 3U4AA 1H41A 1N8FA 2XIIA 4IX0A 5A5WA 1YXCA 3QRHA 1REQA 1YQ2A 2XVGA 1GW1A 3IJQA 3W7JA 2GVJA 1WNOA 3SB0A 5M1TA 3KTXA 2WBKA 2QULA 4IQJA 3FJLA 2ZX6A 1PTAA 3A3HA 1R3TA 3UCDA 2X1IA 1Z42A 1WKDA 5I5RA 2Y7GA 3AHXA 2JGQA 1YPFA 5AC4A 1HQTA 5DITA 1LOQA 3B4UA 4ZS6A 1V4YA 3W37A 1GJWA 3SN4A 1SMDA 1JF6A 2E67A 5I06A 4C6LA 3LD5A 5AYIA 2D3LA 4YHGA 4W8BA 3L5LA 3CH0A 1T96A 2PGWA 4Q4SA 4YIWA 1E5JA 1Q6FA 3M0IA 3W7DA 3WH7A 2QCHA 4LS2A 1JVWA 1WZMA 1O4UA 4EWJA 1FWTA 3MB9A 3UI6A 9XIAA 3T8QA 4M7TA 3ARWA 4AD0A 4DWSA 5BZAA 1VYPX 1KFJA 1UR2A 1AH0A 4HSNA 3LUTA 5F2LA 2HK0A 1N82A 4QAWA 1S2TA 2J7BA 5C9WA 3GDRA 1VCVA 3OG3A 4LU0A 4ILSA 1OY0A 1MQQA 3OIHA 3RAOA 3C2FA 1UR0A 1F61A 4J27A 1MW0A 3QC3A 1KV8A 3VNJA 3WLLA 3WKZA 3EDJA 2OZ8A 1QCWA 2H8XA 3L0KA 2A0NA 4AMAA 3QW4B 1JDAA 5CZKA 1K9EA 4CLMA 3C56A 1FWSA 2DH3A 1E9ZB 1PJ9A 4G2DA 4R53A 3ALFA 4DZ3A 1WXZA 5DANA 4LUIA 1JZ6A 5F4SA 3K8MA 4I5UA 1UBPC 2NUWA 2HS6A 1XINA 2OGJA 1OFOA 2JKPA 1EO5A 4RZ5A 3RCNA 3IKDA 4R27A 1EF2A 2PBOA 1VFHA 2YIHA 1I9CB 4PCSA 2GYIA 3FK4A 1KRBC 1G4EA 4I7UA 4DB7A 5GPGA 1P1MA 3CU2A 4CN4A 4U4MA 4ODNA 5C7VA 1K70A 3OYZA 4S3KA 2ALDA 3NM1A 3P14A 3H22A 4HPJA 1SW7A 3L67A 4LW7A 1JF5A 4TX6A 5T9BG 1I75A 3A4XA 2AAAA 5HUOA 4JEQA 2ZRYA 1HKIA 2FLIA 3ONCA 3O5DA 4F8XA 2E5DA 4D8LA 1TV8A 3KE0A 2MLZA 2QF8A 1PTDA 3A5FA 4Y9PA 4NT0A 4X60A 4ONVA 2VXNA 2PD9A 2XTKA 5K9XA 1KKOA 4KWOA 1PSCA 2BHZA 4LNYA 5A94A 3CQJA 3IPWA 1RLCL 1XV8A 3NQAA 4LAOA 3O8AA 1W9XA 3D0CA 1OK6A 3QPEA 5DMLA 3LTYA 1CGYA 3T44A 4JTJA 1E56A 4JL2A 1V3KA 3B9EA 4QXIA 3WDIA 1ZBWA 5FEZA 3SRKA 2AWGA 1K1DA 4NXKA 4GE8A 3FHAA 4DI9A 4LAKA 3KOYA 1QASA 4YU1A 3VNMA 2PWFA 3UZZA 2CZ5A 2X41A 3NURA 4Q6XA 4DM2A 5FEPA 4PRWA 3E0IA 2F8QA 3RM4A 3B9DA 1YIXA 3UJSA 1TR1A 1YNQA 4UTTA 2O7SA 3LCIA 2V63A 2XFRA 2M08A 5I0DA 1POKA 4LANA 3W7OA 3BMXA 2OODA 1J0JA 1T8QA 2Z29A 1WO2A 2R1NA 1YTEA 2FKEA 4O19A 4FAMA 3A21A 4IPNB 4WCJA 3GM8A 2GGGA 4LPCA 4UOZA 3SBFA 2A4AA 2D2HA 1A0EA 3VUSA 3GKFA 5BXPA 3SY1A 3H7UA 4W4QA 3TJ4A 2CLKA 2PDWA 1F6YA 3GXMA 2GQ3A 2PRHA 5LGXA 4PBGA 3QGKC 3IEBA 4FMVA 5T91A 2PZNA 3QMRA 5BMXA 1V93A 1Z44A 1L9WA 3FKRA 2Y7DA 4PTNA 3PWGA 1P6WA 3I6EA 1HIZA 5K3VA 3R43A 2EEXA 2DZBA 4EANA 3CTLA 1UOZA 4HTBA 1P48A 2JGYA 3EOSA 1TCOC 4JIRA 3STFA 5E5CA 4UTWC 1DJWA 3BSMA 1JRBA 1JDEA 1TVPA 4AZ6A 1W3NA 2D0FA 2J8TA 3IKGA 3LN3A 4DF2A 2YDSA 5C9UA 4NYYA 4YTQA 4JTKA 5D09A 5GNXA 4ALDA 2ATSA 3SSZA 3PSVA 4XQ6A 3KLLA 5IM51 4F0LA 3ENLA 1D7JA 3VD9A 3WQ4A 5CLTA 1QUMA 1Y5XA 2WCSA 1NMVA 4N19A 1XG3A 2VJXA 4O10A 4UQDA 1KBBA 3LS9A 3WBWA 2YDAA 4IPLA 3E9AA 1UKOA 4KGJA 4I90A 4TMBA 4IP5A 5D75A 4WLCA 4F66A 1G67A 3S47A 2V6AA 4BY3A 3BLEA 4ZPVR 1GPFA 2DQXA 1IWBA 1KGXA 1TTQA 4PODA 1PX3A 1TX0A 1TRIA 4AD2A 5CKSA 2PTWA 1QPFA 1EJWC 3OJGA 3GLCA 1EO7A 1R7AA 3W23A 4FIQA 1DPMA 4A8RA 3CGMA 1OK4A 2CHOA 1FWCC 3TN5A 3WLTA 2O92A 1LQ2A 3NZPA 4HPGA 1QNOA 1WBJA 3TNOA 3N14A 3BICA 4NL1A 3BE7A 1NOWA 3B0YA 3W2UA 4XKYA 1XLHA 1WDQA 1R3YA 3L68A 3ARQA 1FX6A 3LY0A 4P7RA 2PV2A 3KCJA 4PFMA 3BVJA 1GKQA 3WQCA 4OUEA 3B0XA 2X8RA 3SECA 3DESA 4OV4A 3ATZA 3AWOA 5TF0A 3L5MA 1HL9A 4OFCA 2VEKA 3PWIA 1JPDX 1DWHM 4H9XA 4XZWA 3QXBA 3RLUA 3PM6A 2NSXA 2X7VA 1O5KA 2H3DA 4LJ3A 4ODLA 3L4TA 3POHA 1Q63A 3HQPA 2WVSA 2QV5A 4U85A 2VR5A 1ISYA 1KXTA 2FHFA 3BAXA 1BWKA 4IHCA 3KBSA 5FAJA 1JCLA 2ZXBA 3LXAA 2J7CA 3CZGA 1EP3A 3TYZA 2VX5A 3IJIA 3O5RA 1OB0A 2V5LA 2PBGA 1F5ZA 3EB3A 1ISVA 3LGGA 3TTYA 5D2TA 3G0UA 1AODA 1H7PA 5DN1A 2EULA 5JH2A 2NXGA 3BMWA 4ADSA 5LYRA 1TB3A 1HVQA 3CEPA 4AIEA 3KS5A 3KBJA 3UZWA 3QY7A 3ARSA 3NYZA 2B7OA 2E9MA 4HNOA 3TFCA 2ZA2A 4KWUA 4J3VA 1OYBA 1GVYA 1TJPA 4W8AA 1QOPA 4S23A 2G50A 7XIMA 1R6WA 3KRUA 2FHBA 1IEVA 2FIQA 4J3SA 1GQKA 3L7RA 3W1XA 3MWCA 3GIYA 1N8IA 3WFZA 3GTHA 3P60A 1UC4A 4Y9AA 4NJIA 3IRSA 3PTQA 4Q4MA 1B31A 4L6OA 4DRKA 1XD0A 5FSDC 3N29A 1OF8A 1UA7A 2DZXA 4DRMA 4DNMA 4ZB2A 4EXAA 3R7MA 1O60A 4TYOA 2PURA 4DBDA 2J27A 1ECQA 2PI6A 3R2GA 2YR1A 3EWUA 4BQ4A 3W1PA 2RJGA 1FWHC 4NF7A 5CEWA 2XM2A 1PL9A 4WSJA 1HUVA 2CHRA 3G8EA 1Q65A 1HXJA 2C8NA 2G5WA 4HKPA 4HB7A 3W72A 4A8LA 2QNEA 4P2VA 4GYPC 4MVAA 2KR7A 1RVGA 1IHIA 1L0PA 1M41A 2PLJA 2ZX5A 1WKYA 4HBKA 2R91A 1HNYA 3SY8A 5LIWX 1CLXA 4TV6A 3W86A 4G7EA 2VC9A 3CWHA 2CW6A 1FBAA 4PB4A 3VGFA 4HCDA 4CU6A 1RBAA 8XIMA 3NIYA 3UT0A 4WKHA 1ZNNA 4WJ8A 4HTYA 1MEIA 1X96A 3IWPA 5MF5A 3G1XA 3UPWA 4LVDA 3H8AA 1DHKA 1EP1A 3CMGA 4OUIA 1LP6A 3LX9A 3CUZA 4HGXA 1THFD 2Z27A 1F3XA 2VC6A 4B5XA 1MNZA 2HMCA 2ZZ3A 1XLLA 4OECA 2JF7A 4V27A 2BASA 3UR5A 3HGJA 4AZ7A 4EACA 4LY4A 3RM8A 4U3AA 2VX7A 2J74A 4UQCA 4DJDA 2C7FA 2NX1A 4HMDA 3ZR4A 3RFWA 1LYXA 2Y8VA 2EBNA 3PZMA 3GC4A 4FS9A 2RH9A 1UR9A 5HQLA 4AHPA 4UNKA 2ADAA 5D9PA 1W31A 1B3WA 3P6LA 1UA3A 1YBQA 4I5RA 3P2VA 4JKKA 1Q2SA 3HPSA 1ZS2A 4UFLA 5T9CE 5HPCA 2GPTA 4LNCA 4EWND 3K4AA 4NP7A 2POZA 1I0DA 4AX7A 2XYLA 2Y63A 3PA7A 1R3RA 5E6ZA 1KFEA 1EYWA 4US6A 2NQZA 3B8DA 4GI9A 1NOUA 5F1UA 4ZZ9A 2RKXA 2O4MA 4IIBA 1IZCA 1NDYA 2I5QA 4GUHA 2DT2A 4LF2A 3MS8A 2OELA 1KTBA 3NYDA 3T0BA 3PF3A 3H9RB 5KZDA 1XIIA 3PBYA 4FHAA 2DG3A 4Z2KA 3DYPA 1FXPA 4HHHA 3IARA 3PB2A 4NAEB 4KCUA 2WPGA 3M0LA 4IQ2A 1OFDA 1MXGA 5H8PA 4QE5A 2Z1XA 4BR1A 3QQWA 3H7VA 2OXNA 2ZE3A 2BVTA 3FOKA 5JBEA 4RXGA 4Z1DA 3LHWA 3TN3A 2WQPA 3W73A 3NTPA 1WOAA 5K9DA 3AMKA 3GTIA 3VDHA 5CSRA 4PBFA 4BQ3A 1SJCA 1T8XA 2QT3A 4DPPA 4A3QA 3KOWA 2VURA 1Q6RA 1WQ5A 4J2MA 3QSRA 4RPQA 2V68A 1E4MM 2WQDA 2ZA3A 1J0ZA 4AZCA 3O5PA 1HXVA 2HPMA 4NKCA 4D9PA 1IEWA 1E72M 5A6MA 4OOZA 1XYCA 1IGSA 1UW9A 5H6HA 3N12A 3PJUA 2HVMA 1J01A 5H91A 2DIEA 2J47A 3C8NA 4AEEA 1RA0A 2Y8KA 3DGRA 3N13A 3TYEA 1XYLA 2ZUTA 4PFHA 5HDRA 1WKEA 1FXQA 1DJZA 3LQLA 4IT1A 1E6XM 3L9CA 1J4HA 1OF6A 4NG3A 5I78A 5JIWA 2V2HA 3KACA 4ZVJA 3G1FA 4LAUA 1X7FA 2GJXB 3M0ZA 2PLKA 4J40A 4ORMA 1FDYA 4MYAA 4ICCX 3PPHA 2CXEA 2OR2A 1VAHA 4IISA 3OB8A 2FGBA 2RJHA 3NOEA 3AU6A 3STGA 3P8JA 2J24A 2VEMA 8TIMA 1JAEA 3VGEA 2WSPA 4RE2A 1KO0A 1DQWA 1PHQA 3GIPA 2PWEA 2QUMA 1D7FA 3W7MA 2PS2A 4ODMA 5CPMA 4B5UA 4IICA 1JUBA 3QOKA 9CGTA 1TZ7A 3G3MA 3TYCA 1LM1A 1HO4A 4KH2A 4WUIA 4K7YA 3OO2A 1OD0A 2VR4A 4XZHA 5A95A 1GHRA 2ABAA 2A1YA 3AHVA 2QDHA 3B04A 1XFCA 2D1ZA 1E6ZA 3FFSA 1POJA 4LXFA 1CXHA 4LCSA 3O5LA 3CV2A 4U84A 2HE8A 5BRBA 3GZAA 5AC7A 3SAZA 1PTGA 3I6TA 1QPLA 3BO9A 2WOQA 4Q4OA 2WJEA 3S1XA 4DUOA 4LTSA 1F3TA 5IXEA 4JEJA 5I6SA 1Q4NX 1IWPA 1BSLA 4LYQA 1SFTA 4G1NA 2CCRA 5EYWA 2QCDB 4JIQA 3MU7A 3IIZA 2ZIDA 3ABRA 2PC8A 2PFHA 1JZ5A 2WMGA 1OYCA 2VWTA 3A4AA 3SGZA 3DFOA 1HJQA 3CM4A 1S5MA 3WJXA 5CAKA 2P10A 4LBUA 1GZGA 4PMUA 2E25A 3OGVA 2C1HA 1C8XA 4CNUA 1FKWA 1GVSA 2OEKA 4XAZA 2A5HA 4YCOA 4DRSA 3DFSA 3WQGA 1UD6A 2I7GA 4C6CA 3L4ZA 1EC9A 1HJWA 3TUUA 4O4VA 4ORIA 1VFMA 1A5AA 3HURA 4EPKA 1XCFA 4XAGA 3ITYA 3A24A 2YL9A 4JTGA 2Z2UA 4XZMX 3TKFA 3TQ0A 2A3CA 2XH2A 3HGRA 4PUJA 4WY0B 4HYVA 3W7GA 2YL5A 3QFEA 4UTKA 4QFUA 3NDYA 1UB3A 4GBUA 1EBHA 3TC7A 4EVZA 4L9XA 3EPOA 4C1NA 5DF0A 2QCGA 5HJLA 4FXFA 4A3RA 1K6AA 2ZUMA 4US5A 4B5TA 2P0IA 3A22A 4QEEA 1KBLA 5AHEA 3KHJA 4FEZA 3PJWA 1Z69A 4HOXA 1VFUA 4D6FA 6XIMA 1VBJA 3I6RA 4L3NA 2X0YA 4MADA 3W7PA 4D72A 5EGRA 4K8GA 3AICA 1R0MA 2W3ZA 4WGXA 2ZBTA 3WH0A 2Z7GA 3OG2A 1U1UA 3GHTA 2AGTA 1P43A 1FWFC 3OODA 4M1RA 4H04A 4GY1A 1WA3A 5HULA 1QWKA 4IL0A 4GQGA 1YEYA 3SW6A 2TMDA 1DQXA 2FZ9A 3W2LA 4GI8A 5M3WA 1X8CA 3LCFA 2X09A 2XG9A 1D7HA 4NZ3A 3ZFHA 1RALA 7A3HA 1XPGA 3TLQA 4H83A 1XLAA 3M9YA 3KAIA 2VN1A 5JH8A 1UWAA 3QGAC 4PYSA 3PPFA 3GC2A 2Q8ZA 3EDDA 1CYGA 3CNYA 1NWTA 3GPKA 3P80A 1W56A 4KRTA 4UMAA 4AVOA 5GNZA 2FZNA 2P4VA 5HT1A 4FR6A 3FLUA 3TZFA 3M64A 3CTTA 3UETA 5B7ZA 2GOUA 3TU9A 2HVOA 3O5EA 4C60A 1BXBA 2M1IA 3R5EA 3NSMA 2WHKA 4KW2A 3K13A 4W84A 3PTDA 1QNPA 3P62A 3WUEA 2RGMA 3OIXA 4ZQOA 3W2KA 1PKMA 1W91A 4H6EA 3P81A 3DBPA 2DVUA 4D8AA 1XCWA 3WH5A 3QF0A 1L1PA 4XTDA 2CERA 2FVLA 1ENUA 1EWDA 1G9HA 3G8RA 1W9BM 1SR9A 2FH8A 3VKBA 5IDIA 4PH6A 1VB9A 2V5JA 4OT7A 3W6MA 5EPDA 1OCJA 2LPVA 3S5NA 1A80A 3PBWA 1PAMA 1TG7A 1KM3A 3WN6A 1S2AA 2A3EA 2WKGA 2PDYA 2Y7EA 1OX5A 3M7WA 2P88A 2VR2A 3W74A 2D73A 4Q3MA 1XYFA 1ZSXA 3GK0A 4HT3A 1UUOA 4QJ5B 1EGZA 3AOFA 1WAUA 4HOZA 3HM7A 2P53A 5H1WA 2NV1A 3QSTA 5G1YA 2HISA 4BQ5A 3GVGA 1ZCOA 2RDTA 1TIWA 2PA6A 2HXUA 2ESCA 3W28A 1LTDA 4HMNA 1Y0EA 2Z26A 4HK7A 2QV4A 4XAFA 3CHFA 3U5UA 1CXEA 2Z1BA 1RD5A 1W5OA 3L2IA 4IGNA 2XGIA 4TQTA 4I8YA 1R3WA 4FAPA 3WF2A 2HNHA 5HMEA 2YKKA 1TVLA 3AROA 3WG6A 2J75A 5FF3A 2OT0A 2E28A 3II1A 4CCEA 4QITA 2EGZA 3BK0A 2Y0FA 4F0MA 3V0UA 3UXKA 3H2OA 3GY1A 4F9JA 3P84A 4P7NA 5CZJA 2VDIA 4LS1A 4LV4A 3VNLA 3R10A 1ISZA 1T11A 4J3TA 2E0PA 2ANUA 4EPEC 4CVUA 1E1FA 3Q65A 4AZGA 4WSHA 2WM1A 4WVXA 2XUCA 1HKVA 4UB9A 1AH4A 3BZJA 3V3WA 5HQMA 4CD7A 3P0WA 3S46A 5C6MA 5IHRA 4PTDA 4KKXA 1EPVA 4XO7A 1DTNA 2PDIA 3M44A 3ICJA 1CXFA 2CEQA 1VBRA 5EFDA 1QI0A 3Q58A 4W9TA 5EMJA 3G2GA 1KCZA 4N9BA 3OVQA 1NF0A 4MGGA 4NAFA 3V35A 3LNMA 4HHLA 1E4LA 2A3LA 2ZQTA 3TH6A 7REQA 3HMJG 2W62A 4R7JA 4C6QA 1GHSA 2Z2AA 1A0DA 4HQVA 4DF0A 2NT0A 3TAOA 1JXJA 1ZCCA 4B5WA 2X1UA 3AS3A 1UCWA 3NZRA 5D8ZA 3LGEA 4ERGA 3UW6A 3U5YA 3WLKX 1PX4A 1ZJAA 4Z17A 2HCVA 3LRMA 1RJQA 4NSBA 3QVQA 1XBVA 4QROA 1XIHA 3LBMA 1OFPA 2FVMA 3NL2A 4GQQA 5G2HA 2FPTA 4QEHA 3HPZA 5DMYA 2DT1A 1YE6A 3A9BA 2CKRA 1OIMA 2TYSA 2YCJA 3LB0A 4PMXA 3R8HA 3HZ3A 3T0DA 1VHCA 4LB3A 3ARRA 2HQAA 2H9AB 3WLRA 2OSYA 3E0VA 3FKKA 4XBKA 2VL4A 2CC0A 4C1NB 2VZOA 4K36A 1L6GA 2WVVA 2WJFA 4JICA 3FA4A 4U2ZA 4FLRA 4GOAA 4QLJA 5JH1A 5KZEA 1K7EA 3ITCA 1JCNA 4RDVA 3OLEA 4OBSA 1SMAA 3K2GA 3UR8A 4I9AA 2ISWA 4Z1AA 5I02A 1KRAC 4XD4A 4C6IA 3NQEA 1F9CA 3L5AA 2MNTA 4GNVA 4UNLA 2AQVA 1BKSA 1R46A 4D71A 4Y9NA 4QE4A 1E4NA 4AF0A 3WD0A 4Z1BA 3IUIA 3EXSA 3OU8A 2BBFA 4UFJA 5EFFA 6REQB 1ADOA 1DWGM 1J0IA 4X22A 4PCPA 5AYYA 3BZGA 3VOFA 1HT6A 4BF8A 3L0NA 5E0FA 3NGJA 1KBIA 4UMCA 3XISA 4E4PA 2YL8A 3BJFA 5DO8A 3A13A 4PCTA 4A2RA 3TR2A 2ZXQA 4NILA 3WDJA 1RJRA 2CETA 3UXAA 3R8GA 5BOEA 4DWSB 4J3UA 1X1ZA 5FOOA 3FAWA 1YTDA 3NXLA 2R1PA 4FF7A 2EPKX 4AQLA 4DWSD 4ROPA 2PGEA 3MSDA 1G7UA 3C3NA 2AMXA 4EPBC 3SIMA 2AQOA 2FZ8A 4IG2B 2F2HA 3AIUA 2INEA 4Z2HA 1XRSA 3H4XA 4C7DA 3BLDA 1GVIA 4CD4A 3ES8A 3OGSA 1RBOB 2GVLA 4GFSA 1BWVA 4IFKB 3ABZA 1DXEA 4LVAA 4QDWA 4GX9A 1PIFA 3OZMA 2UZ5A 3UYCA 4AXKA 2CLIA 2E68A 3BAYA 1X6UA 2GDVA 1GG1A 4IMEA 2ISFA 2PBCA 3VK5A 4ECLA 1S2CA 1KBJA 2ITKA 3WENA 4DRPA 3W81A 5REQA 2PMQA 4JQ4A 3L4UA 1PKLA 1D3HA 4FOJA 3BV7A 2XWEA 3NEVA 3ID7A 4JTUA 2PPOA 5HW8A 4PMVA 2QIIA 1CNVA 1VP5A 1B5TA 1C9DA 1JZ8A 1VS1A 1TX2A 2YX0A 3FXGA 5HMDA 4WDXA 3EX1A 3FYYA 4XD6A 2YA1A 2QGHA 1QDSA 3LQGA 2WMIA 3WK3A 3SRDA 2BODX 3N25A 1AQFA 4HU3A 4LUJA 4Z0SA 4DO6A 3M0JA 1M01A 2OEJA 2WBGA 3RCYA 2AL2B 4JQAA 2Q09A 2WW5A 4PTWA 3AZSA 3S5SA 3B8WA 3T4CA 2XSXA 1DV7A 5HWJA 1E6NA 2XM1A 2R1MA 4RX0A 5AOUA 3EB4A 3ME3A 4MKSA 1CLKA 1JUKA 1B3ZA 1BKFA 4X2RA 1S5WA 3S4TA 4B2DD 6A3HA 4NJGA 3WLHA 4C02B 4B91A 2DZAA 4ZCWA 3VIPA 3T81A 2CBIA 3SN0A 1J5SA 3OVRA 2XIOA 4MKVA 2VUYA 4Q7IA 1GVFA 5DRIA 1QK0A 3TTQA 1V5XA 4UOQA 1CEOA 4LUSA 3OQEA 1B1YA 2UBPC 4XD5A 3GU1A 5AC5A 4PEKA 2RURA 1JYWA 3S9YA 2YXGA 3VD7A 2RUCA 4H4IA 3FJNA 3L66A 3L2LA 3I68A 1BYBA 4JFVA 1UUQA 3MKCA 1B3XA 2C19A 4ODQA 4H8VA 5BOFA 4IIDA 4DM1A 3OTRA 4E2DA 4W8LA 1S1PA 4ML4A 2ZXAA 2QVNA 2R1KA 1TPB1 1GQNA 4TU1A 1NFGA 4N2YA 5AC6A 5KZMA 2J8GA 1UH3A 1E40A 4UFMA 3UXLA 4JPGA 1XICA 3MYPA 5AYXA 1KWGA 2VELA 4H8NA 3N9SA 3MKKA 3KRZA 2J9YA 4R33A 3F4VA 3UF9A 3ZLGA 1QR7A 5AHFA 4GISA 1A5KC 5CPOA 3TDFA 1ZP3A 4A29A 2PWUA 1E6RA 1ZUAX 1U2YA 4MY9A 1E5NA 1F07A 4L9ZA 3H2FA 1FKXA 3INPA 3EWXA 3TCSA 2I5IA 1TMHA 1FH9A 1C7TA 1PIGA 2BY3A 3N6QA 1KLZA 1FY6A 1UASA 3S1WA 1O94A 4TTUA 1YLVA 4P7OA 2TAAA 4XZNX 1WDDA 1GVQA 5LA0A 3IK8A 3MQTA 1A5OC 4M81A 1EA9C 1PIIA 4PN2A 1ICQA 4KS0A 4JFIA 1H61A 2ALRA 2EF9A 1QPQA 5HQEA 4Q8PA 2VQTA 3ARVA 4XAYA 1J18A 1PKYA 4C5YA 4K37A 1FKBA 2PTYA 4LRSA 3W29A 3WLJA 1AD1A 2PP1A 2REQB 4MJZA 4H7VA 5BCAA 1QNSA 1V79A 4UQEA 2Z4GA 3CK5A 3UGVA 2WSQA 3AU2A 4HCLA 3DN5A 1Z3NA 1M7OA 3TAKA 2F2KA 1DORA 2OYMA 1N55A 1BVWA 3PNUA 1D8WA 4FX7A 3W9ZA 5D9OA 2EAWA 3GNXA 1VPXA 3S6TA 2V2CA 1FH8A 5KEZA 1GOWA 5CC7A 1FKIA 2NVAA 4OV9A 1M04A 3NFUA 2YXOA 1QPKA 3NVTA 2HTMA 2VCAA 3NUKA 3U2ZA 3WD1A 1XXXA 1PVNA 4Q32A 2GGHA 2CPUA 5E70A 4JX4A 3TJXA 3AC0A 2O9RA 3IK2A 2QLYA 3FDKA 5E9AA 2CWXA 1P7TB 1RQHA 1F74A 4LAYA 2VC5A 4A05A 3KFTA 2FFIA 2ZUWA 1WDRA 3F4CA 3VDGA 4H3DA 3V5FA 3PFMA 2J8FA 3PTKA 4G9PA 3M07A 3R11A 1S3TC 4R9OA 2OPJA 4RW3A 4WOZA 3B8IA 2PPNA 1WZKA 4QDMA 2FTWA 5CGTA 3H7RA 4KERA 3GXPA 2LGOA 1UKQA 4A3YA 3NSXA 3TYUA 3BARA 4GC4A 2G97A 1NIUA 4QIUA 1NQ6A 3ARXA 3WO8A 1QT1A 2CXGA 1UZDA 5FD0A 1BGAA 2RFGA 2WV8A 3K1DA 4FNUA 2CLOA 3TCEA 2X16A 3W7QA 4OU1A 3REQB 2GWGA 1A49A 1A7XA 2B81A 4IPXA 2A7NA 2X1RA 2V5KA 3LPGA 4ZB0A 5K4ZA 4BJHA 4NU7A 4GNKB 1EC8A 3VKJA 3FVMA 3B9OA 2FYMA 2YDQA 4Y8EA 3N6HA 3W7RA 4V15A 3NR0A 3AMGA 4CEUC 4K1GA 2YYTA 4Y6GA 4LYPA 4GUIA 1JULA 1ZRQA 2YDRA 1XIBA 4NUWA 4US5D 1C93A 1W9DM 3BOXA 3CV6A 3PZOA 3W84A 4O8RA 4A8NA 3FGCB 4W93A 4O1DA 2YCKX 4G50A 3W07A 4GK8A 3B9NA 4L72B 1HO1A 3VXGA 1HF6A 1KM4A 3F4DA 1XGZA 4GQ0A 3SCTA 4U10A 1BVNP 4UOJA 3GXTA 3TW6A 4ZMGA 4EAYA 5B8IC 5A8PA 3WZ0E 4O52A 5CBIA 3C6CA 3TFXA 2R82A 3VKDA 3PB0A 3F5JA 1U30A 2WSKA 5A8QA 4DRJA 4GIRA 3CAVA 2VUNA 3FJ4A 4O28A 4O0ZA 4ZEPA 2FQIA 1DQUA 3N3MA 3N34A 2JEPA 4IGSA 4LY8A 4GI4A 2QCMA 2L5HA 3VIKA 2XIQA 4DN1A 2WC4A 1AJZA 3GVRA 3THUA 4GO9A 2FMOA 4UWMA 1XIGA 1XQLA 1G1YA 3RUBL 1EP2A 3MW7A 4OBTA 5T8GA 3LERA 3PY2A 1F6KA 4G8TA 3URAA 1XBXA 3ZJ7A 3MBFA 2OSXA 2WZHA 4KCTA 3HFTA 2B0MA 3P61A 3LHTA 3LI0A 3HIJA 3T2QA 3UP8A 4D1JA 3GSMA 4MZ1A 5MKGB 1D7KA 4H00A 2BVYA 5GVJA 3WH8A 4LT9A 1EC7A 1AQMA 5GJPA 4IGMA 3MZNA 2PPPA 5HNUA 4AHQA 4PUDA 1S5NA 3DFNA 3I65A 1NMWA 3PZVA 4C1KA 3R13A 3AS2A 3ABOA 1K9FA 3ARYA 5KTLA 3EX6A 1DE5A 4PMNA 1EDQA 1UYQA 3GXFA 3WNNA 2OMAA 3Q2DA 3O5QA 3LCHA 1VIZA 2H3BA 3R6IA 4LVGA 4JY9A 1TTPA 1EDGA 3ABSA 3OA5A 4M80A 4OVXA 4ZO9A 2DQWA 2A7RA 3OLGA 4UTWA 3W7EA 1KFBA 4AIOA 4AYGA 1S3HA 2XIBA 2JF6A 3GNRA 1XGDA 3CJPA 3NQFA 2VCBA 2QPUA 3SCQA 4ZPTR 3I10A 3CV1A 1HP4A 1SR0A 3WLIA 1T6MA 3PJTA 4XO6A 3VDBA 2CLHA 3LLDA 4KEVA 3UWZA 2PAJA 3E0LA 3H6OA 2E6FA 1CLVA 4R85A 4EAMA 1OX6A 3DBNA 3IVUA 4CEXC 4ZO7A 1A5MC 4INFA 4F2BA 3MCNA 3OP2A 2G37A 4M7SA 3QV8A 4Q8OA 3I7QA 4MNMA 1H09A 3TDBA 4AB4A 3QR3A 1VLIA 3T7VA 5MKGA 1UZ1A 4YTTA 3RLHA 4LEFA 2XFFA 2KGJA 4GY7A 3H2CA 1P0NA 4OQVA 5AZ1A 3FCPA 2XWDA 1RHCA 1PKNA 1F73A 8A3HA 5D05A 4FZIA 1GOOA 1KFKA 4JX5A 1TFVA 1ITUA 3B9AA 5AHMA 3DG7A 3STPA 3J7HA 4DZ2A 2Y5SA 3NAVA 3P93A 3WNKA 2WKLA 3GTXA 1V8EA 1DOSA 1DJYA 1JPIA 3IGHX 3G0XA 2EQDA 3EDKA 1XLGA 3MMTA 4JIEA 3GC5A 2XDFA 2CZEA 4YYFA 5C9XA 5DFAA 2FPVA 2QMKA 3QZEA 4Q4RA 4LWWA 4D6JA 2EHHA 2POTA 3KDNA 2QKFA 3WD3A 4NXSA 2J9XA 4MFEA 2ZWYA 3BAWA 3CQHA 1NF7A 3NQBA 1W6TA 3BGGA 4ZTXA 3OZOA 5SWUA 5AECA 1PS9A 5I79A 4XZ9A 1H60A 1ME9A 1QVBA 3E2RA 1ZK6A 3G6MA 2R6OA 5HWMA 1YADA 1HKKA 4GZ7A 4ZXLA 4KBXA 1KT1A 4IQLA 2PDHA 4G1KA 4JFTA 3E1F1 1J0KA 3KLKA 4DJEC 2E6AA 4LAVA 3N4AA 1PBKA 2VD8A 3B0UX 1IXNA 1XS2A 1W17A 3CZJA 2QYGA 2PWHA 3GD6A 2D22A 5E0KA 4XISA 1S46A 3TYBA 2G4FA 3TMLA 3E12A 1W9VA 1W26A 3KEHA 1W5NA 4F79A 3EMZA 4ZL1A 4JTIA 4GYJA 3ZLHA 1B30A 3U7BA 1TO3A 2ACQA 5F2MA 1B3OA 2WVTA 1KQZA 5E09A 4OHQA 1H49A 2UY3A 1Q6EA 3BV4A 3H2AA 3HN3A 2YCLA 4JTAA 2DUZA 4S3JA 1NH6A 4YVXA 4JYEA 3KBWA 2QPXA 1WYIA 4XAKA 3ZYZA 3A5VA 2XFYA 1LLWA 1LOLA 3UJ2A 3EEZA 4GJ1A 3VKAA 2G3FA 3BW2A 1EZWA 6XIAA 4GIYA 2DEPA 2MPHA 3WFAA 2LLEA 3F4WA 1YX1A 5G4WA 2B7PA 4V1YA 4MLJA 1W3KA 2C91A 3TTEA 3RR4A 5GJNA 3U2CA 2A3AA 3RRAA 4OJYA 4LUSB 4FLOA 1HL8A 2DSWA 3QPYA 4Z2GA 4ZFMA 4OZOA 5DT7A 2XJ7A 4FX8A 2X1SA 4JFKA 4X9YA 2Q8XA 4Q33A 4RNHA 1TELA 2XP3A 3N2MA 2AMGA 3C2VA 2E1WA 3T78A 2NUXA 4WR3A 3IJDA 1J2BA 3O6AA 1ITCA 3S1UA 3SURA 2XP5A 4Q4KA 4A2SA 3GBDA 2RHGA 4PUKA 5LKYA 1A0CA 3KXQA 3WQ8A 1UR3M 3BANA 3SUWA 4Y2WA 1WX0A 4DUWA 1QOQA 2NXIA 3K30A 4R7WA 2QJHA 1VFSA 4HNUA 1C9WA 2GOKA 4AIBA 1UQZA 3ATYA 4RE4A 3ZQ9A 1ZZMA 4H9YA 5A6BA 2QCNA 4IM4A 1AD4A 3E2VA 3SDOA 5A3HA 4R3UA 3O5FA 2WNNA 3IACA 1JJKA 1QNRA 4UTLA 4QJ4B 2J62A 3NG3A 3UCQA 3B4YA 4WJEA 4FXRA 4NZ5A 3QR1A 3NOYA 1PX8A 4NQ1A 4Q8TA 1YHTA 2PDFA 4I7WA 4LB4A 3C0SA 1I2OA 3RPDA 4NZFA 3LPOA 1XKYA 4HA1A 1R9HA 4UR9A 4HA4A 1E9IA 5I2UA 3PBVA 1Z41A 5EL1A 4ZOCA 4P8XA 3CYJA 1J2WA 4ZE5A 7TIMA 4O13A 1TE1A 3NSNA 4UMBA 3VABA 3LRLA 1LQ0A 4FNRA 1CGVA 1YDNA 4MWAD 3VOHA 2G95A 2PF0A 1MFVA 1EJTC 3N2OA 4REQB 3SRFA 3RX4A 1WXYA 3DHPA 2V3GA 4U5IA 2INFA 2C15A 3RFAA 3LTSA 4LVFA 3UWUA 4GZEA 3IGUA 3RX3A 1EXPA 4GFIA 5C0QA 5I3IA 4ATWA 3UG8A 1UR8A 4UTJA 1EL3A 4GQRA 4GGQA 1JRCA 2SFPA 4BQ2A 4W7VA 2FZMA 4PMJA 3ELFA 1CZ1A 9RUBA 2OYKA 1RQBA 1DEDA 3LM3A 5A69A 5A8NA 1SO6A 1J11A 1CB2A 3WF3A 2O55A 4TR9A 4IMFA 2OSWA 1FH7A 1TPDA 3SADA 5FEWA 1KTCA 3BJTA 2NWSA 1SPQA 3QQ0A 2H8ZA 2WANA 4RZBA 3THDA 2IKHA 5E6YA 3BCFA 3AI0A 1OGSA 2F38A 2KO7A 1OGBA 1YNPA 2W6RA 3MKVA 2VEFA 4V1XA 1R85A 4B3ZA 5A6KA 2JQXA 4JTSA 3R58A 1SO4A 3WK0A 3EMCA 3JRKA 2V5CA 4CU7A 2C79A 3ORWA 1XUZA 3KOZA 3NQ2A 3QV6A 1L6SA 5CGMA 2E8ZA 4FLSA 1KRCC 1TV5A 4NRSA 1MQRA 1DJNA 4ICMA 4WX2A 4I9MA 3TQVA 3N9RA 1KWKA 2DFAA 4WGHA 2WVUA 5U7SA 5HUPA 4PMQA 3APTA 2VC7A 3P5YA 4ADTA 2C0HA 3T1GA 4JFMA 2XP8A 3R89A 3CUFA 3UXDA 1M7XA 2HROA 4GKLA 4AD4A 2WK2A 1JCYA 1Z7AA 3RXZA 4F9DA 3RGCA 2ICSA 3RR1A 3FY1A 3QV9A 3WNPA 4AW7A 3BSGA 3EDFA 3BJSA 4AD1A 3GH4A 2E9LA 2I5GA 2D69A 4U86A 1Y8BA 4DUVA 5HWCA 3PP7A 2GFTA 1KM1A 3CWOX 4RCXA 2BLEA 2PGFA 4YCPA 1I1WA 4M8UA 1KD0A 3T0CA 1H7XA 3TOPA 2VCDA 3DUGA 5CPQA 4DO5A 3YPIA 3NQ6A 1Z9AA 1RCXB 4IL2A 4GNJA 2C13A 4XSMA 1PZ0A 5CBBA 4S3AA 1U22A 4L5ZA 2WMFA 3F5LA 5D8WA 2ZTJA 3EWZA 4LV9A 3DI1A 3KBVA 3CT7A 1A50A 4GUGA 3WCZA 1TJ2A 1CGWA 4C1LA 1OG0A 1I2QA 5C8BB 2ACSA 4F0KA 5CH9A 1XH0A 3W1TA 5L9FA 3O15A 1G4SA 1XCXA 2WSRA 4PEEA 4DBEA 3UPMA 3GXDA 5EB8A 2KI3A 2J7FA 3BWWA 2YL6A 5DRCA 3UR7A 3IIOA 1W3IA 4RDYA 3DIPA 1BF6A 1EPXA 3Q94A 5AZ0A 3QMSA 1D8CA 1EYMA 3MVIA 2VEPA 3ISIX 1SU5A 3UPBA 1JCTA 2BV9A 1FKSA 2XVLA 1UOKA 1AL8A 3GFYA 1CI1A 2PN0A 4AH7A 1UWIA 4J2PA 2VRJA 1KGUA 1WUEA 3AYRA 3VE9A 1I2RA 1MW1A 4QDPA 3ITGA 2OQYA 3I3BA 2R9RA 3GDBA 3TA6A 4Y9MA 2PDJA 4HMCA 4RR4A 3QGVA 1A3WA 1ONWA 3UG3A 4Q6JA 3TWBA 1EDTA 3VC6A 1NFBA 5EA9A 2PDLA 4MNKA 3P74A 1EKOA 1H7NA 3D46A 1H1ZA 4S2BA 1EUAA 3ZSTA 1JNEA 4ACZB 5I00A 1OHLA 1P5QA 1V6YA 3M0HA 3N1AA 4YWIA 3BW4A 2VOTA 1A5CA 2FH6A 1EJRC 2Z1SA 4IWWA 2GJNA 4QJ1A 1YDVA 3PS7A 5HAOA 3ZS4A 4XWUA 1GEQA 1JZ4A 3VKKA 3JR2A 2W67A 4Q7BA 2ZZ6A 3DFPA 5M17A 2VO5A 3WEMA 1TQJA 4LGXA 3U6WA 4JY8A 3CEUA 1U5VA 1O5XA 2QUTA 4KQNA 3S2JA 2WNQA 1D9EA 3RLGA 5G4HC 3MUAA 1MDRA 1J79A 5G5IA 3OHIA 4IXHA 1ONRA 2E3ZA 5BU6A 1GW9A 3ES7A 3VIFA 2ZRUA 4NNRA 2Y4SA 1RY0A 2GWNA 1OSEA 1VBUA 5KSWA 4KESA 2RDXA 2VDGA 3NNTA 4JQ3A 1TIMA 3C0JA 1LRTA 3N3TA 5ENLA 3B8SA 3IV3A 4PMRA 4MZ8A 4CCDA 2PDUA 1JD7A 3O0KA 2IXUA 3OZYA 1B4KA 3MP3A 4EX4A 2F6KA 2QDGA 3L0GA 1XGEA 3C2OA 3BLPX 3WSUA 3CQIA 1XUUA 4O53A 1EEPA 4O54A 3W1MA 2CLLA 4C65A 1LWIA 2DG4A 2ODOA 1E51A 5EMYA 4CQ8A 2Z1WA 1I0BA 3SCSA 3VZZA 2RUQA 4CUCA 1XYMA 2XH7A 4FO4A 3UESA 1KXVA 4A22A 5CJNA 4DYEA 2AQWA 2LJ4A 1IZJA 1RPXA 3ONBA 2X1TA 1LL6A 3MDUA 3SM0A 1LF1A 1V77A 3WLOA 3RU6A 1XH2A 3EPNA 2MNRA 2J79A 3BPWA 1NP2A 2ZWZA 4F3HA 4IP4A 3UJFA 3CL7A 1J4IA 1GOIA 4X63A 2ZE0A 4ZQPA 5DY2A 3JS3A 4UQAA 3VC5A 4U31A 2QUVA 3CIXA 3IAPA 1QI5A 2YSWA 4IP7A 2UWFA 2ZZ4A 3VA8A 1MXSA 2ASHA 3THCA 2GJRA 4FIRA 2GGEA 4P5UA 1EJSC 1OC7A 1XH1A 4CD5A 4J9JA 3SCVA 2XPKA 1JCJA 4NZJA 4BHYA 3M0YA 1FKJA 3VILA 4KEZA 1ICSA 3LSBA 3R4IA 1A5LC 1YDYA 1WBHA 3PG8A 3GVQA 1HG3A 1VJIA 1EIXA 1ZPTA 4RDZA 1KBKA 1AL7A 3O6DA 3S2CA 1X7IA 3NZ1A 4DRNA 1SZGA 1IEXA 2E7FA 2ZXDA 3M0VA 5C2CA 2GUUA 1QPNA 2XVKA 1GOMA 1AW2A 1H2JA 3KL0A 4PSRA 5EY5A 3EBVA 3IUHA 4UTIA 3CAKA 3WK1A 5FESA 1F7BA 2NV2A 4CD8A 1C8VA 1XSIA 1TV2A 3TW9A 3GNPA 2VVNA 2WXDM 4DPQA 3GW3A 2GSEA 3CAQA 1I2NA 3VZXA 4UR7A 4NJKA 2CZVA 4RV3A 4Z2IA 2HXTA 4IQEA 5DMMA 2PLCA 1FVPA 2CBVA 3B0PA 3C2YA 1OQFA 1LQAA 2MLXA 2VYOA 5C9ZA 1KCKA 3GQYA 3UI4A 3GTYX 4JR5A 2OU4A 1MXDA 4MB4A 3TK7A 3FV9A 3OA3A 3THAA 5KZ6A 8CGTA 1D2KA 1LG2A 2TODA 4MZYA 3R1ZA 4DO4A 1W2PA 1EJXC 3H4GA 4H8UA 5F4XA 4EIVA 4D1IA 4XZIA 1V3JA 2Z6IA 3FDGA 3CHCA 4PMZA 2OKOA 1ZBVA 2YFOA 2WKJA 2EJ1A 1NDVA 4ZTYA 4IFRA 3IJLA 2JKAA 2BXZA 2BZNA 4L4MA 3B97A 4G6CA 3DH7A 1B90A 3GKAA 3LHVA 1E73M 4L1XA 2I57A 3MY9A 3NTYA 4M6PA 3SJNA 4Q8QA 5XIMA 1GZJA 1VRXA 1LT8A 3QN3A 3UWEA 4FNPA 3C0LA 2O9PA 3LSCA 2PDQA 4LCRA 2BOGX 2A3HA 5DXXA 5LGZA 3GO2A 2WHJA 3PZIA 2IKGA 3UZYA 3CB8A 4XKYB 4DX3A 2PLMA 3GR8A 1UBSA 2PF8A 2V82A 2TSYA 2P76A 1IYXA 3WMBA 1VJSA 2JIEA 2XH4A 5ABHA 3FVDA 5M5DA 3PZTA 2J6VA 2B7QA 3ZZ1A 1WXJA 2JEQA 3DENA 1BL4A 1FCVA 1RCOB 4FX6M 1XDLA 1DXFA 3G1AA 1KKRA 2VFDA 5D38A 1H0GA 5JXQA 4G7EB 4D6DA 5XINA 1X6NA 3PWAA 1M65A 2XGBA 2X05A 4FLQA 3KVKA 3UZ5A 1FWIC 4ZR8A 4GJJA 1VPYA 3UZJA 4FXSA 3PUDA 2E09A 1RAKA 5TQLA 1L6FA 4LEQA 4IPPA 1SJAA 3BCJA 1ZALA 5FF2A 5HNTA 3DI0A 4NY2A 3FA3A 1Z48A 4GA8A 5JIPA 3SIZA 1X1OA 4S3EA 5HATA 4AWSA 1U79A 4OTKA 2CKSA 4RW5A 2AKMA 4TX8A 5DCDA 4H1ZA 4NAFB 1F3WA 4TX0A 3RRXA 3JYMA 4DXKA 4MTVA 2FTYA 3ZT5A 4AZ5A 1UWRA 1XQKA 4GHRA 4JYSA 1OX4A 3P67A 1JNTA 4GXMA 2NX3A 5DIVA 1SVDA 3EA3A 5BOOA 3URQA 1P0BA 4R34A 3CHDA 3VI2A 4J35A 2D2JA 3VAVA 1JG9A 4U28A 2Y6ZA 2GDQA 1GTHA 3VNYA 2OQLA 5DX7A 4YTRA 3LZ3A 4F48A 1ZY9A 4GX8A 4N6FA 2F9RA 3FS2A 5CJMA 5HUAA 4UTFA 4RV8A 3W85A 2P0OA 4HZ7A 3OGRA 4ACYA 4XG1A 4DZIA 3GNDA 1W1TA 1YPXA 3UJRA 1AZ2A 2XHYA 5AN7A 4KCWA 3WBEA 2BXVA 4DZHA 6PTDA 1WDPA 4AG0A 1H11A 4BF5A 4N7QA 4H8HA 4MSPA 1BG4A 2J7DA 1OZQA 4KRZA 1CDGA 4DXVA 3USBA 1LROA 2AGKA 3FYOA 3WYZA 4HYRA 2FB2A 4U3CA 1AUSL 3TX9A 3KUMA 1SZRA 5BWAA 1CXKA 4UBPC 4MWAB 3DXIA 3EAUA 1VFFA 3AIBA 1JDFA 3VDCA 3WDPP 3AIRA 1N2VA 3V16A 2V69A 5LHFA 3GR4A 2PEVA 4FR1A 3O5IA 1K7XA 1QMLA 3W2MA 3DC8A 1JI1A 3LM7A 2W4XA 4I7VA 1NSJA 2VZUA 3L4VA 1XLFA 1E71M 3GAKA 1QHZA 1W1B1 4AWTA 2VEGA 1RV8A 3LG3A 2ZQ0A 4IPJA 5CC6A 1EYEA 4ITZA 1F2JA 1HJUA 2BGQA 1DWJM 1RY8A 1GPWA 4IMAA 1MZHA 3UNDA 4UNIA 3O5MA 1A5BA 4JNYA 1FKRA 4TVCA 3TOYA 1U5HA 1F05A 3W70A 2DUXA 1EA0A 4FNQA 3NQ8A 1T5AA 5DY3A 3IANA 3GIQA 3L23A 5FJOA 3UERA 4HPXA 3DX5A 3EWBX 1K9DA 4G7FA 1HJXA 2LKNA 3W0KA 3VMOA 3VOCA 3S8HA 4ENLA 1PZ2A 2QZRA 3T05A 4AY7A 1YBQB 1UG6A 2D3NA 4KWSA