1HKNA

A complex between acidic fibroblast growth factor and 5-amino-2-naphthalenesulfonate
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
128
structure length
128
Chain Sequence
b'KPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEPARIN-BINDING GROWTH FACTOR 1
publication title Leads for Development of New Naphthalenesulfonate Derivatives with Enhanced Antiangiogenic Activity: Crystal Structure of Acidic Fibroblast Growth Factor in Complex with 5-Amino-2-Naphthalenesulfonate
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 33
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1hknA00
1R8NA 3BA5A 1YYNA 1DQOA 4JAWA 3O4OA 4JKXB 1DZCA 1QQLA 5FZZA 2K43A 5BOWA 3MPPG 5F8SA 1BFFA 2IWTB 1AXMA 3RSJA 3K1XA 2WRYA 1PUUB 1EPWA 2X2TA 3WINA 3FJ8A 4QALA 3B9UA 1Q04A 2ZQNA 4KEIA 3H6QA 2D20A 1Z0HA 3HOMA 3OGGA 4LO8B 3OBTA 4LO2A 4ZFUB 1RMLA 2Y9FA 4P0LA 1IJTA 4I6IA 2D43A 3P53A 3WINC 2VLCA 1YBIA 3FGMA 4AN7B 3WO4A 2KLLA 2WBCA 2Q3NB 3ZX7A 1BASA 1F31A 3VSFA 2ZQOA 3BA7A 1DIWA 4LO2C 1EV2A 2ERMA 1TOOA 3CA6A 1N4KA 4JRAA 1FV3A 3FJ9A 5BVPI 1TP0A 4OEFA 2NP0A 5FZUA 1EVTA 4J2SA 1V6UA 4KBBA 2QN4A 3JRRA 5E24E 4J23B 3HMYA 1S0CA 1WBCA 2BEAA 4QD2C 4G1RA 2HWMA 2NM1A 5D63A 4IZXA 1FWUA 2AXMA 4EFPA 1ONKB 1HCDA 3OBRA 3BAGA 3VT1A 1ISVA 1W3GA 3O4DA 1FMZA 1R8OA 4J2KA 3WO2A 3P6IA 4L4HA 3MALA 2Q9XA 5EG6C 3NBEA 5D61A 5BQUA 4I4YA 1XG6A 3T8SA 2HW9A 4QBCA 1D0HA 2NVHA 3OGFA 1NZKA 1HKNA 2BEBA 1JT7A 1K5VA 1FN0A 5BQUC 1V6XA 3AJ5A 2HWAA 3FJEA 1JQZA 3Q7XA 2VXTI 4J2XA 1HWMB 1I1EA 3E8LC 2UUSA 4JKQA 3CA4A 3N7LA 1GGPB 4P0JA 5F90A 1BA7A 1XZZA 3FJKA 1FV2A 2DRZA 4QO3A 1JLXA 4KEJA 4F83A 1Z2VA 5F8WA 1PC8B 1E0OA 5F8YA 4QKRA 3R4SA 3CQAA 2ET2A 3BAVA 1DFQA 4ZOTA 2AQZA 4OEEA 2DREA 3CU1B 2YUGA 4X3AA 3UJ4A 8I1BA 4DCKC 4USOA 3O49A 4X39A 1OQLB 4LO7B 3FJDA 4GOVA 1XYFA 3HALA 4EFRA 2D7IA 3BTAA 4IZEA 1SZ6B 1IOBA 4I1EA 3H6RA 3ILAA 4TLPA 1P63A 4J2YA 4GAIA 3WMVA 3FFZA 3RTJB 2M49A 2F2FA 3CA0A 3VEQA 1QXMA 5BP5A 1AF9A 3PMEA 9ILBA 1G9DA 4OUJA 4ISRA 3WA1A 2K4AB 3FJIA 2XOAA 2VSEA 1II4A 4AN6A 4A7YA 1WBAA 31BIA 3FUOA 3I2XA 2BFHA 3Q7YA 1KNMA 4I4VA 2Y9GA 4OW4A 3AKHA 2F2FC 2L5XA 3VT0A 3FJHA 2HZ9A 7I1BA 1JT3A 4USPA 5BP5C 2DS0A 3O3QA 3OJVA 3ZC9A 1IRPA 2QYIB 3BAQA 3A07A 2K8RA 1BFCA 4H9WA 4EKXB 3WMUA 2MC2A 3V0BB 1JY0A 1RZOB 3Q7WA 3FJJA 1IHKA 4I4SA 4EEEB 2F8XC 1JTCA 4DEPA 2X2SA 5G00A 4IONA 2RQ9A 3BA4A 3AZWA 4Q91A 4HA2A 3VSZA 1YXWA 5GAQA 1HWPB 3NJ5A 3UJ0A 1W3FA 5JMCA 1VCLA 3QYDA 2P39A 3OJ2A 4D8HA 3PUBA 5BXSA 4GP0A 1AFCA 3OJMA 3CAHA 3CRGA 4I4OA 3AZVA 1SR4A 1HCEA 3AH2A 3IAGC 3AH1A 3IIRA 3FJCA 4EFQA 4Z8SB 1G9AA 1EYLA 1UPSA 4L4IA 3CA5A 1IRAX 3VUOA 4I4XA 3A23A 1BFGA 4Q9PA 3UDAA 2KKIA 1G9CA 1JT4A 1AVAC 1V6VA 3ZXDA 1QQKA 1SR4C 5DSSB 3AKFA 3O4CA 4GAFA 2D1ZA 2Z48A 3BAHA 3N7JA 5B2HA 2GO2A 1IILA 4JQ0A 4ZA3B 2Z49A 3FJAA 3BAUA 3BB2A 1S0BA 3IM5A 4ENDA 3O4AA 3NBCA 3I29B 3BRFA 4JPZA 3W9TA 1ISXA 2D24A 4LO3A 4LO7C 3UD8A 3I2AA 1YTOA 4YOLA 1AVXB 2P23A 4FVVA 3N7KA 4P0KA 4OWKA 5BXTA 2DRYA 3O4BA 2FGFA 5JLVA 4OEGA 3RTIB 3A22A 4F34A 3AKGA 3N0KA 4DENA 4LO3C 1DQGA 1DZDA 1PWAA 2VSAA 3ZC8A 41BIA 4A7KA 4IHZA 5FNXA 1S0EA 3CRHA 4G9NA 2MIBA 4XFUA 1BARA 1TTUA 4I96A 3EF2A 2J3PA 3V0AB 3NBNA 3RMYA 3C9ZA 2RG9B 1HIBA 1WD3A 2D44A 2E4MA 4FGFA 4OWLA 3F62B 4H04A 4IY9A 3VWCA 2D23A 3POKA 2NZ9A 3LTQA 4LO0A 3IM6A 4XFSA 5DZUA 1IT0A 2I1BA 4KC3A 5FZYA 1T9FA 5D62A 3BX1C 3BRGC 4QBVA 3AH4A 3FJBA 3AJ6A 1W3AA 4WBCA 5HPZA 2E4MC 4XKIA 3S8JA 1WD4A 4ZBVB 2FO1A 1BLAA 4I3NA 4LO0C 3WO3A 2LIEA 2Y9XE 3N7MA 4II0A 5DUYA 1Z4SA 2KH2A 4G6JA 4IQPA 4I8MA 3UD7A 4IY8A 4X37A 5I1BA 2RSTA 4I7IA 4I1BA 5BXRA 2NTDA 1PUMB 3CA3A 2MLLB 2D7RA 4HR6C 5BXPA 1JLYA 3H6SE 4ZLBB 4QC4A 1TFMB 4KEKA 1G9BA 4PC4A 1TWEA 4I4QA 4I37A 4R6UB 5DVHA 1S0GA 4I4PA 2D22A 4Q9GA 4ZFWB 4I4UA 3D7WB 2AFGA 2ESUA 4CJMA 4XFTA 3CA1A 3PHZA 1PZZA 3P6JA 4ZFYB 1G82A 4I2SA 4LO1A 1J0SA 1FWVA 1CE7B 4I0YA 3PG0A 3S8KA 1DJSB 1M2TB 1TIEA 1Q03A 1YF8B 1L2HA 1DLLA 1ITBA 1ISYA 4G6MA 4Z9WB 3H6RB 4LO1C 1AVWB 5EC5A 3V0AA 1BFBA 3ZXGA 1Q1UA 3IM7A 1ISWA 1CVSA 4IYBA 1S0LA 3NBDA 3R4UA 4P6AA 3TC2A 2AAIB 3HN1A 1JT5A 4I4RA 4X38A 1FMMS 2Y9WC 3LLPA 4A7ZA 1A8DA 1NUNA 4GOYA 2VUAA 1RG8A 1ILR1 3JUTA 5EHAA 4HJJA 4G9MA 3VT2A 1FGAA 5FNWA 3RMXA 4D0ZA 3FJFA 3QR5A 2FFUA 1MC9A 3BADA 4QD2B 1S0DA 4ZGRB 1TWMA 1I1BA 3BAOA 1DFCA 4OWJA 4D0TA 21BIA 2FDBM 1FQ9A 2LIQA 3HBWA 1BLDA 1HWOB 3AKIA 3KMVA 2KI4A 2KI6B 1K5UA 2FFVA 2NYYA 2R9KB 1ISZA 3V0BA 3V79C 1AVUA 1ABRB 3FUQA 3SNVA 1M16A 1RY7A 3F1RA 1HWNB 3UD9A 4ZKTB 1T4QA 4JP0A 2IHOA 2VU9A 3O5WB 4GP3A 3CRIA 1XHBA 6I1BA 4QKSA 4ISQA 1MD6A 2VXRA 2ZR1B 4EB2B 3O44A 1S0FA 3HSMA 1V6WA 3BRDA 2GZBA 3A21A
chains in the Genus database with same CATH superfamily
1R8NA 3BA5A 1YYNA 1DQOA 4JAWA 3O4OA 4JKXB 1DZCA 1QQLA 5FZZA 2K43A 5BOWA 3MPPG 5F8SA 1BFFA 2IWTB 1AXMA 3RSJA 3K1XA 2WRYA 1PUUB 1EPWA 2X2TA 3WINA 3FJ8A 4QALA 3B9UA 1Q04A 2ZQNA 4KEIA 3H6QA 2D20A 1Z0HA 3HOMA 3OGGA 4LO8B 3OBTA 4LO2A 4ZFUB 1RMLA 2Y9FA 4P0LA 1IJTA 4I6IA 2D43A 3P53A 3WINC 2VLCA 1YBIA 3FGMA 4AN7B 3WO4A 2KLLA 2WBCA 2Q3NB 3ZX7A 1BASA 1F31A 3VSFA 2ZQOA 3BA7A 1DIWA 4LO2C 1EV2A 4MZGB 2ERMA 1TOOA 3CA6A 1N4KA 4JRAA 1FV3A 3FJ9A 5BVPI 1TP0A 4OEFA 2NP0A 5FZUA 1EVTA 2NS2A 4J2SA 1V6UA 4KBBA 2QN4A 3JRRA 5E24E 4J23B 3HMYA 1S0CA 1WBCA 2BEAA 4QD2C 4G1RA 2HWMA 2NM1A 5D63A 4IZXA 1FWUA 2AXMA 4EFPA 1ONKB 1HCDA 3OBRA 3BAGA 3VT1A 1ISVA 3BRDA 1W3GA 3O4DA 1FMZA 1R8OA 4J2KA 3WO2A 3P6IA 4L4HA 3MALA 2Q9XA 5EG6C 3NBEA 5D61A 5BQUA 4I4YA 1XG6A 3T8SA 2HW9A 4QBCA 1D0HA 2NVHA 3OGFA 1NZKA 1HKNA 2BEBA 1JT7A 1K5VA 1FN0A 5BQUC 1V6XA 3AJ5A 2HWAA 3FJEA 1JQZA 4MZHA 3Q7XA 2VXTI 4J2XA 1HWMB 1I1EA 3E8LC 2UUSA 4JKQA 3CA4A 3N7LA 1GGPB 4P0JA 5F90A 1BA7A 1XZZA 3FJKA 1FV2A 2DRZA 4QO3A 1JLXA 4KEJA 4MZFB 4F83A 1Z2VA 5F8WA 1PC8B 1E0OA 5F8YA 4QKRA 3R4SA 3CQAA 2ET2A 3BAVA 1DFQA 4ZOTA 2AQZA 4OEEA 2DREA 3CU1B 2YUGA 4X3AA 3UJ4A 8I1BA 4DCKC 4H75A 4USOA 3O49A 4X39A 1OQLB 4LO7B 3FJDA 4GOVA 1XYFA 3HALA 4EFRA 2D7IA 3BTAA 4IZEA 1SZ6B 1IOBA 4I1EA 3H6RA 3ILAA 4TLPA 1P63A 4J2YA 4GAIA 3WMVA 3FFZA 3RTJB 2M49A 2F2FA 3CA0A 3VEQA 1QXMA 5BP5A 1AF9A 3PMEA 9ILBA 1G9DA 4OUJA 4ISRA 3WA1A 2K4AB 3FJIA 2XOAA 2VSEA 1II4A 4AN6A 4A7YA 1WBAA 31BIA 3FUOA 3I2XA 2BFHA 3Q7YA 1KNMA 4I4VA 2Y9GA 4OW4A 3AKHA 2F2FC 2L5XA 3VT0A 3FJHA 2HZ9A 7I1BA 1JT3A 4USPA 5BP5C 2DS0A 3O3QA 3OJVA 3ZC9A 1IRPA 2QYIB 3BAQA 3A07A 2K8RA 1BFCA 4H9WA 4EKXB 3WMUA 2MC2A 3V0BB 1JY0A 1RZOB 3Q7WA 3FJJA 1IHKA 4I4SA 4EEEB 2F8XC 1JTCA 4DEPA 2X2SA 5G00A 4IONA 2RQ9A 3BA4A 3AZWA 4Q91A 4HA2A 3VSZA 1YXWA 5GAQA 1HWPB 3NJ5A 3UJ0A 1W3FA 5JMCA 1VCLA 3QYDA 2P39A 3OJ2A 4D8HA 3PUBA 5BXSA 4GP0A 1AFCA 3OJMA 3CAHA 3CRGA 4I4OA 3AZVA 1SR4A 1HCEA 3AH2A 3IAGC 3AH1A 3IIRA 3FJCA 4EFQA 4Z8SB 1G9AA 1EYLA 1UPSA 4L4IA 3CA5A 1IRAX 3VUOA 4I4XA 3A23A 1BFGA 4Q9PA 3UDAA 2KKIA 1G9CA 1JT4A 1AVAC 1V6VA 3ZXDA 1QQKA 1SR4C 5DSSB 3AKFA 3O4CA 4GAFA 2D1ZA 2Z48A 3BAHA 3N7JA 5B2HA 2GO2A 1IILA 4JQ0A 4ZA3B 2Z49A 3FJAA 3BAUA 3BB2A 1S0BA 3IM5A 4ENDA 3O4AA 3NBCA 3I29B 3BRFA 4JPZA 3W9TA 1ISXA 2D24A 4LO3A 4LO7C 3UD8A 3I2AA 1YTOA 4YOLA 1AVXB 2P23A 4FVVA 3N7KA 4P0KA 4OWKA 5BXTA 2DRYA 3O4BA 2FGFA 5JLVA 4OEGA 3RTIB 3A22A 4F34A 3AKGA 3N0KA 4DENA 4LO3C 1DQGA 1DZDA 1PWAA 2VSAA 3ZC8A 41BIA 4A7KA 4IHZA 5FNXA 1S0EA 3CRHA 4G9NA 2MIBA 4XFUA 1BARA 1TTUA 4I96A 3EF2A 2J3PA 3V0AB 3NBNA 3RMYA 3C9ZA 2RG9B 1HIBA 1WD3A 2D44A 2E4MA 4FGFA 4OWLA 3F62B 4H04A 4IY9A 3VWCA 2D23A 3POKA 2NZ9A 3LTQA 4LO0A 3IM6A 4XFSA 5DZUA 1IT0A 2I1BA 4KC3A 5FZYA 1T9FA 5D62A 3BX1C 3BRGC 4QBVA 3AH4A 3FJBA 3AJ6A 1W3AA 4WBCA 5HPZA 2E4MC 4XKIA 3S8JA 1WD4A 4ZBVB 2FO1A 1BLAA 4I3NA 4LO0C 3WO3A 2LIEA 2Y9XE 3N7MA 4II0A 5DUYA 1Z4SA 2KH2A 4G6JA 4IQPA 4I8MA 3UD7A 4IY8A 4X37A 5I1BA 2RSTA 4I7IA 4I1BA 5BXRA 2NTDA 1PUMB 3CA3A 2MLLB 2D7RA 4HR6C 5BXPA 1JLYA 3H6SE 4ZLBB 4QC4A 1TFMB 4KEKA 1G9BA 4PC4A 1TWEA 4I4QA 4I37A 4R6UB 5DVHA 1S0GA 4I4PA 2D22A 4Q9GA 4ZFWB 4I4UA 3D7WB 2AFGA 2ESUA 4CJMA 4XFTA 3CA1A 3PHZA 1PZZA 3P6JA 4ZFYB 1G82A 4I2SA 4LO1A 1J0SA 1FWVA 1CE7B 4I0YA 3PG0A 3S8KA 1DJSB 1M2TB 1TIEA 1Q03A 1YF8B 1L2HA 1DLLA 1ITBA 1ISYA 4G6MA 4Z9WB 3H6RB 4LO1C 1AVWB 5EC5A 3V0AA 1BFBA 3ZXGA 1Q1UA 3IM7A 1ISWA 1CVSA 4IYBA 1S0LA 3NBDA 3R4UA 4P6AA 3TC2A 2AAIB 3HN1A 1JT5A 4I4RA 4X38A 1FMMS 2Y9WC 3LLPA 4A7ZA 1A8DA 1NUNA 4GOYA 2VUAA 1RG8A 1ILR1 3JUTA 5EHAA 4HJJA 4G9MA 3VT2A 1FGAA 5FNWA 3RMXA 4D0ZA 3FJFA 3QR5A 2FFUA 1MC9A 3BADA 4QD2B 1S0DA 4ZGRB 1TWMA 1I1BA 3BAOA 1DFCA 4OWJA 4D0TA 21BIA 2FDBM 1FQ9A 2LIQA 3HBWA 1BLDA 1HWOB 3AKIA 3KMVA 2KI4A 2KI6B 1K5UA 2FFVA 2NYYA 2R9KB 1ISZA 3V0BA 3V79C 1AVUA 1ABRB 3FUQA 3SNVA 1M16A 1RY7A 3F1RA 1HWNB 3UD9A 4ZKTB 1T4QA 4JP0A 2IHOA 2VU9A 3O5WB 4GP3A 3CRIA 1XHBA 6I1BA 4QKSA 4ISQA 1MD6A 2VXRA 2ZR1B 4EB2B 3O44A 1S0FA 3HSMA 1V6WA 4UY4A 2GZBA 3A21A
chains in the Genus database with same CATH topology
1R8NA 3BA5A 1YYNA 1DQOA 4JAWA 3O4OA 4JKXB 1DZCA 1QQLA 5FZZA 2K43A 5BOWA 3MPPG 5F8SA 1BFFA 2IWTB 1AXMA 3RSJA 3K1XA 2WRYA 1PUUB 1EPWA 2X2TA 3WINA 3FJ8A 4QALA 3B9UA 1Q04A 2ZQNA 4KEIA 3H6QA 2D20A 1Z0HA 3HOMA 3OGGA 4LO8B 3OBTA 4LO2A 4ZFUB 1RMLA 2Y9FA 4P0LA 1IJTA 4I6IA 2D43A 3P53A 3WINC 2VLCA 1YBIA 3FGMA 4AN7B 3WO4A 2KLLA 2WBCA 2Q3NB 3ZX7A 1BASA 1F31A 3VSFA 2ZQOA 3BA7A 1DIWA 4LO2C 1EV2A 4MZGB 2ERMA 1TOOA 3CA6A 1N4KA 4JRAA 1FV3A 3FJ9A 5BVPI 1TP0A 4OEFA 2NP0A 5FZUA 1EVTA 2NS2A 4J2SA 1V6UA 4KBBA 2QN4A 3JRRA 5E24E 4J23B 3HMYA 1S0CA 1WBCA 2BEAA 4QD2C 4G1RA 2HWMA 2NM1A 5D63A 4IZXA 1FWUA 2AXMA 4EFPA 1ONKB 1HCDA 3OBRA 3BAGA 3VT1A 1ISVA 3BRDA 1W3GA 3O4DA 1FMZA 1R8OA 4J2KA 3WO2A 3P6IA 4L4HA 3MALA 2Q9XA 5EG6C 3NBEA 5D61A 5BQUA 4I4YA 1XG6A 3T8SA 2HW9A 4QBCA 1D0HA 2NVHA 3OGFA 1NZKA 1HKNA 2BEBA 1JT7A 1K5VA 1FN0A 5BQUC 1V6XA 3AJ5A 2HWAA 3FJEA 1JQZA 4MZHA 3Q7XA 2VXTI 4J2XA 1HWMB 1I1EA 3E8LC 2UUSA 4JKQA 3CA4A 3N7LA 1GGPB 4P0JA 5F90A 1BA7A 1XZZA 3FJKA 1FV2A 2DRZA 4QO3A 1JLXA 4KEJA 4MZFB 4F83A 1Z2VA 5F8WA 1PC8B 1E0OA 5F8YA 4QKRA 3R4SA 3CQAA 2ET2A 3BAVA 1DFQA 4ZOTA 2AQZA 4OEEA 2DREA 3CU1B 2YUGA 4X3AA 3UJ4A 8I1BA 4DCKC 4H75A 4USOA 3O49A 4X39A 1OQLB 4LO7B 3FJDA 4GOVA 1XYFA 3HALA 4EFRA 2D7IA 3BTAA 4IZEA 1SZ6B 1IOBA 4I1EA 3H6RA 3ILAA 4TLPA 1P63A 4J2YA 4GAIA 3WMVA 3FFZA 3RTJB 2M49A 2F2FA 3CA0A 3VEQA 1QXMA 5BP5A 1AF9A 3PMEA 9ILBA 1G9DA 4OUJA 4ISRA 3WA1A 2K4AB 3FJIA 2XOAA 2VSEA 1II4A 4AN6A 4A7YA 1WBAA 31BIA 3FUOA 3I2XA 2BFHA 3Q7YA 1KNMA 4I4VA 2Y9GA 4OW4A 3AKHA 2F2FC 2L5XA 3VT0A 3FJHA 2HZ9A 7I1BA 1JT3A 4USPA 5BP5C 2DS0A 3O3QA 3OJVA 3ZC9A 1IRPA 2QYIB 3BAQA 3A07A 2K8RA 1BFCA 4H9WA 4EKXB 3WMUA 2MC2A 3V0BB 1JY0A 1RZOB 3Q7WA 3FJJA 1IHKA 4I4SA 4EEEB 2F8XC 1JTCA 4DEPA 2X2SA 5G00A 4IONA 2RQ9A 3BA4A 3AZWA 4Q91A 4HA2A 3VSZA 1YXWA 5GAQA 1HWPB 3NJ5A 3UJ0A 1W3FA 5JMCA 1VCLA 3QYDA 2P39A 3OJ2A 4D8HA 3PUBA 5BXSA 4GP0A 1AFCA 3OJMA 3CAHA 3CRGA 4I4OA 3AZVA 1SR4A 1HCEA 3AH2A 3IAGC 3AH1A 3IIRA 3FJCA 4EFQA 4Z8SB 1G9AA 1EYLA 1UPSA 4L4IA 3CA5A 1IRAX 3VUOA 4I4XA 3A23A 1BFGA 4Q9PA 3UDAA 2KKIA 1G9CA 1JT4A 1AVAC 1V6VA 3ZXDA 1QQKA 1SR4C 5DSSB 3AKFA 3O4CA 4GAFA 2D1ZA 2Z48A 3BAHA 3N7JA 5B2HA 2GO2A 1IILA 4JQ0A 4ZA3B 2Z49A 3FJAA 3BAUA 3BB2A 1S0BA 3IM5A 4ENDA 3O4AA 3NBCA 3I29B 3BRFA 4JPZA 3W9TA 1ISXA 2D24A 4LO3A 4LO7C 3UD8A 3I2AA 1YTOA 4YOLA 1AVXB 2P23A 4FVVA 3N7KA 4P0KA 4OWKA 5BXTA 2DRYA 3O4BA 2FGFA 5JLVA 4OEGA 3RTIB 3A22A 4F34A 3AKGA 3N0KA 4DENA 4LO3C 1DQGA 1DZDA 1PWAA 2VSAA 3ZC8A 41BIA 4A7KA 4IHZA 5FNXA 1S0EA 3CRHA 4G9NA 2MIBA 4XFUA 1BARA 1TTUA 4I96A 3EF2A 2J3PA 3V0AB 3NBNA 3RMYA 3C9ZA 2RG9B 1HIBA 1WD3A 2D44A 2E4MA 4FGFA 4OWLA 3F62B 4H04A 4IY9A 3VWCA 2D23A 3POKA 2NZ9A 3LTQA 4LO0A 3IM6A 4XFSA 5DZUA 1IT0A 2I1BA 4KC3A 5FZYA 1T9FA 5D62A 3BX1C 3BRGC 4QBVA 3AH4A 3FJBA 3AJ6A 1W3AA 4WBCA 5HPZA 2E4MC 4XKIA 3S8JA 1WD4A 4ZBVB 2FO1A 1BLAA 4I3NA 4LO0C 3WO3A 2LIEA 2Y9XE 3N7MA 4II0A 5DUYA 1Z4SA 2KH2A 4G6JA 4IQPA 4I8MA 3UD7A 4IY8A 4X37A 5I1BA 2RSTA 4I7IA 4I1BA 5BXRA 2NTDA 1PUMB 3CA3A 2MLLB 2D7RA 4HR6C 5BXPA 1JLYA 3H6SE 4ZLBB 4QC4A 1TFMB 4KEKA 1G9BA 4PC4A 1TWEA 4I4QA 4I37A 4R6UB 5DVHA 1S0GA 4I4PA 2D22A 4Q9GA 4ZFWB 4I4UA 3D7WB 2AFGA 2ESUA 4CJMA 4XFTA 3CA1A 3PHZA 1PZZA 3P6JA 4ZFYB 1G82A 4I2SA 4LO1A 1J0SA 1FWVA 1CE7B 4I0YA 3PG0A 3S8KA 1DJSB 1M2TB 1TIEA 1Q03A 1YF8B 1L2HA 1DLLA 1ITBA 1ISYA 4G6MA 4Z9WB 3H6RB 4LO1C 1AVWB 5EC5A 3V0AA 1BFBA 3ZXGA 1Q1UA 3IM7A 1ISWA 1CVSA 4IYBA 1S0LA 3NBDA 3R4UA 4P6AA 3TC2A 2AAIB 3HN1A 1JT5A 4I4RA 4X38A 1FMMS 2Y9WC 3LLPA 4A7ZA 1A8DA 1NUNA 4GOYA 2VUAA 1RG8A 1ILR1 3JUTA 5EHAA 4HJJA 4G9MA 3VT2A 1FGAA 5FNWA 3RMXA 4D0ZA 3FJFA 3QR5A 2FFUA 1MC9A 3BADA 4QD2B 1S0DA 4ZGRB 1TWMA 1I1BA 3BAOA 1DFCA 4OWJA 4D0TA 21BIA 2FDBM 1FQ9A 2LIQA 3HBWA 1BLDA 1HWOB 3AKIA 3KMVA 2KI4A 2KI6B 1K5UA 2FFVA 2NYYA 2R9KB 1ISZA 3V0BA 3V79C 1AVUA 1ABRB 3FUQA 3SNVA 1M16A 1RY7A 3F1RA 1HWNB 3UD9A 4ZKTB 1T4QA 4JP0A 2IHOA 2VU9A 3O5WB 4GP3A 3CRIA 1XHBA 6I1BA 4QKSA 4ISQA 1MD6A 2VXRA 2ZR1B 4EB2B 3O44A 1S0FA 3HSMA 1V6WA 4UY4A 2GZBA 3A21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R8N A;  3BA5 A;  1YYN A;  1DQO A;  4JAW A;  3O4O A;  4JKX B;  1DZC A;  1QQL A;  5FZZ A;  2K43 A;  5BOW A;  3MPP G;  5F8S A;  1BFF A;  2IWT B;  1AXM A;  3RSJ A;  3K1X A;  2WRY A;  1PUU B;  1EPW A;  2X2T A;  3WIN A;  3FJ8 A;  4QAL A;  3B9U A;  1Q04 A;  2ZQN A;  4KEI A;  3H6Q A;  2D20 A;  1Z0H A;  3HOM A;  3OGG A;  4LO8 B;  3OBT A;  4LO2 A;  4ZFU B;  1RML A;  2Y9F A;  4P0L A;  1IJT A;  4I6I A;  2D43 A;  3P53 A;  3WIN C;  2VLC A;  1YBI A;  3FGM A;  4AN7 B;  3WO4 A;  2KLL A;  2WBC A;  2Q3N B;  3ZX7 A;  1BAS A;  1F31 A;  3VSF A;  2ZQO A;  3BA7 A;  1DIW A;  4LO2 C;  1EV2 A;  2ERM A;  1TOO A;  3CA6 A;  1N4K A;  4JRA A;  1FV3 A;  3FJ9 A;  5BVP I;  1TP0 A;  4OEF A;  2NP0 A;  5FZU A;  1EVT A;  4J2S A;  1V6U A;  4KBB A;  2QN4 A;  3JRR A;  5E24 E;  4J23 B;  3HMY A;  1S0C A;  1WBC A;  2BEA A;  4QD2 C;  4G1R A;  2HWM A;  2NM1 A;  5D63 A;  4IZX A;  1FWU A;  2AXM A;  4EFP A;  1ONK B;  1HCD A;  3OBR A;  3BAG A;  3VT1 A;  1ISV A;  1W3G A;  3O4D A;  1FMZ A;  1R8O A;  4J2K A;  3WO2 A;  3P6I A;  4L4H A;  3MAL A;  2Q9X A;  5EG6 C;  3NBE A;  5D61 A;  5BQU A;  4I4Y A;  1XG6 A;  3T8S A;  2HW9 A;  4QBC A;  1D0H A;  2NVH A;  3OGF A;  1NZK A;  1HKN A;  2BEB A;  1JT7 A;  1K5V A;  1FN0 A;  5BQU C;  1V6X A;  3AJ5 A;  2HWA A;  3FJE A;  1JQZ A;  3Q7X A;  2VXT I;  4J2X A;  1HWM B;  1I1E A;  3E8L C;  2UUS A;  4JKQ A;  3CA4 A;  3N7L A;  1GGP B;  4P0J A;  5F90 A;  1BA7 A;  1XZZ A;  3FJK A;  1FV2 A;  2DRZ A;  4QO3 A;  1JLX A;  4KEJ A;  4F83 A;  1Z2V A;  5F8W A;  1PC8 B;  1E0O A;  5F8Y A;  4QKR A;  3R4S A;  3CQA A;  2ET2 A;  3BAV A;  1DFQ A;  4ZOT A;  2AQZ A;  4OEE A;  2DRE A;  3CU1 B;  2YUG A;  4X3A A;  3UJ4 A;  8I1B A;  4DCK C;  4USO A;  3O49 A;  4X39 A;  1OQL B;  4LO7 B;  3FJD A;  4GOV A;  1XYF A;  3HAL A;  4EFR A;  2D7I A;  3BTA A;  4IZE A;  1SZ6 B;  1IOB A;  4I1E A;  3H6R A;  3ILA A;  4TLP A;  1P63 A;  4J2Y A;  4GAI A;  3WMV A;  3FFZ A;  3RTJ B;  2M49 A;  2F2F A;  3CA0 A;  3VEQ A;  1QXM A;  5BP5 A;  1AF9 A;  3PME A;  9ILB A;  1G9D A;  4OUJ A;  4ISR A;  3WA1 A;  2K4A B;  3FJI A;  2XOA A;  2VSE A;  1II4 A;  4AN6 A;  4A7Y A;  1WBA A;  31BI A;  3FUO A;  3I2X A;  2BFH A;  3Q7Y A;  1KNM A;  4I4V A;  2Y9G A;  4OW4 A;  3AKH A;  2F2F C;  2L5X A;  3VT0 A;  3FJH A;  2HZ9 A;  7I1B A;  1JT3 A;  4USP A;  5BP5 C;  2DS0 A;  3O3Q A;  3OJV A;  3ZC9 A;  1IRP A;  2QYI B;  3BAQ A;  3A07 A;  2K8R A;  1BFC A;  4H9W A;  4EKX B;  3WMU A;  2MC2 A;  3V0B B;  1JY0 A;  1RZO B;  3Q7W A;  3FJJ A;  1IHK A;  4I4S A;  4EEE B;  2F8X C;  1JTC A;  4DEP A;  2X2S A;  5G00 A;  4ION A;  2RQ9 A;  3BA4 A;  3AZW A;  4Q91 A;  4HA2 A;  3VSZ A;  1YXW A;  5GAQ A;  1HWP B;  3NJ5 A;  3UJ0 A;  1W3F A;  5JMC A;  1VCL A;  3QYD A;  2P39 A;  3OJ2 A;  4D8H A;  3PUB A;  5BXS A;  4GP0 A;  1AFC A;  3OJM A;  3CAH A;  3CRG A;  4I4O A;  3AZV A;  1SR4 A;  1HCE A;  3AH2 A;  3IAG C;  3AH1 A;  3IIR A;  3FJC A;  4EFQ A;  4Z8S B;  1G9A A;  1EYL A;  1UPS A;  4L4I A;  3CA5 A;  1IRA X;  3VUO A;  4I4X A;  3A23 A;  1BFG A;  4Q9P A;  3UDA A;  2KKI A;  1G9C A;  1JT4 A;  1AVA C;  1V6V A;  3ZXD A;  1QQK A;  1SR4 C;  5DSS B;  3AKF A;  3O4C A;  4GAF A;  2D1Z A;  2Z48 A;  3BAH A;  3N7J A;  5B2H A;  2GO2 A;  1IIL A;  4JQ0 A;  4ZA3 B;  2Z49 A;  3FJA A;  3BAU A;  3BB2 A;  1S0B A;  3IM5 A;  4END A;  3O4A A;  3NBC A;  3I29 B;  3BRF A;  4JPZ A;  3W9T A;  1ISX A;  2D24 A;  4LO3 A;  4LO7 C;  3UD8 A;  3I2A A;  1YTO A;  4YOL A;  1AVX B;  2P23 A;  4FVV A;  3N7K A;  4P0K A;  4OWK A;  5BXT A;  2DRY A;  3O4B A;  2FGF A;  5JLV A;  4OEG A;  3RTI B;  3A22 A;  4F34 A;  3AKG A;  3N0K A;  4DEN A;  4LO3 C;  1DQG A;  1DZD A;  1PWA A;  2VSA A;  3ZC8 A;  41BI A;  4A7K A;  4IHZ A;  5FNX A;  1S0E A;  3CRH A;  4G9N A;  2MIB A;  4XFU A;  1BAR A;  1TTU A;  4I96 A;  3EF2 A;  2J3P A;  3V0A B;  3NBN A;  3RMY A;  3C9Z A;  2RG9 B;  1HIB A;  1WD3 A;  2D44 A;  2E4M A;  4FGF A;  4OWL A;  3F62 B;  4H04 A;  4IY9 A;  3VWC A;  2D23 A;  3POK A;  2NZ9 A;  3LTQ A;  4LO0 A;  3IM6 A;  4XFS A;  5DZU A;  1IT0 A;  2I1B A;  4KC3 A;  5FZY A;  1T9F A;  5D62 A;  3BX1 C;  3BRG C;  4QBV A;  3AH4 A;  3FJB A;  3AJ6 A;  1W3A A;  4WBC A;  5HPZ A;  2E4M C;  4XKI A;  3S8J A;  1WD4 A;  4ZBV B;  2FO1 A;  1BLA A;  4I3N A;  4LO0 C;  3WO3 A;  2LIE A;  2Y9X E;  3N7M A;  4II0 A;  5DUY A;  1Z4S A;  2KH2 A;  4G6J A;  4IQP A;  4I8M A;  3UD7 A;  4IY8 A;  4X37 A;  5I1B A;  2RST A;  4I7I A;  4I1B A;  5BXR A;  2NTD A;  1PUM B;  3CA3 A;  2MLL B;  2D7R A;  4HR6 C;  5BXP A;  1JLY A;  3H6S E;  4ZLB B;  4QC4 A;  1TFM B;  4KEK A;  1G9B A;  4PC4 A;  1TWE A;  4I4Q A;  4I37 A;  4R6U B;  5DVH A;  1S0G A;  4I4P A;  2D22 A;  4Q9G A;  4ZFW B;  4I4U A;  3D7W B;  2AFG A;  2ESU A;  4CJM A;  4XFT A;  3CA1 A;  3PHZ A;  1PZZ A;  3P6J A;  4ZFY B;  1G82 A;  4I2S A;  4LO1 A;  1J0S A;  1FWV A;  1CE7 B;  4I0Y A;  3PG0 A;  3S8K A;  1DJS B;  1M2T B;  1TIE A;  1Q03 A;  1YF8 B;  1L2H A;  1DLL A;  1ITB A;  1ISY A;  4G6M A;  4Z9W B;  3H6R B;  4LO1 C;  1AVW B;  5EC5 A;  3V0A A;  1BFB A;  3ZXG A;  1Q1U A;  3IM7 A;  1ISW A;  1CVS A;  4IYB A;  1S0L A;  3NBD A;  3R4U A;  4P6A A;  3TC2 A;  2AAI B;  3HN1 A;  1JT5 A;  4I4R A;  4X38 A;  1FMM S;  2Y9W C;  3LLP A;  4A7Z A;  1A8D A;  1NUN A;  4GOY A;  2VUA A;  1RG8 A;  1ILR 1;  3JUT A;  5EHA A;  4HJJ A;  4G9M A;  3VT2 A;  1FGA A;  5FNW A;  3RMX A;  4D0Z A;  3FJF A;  3QR5 A;  2FFU A;  1MC9 A;  3BAD A;  4QD2 B;  1S0D A;  4ZGR B;  1TWM A;  1I1B A;  3BAO A;  1DFC A;  4OWJ A;  4D0T A;  21BI A;  2FDB M;  1FQ9 A;  2LIQ A;  3HBW A;  1BLD A;  1HWO B;  3AKI A;  3KMV A;  2KI4 A;  2KI6 B;  1K5U A;  2FFV A;  2NYY A;  2R9K B;  1ISZ A;  3V0B A;  3V79 C;  1AVU A;  1ABR B;  3FUQ A;  3SNV A;  1M16 A;  1RY7 A;  3F1R A;  1HWN B;  3UD9 A;  4ZKT B;  1T4Q A;  4JP0 A;  2IHO A;  2VU9 A;  3O5W B;  4GP3 A;  3CRI A;  1XHB A;  6I1B A;  4QKS A;  4ISQ A;  1MD6 A;  2VXR A;  2ZR1 B;  4EB2 B;  3O44 A;  1S0F A;  3HSM A;  1V6W A;  3BRD A;  2GZB A;  3A21 A; 
#chains in the Genus database with same CATH topology
 1R8N A;  3BA5 A;  1YYN A;  1DQO A;  4JAW A;  3O4O A;  4JKX B;  1DZC A;  1QQL A;  5FZZ A;  2K43 A;  5BOW A;  3MPP G;  5F8S A;  1BFF A;  2IWT B;  1AXM A;  3RSJ A;  3K1X A;  2WRY A;  1PUU B;  1EPW A;  2X2T A;  3WIN A;  3FJ8 A;  4QAL A;  3B9U A;  1Q04 A;  2ZQN A;  4KEI A;  3H6Q A;  2D20 A;  1Z0H A;  3HOM A;  3OGG A;  4LO8 B;  3OBT A;  4LO2 A;  4ZFU B;  1RML A;  2Y9F A;  4P0L A;  1IJT A;  4I6I A;  2D43 A;  3P53 A;  3WIN C;  2VLC A;  1YBI A;  3FGM A;  4AN7 B;  3WO4 A;  2KLL A;  2WBC A;  2Q3N B;  3ZX7 A;  1BAS A;  1F31 A;  3VSF A;  2ZQO A;  3BA7 A;  1DIW A;  4LO2 C;  1EV2 A;  4MZG B;  2ERM A;  1TOO A;  3CA6 A;  1N4K A;  4JRA A;  1FV3 A;  3FJ9 A;  5BVP I;  1TP0 A;  4OEF A;  2NP0 A;  5FZU A;  1EVT A;  2NS2 A;  4J2S A;  1V6U A;  4KBB A;  2QN4 A;  3JRR A;  5E24 E;  4J23 B;  3HMY A;  1S0C A;  1WBC A;  2BEA A;  4QD2 C;  4G1R A;  2HWM A;  2NM1 A;  5D63 A;  4IZX A;  1FWU A;  2AXM A;  4EFP A;  1ONK B;  1HCD A;  3OBR A;  3BAG A;  3VT1 A;  1ISV A;  3BRD A;  1W3G A;  3O4D A;  1FMZ A;  1R8O A;  4J2K A;  3WO2 A;  3P6I A;  4L4H A;  3MAL A;  2Q9X A;  5EG6 C;  3NBE A;  5D61 A;  5BQU A;  4I4Y A;  1XG6 A;  3T8S A;  2HW9 A;  4QBC A;  1D0H A;  2NVH A;  3OGF A;  1NZK A;  1HKN A;  2BEB A;  1JT7 A;  1K5V A;  1FN0 A;  5BQU C;  1V6X A;  3AJ5 A;  2HWA A;  3FJE A;  1JQZ A;  4MZH A;  3Q7X A;  2VXT I;  4J2X A;  1HWM B;  1I1E A;  3E8L C;  2UUS A;  4JKQ A;  3CA4 A;  3N7L A;  1GGP B;  4P0J A;  5F90 A;  1BA7 A;  1XZZ A;  3FJK A;  1FV2 A;  2DRZ A;  4QO3 A;  1JLX A;  4KEJ A;  4MZF B;  4F83 A;  1Z2V A;  5F8W A;  1PC8 B;  1E0O A;  5F8Y A;  4QKR A;  3R4S A;  3CQA A;  2ET2 A;  3BAV A;  1DFQ A;  4ZOT A;  2AQZ A;  4OEE A;  2DRE A;  3CU1 B;  2YUG A;  4X3A A;  3UJ4 A;  8I1B A;  4DCK C;  4H75 A;  4USO A;  3O49 A;  4X39 A;  1OQL B;  4LO7 B;  3FJD A;  4GOV A;  1XYF A;  3HAL A;  4EFR A;  2D7I A;  3BTA A;  4IZE A;  1SZ6 B;  1IOB A;  4I1E A;  3H6R A;  3ILA A;  4TLP A;  1P63 A;  4J2Y A;  4GAI A;  3WMV A;  3FFZ A;  3RTJ B;  2M49 A;  2F2F A;  3CA0 A;  3VEQ A;  1QXM A;  5BP5 A;  1AF9 A;  3PME A;  9ILB A;  1G9D A;  4OUJ A;  4ISR A;  3WA1 A;  2K4A B;  3FJI A;  2XOA A;  2VSE A;  1II4 A;  4AN6 A;  4A7Y A;  1WBA A;  31BI A;  3FUO A;  3I2X A;  2BFH A;  3Q7Y A;  1KNM A;  4I4V A;  2Y9G A;  4OW4 A;  3AKH A;  2F2F C;  2L5X A;  3VT0 A;  3FJH A;  2HZ9 A;  7I1B A;  1JT3 A;  4USP A;  5BP5 C;  2DS0 A;  3O3Q A;  3OJV A;  3ZC9 A;  1IRP A;  2QYI B;  3BAQ A;  3A07 A;  2K8R A;  1BFC A;  4H9W A;  4EKX B;  3WMU A;  2MC2 A;  3V0B B;  1JY0 A;  1RZO B;  3Q7W A;  3FJJ A;  1IHK A;  4I4S A;  4EEE B;  2F8X C;  1JTC A;  4DEP A;  2X2S A;  5G00 A;  4ION A;  2RQ9 A;  3BA4 A;  3AZW A;  4Q91 A;  4HA2 A;  3VSZ A;  1YXW A;  5GAQ A;  1HWP B;  3NJ5 A;  3UJ0 A;  1W3F A;  5JMC A;  1VCL A;  3QYD A;  2P39 A;  3OJ2 A;  4D8H A;  3PUB A;  5BXS A;  4GP0 A;  1AFC A;  3OJM A;  3CAH A;  3CRG A;  4I4O A;  3AZV A;  1SR4 A;  1HCE A;  3AH2 A;  3IAG C;  3AH1 A;  3IIR A;  3FJC A;  4EFQ A;  4Z8S B;  1G9A A;  1EYL A;  1UPS A;  4L4I A;  3CA5 A;  1IRA X;  3VUO A;  4I4X A;  3A23 A;  1BFG A;  4Q9P A;  3UDA A;  2KKI A;  1G9C A;  1JT4 A;  1AVA C;  1V6V A;  3ZXD A;  1QQK A;  1SR4 C;  5DSS B;  3AKF A;  3O4C A;  4GAF A;  2D1Z A;  2Z48 A;  3BAH A;  3N7J A;  5B2H A;  2GO2 A;  1IIL A;  4JQ0 A;  4ZA3 B;  2Z49 A;  3FJA A;  3BAU A;  3BB2 A;  1S0B A;  3IM5 A;  4END A;  3O4A A;  3NBC A;  3I29 B;  3BRF A;  4JPZ A;  3W9T A;  1ISX A;  2D24 A;  4LO3 A;  4LO7 C;  3UD8 A;  3I2A A;  1YTO A;  4YOL A;  1AVX B;  2P23 A;  4FVV A;  3N7K A;  4P0K A;  4OWK A;  5BXT A;  2DRY A;  3O4B A;  2FGF A;  5JLV A;  4OEG A;  3RTI B;  3A22 A;  4F34 A;  3AKG A;  3N0K A;  4DEN A;  4LO3 C;  1DQG A;  1DZD A;  1PWA A;  2VSA A;  3ZC8 A;  41BI A;  4A7K A;  4IHZ A;  5FNX A;  1S0E A;  3CRH A;  4G9N A;  2MIB A;  4XFU A;  1BAR A;  1TTU A;  4I96 A;  3EF2 A;  2J3P A;  3V0A B;  3NBN A;  3RMY A;  3C9Z A;  2RG9 B;  1HIB A;  1WD3 A;  2D44 A;  2E4M A;  4FGF A;  4OWL A;  3F62 B;  4H04 A;  4IY9 A;  3VWC A;  2D23 A;  3POK A;  2NZ9 A;  3LTQ A;  4LO0 A;  3IM6 A;  4XFS A;  5DZU A;  1IT0 A;  2I1B A;  4KC3 A;  5FZY A;  1T9F A;  5D62 A;  3BX1 C;  3BRG C;  4QBV A;  3AH4 A;  3FJB A;  3AJ6 A;  1W3A A;  4WBC A;  5HPZ A;  2E4M C;  4XKI A;  3S8J A;  1WD4 A;  4ZBV B;  2FO1 A;  1BLA A;  4I3N A;  4LO0 C;  3WO3 A;  2LIE A;  2Y9X E;  3N7M A;  4II0 A;  5DUY A;  1Z4S A;  2KH2 A;  4G6J A;  4IQP A;  4I8M A;  3UD7 A;  4IY8 A;  4X37 A;  5I1B A;  2RST A;  4I7I A;  4I1B A;  5BXR A;  2NTD A;  1PUM B;  3CA3 A;  2MLL B;  2D7R A;  4HR6 C;  5BXP A;  1JLY A;  3H6S E;  4ZLB B;  4QC4 A;  1TFM B;  4KEK A;  1G9B A;  4PC4 A;  1TWE A;  4I4Q A;  4I37 A;  4R6U B;  5DVH A;  1S0G A;  4I4P A;  2D22 A;  4Q9G A;  4ZFW B;  4I4U A;  3D7W B;  2AFG A;  2ESU A;  4CJM A;  4XFT A;  3CA1 A;  3PHZ A;  1PZZ A;  3P6J A;  4ZFY B;  1G82 A;  4I2S A;  4LO1 A;  1J0S A;  1FWV A;  1CE7 B;  4I0Y A;  3PG0 A;  3S8K A;  1DJS B;  1M2T B;  1TIE A;  1Q03 A;  1YF8 B;  1L2H A;  1DLL A;  1ITB A;  1ISY A;  4G6M A;  4Z9W B;  3H6R B;  4LO1 C;  1AVW B;  5EC5 A;  3V0A A;  1BFB A;  3ZXG A;  1Q1U A;  3IM7 A;  1ISW A;  1CVS A;  4IYB A;  1S0L A;  3NBD A;  3R4U A;  4P6A A;  3TC2 A;  2AAI B;  3HN1 A;  1JT5 A;  4I4R A;  4X38 A;  1FMM S;  2Y9W C;  3LLP A;  4A7Z A;  1A8D A;  1NUN A;  4GOY A;  2VUA A;  1RG8 A;  1ILR 1;  3JUT A;  5EHA A;  4HJJ A;  4G9M A;  3VT2 A;  1FGA A;  5FNW A;  3RMX A;  4D0Z A;  3FJF A;  3QR5 A;  2FFU A;  1MC9 A;  3BAD A;  4QD2 B;  1S0D A;  4ZGR B;  1TWM A;  1I1B A;  3BAO A;  1DFC A;  4OWJ A;  4D0T A;  21BI A;  2FDB M;  1FQ9 A;  2LIQ A;  3HBW A;  1BLD A;  1HWO B;  3AKI A;  3KMV A;  2KI4 A;  2KI6 B;  1K5U A;  2FFV A;  2NYY A;  2R9K B;  1ISZ A;  3V0B A;  3V79 C;  1AVU A;  1ABR B;  3FUQ A;  3SNV A;  1M16 A;  1RY7 A;  3F1R A;  1HWN B;  3UD9 A;  4ZKT B;  1T4Q A;  4JP0 A;  2IHO A;  2VU9 A;  3O5W B;  4GP3 A;  3CRI A;  1XHB A;  6I1B A;  4QKS A;  4ISQ A;  1MD6 A;  2VXR A;  2ZR1 B;  4EB2 B;  3O44 A;  1S0F A;  3HSM A;  1V6W A;  4UY4 A;  2GZB A;  3A21 A; 
#chains in the Genus database with same CATH homology
 1R8N A;  3BA5 A;  1YYN A;  1DQO A;  4JAW A;  3O4O A;  4JKX B;  1DZC A;  1QQL A;  5FZZ A;  2K43 A;  5BOW A;  3MPP G;  5F8S A;  1BFF A;  2IWT B;  1AXM A;  3RSJ A;  3K1X A;  2WRY A;  1PUU B;  1EPW A;  2X2T A;  3WIN A;  3FJ8 A;  4QAL A;  3B9U A;  1Q04 A;  2ZQN A;  4KEI A;  3H6Q A;  2D20 A;  1Z0H A;  3HOM A;  3OGG A;  4LO8 B;  3OBT A;  4LO2 A;  4ZFU B;  1RML A;  2Y9F A;  4P0L A;  1IJT A;  4I6I A;  2D43 A;  3P53 A;  3WIN C;  2VLC A;  1YBI A;  3FGM A;  4AN7 B;  3WO4 A;  2KLL A;  2WBC A;  2Q3N B;  3ZX7 A;  1BAS A;  1F31 A;  3VSF A;  2ZQO A;  3BA7 A;  1DIW A;  4LO2 C;  1EV2 A;  4MZG B;  2ERM A;  1TOO A;  3CA6 A;  1N4K A;  4JRA A;  1FV3 A;  3FJ9 A;  5BVP I;  1TP0 A;  4OEF A;  2NP0 A;  5FZU A;  1EVT A;  2NS2 A;  4J2S A;  1V6U A;  4KBB A;  2QN4 A;  3JRR A;  5E24 E;  4J23 B;  3HMY A;  1S0C A;  1WBC A;  2BEA A;  4QD2 C;  4G1R A;  2HWM A;  2NM1 A;  5D63 A;  4IZX A;  1FWU A;  2AXM A;  4EFP A;  1ONK B;  1HCD A;  3OBR A;  3BAG A;  3VT1 A;  1ISV A;  3BRD A;  1W3G A;  3O4D A;  1FMZ A;  1R8O A;  4J2K A;  3WO2 A;  3P6I A;  4L4H A;  3MAL A;  2Q9X A;  5EG6 C;  3NBE A;  5D61 A;  5BQU A;  4I4Y A;  1XG6 A;  3T8S A;  2HW9 A;  4QBC A;  1D0H A;  2NVH A;  3OGF A;  1NZK A;  1HKN A;  2BEB A;  1JT7 A;  1K5V A;  1FN0 A;  5BQU C;  1V6X A;  3AJ5 A;  2HWA A;  3FJE A;  1JQZ A;  4MZH A;  3Q7X A;  2VXT I;  4J2X A;  1HWM B;  1I1E A;  3E8L C;  2UUS A;  4JKQ A;  3CA4 A;  3N7L A;  1GGP B;  4P0J A;  5F90 A;  1BA7 A;  1XZZ A;  3FJK A;  1FV2 A;  2DRZ A;  4QO3 A;  1JLX A;  4KEJ A;  4MZF B;  4F83 A;  1Z2V A;  5F8W A;  1PC8 B;  1E0O A;  5F8Y A;  4QKR A;  3R4S A;  3CQA A;  2ET2 A;  3BAV A;  1DFQ A;  4ZOT A;  2AQZ A;  4OEE A;  2DRE A;  3CU1 B;  2YUG A;  4X3A A;  3UJ4 A;  8I1B A;  4DCK C;  4H75 A;  4USO A;  3O49 A;  4X39 A;  1OQL B;  4LO7 B;  3FJD A;  4GOV A;  1XYF A;  3HAL A;  4EFR A;  2D7I A;  3BTA A;  4IZE A;  1SZ6 B;  1IOB A;  4I1E A;  3H6R A;  3ILA A;  4TLP A;  1P63 A;  4J2Y A;  4GAI A;  3WMV A;  3FFZ A;  3RTJ B;  2M49 A;  2F2F A;  3CA0 A;  3VEQ A;  1QXM A;  5BP5 A;  1AF9 A;  3PME A;  9ILB A;  1G9D A;  4OUJ A;  4ISR A;  3WA1 A;  2K4A B;  3FJI A;  2XOA A;  2VSE A;  1II4 A;  4AN6 A;  4A7Y A;  1WBA A;  31BI A;  3FUO A;  3I2X A;  2BFH A;  3Q7Y A;  1KNM A;  4I4V A;  2Y9G A;  4OW4 A;  3AKH A;  2F2F C;  2L5X A;  3VT0 A;  3FJH A;  2HZ9 A;  7I1B A;  1JT3 A;  4USP A;  5BP5 C;  2DS0 A;  3O3Q A;  3OJV A;  3ZC9 A;  1IRP A;  2QYI B;  3BAQ A;  3A07 A;  2K8R A;  1BFC A;  4H9W A;  4EKX B;  3WMU A;  2MC2 A;  3V0B B;  1JY0 A;  1RZO B;  3Q7W A;  3FJJ A;  1IHK A;  4I4S A;  4EEE B;  2F8X C;  1JTC A;  4DEP A;  2X2S A;  5G00 A;  4ION A;  2RQ9 A;  3BA4 A;  3AZW A;  4Q91 A;  4HA2 A;  3VSZ A;  1YXW A;  5GAQ A;  1HWP B;  3NJ5 A;  3UJ0 A;  1W3F A;  5JMC A;  1VCL A;  3QYD A;  2P39 A;  3OJ2 A;  4D8H A;  3PUB A;  5BXS A;  4GP0 A;  1AFC A;  3OJM A;  3CAH A;  3CRG A;  4I4O A;  3AZV A;  1SR4 A;  1HCE A;  3AH2 A;  3IAG C;  3AH1 A;  3IIR A;  3FJC A;  4EFQ A;  4Z8S B;  1G9A A;  1EYL A;  1UPS A;  4L4I A;  3CA5 A;  1IRA X;  3VUO A;  4I4X A;  3A23 A;  1BFG A;  4Q9P A;  3UDA A;  2KKI A;  1G9C A;  1JT4 A;  1AVA C;  1V6V A;  3ZXD A;  1QQK A;  1SR4 C;  5DSS B;  3AKF A;  3O4C A;  4GAF A;  2D1Z A;  2Z48 A;  3BAH A;  3N7J A;  5B2H A;  2GO2 A;  1IIL A;  4JQ0 A;  4ZA3 B;  2Z49 A;  3FJA A;  3BAU A;  3BB2 A;  1S0B A;  3IM5 A;  4END A;  3O4A A;  3NBC A;  3I29 B;  3BRF A;  4JPZ A;  3W9T A;  1ISX A;  2D24 A;  4LO3 A;  4LO7 C;  3UD8 A;  3I2A A;  1YTO A;  4YOL A;  1AVX B;  2P23 A;  4FVV A;  3N7K A;  4P0K A;  4OWK A;  5BXT A;  2DRY A;  3O4B A;  2FGF A;  5JLV A;  4OEG A;  3RTI B;  3A22 A;  4F34 A;  3AKG A;  3N0K A;  4DEN A;  4LO3 C;  1DQG A;  1DZD A;  1PWA A;  2VSA A;  3ZC8 A;  41BI A;  4A7K A;  4IHZ A;  5FNX A;  1S0E A;  3CRH A;  4G9N A;  2MIB A;  4XFU A;  1BAR A;  1TTU A;  4I96 A;  3EF2 A;  2J3P A;  3V0A B;  3NBN A;  3RMY A;  3C9Z A;  2RG9 B;  1HIB A;  1WD3 A;  2D44 A;  2E4M A;  4FGF A;  4OWL A;  3F62 B;  4H04 A;  4IY9 A;  3VWC A;  2D23 A;  3POK A;  2NZ9 A;  3LTQ A;  4LO0 A;  3IM6 A;  4XFS A;  5DZU A;  1IT0 A;  2I1B A;  4KC3 A;  5FZY A;  1T9F A;  5D62 A;  3BX1 C;  3BRG C;  4QBV A;  3AH4 A;  3FJB A;  3AJ6 A;  1W3A A;  4WBC A;  5HPZ A;  2E4M C;  4XKI A;  3S8J A;  1WD4 A;  4ZBV B;  2FO1 A;  1BLA A;  4I3N A;  4LO0 C;  3WO3 A;  2LIE A;  2Y9X E;  3N7M A;  4II0 A;  5DUY A;  1Z4S A;  2KH2 A;  4G6J A;  4IQP A;  4I8M A;  3UD7 A;  4IY8 A;  4X37 A;  5I1B A;  2RST A;  4I7I A;  4I1B A;  5BXR A;  2NTD A;  1PUM B;  3CA3 A;  2MLL B;  2D7R A;  4HR6 C;  5BXP A;  1JLY A;  3H6S E;  4ZLB B;  4QC4 A;  1TFM B;  4KEK A;  1G9B A;  4PC4 A;  1TWE A;  4I4Q A;  4I37 A;  4R6U B;  5DVH A;  1S0G A;  4I4P A;  2D22 A;  4Q9G A;  4ZFW B;  4I4U A;  3D7W B;  2AFG A;  2ESU A;  4CJM A;  4XFT A;  3CA1 A;  3PHZ A;  1PZZ A;  3P6J A;  4ZFY B;  1G82 A;  4I2S A;  4LO1 A;  1J0S A;  1FWV A;  1CE7 B;  4I0Y A;  3PG0 A;  3S8K A;  1DJS B;  1M2T B;  1TIE A;  1Q03 A;  1YF8 B;  1L2H A;  1DLL A;  1ITB A;  1ISY A;  4G6M A;  4Z9W B;  3H6R B;  4LO1 C;  1AVW B;  5EC5 A;  3V0A A;  1BFB A;  3ZXG A;  1Q1U A;  3IM7 A;  1ISW A;  1CVS A;  4IYB A;  1S0L A;  3NBD A;  3R4U A;  4P6A A;  3TC2 A;  2AAI B;  3HN1 A;  1JT5 A;  4I4R A;  4X38 A;  1FMM S;  2Y9W C;  3LLP A;  4A7Z A;  1A8D A;  1NUN A;  4GOY A;  2VUA A;  1RG8 A;  1ILR 1;  3JUT A;  5EHA A;  4HJJ A;  4G9M A;  3VT2 A;  1FGA A;  5FNW A;  3RMX A;  4D0Z A;  3FJF A;  3QR5 A;  2FFU A;  1MC9 A;  3BAD A;  4QD2 B;  1S0D A;  4ZGR B;  1TWM A;  1I1B A;  3BAO A;  1DFC A;  4OWJ A;  4D0T A;  21BI A;  2FDB M;  1FQ9 A;  2LIQ A;  3HBW A;  1BLD A;  1HWO B;  3AKI A;  3KMV A;  2KI4 A;  2KI6 B;  1K5U A;  2FFV A;  2NYY A;  2R9K B;  1ISZ A;  3V0B A;  3V79 C;  1AVU A;  1ABR B;  3FUQ A;  3SNV A;  1M16 A;  1RY7 A;  3F1R A;  1HWN B;  3UD9 A;  4ZKT B;  1T4Q A;  4JP0 A;  2IHO A;  2VU9 A;  3O5W B;  4GP3 A;  3CRI A;  1XHB A;  6I1B A;  4QKS A;  4ISQ A;  1MD6 A;  2VXR A;  2ZR1 B;  4EB2 B;  3O44 A;  1S0F A;  3HSM A;  1V6W A;  4UY4 A;  2GZB A;  3A21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...