1HKXA

Crystal structure of calcium/calmodulin-dependent protein kinase
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
MTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPVHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHRSGAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE II ALPHA CH
publication title Crystal Structure of a Tetradecameric Assembly of the Association Domain of Ca2+/Calmodulin-Dependent Kinase II
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 37
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N
ec nomenclature ec 2.7.11.17: Calcium/calmodulin-dependent protein kinase.
pdb deposition date 2003-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08332 CaMKII_AD Calcium/calmodulin dependent protein kinase II association domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1hkxA00
4XBXA 3DUKA 2CKFB 3CU3A 1UUWB 3EHCA 3OV4A 3OWUA 4KVHA 3G0KA 2GBXB 3F9SA 2GEYA 3KSPA 1SJWA 3NV0A 2QGUA 1OCVA 1TP6A 2B24B 3KKGA 2A15A 5IG4A 3MG1A 3HZPA 1JKGA 3EBTA 3FF0A 1GY6A 1JN5A 4K1VA 4L7KA 2F99A 5D81A 1JB5A 1OH0A 3FSDA 4WWUC 5IEOA 4XDWA 2F98A 3EX9A 2I9WA 1E97A 5DREA 2XR8B 4XM4A 7STDA 5IERA 1S5AA 1DMMA 2BNGA 5IF6A 3OXAA 3B4OA 4ORLA 1OPYA 2QIYA 5DRVA 3G16A 5D83A 5IG0A 4IIAA 2YFIB 3HK4A 4HM8B 3Q90A 3DZLA 2CHCA 1O7MB 4HM0B 2UX0A 4HKVB 3ER7A 1NWWA 2HMOB 3FGYA 4H3UA 5FW5A 4R9LA 3LZAA 3H51A 4OVMA 4J8TA 3JUNA 3SOAA 5AIGA 3JUQA 3DMCA 1K41A 4MJDA 5G2GA 1NDOB 1VZZA 1ZO2A 2BMRB 1A2KA 3SEDA 3SOYA 3B8LA 1CQSA 4WP5A 1WQLB 3OWSA 3BB9A 5KP1A 3F40A 3B7CA 5CF2A 3GZYB 1IDPA 4L8OA 2GBWB 3KZTA 3FKAA 2YFLB 1O7NB 1E3RA 1Q40B 4RZMA 2PZVA 2K54A 3HX8A 5KP3A 1U5OA 1GYBA 3FZWA 4CDLA 2HMNB 5EVHA 3ROBA 2HMJB 2YFJB 5KP4A 1OF5A 3EQQB 3F7XA 3T8NA 4PEJA 2F86B 4U13A 3F8XA 4HM2B 3FH1A 3GZRA 3ECFA 5D82A 3UJMA 3K7CA 4XB5A 1OHOA 2JQ5A 8CHOA 1OHPA 1GS3A 1ULJB 2HMMB 3OWYA 1Z1SA 4OUQA 1TUHA 1C7HA 3F8HA 1UUVB 2XRXB 5AEWB 1OF5B 4I4KA 5CK6A 5HGRA 2Z7AA 3UNLA 3RGRA 3NUVA 5CLKA 5IEPA 4HM7B 3EN8A 1BUQA 1O7PB 4XBYA 1DMNA 1Q42A 1Q40A 2RFRA 3MKIA 1JB2A 5AEUB 3GZBA 3GWRA 4K1UA 3MSOA 1OGZA 4L8PA 3DM8A 3LYGA 1AR0A 3D9RA 3DXOA 4HM6B 1DMQA 3EF8A 4J9AA 1O7HB 1ASKA 3NHXA 2W2CA 3S5CA 1W02A 4HM4B 2Z76A 4GB5A 4HM5B 3EJVA 3CNXA 3FLJA 3KE7A 3A76A 4R9KA 3CPOA 2Z77A 3B4PA 3NM2A 1E3VA 4X2OA 2HMKB 5CXOA 1OGXA 2XSOB 5AIHA 1GY5A 5CF1A 4HM1B 3EC9A 1HKXA 1OUNA 3STDA 6STDA 1O7GB 4LMIA 2HMLB 1ULIB 3NXJA 3CNMA 4HJLB 4LGQA 3MYTA 3I0YA 5BXQA 2B1XB 5IENA 3RGAA 5AIFA 2OWPA 2XSHB 3MHEA 3VSYA 3H3HA 4XDVA 2BMQB 4WYKA 5AIIA 2RCDA 3IPTA 1JB4A 3NV0B 1OHSA 4FCMA 1EG9B 1STDA 4XBTA 1GY7A 5TGNA 5JPPA 3BLZA 2GEXA 1ZX2A 3K0ZA 3JUOA 3T8UA 5IG3A 1NU3A 3F14A 5IG5A 4N3VA 1W00A 3E99A 1W01A 5AI1A 5STDA 2R4IA 1JKGB 2BMOB 1JN5B 5JPUA 4HZBB 2INXA 3JUMA 4Q53A 1QMAA 3EN1B 2IMJA 2RGQA 3VGNA 4HZ9B 4LEHA 3OX9A 3GRDA 3EBYA 3G8ZA 3FF2A 3GZXB 1QJGA 4HM3B 1O7WB 4WYKB 5BVBA 4HVNA 2GXFA 4R1KA 4STDA 1W6YA 2STDA 3MG2A 3F7SA 4X2HA 3JUPA 1ISKA 3M8CA 3WMDA 1EA2A 3MG3A 3NBRA 4FCJA
chains in the Genus database with same CATH superfamily
1YGWA 4XBXA 1I8VA 4FR9A 3DUKA 1ZGXA 4BTWA 2CKFB 1I2FA 3WHOA 3CPW2 3ZFZA 3N9HA 1RGFA 2CFDA 1VQP3 1UDII 1GD4A 3CU3A 1UUWB 2CH9A 3EHCA 3V99A 2PNCA 1DYUA 2W0QA 3D5GA 1ROVA 3OV4A 3OWUA 4ILFA 4MMXB 1Y4KA 4KVHA 3LTDA 1BANA 4FMDA 3WA3A 1YVBI 1EEJA 1YIJ3 1N5PA 1WMPA 3G0KA 4HBRA 3Q3FA 1BAOA 2GBXB 3CCR3 1UI7A 3F9SA 1JZOA 2GEYA 1X1XA 3KSPA 1N5HA 1SJWA 2GU3A 3NV0A 4J5KA 4OK0A 2QGUA 1OCVA 3D3LA 4BTXA 1TP6A 2B24B 2IUKA 3TDGA 4FMCA 1M904 1JBSA 3WDGB 2H0HA 3KKGA 5BU4A 1UCLA 8RNTA 1K28A 1YHQ3 1BNIA 1VQQA 1GOYA 3HIGA 4R80A 1VQN3 2CG1A 1QAKA 2A15A 1I3IA 1B2SA 3MG1A 3WODG 5IG4A 1EQKA 1VQO3 1KC84 4MMZB 5GSPA 1RN4A 1EKMA 1UCIA 9RNTA 3HZPA 3RNTA 1FUSA 1LXEA 1CYVA 1JKGA 2F5WA 2UGIA 3EBTA 3FF0A 1GY6A 1JN5A 3FG4A 3KFQC 4K1VA 2F99A 1RDSA 4L7KA 1K8A4 5D81A 1BNRA 5EEOA 3AGNA 1JB5A 1G0TA 1GOVA 3GAXA 1GD3A 2CFLA 1OH0A 2LYXA 1BUJA 3FSDA 4WWUC 5LC6A 3AMOA 5IEOA 4N6MA 1VQ73 1RRLA 3D4AA 1PU4A 4XDWA 1RN1A 2F98A 1YI23 1IVWA 3EX9A 3A5EA 2I9WA 1E97A 5DREA 2XR8B 3NQYA 4XM4A 7STDA 2CX1A 5G1LA 1Q824 1Q814 1Q7HA 2CFKA 5IERA 5AYSC 3G4S3 1FUTA 1S5AA 1DMMA 5BIRA 1LOYA 2BNGA 1YGEA 4EBGA 5IF6A 5I97A 4LYLB 3OXAA 5EQLA 1GSPA 1LOVA 1IQYA 1LOXA 4BL3A 3B4OA 1M1K4 1W5ZA 4ORLA 1OPYA 2QIYA 5DRVA 2IYJA 1IT8A 3KSED 2BIRA 2D42A 4MMYB 3G16A 2P0MA 5D83A 2WOHA 3CCE3 1QVG2 1W2B2 1MWSA 5IW9A 1R4YA 2CG0A 1RNBA 1BVIA 2CC3A 5IG0A 2K3DA 3X3XA 4DKIA 4IIAA 2SARA 3CMA3 1TFOA 2YFIB 2ZA4A 3HK4A 4HM8B 3Q90A 3S27A 3DZLA 4HOHA 2CHCA 1DE3A 1O7MB 4HM0B 4KFFA 2UX0A 3PS8A 4HKVB 5M18A 3MWZA 3EE1A 3ER7A 3J7Yd 1BSDA 2ZDJA 4EV5A 1TTOA 1LNIA 2OTL3 3QK9A 1NWWA 1SARA 2KAAA 1US1A 2HMOB 3LH4A 3FGYA 4H3UA 1PY3A 1LRAA 5FW5A 1RKYA 2C4BA 1MWRA 4R9LA 4H61A 2Y74A 2XEPA 3H51A 3LZAA 3PGBA 3PXMA 4OVMA 4J8TA 1IV9A 3U1WA 3JUNA 3SOAA 1NJI4 1UGHI 1UI8A 5AIGA 2C11A 3JUQA 1DVDA 2FXTA 3DMCA 1STFI 1V58A 4GL6A 2KCDA 1K41A 3QRDA 3S29A 4MJDA 5G2GA 2YX9A 4RNYA 1NDOB 1SPUA 4FMAA 3ZG5A 3G6E3 3JVCA 1VZZA 1ZO2A 4HAAA 5AYRB 3KIIA 3Q1CA 1KSIA 2BMRB 4RBNA 1UUGB 1A2KA 3X42A 1A67A 1B2MA 3Q2PA 1UCJA 4RNZA 3I563 1MOLA 3SEDA 2RSXA 3SOYA 3G713 3B8LA 2V1LA 4BIRA 1RLSA 3K5TA 1CQSA 2BHMA 4FMBA 1TU5A 2IY2A 4WP5A 1LNHA 1WQLB 1RGGA 5G1KA 3OWSA 1FW7A 1HYFA 3O8YA 3X40A 3BB9A 3BNCA 5KP1A 1B2ZA 1BRIA 3B7CA 3F40A 5CF2A 1GOUA 1I2GA 1RGKA 2L4VA 3GZYB 2O9UX 1N9EA 1TIJA 1IDPA 2RNTA 1BNFA 1PYLA 4L8OA 2MC8A 2GBWB 1B2UA 2P38A 1T5YA 4AKZA 3KZTA 1CYUA 2W03A 2CWUA 2KF6A 3FKAA 2GU1A 3VF1A 2YFLB 3DGNA 3DGOA 1O7NB 1B20A 1IVVA 1E3RA 1G96A 2WGQA 2KF5A 1B21A 1MWUA 5M1AA 1UGIA 3PCRA 4AKYA 1Q40B 2CW9A 4RZMA 2PZVA 3OW22 1FUWA 2K54A 3HX8A 3NX0A 5KP3A 1B27A 3DGYA 6GSPA 2CFWA 3CC43 5RNTA 1U5OA 1RGCA 3GSPA 1GYBA 3FZWA 3WOEB 4CDLA 4CJNA 3LXUX 4NREA 3WOFB 2HMNB 5EVHA 1I2EA 2IUJA 2CWVA 3ROBA 2HMJB 6RNTA 1L5GB 1RMSA 1JZDA 3HOHA 2YFJB 1FGOA 1QALA 3X3YA 5KP4A 2IA7A 1OF5A 2MF7A 3EQQB 1VQL3 4WFOA 4I5QA 1RNTA 3WR2A 1NO3A 2BO9B 3F7XA 1SIIA 3UL6A 3CC23 1Q9EA 1IVXA 1QVF2 2KXGA 1FA3A 2H0IA 2CK3H 1CH0A 1GMPA 1YNVX 1KQS2 3AGOA 4N6OB 1B3SA 1LOWA 1WTHA 5ELJA 3T8NA 2HOHA 1QAFA 2F86B 2KF4A 1B2XA 4PEJA 4U13A 3CCS3 1F8NA 3LOYA 5HOHA 2J8XB 3F8XA 4HM2B 3FH1A 3GZRA 1BRJA 1YJN3 1I0VA 4O02B 3ECFA 5M19A 5D82A 5ELUA 3UJMA 1BNEA 3K7CA 4XB5A 1OHOA 2JQ5A 2XF3A 3NBBA 8CHOA 1VQ83 1OHPA 2CWTA 2BU4A 1VQK3 4NPBA 1BSAA 1GS3A 1W7CA 1TRPA 1ULJB 1U8CB 1WMNA 1BNJA 2OTJ3 1BRGA 1RJOA 2HMMB 1JBTA 2UUGC 4JF8A 3URPA 1HU9A 3OWYA 4HYZA 1Z1SA 1BSBA 4OUQA 5JBSA 1JV2B 5LC7A 1MGRA 2L1SA 1TUHA 3RDEA 3AHSA 1BIRA 1C7HA 3F8HA 1GMQA 1UUVB 2D1WA 3CCJ3 3CC73 1IK3A 1AVKA 1HZ1A 2XRXB 4KFEA 4NHFA 5AEWB 4ZM8A 1OF5B 1MWTA 2XGLA 2ML5A 4I4KA 5CK6A 5HGRA 2Z7AA 3HIIA 3IMAB 1LQGC 1TRQA 3MPHA 3LMLA 3UNLA 3RGRA 3NUVA 1Q864 5CLKA 5IEPA 4HM7B 1M1XB 3FG1A 4O3VA 1BSCA 1GMRA 3EN8A 1BUQA 1O7PB 1JJ22 3LTCA 3D5IA 4XBYA 1DMNA 1Q42A 4G1MB 2QA43 1A2VA 2XH9A 3UB1A 2Z6BA 4N6LA 3LT9A 3BIRA 3SLUA 3UL5A 1JNQA 1Q40A 4CCVA 2RFRA 3MKIA 1W6GA 1VQM3 1JB2A 1T2HA 5AEUB 3GZBA 4IPBA 3GWRA 4K1UA 3MSOA 3SXXA 1OGZA 1TJDA 3CCU3 1RCKA 4L8PA 2XGNA 3DM8A 3LYGA 2C10A 3BU4A 3FG3A 1I70A 3X3ZA 2W56A 4K90B 1I0XA 2CIUA 1AR0A 3D9RA 1N8QA 2CFGA 1X1WA 4J5GA 3PCSA 1N9JA 3I553 1BNGA 2E2UA 4BU4A 1KWIA 1BU4A 1SIHA 3DXOA 2M7OA 1BRHA 3ZG0A 1W2ZA 4HM6B 4EC6A 1DMQA 3BNDA 7RNTA 3EF8A 1BNSA 4J9AA 1O7HB 1BOXA 3CCL3 1ASKA 4RNTA 1YJW3 1I3FA 1ROAA 3NHXA 3LT8A 2W2CA 1V57A 2FGTA 4BTYA 3KCHA 1FGRA 4R4KA 1IV7A 2ZL8A 3DH2A 1YJ93 3S5CA 1W02A 3SYUA 3V98A 4HM4B 1LQMB 1RGAA 2ZHXB 1WMOA 1BSEA 2Z76A 2AADA 4GB5A 3DY5A 1AV4A 4HM5B 3CCM3 3EJVA 3CD63 1NNVA 4CPKA 1M9GA 2E2VA 1TFKA 3CNXA 3FLJA 3KE7A 2W9QA 2RBIA 2W04A 1CEWI 3A76A 4R9KA 3CPOA 3NBJA 1C54A 1J2BA 2Z77A 3B4PA 2F5MA 1RGHA 2JDIH 4N6NB 3NM2A 1E3VA 4X2OA 3LTBA 2O3OA 1RSNA 2HMKB 1UW1A 3FCSB 5CXOA 1W6CA 1IU7A 2W56B 3CME3 1OGXA 1R4CA 2CX0A 2XSOB 5AIHA 5A0OB 1GY5A 1AVLA 2WO0A 5CF1A 3K9MC 4HM1B 3EC9A 1K9M4 2FNQA 1T2IA 4WHAA 1WNHA 1HKXA 1OUNA 3STDA 3T0UA 7GSPA 6STDA 1O7GB 1A2PA 4KT3B 1RCLA 4LMIA 4O2HA 1DVCA 1NB3I 3L0RA 2HMLB 1JRQA 4FCZA 2OOVC 3D79A 2E2TA 1ULIB 4GSPA 4IT7A 2W9PA 3NXJA 3CNMA 4HJLB 4LGQA 3MYTA 3I0YA 2K0MA 1MGWA 5BXQA 4N6TA 4MEIA 2B1XB 5IENA 3RGAA 2WOFA 5AIFA 1IYYA 1RTUA 3SVAA 2F56A 1BGSA 1UCKA 3NQZA 2OWPA 3EB8A 2OOVA 3X41A 1Q7Y4 4KZ1A 2XSHB 2OCTA 3MHEA 3VSYA 1SQWA 3H3HA 1D6YA 4XDVA 2H0GA 1PFPA 2LQVA 1LVNA 2BMQB 4WYKA 2P0XA 2SBLA 5AIIA 2RCDA 3IPTA 2KF3A 1VQ93 4BL2A 1JB4A 1YVSA 1D6ZA 4EYCA 3NV0B 4GHOA 2Y73A 1OHSA 4EXRA 4N6V0 3HI7A 3SX1A 4FCMA 1A90A 1T3BA 1EG9B 3PZWA 1AY7A 1STDA 4XBTA 1GY7A 1X1UA 4K61A 2QEX3 5TGNA 2F4YA 5JPPA 3K63A 3BLZA 4KFDA 2XFTA 1RGEA 2GEXA 2P09A 1ZX2A 1IT7A 1FGTA 3JUOA 3K0ZA 1NU3A 3F14A 3NM7A 3T8UA 5IG3A 5IG5A 1YIT3 1ZS7A 2R41A 2XFSA 1W00A 3E99A 1W01A 3N54B 4N3VA 5AI1A 5STDA 3CCQ3 3S28A 2R4IA 2W6JH 1N8R4 1JKGB 1BRSA 2BMOB 1X1YA 3LTAA 4TX4A 1JN5B 4LZIA 1JBRA 5JPUA 3CXC2 1VQ53 3S67A 4HZBB 2P05A 2AAEA 2INXA 1NB5I 1FGQA 3JUMA 4AEQA 4Q53A 3AMOB 5FGOA 1QMAA 4JRFA 3EN1B 2IMJA 3KN4A 2RGQA 3VGNA 1IQ8A 1V74A 4HZ9B 4LEHA 3OX9A 3GRDA 3EBYA 1VQ63 1FYSA 3N8BA 4O8SA 3G8ZA 3FF2A 3DGLA 3GZXB 1QJGA 3AHWA 4HM3B 1S723 1EUIC 1MNLA 1O7WB 1FGMA 4WYKB 1OACA 1W4NA 2OQEC 1RGLA 2KRTA 5BVBA 4EV2A 2Q07A 3BNEA 4HVNA 4LSOA 2GXFA 1IQXA 2ML6A 4R1KA 1FZUA 4STDA 1RRHA 1W6YA 3WA2X 1RHLA 1KD14 2STDA 1AQZA 3MG2A 3IJEB 2WGOA 3F7SA 1DETA 1D6UA 3V92A 4X2HA 2OQEA 3JUPA 1K734 3PYJA 1ISKA 2BT3A 3U97A 3M8CA 3BNBA 4N6UA 4QWTA 3WMDA 3DGMA 1BRNL 1EA2A 3MG3A 2GSPA 1VQ43 1BRKA 1IVUA 1G02A 3CCV3 3NBRA 4FCJA 4EW5A 3ALAA 1RN7A
chains in the Genus database with same CATH topology
4XBXA 4FR9A 3DUKA 4BTWA 2CKFB 3CPW2 1VQP3 3N9HA 2CFDA 1GD4A 3CU3A 1UUWB 2CH9A 3EHCA 3V99A 2PNCA 1DYUA 2W0QA 3OV4A 1ROVA 3OWUA 4MMXB 4EV5A 2OTJ3 1Y4KA 4KVHA 3LTDA 4FMDA 3WA3A 1YVBI 1YIJ3 1N5PA 1WMPA 3G0KA 4HBRA 2GBXB 3CCR3 1UI7A 3F9SA 2GEYA 1N8R4 3KSPA 1N5HA 1SJWA 2GU3A 3NV0A 4OK0A 2QGUA 1OCVA 3D3LA 4BTXA 1TP6A 2B24B 2IUKA 3TDGA 4FMCA 1M904 3WDGB 3KKGA 1K28A 1YHQ3 1VQN3 3HIGA 4R80A 2CG1A 1QAKA 2A15A 5IG4A 3MG1A 3WODG 1EQKA 1VQO3 1KC84 4MMZB 1EKMA 3HZPA 1LXEA 1CYVA 1JKGA 3EBTA 3FF0A 1GY6A 1JN5A 3FG4A 3KFQC 4K1VA 2F99A 4L7KA 1K8A4 5D81A 5EEOA 1JB5A 3GAXA 1GD3A 2CFLA 1OH0A 2LYXA 3FSDA 4WWUC 5LC6A 3AMOA 5IEOA 4N6MA 1VQ73 1RRLA 1PU4A 4XDWA 2F98A 1YI23 1IVWA 3EX9A 2I9WA 1E97A 5DREA 2XR8B 3NQYA 4XM4A 7STDA 1Q824 1Q814 2CFKA 5IERA 5AYSC 3G4S3 1S5AA 1DMMA 2BNGA 5IF6A 1YGEA 4EBGA 5I97A 3OXAA 5EQLA 1IQYA 1LOXA 3B4OA 1M1K4 1W5ZA 4ORLA 1OPYA 2QIYA 5DRVA 1IT8A 3KSED 4MMYB 2D42A 3G16A 2P0MA 5D83A 2WOHA 3CCE3 1QVG2 1W2B2 5IW9A 2CG0A 2CC3A 5IG0A 3X3XA 4IIAA 3CMA3 1TFOA 2YFIB 3HK4A 4HM8B 3Q90A 3S27A 3DZLA 2CHCA 1O7MB 4HM0B 4KFFA 2UX0A 3PS8A 4HKVB 3MWZA 3EE1A 3ER7A 3J7Yd 2ZDJA 3QK9A 1NWWA 1US1A 2HMOB 3LH4A 3FGYA 4H3UA 5FW5A 1RKYA 4R9LA 4H61A 2Y74A 2XEPA 3H51A 3LZAA 3PGBA 3PXMA 4OVMA 4J8TA 1IV9A 3U1WA 3JUNA 3SOAA 1NJI4 1UI8A 5AIGA 2C11A 3JUQA 1DVDA 2FXTA 3DMCA 1STFI 4GL6A 2KCDA 1K41A 3QRDA 3S29A 4MJDA 5G2GA 2YX9A 4RNYA 1NDOB 1SPUA 4FMAA 3G6E3 3JVCA 1VZZA 1ZO2A 5AYRB 3KIIA 3Q1CA 1KSIA 2BMRB 4RBNA 3X42A 1A2KA 1A67A 3Q2PA 3I563 4RNZA 1MOLA 3SEDA 2RSXA 3SOYA 3G713 3B8LA 2V1LA 3K5TA 1CQSA 2BHMA 4FMBA 1TU5A 4WP5A 1LNHA 1WQLB 3OWSA 3O8YA 3X40A 3BB9A 3BNCA 5KP1A 3F40A 3B7CA 5CF2A 2L4VA 3GZYB 2O9UX 1N9EA 1TIJA 1IDPA 4L8OA 2MC8A 2GBWB 2P38A 1T5YA 4AKZA 3KZTA 2W03A 2CWUA 3FKAA 2GU1A 3VF1A 2YFLB 3DGNA 3DGOA 1O7NB 1IVVA 1E3RA 1G96A 2WGQA 3PCRA 4AKYA 1Q40B 2CW9A 4RZMA 2PZVA 3OW22 1FUWA 2K54A 3HX8A 3NX0A 5KP3A 2CFWA 3CC43 1U5OA 3WOEB 1GYBA 3FZWA 4CDLA 3LXUX 4NREA 3WOFB 2HMNB 5EVHA 2IUJA 2CWVA 3ROBA 2HMJB 1L5GB 2YFJB 1FGOA 1QALA 3X3YA 5KP4A 2IA7A 1OF5A 2MF7A 3EQQB 1VQL3 4WFOA 3CC23 2OTL3 1NO3A 2BO9B 3F7XA 1SIIA 3UL6A 1QVF2 1IVXA 2KXGA 1FA3A 2CK3H 1KQS2 4N6OB 1WTHA 5ELJA 3T8NA 1CYUA 4PEJA 1QAFA 2F86B 4U13A 3CCS3 1F8NA 3LOYA 3F8XA 4HM2B 3FH1A 3GZRA 1YJN3 4O02B 3ECFA 5D82A 5ELUA 3UJMA 3K7CA 4XB5A 1OHOA 2JQ5A 2XF3A 3NBBA 8CHOA 1VQ83 1OHPA 2CWTA 1VQK3 1GS3A 1W7CA 1ULJB 1U8CB 1WMNA 1RJOA 2HMMB 4JF8A 1HU9A 3OWYA 4HYZA 1Z1SA 4OUQA 5JBSA 1JV2B 5LC7A 1TUHA 3RDEA 1C7HA 3F8HA 1UUVB 2D1WA 3CCJ3 3CC73 1IK3A 1AVKA 2XRXB 4KFEA 4NHFA 5AEWB 4ZM8A 1OF5B 4I4KA 2XGLA 2ML5A 5CK6A 5HGRA 2Z7AA 3HIIA 3IMAB 3MPHA 3LMLA 3UNLA 3RGRA 3NUVA 1Q864 5CLKA 5IEPA 4HM7B 1M1XB 3FG1A 4O3VA 3EN8A 1BUQA 1O7PB 1JJ22 3LTCA 4XBYA 1DMNA 1Q42A 4G1MB 2QA43 1A2VA 2XH9A 3UB1A 2Z6BA 4N6LA 3LT9A 3UL5A 3SLUA 1JNQA 1Q40A 4CCVA 2RFRA 3MKIA 1W6GA 1VQM3 1JB2A 5AEUB 3GZBA 4IPBA 3GWRA 4K1UA 3MSOA 3SXXA 1OGZA 3CCU3 4L8PA 2XGNA 3DM8A 3LYGA 2C10A 3FG3A 3X3ZA 2W56A 4K90B 2CIUA 1AR0A 3D9RA 1N8QA 2CFGA 3PCSA 1N9JA 3I553 2E2UA 1KWIA 1SIHA 3DXOA 2M7OA 1W2ZA 4HM6B 4EC6A 1DMQA 3BNDA 3EF8A 4J9AA 1O7HB 3CCL3 1ASKA 1YJW3 1ROAA 3NHXA 3LT8A 2W2CA 2FGTA 4BTYA 1FGRA 4R4KA 1IV7A 2ZL8A 1YJ93 3S5CA 1W02A 3V98A 4HM4B 1WMOA 2Z76A 4GB5A 3DY5A 1AV4A 4HM5B 3CCM3 3EJVA 3CD63 1M9GA 2E2VA 1TFKA 3CNXA 3FLJA 3KE7A 2W9QA 2W04A 1CEWI 3A76A 4R9KA 3CPOA 3NBJA 1J2BA 2Z77A 3B4PA 2JDIH 4N6NB 3NM2A 1E3VA 4X2OA 3LTBA 2O3OA 2HMKB 1UW1A 3FCSB 5CXOA 1W6CA 1IU7A 2W56B 3CME3 1OGXA 1R4CA 2XSOB 5AIHA 5A0OB 1AVLA 2WO0A 1GY5A 5CF1A 3K9MC 4HM1B 3EC9A 1K9M4 2FNQA 4WHAA 1WNHA 1HKXA 1OUNA 3STDA 3T0UA 6STDA 1O7GB 4LMIA 4O2HA 1DVCA 1NB3I 3L0RA 2HMLB 1JRQA 4FCZA 2OOVC 2E2TA 1ULIB 4IT7A 2W9PA 3NXJA 3CNMA 4HJLB 4LGQA 3MYTA 3I0YA 2K0MA 5BXQA 4N6TA 4MEIA 2B1XB 5IENA 3RGAA 2WOFA 5AIFA 3SVAA 3NQZA 2OOVA 2OWPA 3EB8A 3X41A 1Q7Y4 4KZ1A 2XSHB 2OCTA 3MHEA 3VSYA 1SQWA 3H3HA 1D6YA 4XDVA 1PFPA 2LQVA 1LVNA 2BMQB 4WYKA 2P0XA 2SBLA 5AIIA 2RCDA 3IPTA 1VQ93 1JB4A 4EYCA 1D6ZA 3NV0B 2Y73A 1OHSA 4EXRA 4N6V0 3HI7A 3SX1A 4FCMA 1A90A 1EG9B 3PZWA 1STDA 4XBTA 1GY7A 4K61A 2QEX3 5TGNA 5JPPA 3K63A 3BLZA 4KFDA 2XFTA 2GEXA 2P09A 1ZX2A 1IT7A 1FGTA 3JUOA 3K0ZA 1NU3A 3F14A 3NM7A 3T8UA 5IG3A 5IG5A 1YIT3 2XFSA 4N3VA 1W00A 3E99A 1W01A 3N54B 5AI1A 5STDA 3CCQ3 3S28A 2R4IA 2W6JH 1JKGB 2BMOB 3LTAA 4TX4A 1JN5B 4LZIA 5JPUA 3CXC2 1VQ53 3S67A 4HZBB 2P05A 2INXA 1NB5I 1FGQA 3JUMA 4AEQA 4Q53A 3AMOB 5FGOA 1QMAA 4JRFA 3EN1B 2IMJA 3KN4A 2RGQA 3VGNA 1IQ8A 1V74A 4HZ9B 4LEHA 3OX9A 3GRDA 3EBYA 1VQ63 3N8BA 4O8SA 3G8ZA 3FF2A 3DGLA 3GZXB 1QJGA 4HM3B 1S723 1MNLA 1O7WB 1FGMA 4WYKB 1OACA 1W4NA 2OQEC 2KRTA 5BVBA 4EV2A 2Q07A 3BNEA 4HVNA 4LSOA 2GXFA 1IQXA 2ML6A 4R1KA 4STDA 1RRHA 1W6YA 3WA2X 1KD14 2STDA 3MG2A 3IJEB 2WGOA 3F7SA 1D6UA 3V92A 1K734 4X2HA 2OQEA 3JUPA 3PYJA 1ISKA 2BT3A 3U97A 3M8CA 3BNBA 4N6UA 4QWTA 3WMDA 3DGMA 1EA2A 3MG3A 1VQ43 1IVUA 3CCV3 3NBRA 4FCJA 3ALAA 1RN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBX A;  3DUK A;  2CKF B;  3CU3 A;  1UUW B;  3EHC A;  3OV4 A;  3OWU A;  4KVH A;  3G0K A;  2GBX B;  3F9S A;  2GEY A;  3KSP A;  1SJW A;  3NV0 A;  2QGU A;  1OCV A;  1TP6 A;  2B24 B;  3KKG A;  2A15 A;  5IG4 A;  3MG1 A;  3HZP A;  1JKG A;  3EBT A;  3FF0 A;  1GY6 A;  1JN5 A;  4K1V A;  4L7K A;  2F99 A;  5D81 A;  1JB5 A;  1OH0 A;  3FSD A;  4WWU C;  5IEO A;  4XDW A;  2F98 A;  3EX9 A;  2I9W A;  1E97 A;  5DRE A;  2XR8 B;  4XM4 A;  7STD A;  5IER A;  1S5A A;  1DMM A;  2BNG A;  5IF6 A;  3OXA A;  3B4O A;  4ORL A;  1OPY A;  2QIY A;  5DRV A;  3G16 A;  5D83 A;  5IG0 A;  4IIA A;  2YFI B;  3HK4 A;  4HM8 B;  3Q90 A;  3DZL A;  2CHC A;  1O7M B;  4HM0 B;  2UX0 A;  4HKV B;  3ER7 A;  1NWW A;  2HMO B;  3FGY A;  4H3U A;  5FW5 A;  4R9L A;  3LZA A;  3H51 A;  4OVM A;  4J8T A;  3JUN A;  3SOA A;  5AIG A;  3JUQ A;  3DMC A;  1K41 A;  4MJD A;  5G2G A;  1NDO B;  1VZZ A;  1ZO2 A;  2BMR B;  1A2K A;  3SED A;  3SOY A;  3B8L A;  1CQS A;  4WP5 A;  1WQL B;  3OWS A;  3BB9 A;  5KP1 A;  3F40 A;  3B7C A;  5CF2 A;  3GZY B;  1IDP A;  4L8O A;  2GBW B;  3KZT A;  3FKA A;  2YFL B;  1O7N B;  1E3R A;  1Q40 B;  4RZM A;  2PZV A;  2K54 A;  3HX8 A;  5KP3 A;  1U5O A;  1GYB A;  3FZW A;  4CDL A;  2HMN B;  5EVH A;  3ROB A;  2HMJ B;  2YFJ B;  5KP4 A;  1OF5 A;  3EQQ B;  3F7X A;  3T8N A;  4PEJ A;  2F86 B;  4U13 A;  3F8X A;  4HM2 B;  3FH1 A;  3GZR A;  3ECF A;  5D82 A;  3UJM A;  3K7C A;  4XB5 A;  1OHO A;  2JQ5 A;  8CHO A;  1OHP A;  1GS3 A;  1ULJ B;  2HMM B;  3OWY A;  1Z1S A;  4OUQ A;  1TUH A;  1C7H A;  3F8H A;  1UUV B;  2XRX B;  5AEW B;  1OF5 B;  4I4K A;  5CK6 A;  5HGR A;  2Z7A A;  3UNL A;  3RGR A;  3NUV A;  5CLK A;  5IEP A;  4HM7 B;  3EN8 A;  1BUQ A;  1O7P B;  4XBY A;  1DMN A;  1Q42 A;  1Q40 A;  2RFR A;  3MKI A;  1JB2 A;  5AEU B;  3GZB A;  3GWR A;  4K1U A;  3MSO A;  1OGZ A;  4L8P A;  3DM8 A;  3LYG A;  1AR0 A;  3D9R A;  3DXO A;  4HM6 B;  1DMQ A;  3EF8 A;  4J9A A;  1O7H B;  1ASK A;  3NHX A;  2W2C A;  3S5C A;  1W02 A;  4HM4 B;  2Z76 A;  4GB5 A;  4HM5 B;  3EJV A;  3CNX A;  3FLJ A;  3KE7 A;  3A76 A;  4R9K A;  3CPO A;  2Z77 A;  3B4P A;  3NM2 A;  1E3V A;  4X2O A;  2HMK B;  5CXO A;  1OGX A;  2XSO B;  5AIH A;  1GY5 A;  5CF1 A;  4HM1 B;  3EC9 A;  1HKX A;  1OUN A;  3STD A;  6STD A;  1O7G B;  4LMI A;  2HML B;  1ULI B;  3NXJ A;  3CNM A;  4HJL B;  4LGQ A;  3MYT A;  3I0Y A;  5BXQ A;  2B1X B;  5IEN A;  3RGA A;  5AIF A;  2OWP A;  2XSH B;  3MHE A;  3VSY A;  3H3H A;  4XDV A;  2BMQ B;  4WYK A;  5AII A;  2RCD A;  3IPT A;  1JB4 A;  3NV0 B;  1OHS A;  4FCM A;  1EG9 B;  1STD A;  4XBT A;  1GY7 A;  5TGN A;  5JPP A;  3BLZ A;  2GEX A;  1ZX2 A;  3K0Z A;  3JUO A;  3T8U A;  5IG3 A;  1NU3 A;  3F14 A;  5IG5 A;  4N3V A;  1W00 A;  3E99 A;  1W01 A;  5AI1 A;  5STD A;  2R4I A;  1JKG B;  2BMO B;  1JN5 B;  5JPU A;  4HZB B;  2INX A;  3JUM A;  4Q53 A;  1QMA A;  3EN1 B;  2IMJ A;  2RGQ A;  3VGN A;  4HZ9 B;  4LEH A;  3OX9 A;  3GRD A;  3EBY A;  3G8Z A;  3FF2 A;  3GZX B;  1QJG A;  4HM3 B;  1O7W B;  4WYK B;  5BVB A;  4HVN A;  2GXF A;  4R1K A;  4STD A;  1W6Y A;  2STD A;  3MG2 A;  3F7S A;  4X2H A;  3JUP A;  1ISK A;  3M8C A;  3WMD A;  1EA2 A;  3MG3 A;  3NBR A;  4FCJ A; 
#chains in the Genus database with same CATH topology
 1YGW A;  4XBX A;  1I8V A;  4FR9 A;  3DUK A;  1ZGX A;  4BTW A;  2CKF B;  1I2F A;  3WHO A;  3CPW 2;  3ZFZ A;  3N9H A;  1RGF A;  2CFD A;  1VQP 3;  1UDI I;  1GD4 A;  3CU3 A;  1UUW B;  2CH9 A;  3EHC A;  3V99 A;  2PNC A;  1DYU A;  2W0Q A;  3D5G A;  1ROV A;  3OV4 A;  3OWU A;  4ILF A;  4MMX B;  1Y4K A;  4KVH A;  3LTD A;  1BAN A;  4FMD A;  3WA3 A;  1YVB I;  1EEJ A;  1YIJ 3;  1N5P A;  1WMP A;  3G0K A;  4HBR A;  3Q3F A;  1BAO A;  2GBX B;  3CCR 3;  1UI7 A;  3F9S A;  1JZO A;  2GEY A;  1X1X A;  3KSP A;  1N5H A;  1SJW A;  2GU3 A;  3NV0 A;  4J5K A;  4OK0 A;  2QGU A;  1OCV A;  3D3L A;  4BTX A;  1TP6 A;  2B24 B;  2IUK A;  3TDG A;  4FMC A;  1M90 4;  1JBS A;  3WDG B;  2H0H A;  3KKG A;  5BU4 A;  1UCL A;  8RNT A;  1K28 A;  1YHQ 3;  1BNI A;  1VQQ A;  1GOY A;  3HIG A;  4R80 A;  1VQN 3;  2CG1 A;  1QAK A;  2A15 A;  1I3I A;  1B2S A;  3MG1 A;  3WOD G;  5IG4 A;  1EQK A;  1VQO 3;  1KC8 4;  4MMZ B;  5GSP A;  1RN4 A;  1EKM A;  1UCI A;  9RNT A;  3HZP A;  3RNT A;  1FUS A;  1LXE A;  1CYV A;  1JKG A;  2F5W A;  2UGI A;  3EBT A;  3FF0 A;  1GY6 A;  1JN5 A;  3FG4 A;  3KFQ C;  4K1V A;  2F99 A;  1RDS A;  4L7K A;  1K8A 4;  5D81 A;  1BNR A;  5EEO A;  3AGN A;  1JB5 A;  1G0T A;  1GOV A;  3GAX A;  1GD3 A;  2CFL A;  1OH0 A;  2LYX A;  1BUJ A;  3FSD A;  4WWU C;  5LC6 A;  3AMO A;  5IEO A;  4N6M A;  1VQ7 3;  1RRL A;  3D4A A;  1PU4 A;  4XDW A;  1RN1 A;  2F98 A;  1YI2 3;  1IVW A;  3EX9 A;  3A5E A;  2I9W A;  1E97 A;  5DRE A;  2XR8 B;  3NQY A;  4XM4 A;  7STD A;  2CX1 A;  5G1L A;  1Q82 4;  1Q81 4;  1Q7H A;  2CFK A;  5IER A;  5AYS C;  3G4S 3;  1FUT A;  1S5A A;  1DMM A;  5BIR A;  1LOY A;  2BNG A;  1YGE A;  4EBG A;  5IF6 A;  5I97 A;  4LYL B;  3OXA A;  5EQL A;  1GSP A;  1LOV A;  1IQY A;  1LOX A;  4BL3 A;  3B4O A;  1M1K 4;  1W5Z A;  4ORL A;  1OPY A;  2QIY A;  5DRV A;  2IYJ A;  1IT8 A;  3KSE D;  2BIR A;  2D42 A;  4MMY B;  3G16 A;  2P0M A;  5D83 A;  2WOH A;  3CCE 3;  1QVG 2;  1W2B 2;  1MWS A;  5IW9 A;  1R4Y A;  2CG0 A;  1RNB A;  1BVI A;  2CC3 A;  5IG0 A;  2K3D A;  3X3X A;  4DKI A;  4IIA A;  2SAR A;  3CMA 3;  1TFO A;  2YFI B;  2ZA4 A;  3HK4 A;  4HM8 B;  3Q90 A;  3S27 A;  3DZL A;  4HOH A;  2CHC A;  1DE3 A;  1O7M B;  4HM0 B;  4KFF A;  2UX0 A;  3PS8 A;  4HKV B;  5M18 A;  3MWZ A;  3EE1 A;  3ER7 A;  3J7Y d;  1BSD A;  2ZDJ A;  4EV5 A;  1TTO A;  1LNI A;  2OTL 3;  3QK9 A;  1NWW A;  1SAR A;  2KAA A;  1US1 A;  2HMO B;  3LH4 A;  3FGY A;  4H3U A;  1PY3 A;  1LRA A;  5FW5 A;  1RKY A;  2C4B A;  1MWR A;  4R9L A;  4H61 A;  2Y74 A;  2XEP A;  3H51 A;  3LZA A;  3PGB A;  3PXM A;  4OVM A;  4J8T A;  1IV9 A;  3U1W A;  3JUN A;  3SOA A;  1NJI 4;  1UGH I;  1UI8 A;  5AIG A;  2C11 A;  3JUQ A;  1DVD A;  2FXT A;  3DMC A;  1STF I;  1V58 A;  4GL6 A;  2KCD A;  1K41 A;  3QRD A;  3S29 A;  4MJD A;  5G2G A;  2YX9 A;  4RNY A;  1NDO B;  1SPU A;  4FMA A;  3ZG5 A;  3G6E 3;  3JVC A;  1VZZ A;  1ZO2 A;  4HAA A;  5AYR B;  3KII A;  3Q1C A;  1KSI A;  2BMR B;  4RBN A;  1UUG B;  1A2K A;  3X42 A;  1A67 A;  1B2M A;  3Q2P A;  1UCJ A;  4RNZ A;  3I56 3;  1MOL A;  3SED A;  2RSX A;  3SOY A;  3G71 3;  3B8L A;  2V1L A;  4BIR A;  1RLS A;  3K5T A;  1CQS A;  2BHM A;  4FMB A;  1TU5 A;  2IY2 A;  4WP5 A;  1LNH A;  1WQL B;  1RGG A;  5G1K A;  3OWS A;  1FW7 A;  1HYF A;  3O8Y A;  3X40 A;  3BB9 A;  3BNC A;  5KP1 A;  1B2Z A;  1BRI A;  3B7C A;  3F40 A;  5CF2 A;  1GOU A;  1I2G A;  1RGK A;  2L4V A;  3GZY B;  2O9U X;  1N9E A;  1TIJ A;  1IDP A;  2RNT A;  1BNF A;  1PYL A;  4L8O A;  2MC8 A;  2GBW B;  1B2U A;  2P38 A;  1T5Y A;  4AKZ A;  3KZT A;  1CYU A;  2W03 A;  2CWU A;  2KF6 A;  3FKA A;  2GU1 A;  3VF1 A;  2YFL B;  3DGN A;  3DGO A;  1O7N B;  1B20 A;  1IVV A;  1E3R A;  1G96 A;  2WGQ A;  2KF5 A;  1B21 A;  1MWU A;  5M1A A;  1UGI A;  3PCR A;  4AKY A;  1Q40 B;  2CW9 A;  4RZM A;  2PZV A;  3OW2 2;  1FUW A;  2K54 A;  3HX8 A;  3NX0 A;  5KP3 A;  1B27 A;  3DGY A;  6GSP A;  2CFW A;  3CC4 3;  5RNT A;  1U5O A;  1RGC A;  3GSP A;  1GYB A;  3FZW A;  3WOE B;  4CDL A;  4CJN A;  3LXU X;  4NRE A;  3WOF B;  2HMN B;  5EVH A;  1I2E A;  2IUJ A;  2CWV A;  3ROB A;  2HMJ B;  6RNT A;  1L5G B;  1RMS A;  1JZD A;  3HOH A;  2YFJ B;  1FGO A;  1QAL A;  3X3Y A;  5KP4 A;  2IA7 A;  1OF5 A;  2MF7 A;  3EQQ B;  1VQL 3;  4WFO A;  4I5Q A;  1RNT A;  3WR2 A;  1NO3 A;  2BO9 B;  3F7X A;  1SII A;  3UL6 A;  3CC2 3;  1Q9E A;  1IVX A;  1QVF 2;  2KXG A;  1FA3 A;  2H0I A;  2CK3 H;  1CH0 A;  1GMP A;  1YNV X;  1KQS 2;  3AGO A;  4N6O B;  1B3S A;  1LOW A;  1WTH A;  5ELJ A;  3T8N A;  2HOH A;  1QAF A;  2F86 B;  2KF4 A;  1B2X A;  4PEJ A;  4U13 A;  3CCS 3;  1F8N A;  3LOY A;  5HOH A;  2J8X B;  3F8X A;  4HM2 B;  3FH1 A;  3GZR A;  1BRJ A;  1YJN 3;  1I0V A;  4O02 B;  3ECF A;  5M19 A;  5D82 A;  5ELU A;  3UJM A;  1BNE A;  3K7C A;  4XB5 A;  1OHO A;  2JQ5 A;  2XF3 A;  3NBB A;  8CHO A;  1VQ8 3;  1OHP A;  2CWT A;  2BU4 A;  1VQK 3;  4NPB A;  1BSA A;  1GS3 A;  1W7C A;  1TRP A;  1ULJ B;  1U8C B;  1WMN A;  1BNJ A;  2OTJ 3;  1BRG A;  1RJO A;  2HMM B;  1JBT A;  2UUG C;  4JF8 A;  3URP A;  1HU9 A;  3OWY A;  4HYZ A;  1Z1S A;  1BSB A;  4OUQ A;  5JBS A;  1JV2 B;  5LC7 A;  1MGR A;  2L1S A;  1TUH A;  3RDE A;  3AHS A;  1BIR A;  1C7H A;  3F8H A;  1GMQ A;  1UUV B;  2D1W A;  3CCJ 3;  3CC7 3;  1IK3 A;  1AVK A;  1HZ1 A;  2XRX B;  4KFE A;  4NHF A;  5AEW B;  4ZM8 A;  1OF5 B;  1MWT A;  2XGL A;  2ML5 A;  4I4K A;  5CK6 A;  5HGR A;  2Z7A A;  3HII A;  3IMA B;  1LQG C;  1TRQ A;  3MPH A;  3LML A;  3UNL A;  3RGR A;  3NUV A;  1Q86 4;  5CLK A;  5IEP A;  4HM7 B;  1M1X B;  3FG1 A;  4O3V A;  1BSC A;  1GMR A;  3EN8 A;  1BUQ A;  1O7P B;  1JJ2 2;  3LTC A;  3D5I A;  4XBY A;  1DMN A;  1Q42 A;  4G1M B;  2QA4 3;  1A2V A;  2XH9 A;  3UB1 A;  2Z6B A;  4N6L A;  3LT9 A;  3BIR A;  3SLU A;  3UL5 A;  1JNQ A;  1Q40 A;  4CCV A;  2RFR A;  3MKI A;  1W6G A;  1VQM 3;  1JB2 A;  1T2H A;  5AEU B;  3GZB A;  4IPB A;  3GWR A;  4K1U A;  3MSO A;  3SXX A;  1OGZ A;  1TJD A;  3CCU 3;  1RCK A;  4L8P A;  2XGN A;  3DM8 A;  3LYG A;  2C10 A;  3BU4 A;  3FG3 A;  1I70 A;  3X3Z A;  2W56 A;  4K90 B;  1I0X A;  2CIU A;  1AR0 A;  3D9R A;  1N8Q A;  2CFG A;  1X1W A;  4J5G A;  3PCS A;  1N9J A;  3I55 3;  1BNG A;  2E2U A;  4BU4 A;  1KWI A;  1BU4 A;  1SIH A;  3DXO A;  2M7O A;  1BRH A;  3ZG0 A;  1W2Z A;  4HM6 B;  4EC6 A;  1DMQ A;  3BND A;  7RNT A;  3EF8 A;  1BNS A;  4J9A A;  1O7H B;  1BOX A;  3CCL 3;  1ASK A;  4RNT A;  1YJW 3;  1I3F A;  1ROA A;  3NHX A;  3LT8 A;  2W2C A;  1V57 A;  2FGT A;  4BTY A;  3KCH A;  1FGR A;  4R4K A;  1IV7 A;  2ZL8 A;  3DH2 A;  1YJ9 3;  3S5C A;  1W02 A;  3SYU A;  3V98 A;  4HM4 B;  1LQM B;  1RGA A;  2ZHX B;  1WMO A;  1BSE A;  2Z76 A;  2AAD A;  4GB5 A;  3DY5 A;  1AV4 A;  4HM5 B;  3CCM 3;  3EJV A;  3CD6 3;  1NNV A;  4CPK A;  1M9G A;  2E2V A;  1TFK A;  3CNX A;  3FLJ A;  3KE7 A;  2W9Q A;  2RBI A;  2W04 A;  1CEW I;  3A76 A;  4R9K A;  3CPO A;  3NBJ A;  1C54 A;  1J2B A;  2Z77 A;  3B4P A;  2F5M A;  1RGH A;  2JDI H;  4N6N B;  3NM2 A;  1E3V A;  4X2O A;  3LTB A;  2O3O A;  1RSN A;  2HMK B;  1UW1 A;  3FCS B;  5CXO A;  1W6C A;  1IU7 A;  2W56 B;  3CME 3;  1OGX A;  1R4C A;  2CX0 A;  2XSO B;  5AIH A;  5A0O B;  1GY5 A;  1AVL A;  2WO0 A;  5CF1 A;  3K9M C;  4HM1 B;  3EC9 A;  1K9M 4;  2FNQ A;  1T2I A;  4WHA A;  1WNH A;  1HKX A;  1OUN A;  3STD A;  3T0U A;  7GSP A;  6STD A;  1O7G B;  1A2P A;  4KT3 B;  1RCL A;  4LMI A;  4O2H A;  1DVC A;  1NB3 I;  3L0R A;  2HML B;  1JRQ A;  4FCZ A;  2OOV C;  3D79 A;  2E2T A;  1ULI B;  4GSP A;  4IT7 A;  2W9P A;  3NXJ A;  3CNM A;  4HJL B;  4LGQ A;  3MYT A;  3I0Y A;  2K0M A;  1MGW A;  5BXQ A;  4N6T A;  4MEI A;  2B1X B;  5IEN A;  3RGA A;  2WOF A;  5AIF A;  1IYY A;  1RTU A;  3SVA A;  2F56 A;  1BGS A;  1UCK A;  3NQZ A;  2OWP A;  3EB8 A;  2OOV A;  3X41 A;  1Q7Y 4;  4KZ1 A;  2XSH B;  2OCT A;  3MHE A;  3VSY A;  1SQW A;  3H3H A;  1D6Y A;  4XDV A;  2H0G A;  1PFP A;  2LQV A;  1LVN A;  2BMQ B;  4WYK A;  2P0X A;  2SBL A;  5AII A;  2RCD A;  3IPT A;  2KF3 A;  1VQ9 3;  4BL2 A;  1JB4 A;  1YVS A;  1D6Z A;  4EYC A;  3NV0 B;  4GHO A;  2Y73 A;  1OHS A;  4EXR A;  4N6V 0;  3HI7 A;  3SX1 A;  4FCM A;  1A90 A;  1T3B A;  1EG9 B;  3PZW A;  1AY7 A;  1STD A;  4XBT A;  1GY7 A;  1X1U A;  4K61 A;  2QEX 3;  5TGN A;  2F4Y A;  5JPP A;  3K63 A;  3BLZ A;  4KFD A;  2XFT A;  1RGE A;  2GEX A;  2P09 A;  1ZX2 A;  1IT7 A;  1FGT A;  3JUO A;  3K0Z A;  1NU3 A;  3F14 A;  3NM7 A;  3T8U A;  5IG3 A;  5IG5 A;  1YIT 3;  1ZS7 A;  2R41 A;  2XFS A;  1W00 A;  3E99 A;  1W01 A;  3N54 B;  4N3V A;  5AI1 A;  5STD A;  3CCQ 3;  3S28 A;  2R4I A;  2W6J H;  1N8R 4;  1JKG B;  1BRS A;  2BMO B;  1X1Y A;  3LTA A;  4TX4 A;  1JN5 B;  4LZI A;  1JBR A;  5JPU A;  3CXC 2;  1VQ5 3;  3S67 A;  4HZB B;  2P05 A;  2AAE A;  2INX A;  1NB5 I;  1FGQ A;  3JUM A;  4AEQ A;  4Q53 A;  3AMO B;  5FGO A;  1QMA A;  4JRF A;  3EN1 B;  2IMJ A;  3KN4 A;  2RGQ A;  3VGN A;  1IQ8 A;  1V74 A;  4HZ9 B;  4LEH A;  3OX9 A;  3GRD A;  3EBY A;  1VQ6 3;  1FYS A;  3N8B A;  4O8S A;  3G8Z A;  3FF2 A;  3DGL A;  3GZX B;  1QJG A;  3AHW A;  4HM3 B;  1S72 3;  1EUI C;  1MNL A;  1O7W B;  1FGM A;  4WYK B;  1OAC A;  1W4N A;  2OQE C;  1RGL A;  2KRT A;  5BVB A;  4EV2 A;  2Q07 A;  3BNE A;  4HVN A;  4LSO A;  2GXF A;  1IQX A;  2ML6 A;  4R1K A;  1FZU A;  4STD A;  1RRH A;  1W6Y A;  3WA2 X;  1RHL A;  1KD1 4;  2STD A;  1AQZ A;  3MG2 A;  3IJE B;  2WGO A;  3F7S A;  1DET A;  1D6U A;  3V92 A;  4X2H A;  2OQE A;  3JUP A;  1K73 4;  3PYJ A;  1ISK A;  2BT3 A;  3U97 A;  3M8C A;  3BNB A;  4N6U A;  4QWT A;  3WMD A;  3DGM A;  1BRN L;  1EA2 A;  3MG3 A;  2GSP A;  1VQ4 3;  1BRK A;  1IVU A;  1G02 A;  3CCV 3;  3NBR A;  4FCJ A;  4EW5 A;  3ALA A;  1RN7 A; 
#chains in the Genus database with same CATH homology
 4XBX A;  4FR9 A;  3DUK A;  4BTW A;  2CKF B;  3CPW 2;  1VQP 3;  3N9H A;  2CFD A;  1GD4 A;  3CU3 A;  1UUW B;  2CH9 A;  3EHC A;  3V99 A;  2PNC A;  1DYU A;  2W0Q A;  3OV4 A;  1ROV A;  3OWU A;  4MMX B;  4EV5 A;  2OTJ 3;  1Y4K A;  4KVH A;  3LTD A;  4FMD A;  3WA3 A;  1YVB I;  1YIJ 3;  1N5P A;  1WMP A;  3G0K A;  4HBR A;  2GBX B;  3CCR 3;  1UI7 A;  3F9S A;  2GEY A;  1N8R 4;  3KSP A;  1N5H A;  1SJW A;  2GU3 A;  3NV0 A;  4OK0 A;  2QGU A;  1OCV A;  3D3L A;  4BTX A;  1TP6 A;  2B24 B;  2IUK A;  3TDG A;  4FMC A;  1M90 4;  3WDG B;  3KKG A;  1K28 A;  1YHQ 3;  1VQN 3;  3HIG A;  4R80 A;  2CG1 A;  1QAK A;  2A15 A;  5IG4 A;  3MG1 A;  3WOD G;  1EQK A;  1VQO 3;  1KC8 4;  4MMZ B;  1EKM A;  3HZP A;  1LXE A;  1CYV A;  1JKG A;  3EBT A;  3FF0 A;  1GY6 A;  1JN5 A;  3FG4 A;  3KFQ C;  4K1V A;  2F99 A;  4L7K A;  1K8A 4;  5D81 A;  5EEO A;  1JB5 A;  3GAX A;  1GD3 A;  2CFL A;  1OH0 A;  2LYX A;  3FSD A;  4WWU C;  5LC6 A;  3AMO A;  5IEO A;  4N6M A;  1VQ7 3;  1RRL A;  1PU4 A;  4XDW A;  2F98 A;  1YI2 3;  1IVW A;  3EX9 A;  2I9W A;  1E97 A;  5DRE A;  2XR8 B;  3NQY A;  4XM4 A;  7STD A;  1Q82 4;  1Q81 4;  2CFK A;  5IER A;  5AYS C;  3G4S 3;  1S5A A;  1DMM A;  2BNG A;  5IF6 A;  1YGE A;  4EBG A;  5I97 A;  3OXA A;  5EQL A;  1IQY A;  1LOX A;  3B4O A;  1M1K 4;  1W5Z A;  4ORL A;  1OPY A;  2QIY A;  5DRV A;  1IT8 A;  3KSE D;  4MMY B;  2D42 A;  3G16 A;  2P0M A;  5D83 A;  2WOH A;  3CCE 3;  1QVG 2;  1W2B 2;  5IW9 A;  2CG0 A;  2CC3 A;  5IG0 A;  3X3X A;  4IIA A;  3CMA 3;  1TFO A;  2YFI B;  3HK4 A;  4HM8 B;  3Q90 A;  3S27 A;  3DZL A;  2CHC A;  1O7M B;  4HM0 B;  4KFF A;  2UX0 A;  3PS8 A;  4HKV B;  3MWZ A;  3EE1 A;  3ER7 A;  3J7Y d;  2ZDJ A;  3QK9 A;  1NWW A;  1US1 A;  2HMO B;  3LH4 A;  3FGY A;  4H3U A;  5FW5 A;  1RKY A;  4R9L A;  4H61 A;  2Y74 A;  2XEP A;  3H51 A;  3LZA A;  3PGB A;  3PXM A;  4OVM A;  4J8T A;  1IV9 A;  3U1W A;  3JUN A;  3SOA A;  1NJI 4;  1UI8 A;  5AIG A;  2C11 A;  3JUQ A;  1DVD A;  2FXT A;  3DMC A;  1STF I;  4GL6 A;  2KCD A;  1K41 A;  3QRD A;  3S29 A;  4MJD A;  5G2G A;  2YX9 A;  4RNY A;  1NDO B;  1SPU A;  4FMA A;  3G6E 3;  3JVC A;  1VZZ A;  1ZO2 A;  5AYR B;  3KII A;  3Q1C A;  1KSI A;  2BMR B;  4RBN A;  3X42 A;  1A2K A;  1A67 A;  3Q2P A;  3I56 3;  4RNZ A;  1MOL A;  3SED A;  2RSX A;  3SOY A;  3G71 3;  3B8L A;  2V1L A;  3K5T A;  1CQS A;  2BHM A;  4FMB A;  1TU5 A;  4WP5 A;  1LNH A;  1WQL B;  3OWS A;  3O8Y A;  3X40 A;  3BB9 A;  3BNC A;  5KP1 A;  3F40 A;  3B7C A;  5CF2 A;  2L4V A;  3GZY B;  2O9U X;  1N9E A;  1TIJ A;  1IDP A;  4L8O A;  2MC8 A;  2GBW B;  2P38 A;  1T5Y A;  4AKZ A;  3KZT A;  2W03 A;  2CWU A;  3FKA A;  2GU1 A;  3VF1 A;  2YFL B;  3DGN A;  3DGO A;  1O7N B;  1IVV A;  1E3R A;  1G96 A;  2WGQ A;  3PCR A;  4AKY A;  1Q40 B;  2CW9 A;  4RZM A;  2PZV A;  3OW2 2;  1FUW A;  2K54 A;  3HX8 A;  3NX0 A;  5KP3 A;  2CFW A;  3CC4 3;  1U5O A;  3WOE B;  1GYB A;  3FZW A;  4CDL A;  3LXU X;  4NRE A;  3WOF B;  2HMN B;  5EVH A;  2IUJ A;  2CWV A;  3ROB A;  2HMJ B;  1L5G B;  2YFJ B;  1FGO A;  1QAL A;  3X3Y A;  5KP4 A;  2IA7 A;  1OF5 A;  2MF7 A;  3EQQ B;  1VQL 3;  4WFO A;  3CC2 3;  2OTL 3;  1NO3 A;  2BO9 B;  3F7X A;  1SII A;  3UL6 A;  1QVF 2;  1IVX A;  2KXG A;  1FA3 A;  2CK3 H;  1KQS 2;  4N6O B;  1WTH A;  5ELJ A;  3T8N A;  1CYU A;  4PEJ A;  1QAF A;  2F86 B;  4U13 A;  3CCS 3;  1F8N A;  3LOY A;  3F8X A;  4HM2 B;  3FH1 A;  3GZR A;  1YJN 3;  4O02 B;  3ECF A;  5D82 A;  5ELU A;  3UJM A;  3K7C A;  4XB5 A;  1OHO A;  2JQ5 A;  2XF3 A;  3NBB A;  8CHO A;  1VQ8 3;  1OHP A;  2CWT A;  1VQK 3;  1GS3 A;  1W7C A;  1ULJ B;  1U8C B;  1WMN A;  1RJO A;  2HMM B;  4JF8 A;  1HU9 A;  3OWY A;  4HYZ A;  1Z1S A;  4OUQ A;  5JBS A;  1JV2 B;  5LC7 A;  1TUH A;  3RDE A;  1C7H A;  3F8H A;  1UUV B;  2D1W A;  3CCJ 3;  3CC7 3;  1IK3 A;  1AVK A;  2XRX B;  4KFE A;  4NHF A;  5AEW B;  4ZM8 A;  1OF5 B;  4I4K A;  2XGL A;  2ML5 A;  5CK6 A;  5HGR A;  2Z7A A;  3HII A;  3IMA B;  3MPH A;  3LML A;  3UNL A;  3RGR A;  3NUV A;  1Q86 4;  5CLK A;  5IEP A;  4HM7 B;  1M1X B;  3FG1 A;  4O3V A;  3EN8 A;  1BUQ A;  1O7P B;  1JJ2 2;  3LTC A;  4XBY A;  1DMN A;  1Q42 A;  4G1M B;  2QA4 3;  1A2V A;  2XH9 A;  3UB1 A;  2Z6B A;  4N6L A;  3LT9 A;  3UL5 A;  3SLU A;  1JNQ A;  1Q40 A;  4CCV A;  2RFR A;  3MKI A;  1W6G A;  1VQM 3;  1JB2 A;  5AEU B;  3GZB A;  4IPB A;  3GWR A;  4K1U A;  3MSO A;  3SXX A;  1OGZ A;  3CCU 3;  4L8P A;  2XGN A;  3DM8 A;  3LYG A;  2C10 A;  3FG3 A;  3X3Z A;  2W56 A;  4K90 B;  2CIU A;  1AR0 A;  3D9R A;  1N8Q A;  2CFG A;  3PCS A;  1N9J A;  3I55 3;  2E2U A;  1KWI A;  1SIH A;  3DXO A;  2M7O A;  1W2Z A;  4HM6 B;  4EC6 A;  1DMQ A;  3BND A;  3EF8 A;  4J9A A;  1O7H B;  3CCL 3;  1ASK A;  1YJW 3;  1ROA A;  3NHX A;  3LT8 A;  2W2C A;  2FGT A;  4BTY A;  1FGR A;  4R4K A;  1IV7 A;  2ZL8 A;  1YJ9 3;  3S5C A;  1W02 A;  3V98 A;  4HM4 B;  1WMO A;  2Z76 A;  4GB5 A;  3DY5 A;  1AV4 A;  4HM5 B;  3CCM 3;  3EJV A;  3CD6 3;  1M9G A;  2E2V A;  1TFK A;  3CNX A;  3FLJ A;  3KE7 A;  2W9Q A;  2W04 A;  1CEW I;  3A76 A;  4R9K A;  3CPO A;  3NBJ A;  1J2B A;  2Z77 A;  3B4P A;  2JDI H;  4N6N B;  3NM2 A;  1E3V A;  4X2O A;  3LTB A;  2O3O A;  2HMK B;  1UW1 A;  3FCS B;  5CXO A;  1W6C A;  1IU7 A;  2W56 B;  3CME 3;  1OGX A;  1R4C A;  2XSO B;  5AIH A;  5A0O B;  1AVL A;  2WO0 A;  1GY5 A;  5CF1 A;  3K9M C;  4HM1 B;  3EC9 A;  1K9M 4;  2FNQ A;  4WHA A;  1WNH A;  1HKX A;  1OUN A;  3STD A;  3T0U A;  6STD A;  1O7G B;  4LMI A;  4O2H A;  1DVC A;  1NB3 I;  3L0R A;  2HML B;  1JRQ A;  4FCZ A;  2OOV C;  2E2T A;  1ULI B;  4IT7 A;  2W9P A;  3NXJ A;  3CNM A;  4HJL B;  4LGQ A;  3MYT A;  3I0Y A;  2K0M A;  5BXQ A;  4N6T A;  4MEI A;  2B1X B;  5IEN A;  3RGA A;  2WOF A;  5AIF A;  3SVA A;  3NQZ A;  2OOV A;  2OWP A;  3EB8 A;  3X41 A;  1Q7Y 4;  4KZ1 A;  2XSH B;  2OCT A;  3MHE A;  3VSY A;  1SQW A;  3H3H A;  1D6Y A;  4XDV A;  1PFP A;  2LQV A;  1LVN A;  2BMQ B;  4WYK A;  2P0X A;  2SBL A;  5AII A;  2RCD A;  3IPT A;  1VQ9 3;  1JB4 A;  4EYC A;  1D6Z A;  3NV0 B;  2Y73 A;  1OHS A;  4EXR A;  4N6V 0;  3HI7 A;  3SX1 A;  4FCM A;  1A90 A;  1EG9 B;  3PZW A;  1STD A;  4XBT A;  1GY7 A;  4K61 A;  2QEX 3;  5TGN A;  5JPP A;  3K63 A;  3BLZ A;  4KFD A;  2XFT A;  2GEX A;  2P09 A;  1ZX2 A;  1IT7 A;  1FGT A;  3JUO A;  3K0Z A;  1NU3 A;  3F14 A;  3NM7 A;  3T8U A;  5IG3 A;  5IG5 A;  1YIT 3;  2XFS A;  4N3V A;  1W00 A;  3E99 A;  1W01 A;  3N54 B;  5AI1 A;  5STD A;  3CCQ 3;  3S28 A;  2R4I A;  2W6J H;  1JKG B;  2BMO B;  3LTA A;  4TX4 A;  1JN5 B;  4LZI A;  5JPU A;  3CXC 2;  1VQ5 3;  3S67 A;  4HZB B;  2P05 A;  2INX A;  1NB5 I;  1FGQ A;  3JUM A;  4AEQ A;  4Q53 A;  3AMO B;  5FGO A;  1QMA A;  4JRF A;  3EN1 B;  2IMJ A;  3KN4 A;  2RGQ A;  3VGN A;  1IQ8 A;  1V74 A;  4HZ9 B;  4LEH A;  3OX9 A;  3GRD A;  3EBY A;  1VQ6 3;  3N8B A;  4O8S A;  3G8Z A;  3FF2 A;  3DGL A;  3GZX B;  1QJG A;  4HM3 B;  1S72 3;  1MNL A;  1O7W B;  1FGM A;  4WYK B;  1OAC A;  1W4N A;  2OQE C;  2KRT A;  5BVB A;  4EV2 A;  2Q07 A;  3BNE A;  4HVN A;  4LSO A;  2GXF A;  1IQX A;  2ML6 A;  4R1K A;  4STD A;  1RRH A;  1W6Y A;  3WA2 X;  1KD1 4;  2STD A;  3MG2 A;  3IJE B;  2WGO A;  3F7S A;  1D6U A;  3V92 A;  1K73 4;  4X2H A;  2OQE A;  3JUP A;  3PYJ A;  1ISK A;  2BT3 A;  3U97 A;  3M8C A;  3BNB A;  4N6U A;  4QWT A;  3WMD A;  3DGM A;  1EA2 A;  3MG3 A;  1VQ4 3;  1IVU A;  3CCV 3;  3NBR A;  4FCJ A;  3ALA A;  1RN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...