1HKXA

Crystal structure of calcium/calmodulin-dependent protein kinase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
MTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of a Tetradecameric Assembly of the Association Domain of Ca2+/Calmodulin-Dependent Kinase II
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE II ALPHA CH
total genus 37
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2003-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1hkxA00
4GB5A 1OF5B 1ASKA 1GY7A 2HMLB 4HM0B 3GWRA 3CPOA 2HMJB 1WQLB 3STDA 1W00A 2HMNB 5CF2A 4LEHA 1A2KA 3SOAA 3NXJA 3ROBA 1JN5B 1ULJB 1O7GB 4FCMA 4MJDA 3MG2A 4WP5A 1JB5A 2HMOB 2K54A 2Z77A 3KZTA 5CK6A 2Z7AA 5CLKA 3HZPA 1CQSA 1QJGA 2INXA 1OH0A 3F9SA 3IPTA 3EN8A 3JUOA 4LGQA 2BMRB 4WYKB 3D9RA 5DREA 2B1XB 2OWPA 2STDA 2RCDA 3KSPA 1AR0A 3LZAA 1SJWA 3EBTA 2R4IA 1TP6A 5AIIA 1Q42A 3NUVA 2A15A 3F7SA 3SOYA 3EF8A 3DZLA 3GZBA 1E3VA 3K7CA 3T8UA 3MG1A 2F98A 5AIGA 4XM4A 3F40A 5IG4A 3EQQB 3BB9A 3MHEA 3GRDA 1DMMA 4HM2B 3G0KA 4R1KA 1Z1SA 4XB5A 1OGZA 2F86B 5IENA 1OF5A 1HKXA 4OUQA 2XRXB 3GZYB 1TUHA 5CXOA 2UX0A 1O7HB 3SEDA 3G8ZA 2W2CA 3DUKA 5IEOA 4LMIA 5D82A 8CHOA 4RZMA 3FF2A 3KKGA 3MKIA 3EN1B 2JQ5A 2XSOB 3ER7A 1OGXA 3HX8A 4K1UA 4OVMA 3VGNA 2GXFA 2YFJB 2YFLB 3HK4A 1ISKA 3E99A 1NDOB 4WYKA 5AEUB 3F14A 1BUQA 1O7MB 1OUNA 1Q40B 5KP1A 1C7HA 1O7PB 2GBWB 3MSOA 1DMNA 1JB2A 1JB4A 1OHOA 2I9WA 3CU3A 1OCVA 2BMQB 3K0ZA 3JUMA 4L8PA 3H3HA 3JUQA 1O7NB 3NBRA 4IIAA 2BMOB 1Q40A 2RFRA 2XSHB 2QIYA 3FKAA 3OXAA 2HMKB 4ORLA 4XDWA 5AIHA 5CF1A 3FGYA 4STDA 3EC9A 3FZWA 3OWUA 4HM8B 3H51A 3RGAA 4L7KA 2GEXA 4FCJA 3OX9A 5G2GA 5IF6A 3EX9A 4HM7B 1S5AA 4R9KA 3OWSA 1NWWA 3EBYA 1U5OA 1K41A 2HMMB 3F8XA 5BVBA 5KP4A 1E3RA 4CDLA 1W6YA 1W02A 3A76A 3NHXA 1GY6A 3DXOA 3B7CA 1UUVB 5AI1A 4XDVA 5DRVA 3T8NA 4XBXA 5IG3A 1ZO2A 3G16A 3GZRA 1EA2A 4HM3B 4N3VA 2BNGA 2GBXB 2YFIB 5JPUA 4HM1B 4HZ9B 7STDA 1GY5A 4X2HA 1OHSA 1UUWB 1IDPA 3B4OA 3B8LA 4WWUC 5IEPA 5IG5A 4XBTA 4XBYA 1ZX2A 1JKGA 2CHCA 4HM5B 3GZXB 2IMJA 1OHPA 3F7XA 5KP3A 1EG9B 3CNXA 3NV0A 5AEWB 3DM8A 5D83A 2F99A 3F8HA 3NV0B 2PZVA 4HZBB 4HJLB 5IG0A 4HM6B 3UNLA 3WMDA 5BXQA 4HKVB 5TGNA 4R9LA 5EVHA 4J9AA 3OV4A 3NM2A 3VSYA 1GYBA 3FLJA 5HGRA 1DMQA 1JN5A 1QMAA 3FF0A 3I0YA 4H3UA 4J8TA 1E97A 1GS3A 5FW5A 1NU3A 2XR8B 3JUNA 3BLZA 3B4PA 3CNMA 3OWYA 3Q90A 4X2OA 5AIFA 2CKFB 4HVNA 2Z76A 3M8CA 4I4KA 4Q53A 4PEJA 4U13A 3LYGA 5D81A 5STDA 3UJMA 5IERA 2RGQA 3EJVA 1OPYA 4KVHA 3RGRA 1VZZA 3FSDA 3FH1A 1ULIB 3JUPA 2QGUA 3ECFA 1O7WB 3MG3A 1JKGB 1STDA 4HM4B 4K1VA 6STDA 3DMCA 4L8OA 3MYTA 2GEYA 3KE7A 5JPPA 3EHCA 2B24B 1W01A 3S5CA
chains in the Genus database with same CATH superfamily
2W56B 2V1LA 3DGYA 1Q814 1FZUA 3GWRA 4GL6A 2HMJB 1WQLB 2KF4A 3A5EA 1QVG2 1ZGXA 2ML6A 1BNJA 3ROBA 4FCMA 5STDA 1JB5A 3KZTA 3CCR3 2F5MA 1RGGA 3AGNA 5G1KA 1DE3A 1L5GB 3CCS3 2AADA 2CFLA 1N9JA 3SYUA 1WMPA 1BRNL 3CMA3 3LH4A 2OWPA 2STDA 3X3ZA 1AR0A 2K3DA 1SJWA 1TP6A 1FYSA 6GSPA 4KFFA 4HYZA 3GZBA 1ROAA 3K7CA 3NBJA 2OOVC 2F98A 1RMSA 1KWIA 2O3OA 3MG1A 2QA43 3F40A 5IG4A 1Q824 4HM2B 2OTJ3 2L4VA 1YI23 1UCIA 2FNQA 4ZM8A 3X3XA 1HKXA 2XRXB 1A90A 3S28A 1V58A 2UX0A 3CCE3 1B2ZA 2BIRA 2XFSA 3RDEA 3G8ZA 3HI7A 4N6OB 1DVDA 1LQMB 1V57A 3DUKA 3K9MC 4OVMA 2YFLB 1Q864 4R4KA 1RRHA 3U1WA 8RNTA 1IQYA 1BUQA 1UCJA 3CPW2 4EC6A 1C7HA 1O7PB 3MSOA 3URPA 1SIHA 1JB2A 1JB4A 2I9WA 4JRFA 4N6V0 3KSED 3CXC2 2P05A 3JUMA 4MEIA 1VQM3 4CJNA 2D1WA 4FMBA 1AV4A 2KF3A 4RNTA 1TU5A 3SVAA 2P0MA 5AIHA 1FA3A 4HOHA 1FGRA 3FZWA 3OWUA 2W9PA 1JNQA 3H51A 1VQ63 2P0XA 1AQZA 1TFKA 4QWTA 5IF6A 2CWUA 1WNHA 2ZDJA 4WFOA 1IYYA 3OWSA 5BVBA 4EV5A 1X1UA 1KQS2 3DXOA 4J5KA 2OTL3 5DRVA 1BRHA 4IT7A 1K28A 1OACA 1ZO2A 3LMLA 1EA2A 4N3VA 1A67A 1B20A 1DETA 2KF6A 1YGEA 2W9QA 2C10A 1IVVA 1GY5A 4X2HA 1FUSA 1TJDA 3JVCA 4BTWA 1GSPA 3B8LA 1AVLA 1ZX2A 2KAAA 2CHCA 1VQ53 3FG1A 1MWUA 3GZXB 2IMJA 4EYCA 3F7XA 3LTBA 5LC7A 3DM8A 1CH0A 1RCLA 2CWVA 3AHWA 3FG4A 3PXMA 4FMAA 5D83A 5IG0A 4HM6B 3UNLA 5BXQA 1RNTA 9RNTA 1QVF2 1US1A 1VQL3 4LSOA 4R9LA 3S27A 1UGHI 1KC84 4J9AA 1GYBA 2W56A 1R4YA 5IW9A 1DMQA 3I0YA 3OWYA 2XR8B 5AIFA 3HIIA 4HAAA 4Q53A 3S29A 3CD63 1Q9EA 3AMOA 3L0RA 3EJVA 1D6ZA 1PY3A 3RGRA 2YX9A 4EBGA 5JBSA 3G713 3FH1A 4RNYA 1YJ93 3JUPA 3WHOA 1O7WB 3MG3A 1VQ93 3DMCA 1B3SA 1IVXA 1MOLA 1QAKA 2WOFA 3MYTA 5JPPA 4BTXA 1YJW3 2B24B 3KIIA 1LQGC 1OF5B 1VQ83 1ASKA 2HMLB 4O3VA 2FGTA 1CEWI 3STDA 1YIT3 1BIRA 5CF2A 2ZHXB 4LEHA 1JZDA 4CCVA 1GD4A 3DGMA 3V99A 3NXJA 1ULJB 4MJDA 4CPKA 2CWTA 1LOXA 2Z77A 3LOYA 3IMAB 2CK3H 2CX0A 3MG2A 2OCTA 3N8BA 2CIUA 2F4YA 3HZPA 3U97A 1CQSA 1QJGA 3F9SA 3JUOA 4ILFA 1RGHA 1PYLA 1TIJA 3EN8A 4FR9A 4LGQA 1ZS7A 4WYKB 1HYFA 2B1XB 3FG3A 3PYJA 3ZG5A 2KCDA 2RCDA 5ELUA 1NB5I 3EBTA 2R4IA 2KRTA 5AIIA 1JBSA 1I3FA 1W7CA 2XF3A 4KFEA 4NREA 1SIIA 4I5QA 3EE1A 3DZLA 2WGOA 3BNCA 3BB9A 2E2UA 2PNCA 1DMMA 1JJ22 1RGKA 1BSAA 4XB5A 1FUTA 3BIRA 1B21A 2BO9B 1I2FA 5IENA 2Z6BA 1N8R4 4OUQA 5EQLA 2ZA4A 1BUJA 1TUHA 2C4BA 1O7HB 3SEDA 2W2CA 3X40A 1QALA 4LMIA 3PZWA 5HOHA 8CHOA 1BNFA 1I70A 1N5HA 4RZMA 4EXRA 2W6JH 2XSOB 3ER7A 1OGXA 3HX8A 3VGNA 1ISKA 5AYSC 1W6CA 1NDOB 5AEUB 1LVNA 3F14A 3ZG0A 1BSCA 1Q40B 1JBTA 1UI8A 4LZIA 3DH2A 1DMNA 6STDA 3K0ZA 1W2B2 1D6UA 3CU3A 2BMQB 3LTDA 2M7OA 3PS8A 4L8PA 3H3HA 4N6LA 1UW1A 1C54A 1BRIA 1G0TA 3NBRA 1IV7A 3QRDA 1Q40A 2QIYA 2W04A 1Q7Y4 1RNBA 4BL3A 4STDA 3EC9A 4HM8B 1FW7A 3RNTA 3RGAA 1NNVA 4FCJA 4K61A 5G2GA 2KF5A 2XH9A 1DYUA 1JZOA 1S5AA 2CFWA 4R9KA 1NWWA 3EBYA 2H0HA 3OW22 3F8XA 3N9HA 1E3RA 4CDLA 3WOEB 1B27A 1UCKA 1W02A 2W03A 2QEX3 5AI1A 1NO3A 3B7CA 4AKZA 2Y73A 3CCV3 3Q3FA 1N9EA 3T0UA 1BNRA 2YFIB 3UB1A 1MGWA 2F56A 3X42A 4HM1B 5JPUA 2LYXA 4HZ9B 4K90B 3LTAA 1FGQA 3B4OA 1TTOA 1MWRA 3NX0A 3SXXA 3UL6A 3WA2X 5IG5A 4XBYA 3CCQ3 1RN7A 4HM5B 4O2HA 1RGLA 5M1AA 6RNTA 1OHPA 3FCSB 1EG9B 2CFGA 3DGLA 4O8SA 1J2BA 1GOVA 1RCKA 3NV0B 4O02B 1UUGB 1BNEA 4JF8A 1IQ8A 1Y4KA 5TGNA 3PCSA 1GMRA 3OV4A 1G02A 4EV2A 1BNSA 4J8TA 3FF0A 2IUKA 1CYVA 1E97A 5FW5A 3DY5A 1NU3A 3BLZA 3B4PA 3CNMA 3WMDA 2CKFB 3M8CA 4I4KA 2GU3A 1A2VA 3BNEA 3LYGA 5IERA 3CCM3 1GD3A 3LTCA 3ZFZA 1N5PA 2OQEA 4HM4B 3I553 4FMDA 1B2UA 3X3YA 1X1XA 2GEYA 3D5GA 1OGZA 3E99A 4TX4A 3S5CA 4GB5A 4LYLB 7RNTA 1YNVX 1I0XA 1GY7A 4RNZA 1TRQA 3CPOA 2HMNB 5I97A 1LNHA 1K734 4IPBA 3SOAA 1WMOA 1BNGA 2BHMA 3WR2A 2GU1A 1I2EA 5CK6A 2HMOB 5G1LA 2Z7AA 5CLKA 1OH0A 4DKIA 2BMRB 5DREA 2XGNA 1STFI 3D9RA 1RJOA 1FGMA 3LZAA 3TDGA 3KSPA 1VQK3 4MMZB 3BNBA 4BTYA 3WA3A 4EW5A 3J7Yd 2OQEC 2CX1A 3Q1CA 1M1K4 1B2SA 3EF8A 3PGBA 1M1XB 3CC73 1BRGA 2P38A 5AIGA 3K63A 4XM4A 4KT3B 1MNLA 1JBRA 3MHEA 1RDSA 2CG0A 1Z1SA 2WOHA 4OK0A 1UGIA 2F86B 2ZL8A 3KCHA 5CXOA 2UUGC 3DGNA 3SX1A 2XFTA 5IEOA 2R41A 1RKYA 2Y74A 1RGEA 2IYJA 3FF2A 1IU7A 3EN1B 3GAXA 3G4S3 2GXFA 2YFJB 3HK4A 1RSNA 1W2ZA 1VQQA 1GMPA 2WO0A 1OUNA 5KP1A 1BRSA 3D5IA 1RGAA 3VF1A 3KFQC 1OHOA 4RBNA 4R80A 1O7NB 4KZ1A 2BMOB 2RFRA 1IVUA 1YJN3 1LXEA 2HMKB 4ORLA 1BU4A 1LRAA 1FGTA 4FMCA 2C11A 1YIJ3 1BSDA 3MPHA 2H0IA 2CFDA 2BT3A 3OX9A 1VQO3 2J8XB 1ROVA 2BU4A 3LT9A 2MC8A 1R4CA 2UGIA 1AY7A 3NM7A 1U5OA 2HMMB 1FGOA 2CH9A 4BL2A 3A76A 1BGSA 3ALAA 3V92A 3CCU3 1IK3A 5A0OB 1T2HA 4XBXA 5IG3A 1IT8A 3X41A 4HM3B 1LOWA 2BNGA 1MWSA 4GHOA 1W4NA 3HOHA 3Q2PA 7STDA 1VQ43 1JV2B 4WWUC 1UUWB 1RN4A 2IUJA 1RLSA 5IEPA 4XBTA 1JKGA 1RGFA 3O8YA 1B2MA 5LC6A 2W0QA 3CNXA 3NV0A 2K0MA 4N6TA 1G96A 1LOVA 1M904 1CYUA 2PZVA 1EQKA 4HJLB 3WDGB 2AAEA 4HKVB 1KSIA 2CFKA 3G6E3 1D6YA 1EUIC 3WODG 3S67A 3VSYA 4AEQA 1SQWA 2IA7A 4N6NB 5HGRA 1JN5A 1TFOA 2F5WA 1EKMA 1IQXA 2IY2A 3JUNA 5M19A 3D4AA 1AVKA 1N8QA 2Z76A 2SARA 2RNTA 4U13A 3UJMA 4BIRA 3CCJ3 3BNDA 1BAOA 1BVIA 3AHSA 2RGQA 5ELJA 1FUWA 3CME3 1WMNA 4KVHA 1VZZA 1BOXA 2P09A 1ULIB 2QGUA 3NQZA 1LOYA 5FGOA 1JKGB 1STDA 3GSPA 1S723 1EEJA 1W01A 1T5YA 1GMQA 3UL5A 4HM0B 1SARA 4AKYA 2HOHA 4GSPA 4N6MA 1W00A 2GSPA 3K5TA 1A2KA 1HZ1A 3CC43 1DVCA 1JN5B 1O7GB 1UI7A 4WP5A 2K54A 3AGOA 2CG1A 2INXA 3IPTA 3D3LA 2KXGA 3DGOA 1Q42A 4J5GA 3CC23 3D79A 3LXUX 1U8CB 2A15A 3F7SA 1YGWA 3LT8A 1V74A 2H0GA 3HIGA 3NUVA 5GSPA 3SOYA 1E3VA 3T8UA 5RNTA 4WHAA 3EQQB 1RN1A 2O9UX 1T2IA 2XEPA 3GRDA 3G0KA 4R1KA 1KD14 1OF5A 1WTHA 1YVSA 3GZYB 2XGLA 2SBLA 3NQYA 1X1WA 1T3BA 1BRJA 5D82A 4KFDA 4NPBA 2CW9A 1BRKA 1MGRA 3KKGA 3MKIA 1VQN3 2JQ5A 4K1UA 1BNIA 1RHLA 3AMOB 4WYKA 2E2VA 2MF7A 2LQVA 4FCZA 1O7MB 3QK9A 1K8A4 5M18A 2GBWB 5AYRB 1OCVA 1QAFA 2JDIH 3JUQA 2OOVA 1UDII 1BANA 1X1YA 4IIAA 3FKAA 2XSHB 4XDWA 5CF1A 3CCL3 3OXAA 1BSEA 1RRLA 3FGYA 4N6UA 1B2XA 1I0VA 4L7KA 2GEXA 4H61A 1VQ73 1IT7A 1YHQ3 7GSPA 1K9M4 3EX9A 3IJEB 4HM7B 4G1MB 4MMXB 1NJI4 1RGCA 1W5ZA 1RTUA 1K41A 3MWZA 5KP4A 1HU9A 1W6YA 3NHXA 2CC3A 1GY6A 3EB8A 1UUVB 2RSXA 4XDVA 3T8NA 2E2TA 3G16A 3GZRA 3I563 2FXTA 2GBXB 1IV9A 1YVBI 1OHSA 1IDPA 1F8NA 5BIRA 3WOFB 1JRQA 1TRPA 3BU4A 1MWTA 3PCRA 5KP3A 5AEWB 1PU4A 2F99A 3F8HA 4HZBB 1BSBA 1SPUA 1M9GA 3KN4A 1I3IA 2Q07A 1A2PA 4BU4A 1Q7HA 5EVHA 4MMYB 1GOUA 3NM2A 3FLJA 3SLUA 1GOYA 1QMAA 4H3UA 2L1SA 1LNIA 1GS3A 1IVWA 4HBRA 1VQP3 1UCLA 3Q90A 4X2OA 4HVNA 1PFPA 3V98A 5D81A 4PEJA 1I2GA 4NHFA 2RBIA 1OPYA 2ML5A 5EEOA 1NB3I 3FSDA 2D42A 3N54B 3ECFA 4K1VA 4L8OA 2WGQA 1I8VA 5BU4A 1W6GA 3KE7A 3EHCA 3NBBA
chains in the Genus database with same CATH topology
2W56B 2V1LA 1Q814 3GWRA 4GL6A 2HMJB 1WQLB 1QVG2 2ML6A 3ROBA 4FCMA 5STDA 1JB5A 3KZTA 3CCR3 1L5GB 3CCS3 2CFLA 1N9JA 1WMPA 3CMA3 3LH4A 2OWPA 2STDA 3X3ZA 1AR0A 1SJWA 1TP6A 4KFFA 4HYZA 3GZBA 1ROAA 3K7CA 3NBJA 2OOVC 2F98A 2O3OA 1KWIA 3MG1A 2QA43 1Q824 3F40A 5IG4A 4HM2B 2OTJ3 2L4VA 1YI23 2FNQA 4ZM8A 3X3XA 1HKXA 2XRXB 1A90A 3S28A 2UX0A 3CCE3 3RDEA 2XFSA 3G8ZA 3HI7A 1DVDA 3DUKA 3K9MC 4OVMA 2YFLB 1Q864 4R4KA 1RRHA 3U1WA 1IQYA 1BUQA 3CPW2 4EC6A 1C7HA 1O7PB 3MSOA 1SIHA 1JB2A 1JB4A 2I9WA 4JRFA 4N6V0 3KSED 3CXC2 2P05A 3JUMA 4MEIA 1VQM3 2D1WA 4FMBA 1AV4A 1TU5A 3SVAA 2P0MA 5AIHA 1FA3A 1FGRA 3FZWA 3OWUA 2W9PA 1JNQA 3H51A 1VQ63 2P0XA 1TFKA 4QWTA 5IF6A 2CWUA 1WNHA 2ZDJA 4WFOA 3OWSA 5BVBA 4EV5A 1KQS2 3DXOA 2OTL3 5DRVA 4IT7A 1K28A 1OACA 1ZO2A 3LMLA 1EA2A 4N3VA 1A67A 1YGEA 2W9QA 2C10A 1IVVA 1GY5A 4X2HA 4BTWA 3JVCA 3B8LA 1AVLA 1ZX2A 1VQ53 2CHCA 3FG1A 3GZXB 4EYCA 2IMJA 3F7XA 3LTBA 5LC7A 3DM8A 5D83A 2CWVA 3PXMA 3UNLA 3FG4A 4FMAA 5IG0A 5BXQA 1QVF2 4HM6B 1US1A 1VQL3 4LSOA 4R9LA 3S27A 1KC84 4J9AA 1GYBA 2W56A 5IW9A 1DMQA 3I0YA 3OWYA 2XR8B 5AIFA 3HIIA 4Q53A 3S29A 3CD63 3AMOA 3L0RA 3EJVA 1D6ZA 4EBGA 3RGRA 2YX9A 5JBSA 3G713 3FH1A 4RNYA 1YJ93 3JUPA 1O7WB 3MG3A 1VQ93 3DMCA 1MOLA 1IVXA 1QAKA 2WOFA 3MYTA 5JPPA 1YJW3 4BTXA 2B24B 3KIIA 1OF5B 1VQ83 1ASKA 2HMLB 4O3VA 2FGTA 1CEWI 3STDA 1YIT3 5CF2A 4LEHA 4CCVA 1GD4A 3DGMA 3V99A 3NXJA 1ULJB 4MJDA 2CWTA 1LOXA 2Z77A 3LOYA 3IMAB 2CK3H 3MG2A 3N8BA 2OCTA 4N6OB 2CIUA 3U97A 3HZPA 1CQSA 1QJGA 3F9SA 3JUOA 1TIJA 3EN8A 4FR9A 4LGQA 4WYKB 2B1XB 3FG3A 3PYJA 2KCDA 2RCDA 5ELUA 1NB5I 3EBTA 2R4IA 2KRTA 5AIIA 2XF3A 1W7CA 4NREA 4KFEA 1SIIA 3EE1A 3DZLA 2WGOA 3BNCA 3BB9A 2E2UA 2PNCA 1DMMA 1JJ22 4XB5A 2BO9B 5IENA 1N8R4 2Z6BA 4OUQA 5EQLA 1TUHA 1O7HB 3SEDA 2W2CA 3X40A 1QALA 4LMIA 3PZWA 8CHOA 4RZMA 1N5HA 4EXRA 2W6JH 2XSOB 3ER7A 1OGXA 3HX8A 3VGNA 1ISKA 5AYSC 1W6CA 1NDOB 5AEUB 1LVNA 3F14A 1Q40B 1UI8A 4LZIA 1DMNA 6STDA 3K0ZA 1W2B2 1D6UA 3CU3A 2BMQB 3LTDA 2M7OA 3PS8A 4L8PA 3H3HA 4N6LA 1UW1A 3NBRA 1IV7A 3QRDA 1Q40A 2QIYA 2W04A 1Q7Y4 4STDA 3EC9A 4HM8B 3RGAA 4FCJA 4K61A 5G2GA 2XH9A 1DYUA 1S5AA 2CFWA 4R9KA 1NWWA 3EBYA 3OW22 3F8XA 3N9HA 1E3RA 4CDLA 3WOEB 1W02A 2W03A 2QEX3 5AI1A 1NO3A 3B7CA 4AKZA 2Y73A 3CCV3 1N9EA 3T0UA 2YFIB 3UB1A 3X42A 4HM1B 5JPUA 2LYXA 4HZ9B 4K90B 3LTAA 1FGQA 3B4OA 3NX0A 3SXXA 3UL6A 3WA2X 5IG5A 4XBYA 3CCQ3 1RN7A 4HM5B 4O2HA 1OHPA 3FCSB 1EG9B 2CFGA 3DGLA 4O8SA 1J2BA 3NV0B 4O02B 4JF8A 1IQ8A 1Y4KA 5TGNA 3PCSA 3OV4A 4EV2A 4J8TA 3FF0A 2IUKA 1CYVA 1E97A 5FW5A 3DY5A 1NU3A 3BLZA 3B4PA 3CNMA 3WMDA 2CKFB 3M8CA 4I4KA 2GU3A 1A2VA 3BNEA 3LYGA 5IERA 3CCM3 1GD3A 3LTCA 1N5PA 2OQEA 4HM4B 3I553 4FMDA 3X3YA 2GEYA 3E99A 1OGZA 4TX4A 3S5CA 4GB5A 4RNZA 1GY7A 3CPOA 2HMNB 5I97A 1LNHA 1K734 4IPBA 3SOAA 1WMOA 2BHMA 2GU1A 5CK6A 2HMOB 2Z7AA 5CLKA 1OH0A 2BMRB 5DREA 2XGNA 1STFI 3D9RA 1RJOA 1FGMA 3LZAA 3TDGA 3KSPA 1VQK3 4MMZB 3BNBA 4BTYA 3WA3A 3J7Yd 2OQEC 3Q1CA 1M1K4 3EF8A 3PGBA 1M1XB 3CC73 2P38A 5AIGA 3K63A 4XM4A 1MNLA 3MHEA 2CG0A 1Z1SA 2WOHA 4OK0A 2F86B 2ZL8A 5CXOA 3DGNA 3SX1A 2XFTA 5IEOA 1RKYA 2Y74A 3GAXA 3FF2A 1IU7A 3EN1B 3G4S3 2GXFA 2YFJB 3HK4A 1W2ZA 2WO0A 1OUNA 5KP1A 3VF1A 3KFQC 1OHOA 4RBNA 4R80A 1O7NB 4KZ1A 2BMOB 2RFRA 1IVUA 1YJN3 1LXEA 2HMKB 4ORLA 1FGTA 4FMCA 2C11A 1YIJ3 3MPHA 2CFDA 2BT3A 3OX9A 1VQO3 1ROVA 3LT9A 2MC8A 1R4CA 3NM7A 1U5OA 2HMMB 1FGOA 2CH9A 3A76A 3ALAA 3V92A 3CCU3 1IK3A 5A0OB 4XBXA 5IG3A 1IT8A 3X41A 4HM3B 2BNGA 1W4NA 3Q2PA 7STDA 1VQ43 1JV2B 4WWUC 1UUWB 5IEPA 2IUJA 4XBTA 1JKGA 3O8YA 5LC6A 2W0QA 3CNXA 3NV0A 2K0MA 4N6TA 1G96A 1M904 1EQKA 1CYUA 2PZVA 4HJLB 3WDGB 4HKVB 1KSIA 2CFKA 3G6E3 1D6YA 3WODG 4AEQA 3S67A 3VSYA 1SQWA 2IA7A 4N6NB 5HGRA 1JN5A 1TFOA 1EKMA 1IQXA 3JUNA 1AVKA 1N8QA 2Z76A 4U13A 3CCJ3 3UJMA 3BNDA 2RGQA 5ELJA 1FUWA 3CME3 1WMNA 4KVHA 1VZZA 2P09A 1ULIB 2QGUA 3NQZA 5FGOA 1JKGB 1STDA 1S723 1W01A 1T5YA 3UL5A 4HM0B 4AKYA 4N6MA 1W00A 3K5TA 1A2KA 3CC43 1DVCA 1JN5B 1O7GB 1UI7A 4WP5A 2K54A 2CG1A 2INXA 3IPTA 3D3LA 2KXGA 3DGOA 1Q42A 3CC23 3LXUX 1U8CB 2A15A 3F7SA 3LT8A 3NUVA 1V74A 3HIGA 3SOYA 1E3VA 3T8UA 4WHAA 3EQQB 2O9UX 3GRDA 2XEPA 3G0KA 4R1KA 1KD14 1OF5A 1WTHA 3GZYB 2XGLA 2SBLA 3NQYA 5D82A 4KFDA 2CW9A 1VQN3 3KKGA 3MKIA 2JQ5A 4K1UA 3AMOB 4WYKA 2E2VA 2MF7A 2LQVA 4FCZA 1O7MB 3QK9A 1K8A4 2GBWB 5AYRB 1OCVA 1QAFA 2JDIH 3JUQA 2OOVA 4IIAA 3FKAA 2XSHB 4XDWA 5CF1A 3CCL3 3OXAA 1RRLA 3FGYA 4N6UA 4L7KA 2GEXA 4H61A 1VQ73 1IT7A 1YHQ3 1K9M4 3EX9A 3IJEB 4HM7B 4G1MB 4MMXB 1NJI4 1W5ZA 1K41A 3MWZA 5KP4A 1HU9A 1W6YA 3NHXA 2CC3A 1GY6A 3EB8A 1UUVB 2RSXA 4XDVA 3T8NA 2E2TA 3G16A 3GZRA 3I563 2FXTA 2GBXB 1IV9A 1YVBI 1OHSA 1IDPA 1F8NA 3WOFB 1JRQA 3PCRA 5KP3A 5AEWB 1PU4A 2F99A 3F8HA 4HZBB 1SPUA 1M9GA 3KN4A 2Q07A 5EVHA 4MMYB 3NM2A 3FLJA 3SLUA 1QMAA 4H3UA 1GS3A 1IVWA 4HBRA 1VQP3 3Q90A 4X2OA 4HVNA 1PFPA 3V98A 5D81A 4PEJA 4NHFA 1OPYA 2ML5A 5EEOA 1NB3I 3FSDA 2D42A 3N54B 3ECFA 4K1VA 4L8OA 2WGQA 1W6GA 3KE7A 3EHCA 3NBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GB5 A;  1OF5 B;  1ASK A;  1GY7 A;  2HML B;  4HM0 B;  3GWR A;  3CPO A;  2HMJ B;  1WQL B;  3STD A;  1W00 A;  2HMN B;  5CF2 A;  4LEH A;  1A2K A;  3SOA A;  3NXJ A;  3ROB A;  1JN5 B;  1ULJ B;  1O7G B;  4FCM A;  4MJD A;  3MG2 A;  4WP5 A;  1JB5 A;  2HMO B;  2K54 A;  2Z77 A;  3KZT A;  5CK6 A;  2Z7A A;  5CLK A;  3HZP A;  1CQS A;  1QJG A;  2INX A;  1OH0 A;  3F9S A;  3IPT A;  3EN8 A;  3JUO A;  4LGQ A;  2BMR B;  4WYK B;  3D9R A;  5DRE A;  2B1X B;  2OWP A;  2STD A;  2RCD A;  3KSP A;  1AR0 A;  3LZA A;  1SJW A;  3EBT A;  2R4I A;  1TP6 A;  5AII A;  1Q42 A;  3NUV A;  2A15 A;  3F7S A;  3SOY A;  3EF8 A;  3DZL A;  3GZB A;  1E3V A;  3K7C A;  3T8U A;  3MG1 A;  2F98 A;  5AIG A;  4XM4 A;  3F40 A;  5IG4 A;  3EQQ B;  3BB9 A;  3MHE A;  3GRD A;  1DMM A;  4HM2 B;  3G0K A;  4R1K A;  1Z1S A;  4XB5 A;  1OGZ A;  2F86 B;  5IEN A;  1OF5 A;  1HKX A;  4OUQ A;  2XRX B;  3GZY B;  1TUH A;  5CXO A;  2UX0 A;  1O7H B;  3SED A;  3G8Z A;  2W2C A;  3DUK A;  5IEO A;  4LMI A;  5D82 A;  8CHO A;  4RZM A;  3FF2 A;  3KKG A;  3MKI A;  3EN1 B;  2JQ5 A;  2XSO B;  3ER7 A;  1OGX A;  3HX8 A;  4K1U A;  4OVM A;  3VGN A;  2GXF A;  2YFJ B;  2YFL B;  3HK4 A;  1ISK A;  3E99 A;  1NDO B;  4WYK A;  5AEU B;  3F14 A;  1BUQ A;  1O7M B;  1OUN A;  1Q40 B;  5KP1 A;  1C7H A;  1O7P B;  2GBW B;  3MSO A;  1DMN A;  1JB2 A;  1JB4 A;  1OHO A;  2I9W A;  3CU3 A;  1OCV A;  2BMQ B;  3K0Z A;  3JUM A;  4L8P A;  3H3H A;  3JUQ A;  1O7N B;  3NBR A;  4IIA A;  2BMO B;  1Q40 A;  2RFR A;  2XSH B;  2QIY A;  3FKA A;  3OXA A;  2HMK B;  4ORL A;  4XDW A;  5AIH A;  5CF1 A;  3FGY A;  4STD A;  3EC9 A;  3FZW A;  3OWU A;  4HM8 B;  3H51 A;  3RGA A;  4L7K A;  2GEX A;  4FCJ A;  3OX9 A;  5G2G A;  5IF6 A;  3EX9 A;  4HM7 B;  1S5A A;  4R9K A;  3OWS A;  1NWW A;  3EBY A;  1U5O A;  1K41 A;  2HMM B;  3F8X A;  5BVB A;  5KP4 A;  1E3R A;  4CDL A;  1W6Y A;  1W02 A;  3A76 A;  3NHX A;  1GY6 A;  3DXO A;  3B7C A;  1UUV B;  5AI1 A;  4XDV A;  5DRV A;  3T8N A;  4XBX A;  5IG3 A;  1ZO2 A;  3G16 A;  3GZR A;  1EA2 A;  4HM3 B;  4N3V A;  2BNG A;  2GBX B;  2YFI B;  5JPU A;  4HM1 B;  4HZ9 B;  7STD A;  1GY5 A;  4X2H A;  1OHS A;  1UUW B;  1IDP A;  3B4O A;  3B8L A;  4WWU C;  5IEP A;  5IG5 A;  4XBT A;  4XBY A;  1ZX2 A;  1JKG A;  2CHC A;  4HM5 B;  3GZX B;  2IMJ A;  1OHP A;  3F7X A;  5KP3 A;  1EG9 B;  3CNX A;  3NV0 A;  5AEW B;  3DM8 A;  5D83 A;  2F99 A;  3F8H A;  3NV0 B;  2PZV A;  4HZB B;  4HJL B;  5IG0 A;  4HM6 B;  3UNL A;  3WMD A;  5BXQ A;  4HKV B;  5TGN A;  4R9L A;  5EVH A;  4J9A A;  3OV4 A;  3NM2 A;  3VSY A;  1GYB A;  3FLJ A;  5HGR A;  1DMQ A;  1JN5 A;  1QMA A;  3FF0 A;  3I0Y A;  4H3U A;  4J8T A;  1E97 A;  1GS3 A;  5FW5 A;  1NU3 A;  2XR8 B;  3JUN A;  3BLZ A;  3B4P A;  3CNM A;  3OWY A;  3Q90 A;  4X2O A;  5AIF A;  2CKF B;  4HVN A;  2Z76 A;  3M8C A;  4I4K A;  4Q53 A;  4PEJ A;  4U13 A;  3LYG A;  5D81 A;  5STD A;  3UJM A;  5IER A;  2RGQ A;  3EJV A;  1OPY A;  4KVH A;  3RGR A;  1VZZ A;  3FSD A;  3FH1 A;  1ULI B;  3JUP A;  2QGU A;  3ECF A;  1O7W B;  3MG3 A;  1JKG B;  1STD A;  4HM4 B;  4K1V A;  6STD A;  3DMC A;  4L8O A;  3MYT A;  2GEY A;  3KE7 A;  5JPP A;  3EHC A;  2B24 B;  1W01 A;  3S5C A; 
#chains in the Genus database with same CATH topology
 2W56 B;  2V1L A;  3DGY A;  1Q81 4;  1FZU A;  3GWR A;  4GL6 A;  2HMJ B;  1WQL B;  2KF4 A;  3A5E A;  1QVG 2;  1ZGX A;  2ML6 A;  1BNJ A;  3ROB A;  4FCM A;  5STD A;  1JB5 A;  3KZT A;  3CCR 3;  2F5M A;  1RGG A;  3AGN A;  5G1K A;  1DE3 A;  1L5G B;  3CCS 3;  2AAD A;  2CFL A;  1N9J A;  3SYU A;  1WMP A;  1BRN L;  3CMA 3;  3LH4 A;  2OWP A;  2STD A;  3X3Z A;  1AR0 A;  2K3D A;  1SJW A;  1TP6 A;  1FYS A;  6GSP A;  4KFF A;  4HYZ A;  3GZB A;  1ROA A;  3K7C A;  3NBJ A;  2OOV C;  2F98 A;  1RMS A;  1KWI A;  2O3O A;  3MG1 A;  2QA4 3;  3F40 A;  5IG4 A;  1Q82 4;  4HM2 B;  2OTJ 3;  2L4V A;  1YI2 3;  1UCI A;  2FNQ A;  4ZM8 A;  3X3X A;  1HKX A;  2XRX B;  1A90 A;  3S28 A;  1V58 A;  2UX0 A;  3CCE 3;  1B2Z A;  2BIR A;  2XFS A;  3RDE A;  3G8Z A;  3HI7 A;  4N6O B;  1DVD A;  1LQM B;  1V57 A;  3DUK A;  3K9M C;  4OVM A;  2YFL B;  1Q86 4;  4R4K A;  1RRH A;  3U1W A;  8RNT A;  1IQY A;  1BUQ A;  1UCJ A;  3CPW 2;  4EC6 A;  1C7H A;  1O7P B;  3MSO A;  3URP A;  1SIH A;  1JB2 A;  1JB4 A;  2I9W A;  4JRF A;  4N6V 0;  3KSE D;  3CXC 2;  2P05 A;  3JUM A;  4MEI A;  1VQM 3;  4CJN A;  2D1W A;  4FMB A;  1AV4 A;  2KF3 A;  4RNT A;  1TU5 A;  3SVA A;  2P0M A;  5AIH A;  1FA3 A;  4HOH A;  1FGR A;  3FZW A;  3OWU A;  2W9P A;  1JNQ A;  3H51 A;  1VQ6 3;  2P0X A;  1AQZ A;  1TFK A;  4QWT A;  5IF6 A;  2CWU A;  1WNH A;  2ZDJ A;  4WFO A;  1IYY A;  3OWS A;  5BVB A;  4EV5 A;  1X1U A;  1KQS 2;  3DXO A;  4J5K A;  2OTL 3;  5DRV A;  1BRH A;  4IT7 A;  1K28 A;  1OAC A;  1ZO2 A;  3LML A;  1EA2 A;  4N3V A;  1A67 A;  1B20 A;  1DET A;  2KF6 A;  1YGE A;  2W9Q A;  2C10 A;  1IVV A;  1GY5 A;  4X2H A;  1FUS A;  1TJD A;  3JVC A;  4BTW A;  1GSP A;  3B8L A;  1AVL A;  1ZX2 A;  2KAA A;  2CHC A;  1VQ5 3;  3FG1 A;  1MWU A;  3GZX B;  2IMJ A;  4EYC A;  3F7X A;  3LTB A;  5LC7 A;  3DM8 A;  1CH0 A;  1RCL A;  2CWV A;  3AHW A;  3FG4 A;  3PXM A;  4FMA A;  5D83 A;  5IG0 A;  4HM6 B;  3UNL A;  5BXQ A;  1RNT A;  9RNT A;  1QVF 2;  1US1 A;  1VQL 3;  4LSO A;  4R9L A;  3S27 A;  1UGH I;  1KC8 4;  4J9A A;  1GYB A;  2W56 A;  1R4Y A;  5IW9 A;  1DMQ A;  3I0Y A;  3OWY A;  2XR8 B;  5AIF A;  3HII A;  4HAA A;  4Q53 A;  3S29 A;  3CD6 3;  1Q9E A;  3AMO A;  3L0R A;  3EJV A;  1D6Z A;  1PY3 A;  3RGR A;  2YX9 A;  4EBG A;  5JBS A;  3G71 3;  3FH1 A;  4RNY A;  1YJ9 3;  3JUP A;  3WHO A;  1O7W B;  3MG3 A;  1VQ9 3;  3DMC A;  1B3S A;  1IVX A;  1MOL A;  1QAK A;  2WOF A;  3MYT A;  5JPP A;  4BTX A;  1YJW 3;  2B24 B;  3KII A;  1LQG C;  1OF5 B;  1VQ8 3;  1ASK A;  2HML B;  4O3V A;  2FGT A;  1CEW I;  3STD A;  1YIT 3;  1BIR A;  5CF2 A;  2ZHX B;  4LEH A;  1JZD A;  4CCV A;  1GD4 A;  3DGM A;  3V99 A;  3NXJ A;  1ULJ B;  4MJD A;  4CPK A;  2CWT A;  1LOX A;  2Z77 A;  3LOY A;  3IMA B;  2CK3 H;  2CX0 A;  3MG2 A;  2OCT A;  3N8B A;  2CIU A;  2F4Y A;  3HZP A;  3U97 A;  1CQS A;  1QJG A;  3F9S A;  3JUO A;  4ILF A;  1RGH A;  1PYL A;  1TIJ A;  3EN8 A;  4FR9 A;  4LGQ A;  1ZS7 A;  4WYK B;  1HYF A;  2B1X B;  3FG3 A;  3PYJ A;  3ZG5 A;  2KCD A;  2RCD A;  5ELU A;  1NB5 I;  3EBT A;  2R4I A;  2KRT A;  5AII A;  1JBS A;  1I3F A;  1W7C A;  2XF3 A;  4KFE A;  4NRE A;  1SII A;  4I5Q A;  3EE1 A;  3DZL A;  2WGO A;  3BNC A;  3BB9 A;  2E2U A;  2PNC A;  1DMM A;  1JJ2 2;  1RGK A;  1BSA A;  4XB5 A;  1FUT A;  3BIR A;  1B21 A;  2BO9 B;  1I2F A;  5IEN A;  2Z6B A;  1N8R 4;  4OUQ A;  5EQL A;  2ZA4 A;  1BUJ A;  1TUH A;  2C4B A;  1O7H B;  3SED A;  2W2C A;  3X40 A;  1QAL A;  4LMI A;  3PZW A;  5HOH A;  8CHO A;  1BNF A;  1I70 A;  1N5H A;  4RZM A;  4EXR A;  2W6J H;  2XSO B;  3ER7 A;  1OGX A;  3HX8 A;  3VGN A;  1ISK A;  5AYS C;  1W6C A;  1NDO B;  5AEU B;  1LVN A;  3F14 A;  3ZG0 A;  1BSC A;  1Q40 B;  1JBT A;  1UI8 A;  4LZI A;  3DH2 A;  1DMN A;  6STD A;  3K0Z A;  1W2B 2;  1D6U A;  3CU3 A;  2BMQ B;  3LTD A;  2M7O A;  3PS8 A;  4L8P A;  3H3H A;  4N6L A;  1UW1 A;  1C54 A;  1BRI A;  1G0T A;  3NBR A;  1IV7 A;  3QRD A;  1Q40 A;  2QIY A;  2W04 A;  1Q7Y 4;  1RNB A;  4BL3 A;  4STD A;  3EC9 A;  4HM8 B;  1FW7 A;  3RNT A;  3RGA A;  1NNV A;  4FCJ A;  4K61 A;  5G2G A;  2KF5 A;  2XH9 A;  1DYU A;  1JZO A;  1S5A A;  2CFW A;  4R9K A;  1NWW A;  3EBY A;  2H0H A;  3OW2 2;  3F8X A;  3N9H A;  1E3R A;  4CDL A;  3WOE B;  1B27 A;  1UCK A;  1W02 A;  2W03 A;  2QEX 3;  5AI1 A;  1NO3 A;  3B7C A;  4AKZ A;  2Y73 A;  3CCV 3;  3Q3F A;  1N9E A;  3T0U A;  1BNR A;  2YFI B;  3UB1 A;  1MGW A;  2F56 A;  3X42 A;  4HM1 B;  5JPU A;  2LYX A;  4HZ9 B;  4K90 B;  3LTA A;  1FGQ A;  3B4O A;  1TTO A;  1MWR A;  3NX0 A;  3SXX A;  3UL6 A;  3WA2 X;  5IG5 A;  4XBY A;  3CCQ 3;  1RN7 A;  4HM5 B;  4O2H A;  1RGL A;  5M1A A;  6RNT A;  1OHP A;  3FCS B;  1EG9 B;  2CFG A;  3DGL A;  4O8S A;  1J2B A;  1GOV A;  1RCK A;  3NV0 B;  4O02 B;  1UUG B;  1BNE A;  4JF8 A;  1IQ8 A;  1Y4K A;  5TGN A;  3PCS A;  1GMR A;  3OV4 A;  1G02 A;  4EV2 A;  1BNS A;  4J8T A;  3FF0 A;  2IUK A;  1CYV A;  1E97 A;  5FW5 A;  3DY5 A;  1NU3 A;  3BLZ A;  3B4P A;  3CNM A;  3WMD A;  2CKF B;  3M8C A;  4I4K A;  2GU3 A;  1A2V A;  3BNE A;  3LYG A;  5IER A;  3CCM 3;  1GD3 A;  3LTC A;  3ZFZ A;  1N5P A;  2OQE A;  4HM4 B;  3I55 3;  4FMD A;  1B2U A;  3X3Y A;  1X1X A;  2GEY A;  3D5G A;  1OGZ A;  3E99 A;  4TX4 A;  3S5C A;  4GB5 A;  4LYL B;  7RNT A;  1YNV X;  1I0X A;  1GY7 A;  4RNZ A;  1TRQ A;  3CPO A;  2HMN B;  5I97 A;  1LNH A;  1K73 4;  4IPB A;  3SOA A;  1WMO A;  1BNG A;  2BHM A;  3WR2 A;  2GU1 A;  1I2E A;  5CK6 A;  2HMO B;  5G1L A;  2Z7A A;  5CLK A;  1OH0 A;  4DKI A;  2BMR B;  5DRE A;  2XGN A;  1STF I;  3D9R A;  1RJO A;  1FGM A;  3LZA A;  3TDG A;  3KSP A;  1VQK 3;  4MMZ B;  3BNB A;  4BTY A;  3WA3 A;  4EW5 A;  3J7Y d;  2OQE C;  2CX1 A;  3Q1C A;  1M1K 4;  1B2S A;  3EF8 A;  3PGB A;  1M1X B;  3CC7 3;  1BRG A;  2P38 A;  5AIG A;  3K63 A;  4XM4 A;  4KT3 B;  1MNL A;  1JBR A;  3MHE A;  1RDS A;  2CG0 A;  1Z1S A;  2WOH A;  4OK0 A;  1UGI A;  2F86 B;  2ZL8 A;  3KCH A;  5CXO A;  2UUG C;  3DGN A;  3SX1 A;  2XFT A;  5IEO A;  2R41 A;  1RKY A;  2Y74 A;  1RGE A;  2IYJ A;  3FF2 A;  1IU7 A;  3EN1 B;  3GAX A;  3G4S 3;  2GXF A;  2YFJ B;  3HK4 A;  1RSN A;  1W2Z A;  1VQQ A;  1GMP A;  2WO0 A;  1OUN A;  5KP1 A;  1BRS A;  3D5I A;  1RGA A;  3VF1 A;  3KFQ C;  1OHO A;  4RBN A;  4R80 A;  1O7N B;  4KZ1 A;  2BMO B;  2RFR A;  1IVU A;  1YJN 3;  1LXE A;  2HMK B;  4ORL A;  1BU4 A;  1LRA A;  1FGT A;  4FMC A;  2C11 A;  1YIJ 3;  1BSD A;  3MPH A;  2H0I A;  2CFD A;  2BT3 A;  3OX9 A;  1VQO 3;  2J8X B;  1ROV A;  2BU4 A;  3LT9 A;  2MC8 A;  1R4C A;  2UGI A;  1AY7 A;  3NM7 A;  1U5O A;  2HMM B;  1FGO A;  2CH9 A;  4BL2 A;  3A76 A;  1BGS A;  3ALA A;  3V92 A;  3CCU 3;  1IK3 A;  5A0O B;  1T2H A;  4XBX A;  5IG3 A;  1IT8 A;  3X41 A;  4HM3 B;  1LOW A;  2BNG A;  1MWS A;  4GHO A;  1W4N A;  3HOH A;  3Q2P A;  7STD A;  1VQ4 3;  1JV2 B;  4WWU C;  1UUW B;  1RN4 A;  2IUJ A;  1RLS A;  5IEP A;  4XBT A;  1JKG A;  1RGF A;  3O8Y A;  1B2M A;  5LC6 A;  2W0Q A;  3CNX A;  3NV0 A;  2K0M A;  4N6T A;  1G96 A;  1LOV A;  1M90 4;  1CYU A;  2PZV A;  1EQK A;  4HJL B;  3WDG B;  2AAE A;  4HKV B;  1KSI A;  2CFK A;  3G6E 3;  1D6Y A;  1EUI C;  3WOD G;  3S67 A;  3VSY A;  4AEQ A;  1SQW A;  2IA7 A;  4N6N B;  5HGR A;  1JN5 A;  1TFO A;  2F5W A;  1EKM A;  1IQX A;  2IY2 A;  3JUN A;  5M19 A;  3D4A A;  1AVK A;  1N8Q A;  2Z76 A;  2SAR A;  2RNT A;  4U13 A;  3UJM A;  4BIR A;  3CCJ 3;  3BND A;  1BAO A;  1BVI A;  3AHS A;  2RGQ A;  5ELJ A;  1FUW A;  3CME 3;  1WMN A;  4KVH A;  1VZZ A;  1BOX A;  2P09 A;  1ULI B;  2QGU A;  3NQZ A;  1LOY A;  5FGO A;  1JKG B;  1STD A;  3GSP A;  1S72 3;  1EEJ A;  1W01 A;  1T5Y A;  1GMQ A;  3UL5 A;  4HM0 B;  1SAR A;  4AKY A;  2HOH A;  4GSP A;  4N6M A;  1W00 A;  2GSP A;  3K5T A;  1A2K A;  1HZ1 A;  3CC4 3;  1DVC A;  1JN5 B;  1O7G B;  1UI7 A;  4WP5 A;  2K54 A;  3AGO A;  2CG1 A;  2INX A;  3IPT A;  3D3L A;  2KXG A;  3DGO A;  1Q42 A;  4J5G A;  3CC2 3;  3D79 A;  3LXU X;  1U8C B;  2A15 A;  3F7S A;  1YGW A;  3LT8 A;  1V74 A;  2H0G A;  3HIG A;  3NUV A;  5GSP A;  3SOY A;  1E3V A;  3T8U A;  5RNT A;  4WHA A;  3EQQ B;  1RN1 A;  2O9U X;  1T2I A;  2XEP A;  3GRD A;  3G0K A;  4R1K A;  1KD1 4;  1OF5 A;  1WTH A;  1YVS A;  3GZY B;  2XGL A;  2SBL A;  3NQY A;  1X1W A;  1T3B A;  1BRJ A;  5D82 A;  4KFD A;  4NPB A;  2CW9 A;  1BRK A;  1MGR A;  3KKG A;  3MKI A;  1VQN 3;  2JQ5 A;  4K1U A;  1BNI A;  1RHL A;  3AMO B;  4WYK A;  2E2V A;  2MF7 A;  2LQV A;  4FCZ A;  1O7M B;  3QK9 A;  1K8A 4;  5M18 A;  2GBW B;  5AYR B;  1OCV A;  1QAF A;  2JDI H;  3JUQ A;  2OOV A;  1UDI I;  1BAN A;  1X1Y A;  4IIA A;  3FKA A;  2XSH B;  4XDW A;  5CF1 A;  3CCL 3;  3OXA A;  1BSE A;  1RRL A;  3FGY A;  4N6U A;  1B2X A;  1I0V A;  4L7K A;  2GEX A;  4H61 A;  1VQ7 3;  1IT7 A;  1YHQ 3;  7GSP A;  1K9M 4;  3EX9 A;  3IJE B;  4HM7 B;  4G1M B;  4MMX B;  1NJI 4;  1RGC A;  1W5Z A;  1RTU A;  1K41 A;  3MWZ A;  5KP4 A;  1HU9 A;  1W6Y A;  3NHX A;  2CC3 A;  1GY6 A;  3EB8 A;  1UUV B;  2RSX A;  4XDV A;  3T8N A;  2E2T A;  3G16 A;  3GZR A;  3I56 3;  2FXT A;  2GBX B;  1IV9 A;  1YVB I;  1OHS A;  1IDP A;  1F8N A;  5BIR A;  3WOF B;  1JRQ A;  1TRP A;  3BU4 A;  1MWT A;  3PCR A;  5KP3 A;  5AEW B;  1PU4 A;  2F99 A;  3F8H A;  4HZB B;  1BSB A;  1SPU A;  1M9G A;  3KN4 A;  1I3I A;  2Q07 A;  1A2P A;  4BU4 A;  1Q7H A;  5EVH A;  4MMY B;  1GOU A;  3NM2 A;  3FLJ A;  3SLU A;  1GOY A;  1QMA A;  4H3U A;  2L1S A;  1LNI A;  1GS3 A;  1IVW A;  4HBR A;  1VQP 3;  1UCL A;  3Q90 A;  4X2O A;  4HVN A;  1PFP A;  3V98 A;  5D81 A;  4PEJ A;  1I2G A;  4NHF A;  2RBI A;  1OPY A;  2ML5 A;  5EEO A;  1NB3 I;  3FSD A;  2D42 A;  3N54 B;  3ECF A;  4K1V A;  4L8O A;  2WGQ A;  1I8V A;  5BU4 A;  1W6G A;  3KE7 A;  3EHC A;  3NBB A; 
#chains in the Genus database with same CATH homology
 2W56 B;  2V1L A;  1Q81 4;  3GWR A;  4GL6 A;  2HMJ B;  1WQL B;  1QVG 2;  2ML6 A;  3ROB A;  4FCM A;  5STD A;  1JB5 A;  3KZT A;  3CCR 3;  1L5G B;  3CCS 3;  2CFL A;  1N9J A;  1WMP A;  3CMA 3;  3LH4 A;  2OWP A;  2STD A;  3X3Z A;  1AR0 A;  1SJW A;  1TP6 A;  4KFF A;  4HYZ A;  3GZB A;  1ROA A;  3K7C A;  3NBJ A;  2OOV C;  2F98 A;  2O3O A;  1KWI A;  3MG1 A;  2QA4 3;  1Q82 4;  3F40 A;  5IG4 A;  4HM2 B;  2OTJ 3;  2L4V A;  1YI2 3;  2FNQ A;  4ZM8 A;  3X3X A;  1HKX A;  2XRX B;  1A90 A;  3S28 A;  2UX0 A;  3CCE 3;  3RDE A;  2XFS A;  3G8Z A;  3HI7 A;  1DVD A;  3DUK A;  3K9M C;  4OVM A;  2YFL B;  1Q86 4;  4R4K A;  1RRH A;  3U1W A;  1IQY A;  1BUQ A;  3CPW 2;  4EC6 A;  1C7H A;  1O7P B;  3MSO A;  1SIH A;  1JB2 A;  1JB4 A;  2I9W A;  4JRF A;  4N6V 0;  3KSE D;  3CXC 2;  2P05 A;  3JUM A;  4MEI A;  1VQM 3;  2D1W A;  4FMB A;  1AV4 A;  1TU5 A;  3SVA A;  2P0M A;  5AIH A;  1FA3 A;  1FGR A;  3FZW A;  3OWU A;  2W9P A;  1JNQ A;  3H51 A;  1VQ6 3;  2P0X A;  1TFK A;  4QWT A;  5IF6 A;  2CWU A;  1WNH A;  2ZDJ A;  4WFO A;  3OWS A;  5BVB A;  4EV5 A;  1KQS 2;  3DXO A;  2OTL 3;  5DRV A;  4IT7 A;  1K28 A;  1OAC A;  1ZO2 A;  3LML A;  1EA2 A;  4N3V A;  1A67 A;  1YGE A;  2W9Q A;  2C10 A;  1IVV A;  1GY5 A;  4X2H A;  4BTW A;  3JVC A;  3B8L A;  1AVL A;  1ZX2 A;  1VQ5 3;  2CHC A;  3FG1 A;  3GZX B;  4EYC A;  2IMJ A;  3F7X A;  3LTB A;  5LC7 A;  3DM8 A;  5D83 A;  2CWV A;  3PXM A;  3UNL A;  3FG4 A;  4FMA A;  5IG0 A;  5BXQ A;  1QVF 2;  4HM6 B;  1US1 A;  1VQL 3;  4LSO A;  4R9L A;  3S27 A;  1KC8 4;  4J9A A;  1GYB A;  2W56 A;  5IW9 A;  1DMQ A;  3I0Y A;  3OWY A;  2XR8 B;  5AIF A;  3HII A;  4Q53 A;  3S29 A;  3CD6 3;  3AMO A;  3L0R A;  3EJV A;  1D6Z A;  4EBG A;  3RGR A;  2YX9 A;  5JBS A;  3G71 3;  3FH1 A;  4RNY A;  1YJ9 3;  3JUP A;  1O7W B;  3MG3 A;  1VQ9 3;  3DMC A;  1MOL A;  1IVX A;  1QAK A;  2WOF A;  3MYT A;  5JPP A;  1YJW 3;  4BTX A;  2B24 B;  3KII A;  1OF5 B;  1VQ8 3;  1ASK A;  2HML B;  4O3V A;  2FGT A;  1CEW I;  3STD A;  1YIT 3;  5CF2 A;  4LEH A;  4CCV A;  1GD4 A;  3DGM A;  3V99 A;  3NXJ A;  1ULJ B;  4MJD A;  2CWT A;  1LOX A;  2Z77 A;  3LOY A;  3IMA B;  2CK3 H;  3MG2 A;  3N8B A;  2OCT A;  4N6O B;  2CIU A;  3U97 A;  3HZP A;  1CQS A;  1QJG A;  3F9S A;  3JUO A;  1TIJ A;  3EN8 A;  4FR9 A;  4LGQ A;  4WYK B;  2B1X B;  3FG3 A;  3PYJ A;  2KCD A;  2RCD A;  5ELU A;  1NB5 I;  3EBT A;  2R4I A;  2KRT A;  5AII A;  2XF3 A;  1W7C A;  4NRE A;  4KFE A;  1SII A;  3EE1 A;  3DZL A;  2WGO A;  3BNC A;  3BB9 A;  2E2U A;  2PNC A;  1DMM A;  1JJ2 2;  4XB5 A;  2BO9 B;  5IEN A;  1N8R 4;  2Z6B A;  4OUQ A;  5EQL A;  1TUH A;  1O7H B;  3SED A;  2W2C A;  3X40 A;  1QAL A;  4LMI A;  3PZW A;  8CHO A;  4RZM A;  1N5H A;  4EXR A;  2W6J H;  2XSO B;  3ER7 A;  1OGX A;  3HX8 A;  3VGN A;  1ISK A;  5AYS C;  1W6C A;  1NDO B;  5AEU B;  1LVN A;  3F14 A;  1Q40 B;  1UI8 A;  4LZI A;  1DMN A;  6STD A;  3K0Z A;  1W2B 2;  1D6U A;  3CU3 A;  2BMQ B;  3LTD A;  2M7O A;  3PS8 A;  4L8P A;  3H3H A;  4N6L A;  1UW1 A;  3NBR A;  1IV7 A;  3QRD A;  1Q40 A;  2QIY A;  2W04 A;  1Q7Y 4;  4STD A;  3EC9 A;  4HM8 B;  3RGA A;  4FCJ A;  4K61 A;  5G2G A;  2XH9 A;  1DYU A;  1S5A A;  2CFW A;  4R9K A;  1NWW A;  3EBY A;  3OW2 2;  3F8X A;  3N9H A;  1E3R A;  4CDL A;  3WOE B;  1W02 A;  2W03 A;  2QEX 3;  5AI1 A;  1NO3 A;  3B7C A;  4AKZ A;  2Y73 A;  3CCV 3;  1N9E A;  3T0U A;  2YFI B;  3UB1 A;  3X42 A;  4HM1 B;  5JPU A;  2LYX A;  4HZ9 B;  4K90 B;  3LTA A;  1FGQ A;  3B4O A;  3NX0 A;  3SXX A;  3UL6 A;  3WA2 X;  5IG5 A;  4XBY A;  3CCQ 3;  1RN7 A;  4HM5 B;  4O2H A;  1OHP A;  3FCS B;  1EG9 B;  2CFG A;  3DGL A;  4O8S A;  1J2B A;  3NV0 B;  4O02 B;  4JF8 A;  1IQ8 A;  1Y4K A;  5TGN A;  3PCS A;  3OV4 A;  4EV2 A;  4J8T A;  3FF0 A;  2IUK A;  1CYV A;  1E97 A;  5FW5 A;  3DY5 A;  1NU3 A;  3BLZ A;  3B4P A;  3CNM A;  3WMD A;  2CKF B;  3M8C A;  4I4K A;  2GU3 A;  1A2V A;  3BNE A;  3LYG A;  5IER A;  3CCM 3;  1GD3 A;  3LTC A;  1N5P A;  2OQE A;  4HM4 B;  3I55 3;  4FMD A;  3X3Y A;  2GEY A;  3E99 A;  1OGZ A;  4TX4 A;  3S5C A;  4GB5 A;  4RNZ A;  1GY7 A;  3CPO A;  2HMN B;  5I97 A;  1LNH A;  1K73 4;  4IPB A;  3SOA A;  1WMO A;  2BHM A;  2GU1 A;  5CK6 A;  2HMO B;  2Z7A A;  5CLK A;  1OH0 A;  2BMR B;  5DRE A;  2XGN A;  1STF I;  3D9R A;  1RJO A;  1FGM A;  3LZA A;  3TDG A;  3KSP A;  1VQK 3;  4MMZ B;  3BNB A;  4BTY A;  3WA3 A;  3J7Y d;  2OQE C;  3Q1C A;  1M1K 4;  3EF8 A;  3PGB A;  1M1X B;  3CC7 3;  2P38 A;  5AIG A;  3K63 A;  4XM4 A;  1MNL A;  3MHE A;  2CG0 A;  1Z1S A;  2WOH A;  4OK0 A;  2F86 B;  2ZL8 A;  5CXO A;  3DGN A;  3SX1 A;  2XFT A;  5IEO A;  1RKY A;  2Y74 A;  3GAX A;  3FF2 A;  1IU7 A;  3EN1 B;  3G4S 3;  2GXF A;  2YFJ B;  3HK4 A;  1W2Z A;  2WO0 A;  1OUN A;  5KP1 A;  3VF1 A;  3KFQ C;  1OHO A;  4RBN A;  4R80 A;  1O7N B;  4KZ1 A;  2BMO B;  2RFR A;  1IVU A;  1YJN 3;  1LXE A;  2HMK B;  4ORL A;  1FGT A;  4FMC A;  2C11 A;  1YIJ 3;  3MPH A;  2CFD A;  2BT3 A;  3OX9 A;  1VQO 3;  1ROV A;  3LT9 A;  2MC8 A;  1R4C A;  3NM7 A;  1U5O A;  2HMM B;  1FGO A;  2CH9 A;  3A76 A;  3ALA A;  3V92 A;  3CCU 3;  1IK3 A;  5A0O B;  4XBX A;  5IG3 A;  1IT8 A;  3X41 A;  4HM3 B;  2BNG A;  1W4N A;  3Q2P A;  7STD A;  1VQ4 3;  1JV2 B;  4WWU C;  1UUW B;  5IEP A;  2IUJ A;  4XBT A;  1JKG A;  3O8Y A;  5LC6 A;  2W0Q A;  3CNX A;  3NV0 A;  2K0M A;  4N6T A;  1G96 A;  1M90 4;  1EQK A;  1CYU A;  2PZV A;  4HJL B;  3WDG B;  4HKV B;  1KSI A;  2CFK A;  3G6E 3;  1D6Y A;  3WOD G;  4AEQ A;  3S67 A;  3VSY A;  1SQW A;  2IA7 A;  4N6N B;  5HGR A;  1JN5 A;  1TFO A;  1EKM A;  1IQX A;  3JUN A;  1AVK A;  1N8Q A;  2Z76 A;  4U13 A;  3CCJ 3;  3UJM A;  3BND A;  2RGQ A;  5ELJ A;  1FUW A;  3CME 3;  1WMN A;  4KVH A;  1VZZ A;  2P09 A;  1ULI B;  2QGU A;  3NQZ A;  5FGO A;  1JKG B;  1STD A;  1S72 3;  1W01 A;  1T5Y A;  3UL5 A;  4HM0 B;  4AKY A;  4N6M A;  1W00 A;  3K5T A;  1A2K A;  3CC4 3;  1DVC A;  1JN5 B;  1O7G B;  1UI7 A;  4WP5 A;  2K54 A;  2CG1 A;  2INX A;  3IPT A;  3D3L A;  2KXG A;  3DGO A;  1Q42 A;  3CC2 3;  3LXU X;  1U8C B;  2A15 A;  3F7S A;  3LT8 A;  3NUV A;  1V74 A;  3HIG A;  3SOY A;  1E3V A;  3T8U A;  4WHA A;  3EQQ B;  2O9U X;  3GRD A;  2XEP A;  3G0K A;  4R1K A;  1KD1 4;  1OF5 A;  1WTH A;  3GZY B;  2XGL A;  2SBL A;  3NQY A;  5D82 A;  4KFD A;  2CW9 A;  1VQN 3;  3KKG A;  3MKI A;  2JQ5 A;  4K1U A;  3AMO B;  4WYK A;  2E2V A;  2MF7 A;  2LQV A;  4FCZ A;  1O7M B;  3QK9 A;  1K8A 4;  2GBW B;  5AYR B;  1OCV A;  1QAF A;  2JDI H;  3JUQ A;  2OOV A;  4IIA A;  3FKA A;  2XSH B;  4XDW A;  5CF1 A;  3CCL 3;  3OXA A;  1RRL A;  3FGY A;  4N6U A;  4L7K A;  2GEX A;  4H61 A;  1VQ7 3;  1IT7 A;  1YHQ 3;  1K9M 4;  3EX9 A;  3IJE B;  4HM7 B;  4G1M B;  4MMX B;  1NJI 4;  1W5Z A;  1K41 A;  3MWZ A;  5KP4 A;  1HU9 A;  1W6Y A;  3NHX A;  2CC3 A;  1GY6 A;  3EB8 A;  1UUV B;  2RSX A;  4XDV A;  3T8N A;  2E2T A;  3G16 A;  3GZR A;  3I56 3;  2FXT A;  2GBX B;  1IV9 A;  1YVB I;  1OHS A;  1IDP A;  1F8N A;  3WOF B;  1JRQ A;  3PCR A;  5KP3 A;  5AEW B;  1PU4 A;  2F99 A;  3F8H A;  4HZB B;  1SPU A;  1M9G A;  3KN4 A;  2Q07 A;  5EVH A;  4MMY B;  3NM2 A;  3FLJ A;  3SLU A;  1QMA A;  4H3U A;  1GS3 A;  1IVW A;  4HBR A;  1VQP 3;  3Q90 A;  4X2O A;  4HVN A;  1PFP A;  3V98 A;  5D81 A;  4PEJ A;  4NHF A;  1OPY A;  2ML5 A;  5EEO A;  1NB3 I;  3FSD A;  2D42 A;  3N54 B;  3ECF A;  4K1V A;  4L8O A;  2WGQ A;  1W6G A;  3KE7 A;  3EHC A;  3NBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...