1HL6A

A novel mode of rbd-protein recognition in the y14-mago complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
143
structure length
119
Chain Sequence
AEEFEVDEDGDQGIVRLKEKAKHRKGRGFGPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG8781 PROTEIN
publication title A Novel Mode of Rbd-Protein Recognition in the Y14-Mago Complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signal protein
total genus 27
structure length 119
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hl6A00
4TLQA 2CPYA 2KRBA 1U1KA 2I2YA 1BY9A 3NNHA 3CCVS 1OWXA 3S7RA 1WF2A 2Q79A 2O3DA 2XS5A 3TYTA 5GVQA 3OW2R 2RS2A 2OSRA 2LMIA 1HD0A 2M88A 2JVOA 2DHGA 3J7YU 1U1QA 3NMRA 1YI2S 1SJ4P 4C4WA 3I55S 4UY8T 1YHQS 1SXLA 5ITHA 1RK8A 1X5TA 4IOCQ 3UD4P 1HA1A 5JVGQ 5HO4A 2X1FA 3NS5A 5JVHQ 3U1MA 1WWHA 2DNNA 2HGMA 2NLWA 3RW7A 2A3JA 3UE2A 3IWNC 3G9CA 1JMTA 2YWKA 3U1LA 3HI9A 5EN1A 2ZJQQ 2XS2A 2MSSA 2AYBA 2M8HA 3SMZA 4RU2A 3FEXB 2DH9A 2KYXA 3JB9k 1Q86T 2DHSA 4ERDA 5DDQC 2CPFA 5GMKa 2FY1A 2AYMA 2U1AA 3CXCR 1OPIA 2MHNA 2KT5A 2ADBA 1KQSR 4LMZA 1D8ZA 1HL6A 2YKAA 3MURP 1KOOA 1X4BA 1R8HA 2CQ2A 3MD1A 3CCRS 1H2UX 2CQHA 2M52A 2BOPA 5IFMA 2YH1A 2KM8B 4OZ1A 2E5GA 3VAFA 3Q2TC 1VQOS 2SXLA 1SJRA 4LIRA 3P5TL 1X4HA 1HD1A 2DGWA 1PO6A 4FXVA 5DDRC 3CCJS 1WHWA 3VAHA 2E5JA 5GAGU 4WIIA 2G4BA 4A8XA 5BJRA 2LCWA 1VBYA 1WHYA 4M5DB 1SJQA 1WG4A 3EGZA 3B4DA 1D9AA 1FJCA 2M2BA 2OTJS 1UP1A 2MZTA 1WG1A 2MMYA 5CXTA 3MUVP 2CPZA 2KXHA 3MDFA 2FC8A 2LXUA 2MZQA 1O0PA 3CCQS 5FJ4A 1UW4A 1NJIT 2CPXA 3SXLA 2MJNA 1Q81T 3VAIA 1X4CA 3UCZP 5H1SV 2J76E 1K73T 1YWXA 2KH9A 2QEXS 4Y0FA 1JJ4A 4FXWA 2CQPA 5DM6Q 4EGLA 3CULA 1U2FA 2FC9A 2MQQA 2DNYA 2NZ4A 3P6YC 1N52B 4ZKAA 3EGNA 5IQQA 3P49B 2X1GA 3TO8A 2RNEA 2CPHA 3CPWR 1WEYA 1A7GE 5LJ3Y 3LQVA 1N88A 1FO1A 3H2UB 5GAEU 4UQTA 1YJ9S 2DITA 1AUDA 2GHPA 2PE8A 5LXYA 4WCEQ 2JVRA 1URNA 4IUFA 1M5KC 1OO0B 2HZCA 3R1LA 2DGQA 1M90T 2DHAA 3VAKA 2KG0A 5GADU 1QVFR 4ED5A 1VQ6S 2LA6A 2OSQA 1P1TA 2LA4A 1QVGR 1VC0A 1QM9A 1ZZFA 3L3CA 4YB1P 4Y00A 3PIPQ 1X5OA 3S01A 3CCES 1IQTA 4QU7A 2CQCA 1VQ8S 2RUGA 2ERRA 4WFNQ 4YOEA 2KXNB 3CUNA 1WI6A 4C7QA 1KOHA 2LEAA 4TU8A 2X1AA 3HHNB 5DM7Q 2MQPA 3VAMA 2RT3A 3N9UC 3G6ES 1DRZA 2N3LA 5CYJA 2OIHA 2G1DA 1DBDA 1H2VZ 5CA5A 5LSLA 2DH7A 2RRBA 2L9WA 2DGUA 3THTA 2KRRA 2YH0A 2QA4S 2D3OR 3CTRA 2LQ5A 1YJNS 2MY8A 1Q82T 2I38A 4U67Q 2MY7A 1UFWA 1X5SA 1P27B 2K3KA 5D78A 3BS9A 2N3OA 2DNPA 1X4DA 2CQ0A 2D9PA 2JRSA 2OJ3A 3H2VE 5LXRA 1FHTA 3MI7X 1W2BR 2HVZA 3CD6S 4C0OC 1YIJS 3I56S 3DLLQ 3IRWP 2MQNA 3P3DA 2DGVA 3S8SA 3NNCA 2CQBA 2JX2A 2F3JA 2DB1A 3UCGA 2CPDA 2KFYA 2MZRA 2PEHA 4Z2XA 5IM0A 2CPEA 2MKKA 2MSTA 1X4GA 1VQ9S 2GO9A 3CCLS 1S79A 1X4AA 4WFAQ 2EK1A 3MUMP 1WHVA 5DETA 2DNKA 1WG5A 3VAJA 1VBZA 2D9OA 2KU7A 1H2TZ 1X4FA 2XB2D 2CQDA 2E44A 1A9NB 3PIOQ 1K9MT 3EX7B 2MKSA 4IO9Q 2DGSA 4WFBQ 3G96A 2DNQA 1M5VC 2FHOB 2QFJA 3K0JA 2DNHA 3CCMS 2CQGA 2AD9A 4IOAQ 2N7CA 4CQ1A 1VQNS 3VAGA 2CQ3A 3THPA 2DHXA 5GAHU 1VQMS 1YITS 2VOPA 2V94A 1U1PA 4CH0S 2JWNA 1JJHA 2DGXA 4P6QA 1WI8A 2XNQA 2M7SA 1NO8A 2MGZA 3ZZZA 2VONA 1B7FA 2DNZA 2MZSA 2K8GA 1VQPS 1U6BA 1RKJA 3ZZYA 2RQ4A 1WTBA 2E5HA 2E5IA 1U1MA 2MQLA 2DNRA 2MZJA 1FXLA 1L3KA 4BS2A 2AYGA 3US5A 3FEYB 3G4SS 3BO3A 2KVIA 3UWTA 2WBRA 2MXYA 3NNAA 2DIUA 2MGZB 1VC6A 3BEGB 2CPJA 3MOJB 1ZZNA 2F9DA 1U1LA 3R1HA 1WHXA 4WF9Q 3ULHA 3CMES 1VC5A 1WELA 4OZ0A 1FNXH 1VQKS 1VBXA 1M5PC 2OTLS 3V4MA 4CIOA 2CQ4A 4F25A 2M4MA 3DXBA 2LEBA 1VQ4S 3D2WA 1UAWA 2LKZA 2ZJRQ 2DH8A 1H6KX 3S6EA 4WKRA 2HGLA 2KM8C 2VODA 2J0SD 1ZH5A 2KXFA 1KC8T 3MUTP 5LJ5Y 4PR6A 3VF0B 2DO4A 2MKJA 2LECA 2MQOA 2MZ1A 4YUDA 4F26A 3Q2SC 2DK2A 1WEXA 3J7ZT 3BO4A 2RU3A 1YTYA 4CH1A 2XNRA 2UP1A 1N54B 2RRAA 3UCUP 2B0GA 1FT8A 2DNLA 2XSFA 2DIVA 1DZ5A 2EK6A 5DDPC 2G0CA 1M5OC 4F02A 2MQMA 3B4MA 1SJFA 5MLCV 4W90B 3BO2A 3SDEA 1U6FA 4PKDB 2AYEA 3CC2S 2EVZA 2J8AA 4W92B 2DGOA 2XS7A 2YTCA 2M70A 2MPUA 1K8AT 2CQIA 2DNOA 2M0GB 4J5OA 1YJWS 1JJ2R 5HL7Q 2L08A 3NS6A 3LPYA 1KD1T 2DO0A 2RS8A 2F9JA 2MJUA 5D77A 2RVJA 2KHCA 2HGNA 3SDEB 1WF0A 3MD3A 4QQBA 2DGTA 2MKHA 2DNMA 3MXHP 1DHMA 3CF5Q 3CCSS 2U2FA 2LYVA 4PRFA 2CPIA 1XN9A 2MB0B 5IM0B 1OIAA 3CC7S 1X0FA 2CJKA 2DNGA 3G8TA 1VQLS 2ADCA 4V19X 2KI2A 4QPTA 3VALA 1FJ7A 1N8RT 2MKCA 2N82B 2LXIA 2MYFA 3RW6A 2CQ1A 4LJMA 2M8DB 2KN4A 2M9KA 1F9FA 1WEZA 4QU6A 2ZJPQ 2J0QD 1Q7YT 1SJ3P 4TU7A 2RQCA 3R27A 1NU4A 5DDOC 1U1NA 1X5PA 3UD3P 1VQ5S 1U1RA 1FJEB 2X1BA 2DISA 1M1KT 2FPHX 1PGZA 1S72S 1R8PA 3CC4S 1CVJA 3CCUS 1WF1A 1X4EA 1G2EA 2VOOA 5LSOA 2L41A 1U1OA 4TU9A 2BZ2A 3TP2A 2MKIA 3G71S 2KG1A 2HYIB 3G8SA 1VQ7S 3CMAS
chains in the Genus database with same CATH superfamily
3J81U 5J1NA 5MAOA 1W2IA 2PA8D 2IHR1 3PJXA 2IM3A 2R8GA 1MWYA 3J7YU 1R3NA 3HKZD 1VYAA 4A8WA 4DX7A 4RKUC 1PYOB 1IUJA 1YDLA 4V19J 1K47A 3UD4P 3C6TB 3GJSB 4CI0B 1FESA 1NH7A 1WWHA 2HGMA 3RW7A 3SFGA 4F4XA 3FNNA 3EGVA 4WZQA 4CLKA 1NK6A 2ATCB 2FVRA 3QJPA 4E2FB 4F4AA 3R6GB 1S1WB 4C48A 3VVUA 2Z30B 3TI0A 2WVCA 4K2XA 3UDEA 1T9WA 2YKAA 2VC1A 4KGVB 1KOOA 3PJ9A 4F2SA 1H2UX 2WHOA 3OPKA 4MKAA 2CDRB 3NBPB 3TX0A 4WK3A 1SKSA 1VQOS 1OYDA 5J2PA 3VAHA 4DV0J 5D4LA 1G4CA 1D09B 4MKBA 2OTJS 1UP1A 4X4NA 3MUVP 5DLGA 3Q8RB 2LU2A 1C1CA 2LXUA 4ZP6A 3RAXA 3M4XA 2MJNA 3LWLA 4RJVA 3MPUB 3QNWB 1YWXA 2AHOB 2ZNYA 2K1RA 5DM6Q 1P9QC 1U2FA 2FC9A 2VJVA 2NZ4A 1HNXF 4B3TJ 1X0PA 3K57A 4GRSA 1TFYA 1AUDA 5LXYA 2JVRA 3BR9A 3OL7A 2QIFA 4JI6F 3KJFB 1JLGB 2IMWP 4USUA 4NLTA 1QUVA 3CUNA 4C7QA 1KOHA 4A8YA 2UXDF 2MQPA 1X31C 3KUHA 4FNHA 2XY6A 5T14A 3VAMA 2COLA 1N6QA 3DU5A 3CCTA 5CYJA 4K4YA 1RAGB 4AE5A 2GNKA 4KSEB 1S9GB 3K8VA 5KFFA 1Z2LA 4DX5A 1TTHB 3UNYA 4NEZA 2Q6BA 5L1IA 4MT1A 3QGIA 1TK5A 5C42B 3HFKA 1YK9A 1YJRA 3CD6S 3I56S 3P3DA 2JX2A 3QBCA 2BACA 3UCGA 1RWUA 4Z2XA 3L95X 3DOLA 2HFOA 1O5JA 5DETA 3Q89A 3OTEA 3NY0A 1WKKA 1K9MT 4FPRA 3EX7B 1RBOB 2MKSA 2ZC4A 3PACA 3TEHB 3G82B 1T05B 1S1UB 3IG1A 4DZDA 2V4RA 4I1TA 4MFBA 2DNQA 1RWKB 4ES2A 3MAAB 2HURA 4DI6A 4H4OA 4HHHA 2CJXB 5EUHA 3I0RB 4M94A 3CJTA 3HVRA 3DOMA 4DJBA 3M9NB 2B56A 1P1LA 1S6QB 2XC9A 1P6TA 3MOZA 3UWTA 1HBOB 3UDLA 3CJKA 4K0KF 4FYVB 5D3GB 3VTIA 4OZ0A 3OJUA 2IYIA 5D0HA 3N5BA 2H9ZA 1OY6A 3DXBA 2A2DA 1JB0C 3VVTA 3RBDA 4U95A 4FF3A 2J0SD 3GV7B 3MUTP 1IKXB 4PR6A 3G6XA 4DV2F 2DK2A 4WXOA 3I0SA 1ICEB 5EGYA 4LF4J 2FLPA 1T7PA 3PRDA 5KFIA 4KO0B 2HFSA 2Y8YA 3SI8A 3QT5A 3A8IA 4MYTA 1QSYA 3F44A 5G0RA 1GTHA 1NJYA 2J0WA 1V3SA 4CLUA 2U2FA 1FA0A 2R7TA 2ZE2B 5IM0B 1YBAA 7FD1A 4D3GA 1FJ7A 4J9QA 2H51B 4C3LA 2LXIA 3E51A 5HVFA 2VPWB 1F9FA 1FERA 4F7VA 2XHCA 3MM8A 7FDRA 1BMQB 3GPAA 1NAQA 2YKMB 4CNYA 3K2YA 4JYAJ 4F3QA 2F63A 5KG7A 2LDYA 1S6PB 3SCLE 2EBEA 3TVZA 3G8SA 1F0XA 2GZOA 3EM1A 2I2YA 2C2RA 3QPIA 3WDOA 3C6TA 1AFIA 2AGOA 1HQ2A 3AODA 4KGKA 3I55S 3PY8A 4UY8T 1Q79A 5SUHA 1YHQS 2YKNB 1LNQA 3IRXB 2XLKA 5KFUA 4J9NA 3PJWA 1S1WA 3GR1A 3ZO7A 1JMTA 3U1LA 1TVRB 3ENVA 2MSSA 1HNWJ 2XS2A 2CNLB 5D8HB 1H98A 2DHSA 3I96A 2H5IB 3NBPA 1S1TB 3IAM9 2UU9J 4K5RA 4GO5X 3JAMY 1MG7A 1MWZA 1HWIA 2VKRA 2W7PA 1RAHB 2XO6A 3KHHA 1U8SA 3POTB 1HBMB 3QGPA 4Q8EA 1RAIB 1SJRA 4DR7J 4O0IA 2AEFA 3K5MA 4AUKA 4ZPDA 4WIIA 3JSMB 3MR5A 2GV1A 2VU5A 1T9VA 1TQLA 2AEMA 4F0HA 1XTZA 1I5OB 3ILIA 5HVHA 1Y11A 1TAUA 1SV5B 3SYZA 4FXWA 3TAMB 1RTDB 4YS2A 1JXVA 1CS4B 2AZ3A 1JLGA 4OJHA 1B0PA 1VDHA 4H4MB 1T3OA 4LF6F 4X65F 1M90T 1QVFR 2A2CA 1VHFA 1RP5A 3L3CA 3TOQA 3OJSA 1J5EF 4A47A 1S9GA 1UJ5A 4C8YA 1SH2A 1CJUA 5CCLA 4C9DA 3T5JA 1NRKA 1VQSA 1H2VZ 3N4WA 2L9WA 2AX0A 3HHLB 4YQWA 4CO3A 2MY7A 1ROFA 2VBXA 3IA0A 1XEZA 3DLHA 1RABB 3R2DJ 1R8BA 2MTLA 3OL9A 3R7NB 2KFZA 1NHKL 2GQCA 3KLFB 3LGHA 4ZVSB 3JSRA 3IRWP 2HS3A 4MMOA 1IBKJ 5CZVA 2F3JA 1EKRA 4ITSA 3CJ8A 4MYUA 1BHNA 3PCOB 1KVJA 1S79A 4ZVUB 4WFAQ 4ED6A 3LWMA 2C3YA 2D9OA 1JXEA 3MAAA 2UUCJ 1WUUA 3DRRA 4F4KA 3PIOQ 1N32J 3I0RA 3M9MB 2CWXA 4Y2AA 2QFJA 1HHSA 1S6QA 3MZIA 1KFDA 1U1PA 1KDNA 5KT7A 2C2KB 3NG8A 2WVEA 1HBOA 3TZWA 4DQQA 2VF3A 2G13A 2ASJA 5D3GA 3DNCA 3J7AN 4CLFA 2QYCA 5F3ZA 2NSBA 3M8QB 4DFJA 1IJFB 1WELA 4MIBA 1TL4A 2ROEA 1IKXA 2YQ0A 4LRAA 3V4MA 2EFPA 2F8MA 3FEZA 4KO0A 4RL1A 4NEYA 2MZ1A 1S10A 2RU3A 5KFKA 1TFWA 4U7UK 2VDIA 4DF8A 1H38A 3IM9A 1T3NA 2CVEA 2ZDOA 1XIQA 2MDAA 4BCAA 3LW5C 3VV2B 2B8PA 3NWGA 2ZE2A 2EC2A 1FRIA 1TL1B 4C0HA 4ZCIA 1WF0A 2MKHA 5E2QA 4WYWA 4I68A 3TEGA 2KTQA 3OD2A 2HNZB 2MKCA 4ZPWR 1NKEA 3UI3A 1FDBA 2F4FA 1TKXB 1SJ3P 4QWCA 1S6PA 4EK2A 3CO0P 8ATCB 1M1KT 1JLEA 3K59A 1QTMA 4QIEA 1G2EA 5E33A 3FKBA 1VHIA 2JZ5A 3L7UA 1LK7A 2YKNA 3OTDA 4HDHA 1WKLA 3TUZC 3OTBA 1UWBB 1UEVA 4AQYF 1TVRA 5I3QA 3GIJA 2IMOA 3CJSA 3W7BA 1RK8A 2VDHA 5EHHA 4IR1A 4K4ZA 2LQ9A 4FPIA 1S1TA 1EX8A 3GJTB 2X1FA 1RCOB 2JC0A 2OPQA 4K4WA 5F41A 4LBIA 4J9RA 2ZBIA 3POTA 4PG5A 3PW0A 1MMLA 2FY1A 2U1AA 1YBTA 2R7XA 4CTAB 4YMEA 2YKPA 4QIVA 2XGQA 1D8ZA 2OGUA 3MMCB 4PWDA 3JSMA 2V8VA 4FKXA 4E8UA 2I9SA 4KB7A 2XTJP 2DYAA 4QWBA 5A6WA 4EFAC 2UVWA 1UFLA 3OHBA 1SV5A 4LR9A 1BWEA 1D9AA 1FJCA 1CQMA 3NP5A 3HCXA 3TQEA 3TAMA 5CXTA 1RWWB 2MZQA 3CCQS 3J81j 1RTDA 2GMJA 2FHKA 3QRPA 1CS4A 4RW7B 5A2QU 3RJMB 4Y0FA 3GJQB 3CULA 4DDFA 4NZ7A 1NK9A 3HHKA 4H4MA 2DNYA 4ZKAA 5H9FJ 3P49B 1RT2A 2J7WA 3CPWR 3K5PA 1YRUA 1N5YB 2XCPA 1DTQA 1XNQJ 3RBXA 1UEUA 2RUSA 1ELOA 4LF5J 3B54A 2DPIA 4ANDA 1VRTA 3G2XA 2WVDA 3A8EA 5B0DA 2RUGA 5DG9A 3LUYA 4DUZF 1HI0P 3K8WA 3HHLA 4JI3J 5ETRA 2A1BA 4ZLPA 1R0BG 1RWXB 4ZITA 2G1DA 3GZ7A 3GCXP 1RWOB 4P10A 3KLFA 5ETVA 4DU7A 4ID5B 4JI2F 1NDLA 3ILOA 2N3OA 2BEFA 2UUBF 1RAFB 5H9FK 2HNYB 3JSBA 4MIWA 4J9SA 5KT4A 3MEDB 2AKWB 3GE9A 1NHVA 3KXDA 5KFDA 4K2JA 3T9NA 5C24B 4DN0A 4ECYA 5A0YB 3QIPA 2EK1A 3PEJA 2BJ8A 3TZXA 2HWTA 3N6LA 3BGLA 2R2RA 4JUZA 1BC6A 5DQHA 2QL5B 5LMUF 2BKNA 1VRQC 3SBMA 2E9RX 1YITS 4A4JA 4CH0S 1WI8A 3TUJC 1T03B 4QZVB 2DNZA 3GWCA 2C42A 5D0EA 2JDJA 1HLWA 2ZH2A 2MZJA 3AOCA 2XI3A 3I32A 4LSNB 2V68A 4X66F 4RLEA 3O44A 2VG5B 4G6VB 3JYTB 1VLYA 1I1GA 3ELHA 2RAQA 2Y1IA 1AZSB 1XR7A 1FNXH 3C16B 2R2TA 1EJ7L 2QLJB 4TY8B 4DV4J 2FLOA 4RBUA 3AD7C 3S6EA 4YR0A 1ZH5A 2W2NP 2DO4A 3TA0A 3LANA 3BR8A 1S0VA 4LF2A 3PM9A 1S9FA 5E3CA 4XPEA 3Q0AA 2EK6A 1TL1A 2G0CA 3N6NA 1Q5VA 4IRCA 3VQTA 5BR8F 3TZYA 4ZVQB 3SEOA 5HLFA 2IC3B 5KG4A 3E8OA 4DL0C 3OTOJ 2J8AA 4HVZA 3DGVA 3FZ2A 3MM7B 3LPYA 5ETLA 4FVMA 1KD1T 3DM2A 4ZIVA 4WFZA 2KHCA 3H4BA 4EO6A 3SDEB 5KFYA 2NSCA 3CF5Q 1W26A 2LYVA 1ZAWA 1TR0A 4HL9A 1SL0A 4LBHA 3QGGA 3RZAA 3LP1A 1AW0A 4EO8A 2LDIA 2XM3A 1EARA 3Q8YA 4LSZB 2M8DB 1F1BB 2GC8A 5IWAJ 2RQCA 3UD3P 2AJ4A 1SI9A 3ET6B 2X1BA 4CO0A 1H74A 5I42B 3A3PB 2JL9A 3AT1B 3CB4A 3G71S 1VQ7S 3PW5A 2H4WB 1VK3A 3N01A 1PILA 1UWBA 4RW9B 4N5SA 3H98A 4LVOP 2Q79A 2J8SA 2RE1A 4ZJLA 2C2EA 3IBWA 2M88A 4OJ1A 3SV3A 2UUAF 2C22A 2RF2B 1LOUA 3GIRA 4A48A 5HQLA 4WIQA 4IOCQ 1NKCA 3IBCB 1X9SA 2O66A 1BQNB 3HXMA 3KFWX 5HANA 2XWXA 2J7KA 4WE1B 4CLSA 4PYAA 2ASLA 3MMCA 5D15A 4LF7J 2P8IA 5DDQC 3V6DB 3FSIA 2KT5A 2PGCA 3LP2A 1QAXA 2IA0A 3DCAA 1MNEA 3BREA 2CQ2A 3MD1A 1KTVA 3SSRA 2BOPA 3GYGA 2V67A 2SXLA 4HKQA 3KG1A 3A4TA 3KLEA 3IM8A 4M5DB 2B9YA 2ZOFA 4RW7A 4YN3B 3B4DA 4IFVB 4YDXA 2AT1B 4EUVA 1SBRA 2IVMA 4OJGA 2CPXA 2X3GA 2ZOMA 2CQPA 1Q4RA 1N5YA 3SCJE 3UO0A 2XQCA 1O6XA 2KZZA 4CNZA 3WX8A 2R8JA 5LJ3Y 4F8RA 1HNXJ 1FO1A 3PFEA 2UXCF 5E5NA 2FJDB 4TVAB 4JI0F 4KR0B 4ECUA 4A8KA 4CM0A 1ZAVA 3U27A 2MEWA 1X5OA 4ZN3A 4OX9F 2ERRA 2WB1D 4L75A 2BRLA 5CYMB 5DM7Q 1LW2B 2JLGA 3N9UC 4D3HA 4ID5A 3KHGA 2UXDJ 1J5OB 3OHAA 1NBEB 2HS4A 1B0VA 1RTJB 3MEDA 3M2RB 5D6GA 4ECVA 3BYRA 5C24A 3GYNA 3LGNA 4OZLA 1FFWB 5A0YA 4UZBA 4KH0B 3MCSA 1XR6A 1BWVA 2O1PA 4C8ZA 4K4XA 2G1HA 1N36J 4DL4A 1KQKA 1HARA 1H72C 1X4AA 3PG9A 5KFLA 4USTA 3GFXA 3FCVA 3HP6A 2VD3A 1QTNB 1KQFB 4ILRA 4RBVA 1IWGA 5CZXA 3W9IA 3G96A 1T03A 4XDCA 3K0JA 1BXNA 2HHTA 1T8EA 2RKIB 4A8QA 2HBQB 3THPA 3DRYA 1RT3B 3M30B 4M5HA 2J6SA 3OXFA 5BYRA 4LSNA 2DGXA 3QFHA 4ZOSA 1T94A 2VG5A 4XTTA 1VQPS 1JLCB 1RKJA 3JYTA 1WTBA 4CLYA 1BQMB 1UCNA 2AYGA 1AZSA 3FEYB 3MM9B 3C16A 2QO3A 1U09A 2GMLA 2KO1A 4ATNA 4TY8A 4WF9Q 1S48A 4X84A 4OYPA 4O3OA 1FX2A 2XMVA 2C2NA 1MN7A 5CD4A 1VRUB 5DS7A 3Q83A 4PXDA 4PG7A 3CWJA 2YNHA 2OMOA 2LLZA 2IC3A 4CCHA 3LPEA 3GV5B 2RHSB 3BO4A 4DV2J 5B0AA 2QG9B 2D3ZA 3OXLA 9RUBA 3MM7A 4ED3A 3C66A 3U1NA 2YBVA 3SDEA 3LALA 1AA1B 2FGCA 4DQSA 2BE2A 4CH7A 4OL8A 3R2CJ 4P2MA 3MAHA 3RYLA 3BQ0A 1URRA 2J9CA 4Q0BA 3AJDA 2DO0A 2PIIA 4Y2CA 4GKKF 2AJ2A 3D0HE 5ETSA 2CPIA 4FVCA 4EEYA 3QWPA 4QIFA 3LAMA 5KFWA 3NOCA 2BQUA 2AW0A 3W8GA 2KI2A 3ET6A 1FEEA 4RPFA 4KPYA 1NNDA 3I9V9 2HHHJ 2L9DA 3D6HB 1NK8A 2IAJB 1Y00A 2E1AA 2XMUA 4DCJB 1WD6A 1VQ5S 1HWKA 4QR1A 3LH2S 1PJ5A 2W9BA 3MCNA 1X4EA 1EZZB 2W4CA 3TP2A 2KG1A 1OJ4A 4JV1A 1FE0A 1NJZA 3G86A 1FDNA 2O5DA 2LMIA 3OLBA 1REVB 1NPKA 1U1QA 3U7JA 2HFNA 3OR2B 1CSJA 2AU0A 2R8HA 4WE1A 3W65A 3TJ9A 4NYOA 3M8YA 4LRCA 1TKDA 3V6DA 3E3XA 3PHTA 2ZVIA 3UE2A 3G9CA 2YWKA 2AYBA 3MEGB 3BN4A 4IFYB 3NKYA 1TZ0A 1I94F 1F9EB 2YWEA 4Y65A 5GADI 2W9CA 2B4PA 1JLAA 9ATCB 2GS8A 3PYFA 2NREA 2JHEA 2F8EX 3IR6B 2KB2A 1ZETA 1WHWA 2DCUB 2F7VA 1S6UA 2XGPA 2RB7A 4YB7A 1CEZA 2RSQA 2DRAA 5B09A 2IJFA 5IC4B 2LQ8A 4TYBA 1W7WA 2BBEA 3I6PA 1NK0A 5M2UA 3DRPB 5LOQA 3AQOA 2FTRA 2B3TB 2QJ3A 3D0GE 2J76E 3PHEA 2XY5A 5F9LA 5EWEA 5B0GA 4EGLA 3B82A 2F4VJ 4R0JA 5K20B 3J81Y 3NEKA 4NI2B 3EGNA 4JP8A 4HTIA 2F1FA 4ZHRB 3KDOA 3PV8A 4TNOA 4XPCA 3VCDA 1IQZA 4UQTA 1ZM9A 3ZTSA 3GFZA 3OUYB 3CGIA 3MR3A 2Q1LA 4IUFA 3EDQB 3R5JB 3D5MA 1VQ6S 5CYMA 3AY0A 1P1TA 2E1RA 4X65J 2AJFE 1FDAA 2B8QA 1LW2A 1YRTA 2WSFC 4FDFA 1J5OA 4O3QA 2VPXB 1NZ8A 3I87A 3LGMA 4Y2IA 3HHNB 1RTJA 2RT3A 4F67A 1EQ0A 3DLGA 1DRZA 1J5EJ 2OIHA 3R7BB 1KNZA 4IR9A 4YR2A 3MR7A 4OYOA 2R7RA 3NCQA 4Q7AA 4UF4A 1Y5LB 3H7HB 1P27B 2OI2A 2HEKA 3CJ5A 4EYIB 1NPPA 3N79A 4Y6IA 4DFPA 4FYDA 4NLWA 3D66A 1YGYA 2W1BA 3M2UB 4UQGA 2DGVA 2JEFA 3BQ2A 3EZ5A 3RBZA 3AOBA 4KAIA 3CCLS 4EYHB 2E1PA 2Y0SD 5H9EK 3H59A 4JI1J 2GCFA 2CQDA 4K4SA 1E6VB 5E7OB 3M30A 1RT3A 5GMEA 1W25A 2CQGA 1JLCA 1BQMA 4KBIA 2FHJA 5B08A 4B9TA 2ZM6F 3MM9A 2CJBA 3R6LB 3F0NA 1IJEB 5KT6A 3QT8A 2AJQA 1XMBA 2VICA 4A46A 3W3SA 4DV3F 1HR0J 2B9EA 2BUNA 2MXYA 3MM6A 2RDJA 1VRUA 1FXRA 1WHXA 4IYQA 3AH6A 4L73A 3KLIB 4KGZB 1VBKA 1RT4B 3MFHA 2CQ4A 2M4MA 1VQ4S 1XJWB 2LKZA 2KXFA 4OJ3A 1KC8T 5E3AA 2LECA 1HNWF 4F26A 1S4EA 4H4KC 1Y7PA 2B0GA 2DIVA 2V5HG 5D0RA 1T9UA 4P71A 1M5OC 2BE7D 1FKPB 2DXDA 1KSPA 1Q8LA 4RNMA 4Z37A 2E29A 1RT1B 4BBYA 4EZ6A 3G6YA 2ROGA 1B3TA 2IAJA 1YQHA 3VALA 3EE3A 1RWNB 4N56A 4P7TA 3ZTRA 4MKYA 2JH3A 1QSLA 2ZJPQ 1XK8A 1SKWA 3FUYA 2YNIB 2B6AB 3MM5B 1U1RA 1X60A 2CRLA 1VK8A 2ZH9A 4P2XA 2CNNB 2HBRB 3GILA 3SQGB 2FGOA 3H5XA 4RUBA 2UVRA 3I4PA 1REVA 4ETZA 3OR2A 4KKOA 2J6UA 2FJXA 2UXBJ 3NMAA 4OI2A 1OWXA 5DRKA 2O3DA 3R8YA 3KYLA 3TYTA 3DN9A 1TKZA 2XZWA 2WB4A 3QZ7A 4FYYB 5HQMA 3MEGA 4IFYA 4AQYJ 2ZUGA 3BPSP 4AXJA 2XMAA 2QC3A 3BSOA 1VS3A 2R8KA 1FI4A 3M6XA 4O23A 4J9LA 3T1AA 3A12A 1QDUB 3CO9A 2UVUA 2BE9B 4ECRA 2KKHA 5GMKa 4K59A 5U47A 1CLFA 3HF5A 3TA2A 4LMZA 1IR2A 3GFHA 2K7JA 3KLVA 3VAFA 2ZOGA 2YPYA 3JQMA 2RDIA 4A8SA 4EZ9A 2H1YA 1NH8A 1WHYA 3MCOA 2ASDA 1ITPA 4GVLA 2MLZA 4OYMA 3KJVB 3EYZA 2HHSA 2UUCF 2M2BA 3QSYB 1N32F 1VGYA 4CO2A 2V4JA 4JBCA 1AT1B 1Q81T 4NI2A 2DR9A 4I67A 1X4CA 1BLUA 1E6YA 4F3MA 4ZHRA 5AXNA 3PO5A 4ZVEA 2J9DE 4ZA1A 3KWMA 4LF8J 1RE1B 1ZOTA 2CPHA 5DG8A 2DXFA 5GAEU 5CQGA 3EVMA 1ZYQA 5K14B 3R1LA 1CULB 2KG0A 3K7RA 1QVGR 2FJVA 1PBAA 5T41A 1RAAB 4YB1P 3IS9B 1RWVB 2QLXA 4ZLLA 4WTOB 2FQQB 4WFNQ 2LEAA 1KFSA 2PMZD 2IDEA 4DUZJ 3HKWA 1FD8A 4WWSA 3QIDA 2LXFA 3OL8A 4OI0A 4NLOA 5HVGA 2PO4A 2UV8A 5F8HA 2D3O1 4OV6A 4IOBA 1U4BA 1UVNA 5ETNA 4FF2A 3ITHB 1CJKB 1SCJB 2LQ5A 2MY8A 3EXCX 2OHDA 1UFWA 3M2UA 2UUTA 1M1GA 1X4DA 2CQ0A 2OJ3A 1UVJA 1CPZA 1T9XA 1FHTA 4DF4A 1S1VB 2K7KA 2EI5A 4ANEA 2CPDA 1E6VA 4X64J 2GO9A 4CDIA 2IJRA 1UVLA 2K3IA 1WHVA 3MR2A 1F5BA 1OY8A 1NPRA 1K0TA 3VQSA 2CG8A 3VGTA 4DZ6A 2NS1B 1SQGA 4XIUA 3QJLA 5AE2A 4F4YA 3HSGA 2RMLA 3VAGA 3NAHA 2CQ3A 2V8DA 1JJHA 3V4IB 4DOZA 2WTFA 3CJRA 2QL9B 1JLFB 3CJQA 2DNRA 3KHRA 3KLIA 1RT4A 1M0SA 1UWAA 3PEHA 3MOJB 1ZZNA 2I8EA 2HHPA 3ENWA 5IC6B 2BQ3A 4ZS6A 3M6VA 3FDSA 2HFZA 4CRJA 3I4HX 2WOMB 4WK1A 2W4DA 1HYSB 2VH7A 4DSIA 4CIOA 2KHDA 3DDKA 4F25A 2J7UA 1H6KX 5KFPA 2KJWA 3VZIA 3JS9A 3MEEA 1LQ9A 2CAJA 4WKYA 2MQOA 2WSEC 2EFOA 5KG1A 2RHQB 1A0OB 1R6VA 3DMJB 5K5MA 4RNHA 1FKPA 4USMA 1DZ5A 2H65B 1RDRA 1FRMA 3HHDA 4USKA 5MLCV 1HPZA 2V9KA 2EVZA 4J5OA 1RKIA 1VIOA 5D77A 3MD3A 1UJ4A 2HK3A 5C5JA 1C0TB 2QZ8A 2CJKA 2FVQA 5E41A 2ADCA 1HBUA 4DS4A 2YNIA 2B6AA 3MM5A 3MPVA 2BV3A 2QTWA 4KFBA 4JV2A 2CZ4A 1U25A 1N34F 1X5PA 5F8JA 1FJEB 1IXKA 1S72S 1IBMJ 2ZBQA 2C3UA 1RSCA 5LSOA 1B7YB 2Y0BB 1GNKA 3W61A 1D8YA 3BGRB 4CO4A 2V50A 4RNFA 2OELA 3A3OB 4FF4A 1KN6A 1WF2A 3BJYA 4LF5F 2RS2A 4ECQA 2HLUA 1WC4A 4DSEA 4JI8F 4JOUA 1R8AA 1RHQB 2Y1LB 2DR6A 3M6WA 1ACMB 1S1XB 4Y28C 4P9SA 5CHCB 5JVGQ 1I6JA 1U49A 5A8RB 2P9GA 2B5JB 4JI3F 3M2VB 2M8HA 4CLZA 1H0HB 5KFHA 2V0NA 1S99A 2OEJA 5CH7B 2DXEA 2DBBA 4B3MJ 1X4BA 3CCRS 4IG0B 5ADZA 2W2PP 4LQ3A 3NCPA 2HWHA 5IFMA 3KJVA 5A8KB 3Q8QB 4OYIA 2CXEA 3HO1A 4NMXA 3KJQB 1SJQA 1GQEA 4J9VA 4YEAA 2ZWOA 2P9CA 1LWXA 5EDWA 4KT0C 3T6JA 4LBPA 4OZ3A 3SXLA 4PPDA 1RTHB 3A8JA 4S0MA 1UVIA 2GHWA 3AXKA 2WRMA 2QSFA 3FBFA 3FQLA 4F2RA 1IN0A 1U26A 1N0VC 5K14A 4DPWA 2D74B 1U2CA 3NRBA 1V6HA 3G6VA 2LFVA 1CULA 4I0WA 1SJ1A 3TQ1A 4NMLA 4N47A 3FFIB 1MMNA 3BM7A 2IPOB 4OZJA 2HKEA 2ZFHA 4FS2A 4ECXA 3TANA 4EWTA 1U0SA 1M5KC 2DGQA 4JI0J 4CLLA 1FRJA 3HVWA 2XMTA 2Z2MA 3AHPA 4ZJQA 2Z2LA 2Q43A 4OI6A 3EXYA 4F50A 1TUWA 3ITHA 4DV4F 4URGA 1TAQA 2L9NA 5A76A 4NLQA 1PSDA 3ETMA 1AFJA 2DGUA 2GA7A 1PJ7A 2J5AA 1S1VA 2XHWA 4FZVA 2I38A 2DT9A 1X5SA 3BS9A 3VGVA 1HI1A 2DNPA 4F4WA 1RISA 2HZAA 1P8GA 2HVZA 4ZPBA 4KRWA 1YIJS 3M8ZA 1VISA 3W2WB 2MKKA 1IM4A 1VQ9S 2V2QA 4UY85 4YB5A 3G8QA 5KFSA 1L3TA 5A2QY 2E44A 4OX6A 1UJ6A 1RTIA 1U24A 3ENAA 3OFHA 4WFBQ 5IWAF 3V4IA 1B0TA 1VQNS 1JLFA 3BDEA 4ANCA 4OHXA 5D4OA 4C8NA 2IDLA 4QOTA 2AGPA 3RG6A 3ZZYA 4ER8A 3GSDA 2V9WA 3N28A 4RNNA 2E5HA 1U1MA 4YP3A 3OVAA 2WOMA 4J37A 2MGZB 3BEGB 3KG4A 3PYDA 4DV6F 3R5GA 2HWIA 3HT0A 5J1EB 2OTLS 3HZGA 2DJWA 2BABA 4K7QA 3DMJA 3D2WA 1EP4B 2AIRB 2J6TA 4BDPA 5C2GA 4ELVA 2E5LF 4RNOA 4DSKA 1H7WA 2MKJA 1F3FA 3MMJA 5B0FA 4NLVA 4LFBF 3DLKA 3LP0A 1YTYA 4LF7F 1PG5B 2W2MP 4DQPA 2BJ9A 2I5JB 5DDPC 2ZITA 4W90B 4ILLA 3AJ2A 5EX3A 3T3FA 4A8MP 4NA1A 5CCMA 4TN2A 1YJWS 1C0TA 3FMBA 5HL7Q 3WIUA 4M63A 2ZH3A 4GKKJ 4O3NA 4OZ2A 3TW0A 4C11B 5J2MB 2KN4A 3GR0A 4C97A 2WZ1A 2OEMA 3J7Z5 3VZHA 2GAHC 5BYQA 1X9WA 2KDOA 3IMQJ 4RX6A 3CDUA 1F2HA 3PRBA 1G6BA 2FJEB 2Y9HA 5G4DA 2W01A 1RWPB 1U1KA 4QYZK 2VQFJ 2CIMA 1VI7A 4U6PA 1EHWA 1S1XA 2CNKB 3BBBA 5A8RA 2FJBB 2B5JA 1IKYB 3M2VA 3H25A 2XMMA 3HM9A 5KFAA 4RW4A 1VIXA 5HMXA 2K2PA 2JEGA 3Q22A 2BA9A 3HD1A 2NLWA 4J9UE 3PZPA 1Q95G 4RU2A 2WVBA 1ZAXA 1V3RA 3JB9k 4URQU 1PBUA 4IG0A 2V34A 5K8NA 1JLQB 1I94J 5A8KA 3MMBB 3FQKA 1JLBB 2V63A 2HFVA 4ZVOB 1HL6A 2AGQA 1WORA 3W5YA 4JI4F 3NGTA 2CQHA 4OI4A 4B9NA 2M52A 2KM8B 1G7CB 3P5TL 2YQ1A 1N36F 1PO6A 5E0OA 2HQCA 1FXDA 3WZ0A 5GAGU 3BKFA 5HQ8A 1RTHA 3NLCA 2MZTA 2MMYA 3CD7A 3CDAA 5KFXA 5K8OA 3MDFA 1LWFB 1L3VA 3GIIA 2EFQA 4P7VA 3VAIA 1KKHA 1YRXA 2QEXS 5HN0A 4IQMA 4LUBA 2BJ1A 3EVWA 2MQQA 2R42A 2BVZA 1HNVB 4X4PA 4FYXB 3TO8A 2MLXA 1CC8A 1SQFA 4C8KA 1N88A 4YY3F 2J9DA 2PE8A 3UW1A 4CYUB 4ZPAA 1N0UA 1TMMA 2OPPB 1PAEX 3GLJA 3ZZ0A 2WAQD 4DUTA 2W9AA 4NLUA 1Q16B 3CNQP 2VL1A 1I51B 4TU8A 4K5SA 2X1AA 4DMZA 3D28A 3H5UA 5FDLB 3NGKA 1FTRA 1SIZA 2BW2A 5KFVA 2RRBA 2HVDA 4P73A 1RHUB 1B99A 4X4OA 3IAS9 2YQ3A 4ECSA 2GJFA 3OXGA 3FVYA 3HT3A 3W2WA 3C46A 5LXRA 1DQ8A 3DLLQ 3S8SA 2X7IA 3W62A 1K1QA 4DL3A 1JX4A 5K9FA 1FVQA 1EETB 5KT5A 1NKBA 4YHHF 4WJBA 1YG0A 3T6BA 1WG5A 3DLEB 3D68A 4J7CA 4TQSA 2NXCA 2VPZB 4BWJA 4O3SA 1RXOB 3BGFA 1BGXT 5HSPA 3EICA 2HHHF 2NXJA 5CD4H 5E3QA 5K8PA 2BM1A 5ETOA 4CQ1A 3F73A 4USVA 2JLEA 2JWNA 5SZTA 4KGMA 2MGZA 4CT9A 2ZM6J 3Q8VA 4I2PB 2HIYA 3X3UA 4BS2A 1Y4ZB 4G65A 2MLYA 5HMYA 5J1EA 2DIUA 4DV3J 3QATA 1IWAA 3KTQA 1EP4A 1LFPA 3GTYX 2ABYA 4ID8A 2VV5A 4RUHA 5KT2A 1TV6B 2YX4A 3GB0A 5THWA 3R3TA 4N8NA 4C3KA 4FF1A 2ZH4A 4KH1B 3C2PA 4P72A 2B4OA 2I5JA 1RACB 3OFEA 4YUDA 2HQ3A 3AOAA 4KHRA 1RHMB 1PIEA 3MTJA 2MQMA 4X4RA 1U0HB 4B3SJ 3BO2A 2QSWA 4OZNA 5ETQA 2L08A 4IH5A 4DR5J 2RVJA 5JMNA 2AWZA 2HGNA 4C11A 5J2MA 2WBMA 3Q8SB 2XLIA 2BJEA 2RILA 4DSJA 1IR0A 3UVJB 1B70B 2JSXA 2IRUA 2VZ9A 3CVKA 3CSKA 3QT6A 2VA3A 1MN9A 4F04B 4QU6A 2J0QD 1ZA1B 1CC7A 4IG3B 1U1NA 1XMQJ 2EFGA 3W2VB 4PWUA 2HHUA 2F4VF 1PGZA 3CW2C 2V2ZA 3CC4S 1CVJA 2K06A 2BKOA 2PMHA 2EG1A 3BYPA 4HACB 3KK2B 4USHA 4XAKA 5B0EA 2HYIB 1IKYA 5B0CA 2FVPA 2CWKA 1SVDA 4QYRA 3WHIA 4L74A 4ZJOA 3HHLC 2OFGX 2AJ1A 3MPDA 4MK7A 3OSNA 3DLJA 3IR7B 3H42A 2AX1A 1TP7A 4NPOA 3K5NA 3EWGA 4W98A 1F60B 2C2DA 2EXUA 5IQ6A 3O3LA 3FCWA 4X4UA 1JLQA 1O51A 3IWNC 5KFZA 3MMBA 1KTQA 3HI9A 1JLBA 3L7PA 3EMTA 4NX9A 1KRPA 4LIWA 2FZKB 1Q8KA 4O3PA 5C42A 1RHJB 2J9EA 2YX7A 2NPFA 3PYGA 2RIJA 3N6MA 2W24A 1DY3A 1RU2A 2RQMA 3RGIA 2ZKUA 2OO4A 3LTOA 1VBYA 1S12A 4DV5F 1NK4A 2H54B 2ZBCA 3G82A 4C8LA 1T05A 1KHVA 1S1UA 1UVMA 4JI1F 1RT7B 1MW7A 1L5UA 5T7LB 1N5SA 4RW8B 3QRQA 5FJ4A 4ZVHA 1HNVA 4O0NA 3T5KA 4USJC 3UCZP 1PKUA 4E0DA 1S4FA 1WSVA 1V9OA 5JUMA 4HI2A 5L38A 4AXIA 4EBCA 1WEYA 1LWEB 1A7GE 4HR2A 2OPPA 3NXZA 4DR2J 1C4CA 1HKAA 1HR0F 3BKUA 4E98A 2VIHA 4ZN1A 5KFJA 2HPUA 1ZZFA 2YPZA 2L3MA 3Q8UA 4B17A 2C2MB 4K4VA 1U2RA 5FDLA 1C1BB 1IBLJ 4NASA 2XMKA 1NXIA 1QAJA 1S0NA 2DCLA 3DHXA 2VBWA 1TL7B 5CA5A 2DKOB 1SUQB 1XR5A 1Q82T 2VBYA 2PI4A 3PR5B 2YWGA 3CDBA 3NWRA 4WBFA 1WOSA 1YJVA 4PZVA 3MI7X 2OD4A 1R31A 3H90A 3DLEA 2BJDA 4FNIA 2JLFA 2CQBA 1YJUA 1AYEA 2PEHA 4NLYA 5IM0A 2CPEA 3W66A 2MKYA 2ZDPA 4C98A 4K4UA 5J2PB 1FK9B 1VQYA 1D1UA 4XDDA 5J2QB 1FKOB 3DDIA 2YKMA 5AXKA 3R5CA 1C1CB 1UTAA 3O1LA 4I2PA 4DQIA 4IOAQ 5KG0A 4L3KA 3WX4A 2ACMA 3HHLD 4KC5A 4RUAA 1QJHA 1NK5A 2M7SA 2VONA 1ZPWX 2CA9A 2MQLA 4Q45A 5J2NB 2W7AA 1Q7LB 3G4SS 3BO3A 2KVIA 2UXBF 1F3VA 2P9EA 1U7LA 4PCQA 3R1HA 1RYSA 3IRXA 3FGVA 1WC3A 4DR3J 2XLJA 1Q8IA 1PYTA 1G1XA 2NYIA 4K8RA 2LEBA 2JEJA 2X3DA 4DL6A 2LQBA 5L1KA 1DARA 3VF0B 1U0HA 2PT0A 2GAGC 4I69A 5E3PA 4ILMA 2APOA 2BMBA 3J7YI 3A13A 1HBMA 2GO8A 4W92B 2PC6A 5CYQB 1KLMB 1SH0A 1T9TA 2DNOA 4NZ0A 1S49A 5DQGA 5KG3A 3VWSA 2IIHA 3UR0A 1FRHA 2ASYA 2OKQA 3RRGA 3CC7S 3RB3A 4B9SA 3OR1B 3KNGA 4IG3A 4QPTA 1SH3A 2FZGB 2VG6B 5LT5A 3E01B 1WEZA 4WTYA 2YX1A 1D9DA 4BC9A 4TU7A 4GVBB 4HACA 3V6KA 3KK2A 3SCKE 1UPMB 4MFBB 4DQRA 3NAIA 1N34J 3KOAA 4LF8F 1WDTA 4H4OB 2IJNA 1S57A 1VJQA 3L4BC 2ILZA 4Z7YA 4DX8H 3FJ2A 3GIMA 2FJWA 2V8GA 5CABA 2FY8A 2KFNA 3IFEA 1QLNA 3HX9A 2BANB 1IM6A 3NMRA 2EPIA 5HMZA 1B4SA 4C3MA 4Q44A 4L72B 4JI8J 1HA1A 4Q2LA 4DSLA 1JJCB 3GQCA 3H40A 4RR5A 5EN1A 1MLAA 1JNRB 4L6V3 1RHKB 1WNEA 5HROB 2Q3PA 2DH9A 3L9ZA 2VPYB 3GYXB 3MMAB 1Y3KA 4IO1A 5HJYA 3I0SB 2C3MA 4OLPA 5FLXU 1R8HA 3D54A 1FFSB 1SL2A 4U7UD 2BJ7A 2MQ8A 2E7VA 1GMUA 2E5GA 5L39A 1NEEA 4R0EA 1RT7A 3AQPA 1HD1A 1WC6A 3UN3A 4X64F 1HHQA 5G0RB 2Z8QA 2C1EB 2HHXA 3SCIE 4HHUA 4ZVFA 2NXUA 1L3SA 1TU0B 2AF6A 3CT9A 1FCAA 3KMSA 1EKSA 5GMDA 5EWFA 3BH7B 5GAGI 2HS0A 3I5BA 1XC9A 4Q8FA 4BLGA 3OVBA 2XULA 5CAAA 3T5LA 3ZZUA 1VJWA 3NGRA 3M32B 2E7WA 4DWIA 3H2UB 3M8QA 2R7VA 1NSAA 2UVVA 1C1BA 3V5RA 1OO0B 3KK1B 2YNGB 1RBLA 3B8HA 1Y0HA 4Y00A 1TL7A 1GT8A 1FF2A 2GGPB 7AT1B 3QGHA 2AZ1A 1S5ZA 5KOXA 1SUQA 1SIWB 4ZPCA 2EW9A 2N4DA 3W64A 3EZUA 3FSXA 4NCBA 2KRRA 2D3OR 3GONA 1IKWB 2E9TA 4QPXA 4LF1A 2ACYA 1DJ0A 3H2VE 4KYZA 4CO1A 2OMLA 3FCHA 4MTPA 1FK9A 1J2VA 1VFJA 2DR7A 3O2IA 3C8YA 4C2MA 5ETPA 3DXSX 5J2QA 1FKOA 2HNZA 4EMDA 1CG2A 1Y9OA 2UUWA 4YFUA 1UKUA 1X4FA 3ADAC 4N41A 4TYAA 1TKXA 1LV5A 2UV8G 8RUCA 1Z2ZA 3AA9A 1NM2A 3THVA 2HQIA 3R5BA 4M5LA 3T1YJ 1F5AA 2V94A 5J2NA 1IBMF 4U8YA 2XNQA 1S77D 2K8GA 2RQ4A 5KG2A 4FBTA 3US5A 1SKRA 2JNJA 4KQZA 4PG4A 5A8WB 3AA8A 4FN5A 1UETA 4X4VA 3NNAA 2HNDB 2W7OA 1N33F 4ALZA 1C0UB 2EKNA 3PDNA 3OL6A 3LOUA 2CJQA 2V8PA 3GG0A 5IT9U 3CMES 1VC5A 4ZCKA 1RT6B 3TA1A 3RBEA 4DV6J 1T9YA 4WKRA 2CZVC 1H3DA 2E5LJ 4B02A 3Q2SC 2IVYA 2B51A 1CJUB 4CTAA 1PYSB 5CYQA 1KLMA 5F8GA 4LFBJ 5FD1A 3PNIA 5AT1B 2B7BB 1SJFA 4AD6A 2OAUA 3C15B 4PABA 3ILLA 4B3MF 1RGVA 3A8KA 4ZLNA 3O5TB 2W8KA 3OR1A 1T02A 2YWHA 4G1PA 5LSRA 1DHMA 2VG6A 2UZAA 3E01A 4KTQA 3JQJA 1X0FA 2YY3A 2RU9A 4GVBA 4KPCA 3J80U 1VQLS 2C3PA 4U9RA 1UL3A 1SL1A 2CQ1A 3DRRB 3MFIA 3DRSB 4N76A 4MKVA 3DGPB 2HAFA 1FE4A 4LF9F 2DTJA 3BGUA 3UFCX 3CCUS 3FRZA 1U6ZA 3UQSA 3RB0A 2BZ2A 2HG4A 2MKIA 4J90A 2BANA 2CVIA 4FS1A 2YNFB 1ZM4A 1GK8A 2CPYA 5IS2A 3NNHA 3S7RA 4PQUB 4KHPF 3CD5A 3OW2R 1QE1B 4LSLB 4C4WA 5HROA 3CMQA 3QMQA 4DLEA 4P2FA 3FSYA 3MMAA 1FKAF 1YX2A 4M5GA 4ES1A 3QYYA 4UOCA 2KYXA 3KG0A 1XWLA 4ERDA 4OIXA 2D41A 2HNYA 2AYMA 4DX6A 2MHNA 5I3UB 4LFCF 1Q5YA 4OI1A 4AL5A 4J9PA 3I5AA 3PRVA 4JI4J 2R7QA 4USIA 2NUHA 2DGWA 4CLPA 3DKDA 5BJRA 4J9OA 4CLTA 3BSCA 3W5XA 4AT1B 4YB6A 4XO0A 2O67A 2FC8A 1OSCA 5KFRA 5M2PA 1QY7A 3M32A 2QL7B 1LEOA 4ZIWA 1N52B 5BYSA 3HDSA 4JI7J 3KK1A 4DLGA 4DV7F 2YNGA 5HATA 3HPOA 1JLEB 2VKZG 4WCEQ 4YY3J 2GGPA 3CIZA 4V1Ak 4H54A 1HQEB 4ED1A 3HSJA 1J27A 4ECTA 1QM9A 1S0MA 3FRYA 3AB2B 3JSYA 4QU7A 3KK3B 2DHHA 1U8WA 4JB8B 2FIUA 4ICLB 2XSJB 4RWXA 4R5PB 5DG7A 3G6ES 1IKWA 1DBDA 2Q6CA 4NLSA 3HZEA 2QA4S 3MAQA 2LQJA 3EUNA 3CEDA 4M5JA 2FHMA 4U67Q 1BD6A 4DHVA 1RQ0A 2OPQB 2A0FB 1V3ZA 3K58A 4I2QB 2ZEJA 4ELUA 4IH6A 3TVYA 2FLLA 1C2PA 2GVDB 2DB1A 4PWDB 2MZRA 3U02A 5AJ3J 2MSTA 4ZP7A 1RAJA 2HVHA 4QIGA 2ALZA 4YHHJ 2XB2D 2EEYA 1A9NB 1FWPA 1NDPA 5HMWA 4OHZA 1S59A 3Q23A 4PPZA 1GX5A 1REGX 2CJ9A 4QWAA 3ONQA 2CFXA 1ZBTA 1IR1A 1HIYA 3KKFA 2DNHA 5E3RA 3VHQA 3EDRB 2N7CA 5I42A 3L7OA 1Q8BA 2VOPA 2QE5A 1NHUA 5A8WA 1FJGJ 2HNDA 3UN5A 1C0UA 4RW9A 4HH0A 3UDVA 3J7A1 3PKYA 1RT2B 1TKTB 2HBYB 3QQCD 3L09A 2V2VA 1RT6A 4G1QB 4NA2A 2VQFF 1DTQB 2RF2A 1TUGB 1WC0A 4B3OB 1JIHA 2OD6A 1RBAA 4X4TA 5KG6A 5KOWA 5F8IA 1VBXA 4EI2A 5AE3A 1VRTB 4KY3A 3ETOA 1NJWA 1BQNA 4DPOA 2ZJRQ 2XMJA 2RH3A 2VODA 3EGWB 1M5SA 3GFYA 4HEA9 3C15A 3J7ZT 3W5ZA 1KWMA 1N54B 1TK0A 3AJ1A 3UCUP 2P6TA 3B78A 2ZHOA 3GP9A 1ZA2B 2XMWA 4F02A 2ZZMA 2H5EA 2VASA 2BM0A 3NL0A 3PXGa 4MJKA 4Y2MA 2FHJD 2G2ZA 2M70A 2XCAA 5KFNA 2KZMA 4M5DA 4RO0A 1K44A 3BV8A 2MJUA 3F56A 4C6AA 1LWCB 4IFVA 2DNMA 4WP3A 2MB0B 3BQ1A 4KHMA 4QW8A 2C2ZB 3DRSA 1UZDA 3QIPB 4OLOA 3RB4A 3DGPA 4NYZA 4B08A 4LJMA 1DQAA 2XY7A 3DU6A 4NCGB 2M9KA 4RWWA 4ZVTB 2DD8S 3R27A 5DDOC 1MWQA 4XK8C 3R5AA 1GMWD 1T0TV 2NYHA 2PDAA 1FD2A 2YNFA 5D4PA 3HMJG 1LFWA 2VOOA 2EWHA 2L41A 3OFGA 4DR4F 4PQUA 3D3CJ 4ED7A 5L1JA 1QE1A 4LSLA 3CMAS 3GSIA 4DCOB 2ZH8A 3ZTQA 4NLDA 2F5GA 5DLFA 1RT5B 1KVKA 1R27B 4DL7A 2ZD1B 3D4JA 4FBUA 2A6MA 1R0AB 2NUUG 3W1YC 4CP5A 3QO9B 2PN6A 1FWKA 5H9EJ 3JTNA 3V6HA 2FVCA 2M5YA 2OUGA 3EPIA 2PFFB 1IVZA 1TL3B 3TAQA 2IM2A 3M2RA 2ZJQQ 5I3UA 3SMZA 4X4SA 2Z56B 3M8SA 4FXDA 2HQDA 3ISZA 3BZQA 1KQSR 2ZH5A 4CWBA 2YH1A 1RCXB 5HLFB 1Z1ZA 4ZPVR 1FTCA 3M05A 1O8BA 3BKTA 5DDRC 3CCJS 2BQRA 1PAUB 4A8XA 2Z0GA 3DM2B 3FZBA 4DV5J 4DBQA 4ED2A 2XO7A 3G87A 1HNZJ 1EB0A 2POKA 5LM7E 3LP1B 1NJIT 2RKIA 2ZH1A 4N77A 2DRDA 5H1SV 3QWUA 2VHGA 1JJ4A 2V6AA 3K17A 2D3UA 2ATLA 4DL5A 3HJFA 1HQEA 2AP6A 3NGSA 4PXCA 3LQVA 1DAXA 1YJ9S 2ZVSA 3IBFB 3KK3A 4I7FB 2GHPA 3I82A 4ECZA 1T11A 3BDPA 1VCTA 3AD9C 5GADU 2OSQA 1HNIB 4UW2A 1YBUA 4ICLA 1VC0A 2XSJA 1R43A 2HLTA 3PIPQ 2HRYA 4R5PA 3WC2A 3DFEA 5IXUA 2CQCA 1OPZA 1RWMB 1TL5A 5F0UA 2ZZTA 5HI7A 2XEXA 2RJZA 1GMWA 3CJ4A 2N3LA 4B3RF 4I2QA 2VFVA 4FKYA 2YH0A 2R2SA 2RRNA 4AL6A 5D0GA 3CTRA 2HFUA 4LFAF 1UVKA 4F0MA 2Z57B 1KLNA 2HRTA 3MPWA 3CCZA 2W8LA 2GVDA 1PJ6A 2D9PA 3H5SA 4J9MA 4B3SF 4YR3A 1RADB 4Y34A 6FDRA 3DYAB 2HHWA 3LP2B 2A6OA 1GEHA 2KFYA 2Y1JA 4DR5F 4PUOB 2E1CA 1F6TA 4X4QA 4NLXA 1Q0NA 2HAIA 4QW9A 4X62J 1ZM2A 3NS7B 3KLEB 2GHVC 3SFUA 4UT4A 4IO9Q 3CCMS 4PXBA 2QX0A 5KFTA 4G3IA 1XMQF 1FDDA 1AROP 2AMCB 4IH7A 1VQMS 1TKTA 3WC0A 2OFHX 1R7IA 4JI5J 4G1QA 1SC3B 5HJXA 4OHYA 1JWWA 1VLOA 4B3OA 4ETXA 2HBZB 2CZ9A 1NCLA 1XERA 2XYGB 2VFUA 1S9EB 3M8RA 5C2CA 1A6LA 4DV1F 3LF0A 2F9DA 4M1KA 4R8UB 3ZZOA 2R8IA 3ULHA 2X51A 1RZMA 3TR5A 4IDKB 3TAPA 2DH8A 3MWBA 3TZZA 3RR7A 2KT3A 2N4CA 3EJMA 3Q8PB 3UD5A 4DFMA 4ECWA 1UFKA 2FB0A 4Y2KA 1Y3JA 2VJUA 2NXEA 8AT1B 2UP1A 1FT8A 1NSQA 5I3PA 4IKAA 2XBPA 3QSIA 2FYXA 1LWCA 3OBIA 4QJVA 1YVFA 4MK8A 1RHRB 4B9VA 2CQIA 2W25A 2G2OA 3BGOP 3ZTOA 2F9JA 3MCMA 3AD8C 3UPFA 3MPYA 2OPSB 4QQBA 3QLHB 2DGTA 2WK4A 2DR8A 3V2UC 3DRPA 4NCGA 1RTZA 1OIAA 3G8TA 3T1HJ 1RA7A 3QRRA 3A1YG 1OSDA 4JV0A 5L1LA 1R6YA 5IOLA 1TK8A 3RR8A 1ZM3A 2NR0A 3CDWA 1GH8A 3DC2A 3KLHB 1HW8A 1UW9A 1WDDA 3C3LA 3BN7A 1R8PA 2CYYA 3BPDA 1RT5A 4QBUA 1WF1A 3TNVA 2GVZB 2B4VA 3OUYA 2ZD1A 4DR2F 4U7CA 1R0AA 2G0JA 2KRBA 5JJBA 3QO9A 4L3NA 1BY9A 1EQMA 1XNRF 3C6UB 2BYCA 1RAEB 3V6JA 1I3OB 3JTOA 3DRXA 1HD0A 4OV1A 4I6AA 2JVOA 3OTCA 1SJ4P 1WC1A 1TL3A 4UUWA 3HSDA 1IBLF 3BBFA 4HYKA 3MEKA 1UMJA 4F3OA 4KV8B 4JV5F 3U1MA 4O44B 2DNNA 2QLBB 4PAAA 3VGUA 5AXMA 5AE1A 1DFDA 3KHLA 2Q66A 2LVWA 1Q86T 2WW8A 4B9LA 2YNHB 3QAUA 4O4GB 3CXCR 4OX7A 5C25B 1IKVB 5F9NA 5B7WA 2VFSA 3OFFA 4M8LA 4ZCLA 4M95A 4OX8A 2D1CA 1GTEA 3Q2TC 1HWLA 2BE2B 4FXVA 2VFRA 6AT1B 4GKJF 4Q0BB 2XYHB 1NMEB 1WG4A 4OYZA 2EFNA 4M5IA 4FYWB 4OZ5A 1Q53A 4NXNJ 2XI2A 2KL8A 2PSZA 3TARA 3SV4A 1AXQA 2JFKA 4ZVRB 3RU0A 3T9ZA 4UOGA 4I7FA 4NRUA 1LXJA 2IY5B 3HHEA 1HNIA 1CJTB 2W9BB 5EX0A 2AQ4A 3GIKA 3GMGA 2HZCA 1LKZA 1ZPVA 3VAKA 1AUSL 3M8PB 3ZXWA 4ED5A 3A3NB 4OYWA 2QYGA 1KP6A 1NB7A 3MF5A 2FLNA 1IQTA 1KONA 2HQGA 4NOHA 5KFOA 2GMHA 2KXNB 1WI6A 4DR3F 3K5LA 2P6SA 4KIAA 5KFCA 3VGSA 4UOHA 2ZKTA 2BX6A 4HI1A 4CLWA 1JKHB 3D1OA 1YJNS 3DYAA 1HWJA 1P9YA 3W8PA 4IRDA 3KJNB 5D78A 2HHQA 2P5VA 3HVAA 4PUOA 2JRSA 4HDGA 5KFMA 4URSA 2W9CB 2L48A 1JLAB 4K4TA 3AB4B 1B64A 1RT1A 4RUCA 3S1TA 3NNCA 1NUEA 2C28A 3I5CA 3ZNJ1 5HAOA 4P2SA 2HIQA 1X4GA 4PQAA 4R25A 2P2CB 4DUYF 4TKTA 3UNGC 1H2TZ 4LVNP 3PO4A 3KDNA 4ZP8A 4DEZA 3CE8A 3FC9A 3H0PA 2CADA 3W63A 2RDDA 2VA2A 2J0XA 5K8MA 1KR4A 3FBEA 3SQGA 4RU9A 4ZDNA 4ZP9A 2EC0A 5GAHU 2VFTA 1JXLA 1S9EA 2GJIA 3T19A 3BSAA 2OLWA 4LT6A 4R8UA 1FRXA 1NDKA 1FXLA 1MROB 1L3KA 4ZCMA 2R7WA 1KHWA 1NLKL 1RLCL 3ENQA 4IDKA 3DI6B 4JI6J 5L9XA 1U1LA 1F2GA 1N33J 4QIWD 2NXNA 4OHWA 2DVIA 1UPPA 1KBRA 5LMNF 3HD2A 4U8VA 3ZZPA 1QSSA 4DR1F 3MECB 1X8DA 1N5VA 1SC6A 4LQ9A 1NK7A 3LA0A 4UUXA 3DLGB 1MU2B 2RRAA 3HK2A 3W9JA 4NXMF 2DNLA 3R5DA 1FRLA 2VB6A 1DLOB 1S7IA 2VQEF 2BXJA 2OPSA 4LRDA 3QLHA 2YTCA 4OYAA 3IWXA 3JAMU 3NS6A 2XZDB 5F8MA 3T41A 1D3WA 2BW7A 5FIIA 4DPYA 2DNGA 2QRRA 3H4DA 1C4AA 3R97A 2R9LA 4NCAA 3JXOA 3KLHA 2D69A 2N82B 3QFWA 5HBMB 4DR6F 1XMOF 1Q7YT 2GVZA 2O01C 3D6MB 4GO7X 3N0VA 2R3VA 1K1SA 1OMSA 2FPHX 2OP5A 4B9UA 3TVKA 4I6WA 4LF9J 2IRYA 3C6UA 2ZWPA 1D0EA 1WOOA 4DSFA 3IS9A 3EZOA 2EFVA 1S97A 5LL6d 1GMVA 2XS5A 5GVQA 4K0KJ 3WQPA 2OSRA 4KV8A 2HHVA 4O44A 4KHPJ 3MM6B 3P4UB 4QWEA 4X2BA 2DEJA 5KTQA 1X5TA 3CJ3A 4ZVPB 1GXLA 4GC7A 5HO4A 3AFGA 4CM2A 1CJKA 4O4GA 4LRBA 1CBKA 2AJ0A 5C25A 1IKVA 5C7PA 3FEXB 2ZC3A 4WPAA 3AXMA 1GXUA 5F8LA 1OPIA 3EVOA 2B9XA 4LREA 2PI5A 2ADBA 1VOMA 3MURP 3DLBA 2HRUA 4LFCJ 2I1RA 4ES3A 2Z2YB 3BF4A 4DV0F 3CJ2A 4M5KA 1FNOA 3I9ZA 2XG8A 3C14B 2E66A 2LCWA 2W2QP 2G0IA 3QAEA 1U02A 1ULRA 1X7VA 4DPUA 1UA0A 2KXHA 2LU1A 2IM1A 3W9HA 1O0PA 1RYRA 2ZHBA 4I4BA 1CJTA 1UA1A 5M2RA 5KFEA 3T1YF 4B3TF 3M8PA 2X1GA 1JQGA 3V81B 1WSRA 2RNEA 4DV7J 5RUBA 4HLBA 1BUXA 2ZNZA 5IV3A 1URNA 3IGNA 3MGJA 3O6QA 2LA4A 4KKOB 2QA4G 3KUEA 1HYSA 2RD5C 2CKWA 4AL7A 1FEHA 3NCRA 3CCES 1SC1B 3IGVA 2WW4A 3BBCA 2PA3A 1TKZB 4N7TA 1JKHA 1NSKL 4DL2A 4TXSA 2JC1A 2PMWA 2OH2A 2A18A 2IBOA 2AV5A 3D6TB 5LSLA 4RW6B 2QA1A 2IFXA 1WJ9A 5FLXY 3ZTPA 3HSZA 1FVSA 3X1LB 4PYDA 3JTPA 5IV4A 4O3RA 3RTVA 4WFXA 2V2KA 5D4NA 4DG1B 4TY9A 4QR0A 3PX6A 3PW2A 3TJAA 2FVSA 2Y3YA 1DQ9A 3FMWA 4QYZJ 4YDDB 4TLRA 2M3DA 1SC4B 3KMQA 4HT7A 5F0WA 4USWA 1N4LA 1M1HA 1Y5IB 2W2OP 2FZCB 4HTJA 2R2UA 1U47A 4ZK7M 3ILJA 1ZTTA 3OQ2A 5DGBA 4UZCA 2V4JB 2BOAA 1MROA 3WIVA 3H8YA 2GQQA 1E6YB 4DPTA 3BGRA 4CT8A 1NO8A 2KT2A 1B7FA 3DI6A 1WKJA 2MZSA 2E5IA 1CJVB 3M8WA 4LF6J 5J1PA 2B4UA 2QFIA 2IRXA 4WYLA 5DJBA 1UZHA 2EG2A 3QJJA 3HJVA 3MECA 1VQKS 1M5PC 1YJTA 2R7UA 3F41A 2JFDA 2QMWA 1MU2A 1YKWA 4RBTA 2KM8C 1Q1KA 1DLOA 2D7SA 3LO3A 2BDPA 1HMVB 3CIMA 4LF4F 2VG7B 1VR6A 2QV6A 1L3UA 2NCKL 4KE5A 4PXEA 4AFFA 4F0KA 2Y8WA 1RLDA 3PX4A 3CC2S 3B6BA 3H2LA 3QZ8A 1ZTWA 2MPUA 4Q5VA 1JJ2R 1WOPA 2YXLA 2YWWA 5HBMA 5KFQA 4NLRA 1V5IB 3RAQA 4PRFA 3K89A 3UN2A 4BHQA 1RUSA 1KVIA 2PFDA 2IA6A 3NGDA 2GQ2A 2HVEA 3HVTB 1TUVA 3NOGA 2ALYB 4GMKA 1KQGB 1HFEL 3KUGA 4JYAF 2KJVA 4FP9A 2DISA 2F65A 1HBNB 3FFIA 1IBCB 3TJ8A 4JI7F 3EPGA 4F36A 3BSNA 1RI7A 4TU9A 4DR4J 4OMFG 5IT9Y 4HHJA 1WACA 1KEKA 3D9BA 1ZS6A 3AAWB 1R8CA 3R7SB 2JEIA 4RZRA 1HI8A 2W4PA 2DHGA 1WTFA 4DS5A 3ZC4A 4WP8A 3D0IE 2QMUB 1SXLA 1GFWB 2HMIB 5JVHQ 4EU0A 2A3JA 3GG1A 5GAEI 4Y3CA 2UU9F 3PKMA 3MEEB 3LAKA 3ZZRA 5DQIA 1PC5A 1S6OA 2QMXA 1YLXA 4TQRA 2GX8A 3C14A 1RJJA 1DTTB 4DR7F 3CJ0A 1HPZB 2ILYA 4OZ1A 4WZMA 3J80Y 4LIRA 4LRFA 2DPJA 1BQXA 2B7CB 5AJ3F 3GU0A 3KNAA 1QUPA 2WCXA 4N8OA 1R0CB 3EGZA 4MIAA 1NJXA 2WSCC 2QN6B 2CPZA 4B9MA 1XBWA 2XYPB 3IWLA 3SQOP 3P96A 1HBUB 3PR4A 2HQFA 3V81A 4WP9A 4NYPA 4KFBB 2LEPA 1WC5A 3BH6B 3P6YC 1FJGF 5F8NA 5IQQA 5JXSA 2R7SA 4DFKA 5A6PA 2LA6A 2NPIA 2CNOB 1U45A 3M9OB 3S01A 2OEKA 1NDCA 2R4FA 1VQ8S 1DURA 4NLPA 5DGAA 4DU8A 2YKOA 4RW6A 3D6FB 2ZH7A 3SIPB 4A8FA 2CG4A 2CDQA 4F4ZA 4PWWA 1PCAA 4B3RJ 4DG1A 4GC6A 2YKQA 5ETTA 4MK9A 4LFAJ 4BC7A 2G9OA 2DEIA 4Q2MA 1PC4A 4HH1A 4C8MA 4J9KA 1IBKF 2NZCA 1RB0A 4C0OC 3P45B 3UR3C 2MQNA 1GX6A 3HFZB 2XZTB 1RAOA 1G3OA 1T95A 3R9LA 3MUMP 1S7HA 2DNKA 3VAJA 1VBZA 4QR2A 2OPRB 1OQ3A 4OYXA 3Q24A 2WVFA 2Z4PA 2GIRA 2C3OA 2DY9A 4DPXA 4NE9C 2DGSA 4IRKA 1M5VC 4NZ6A 3PYEA 3PTWA 4A8OA 4WU2A 2DHXA 4WU3A 3O8WA 1CJVA 2PEBA 4OYBA 4P6QA 3ZZZA 1K0VA 4Q43A 3OV7A 1S76D 2ZZNA 4LR8A 3Q86A 2YWFA 2H4YB 3ICLA 3NGUA 2WBRA 1Y10A 1VC6A 2QLWA 3TX8A 3RRHA 3M1VB 4OHVA 4NLGA 5EWGA 4DV1J 1EIYB 2ZUAA 1HQUB 5GAHI 1D9FA 4P75A 4ED8A 3ZNUA 1HMVA 3PW4A 4M5NA 2VG7A 3H5YA 2HGLA 2GIFA 3DDNA 3PVXA 1F9HA 5L8RC 1RU1A 4NA3A 4OQJA 2H5JB 2LP4A 3H20A 2XNRA 2B9WA 4CH1A 2N7YA 3FBCA 2XSFA 3WBZA 4JI2J 2AEJA 3KLGB 2UUBJ 1QAYA 2H3EB 4P74A 3MR6A 1U6FA 3MTKA 2CUYA 1SQEA 4ENOA 2AYEA 3UDCA 4ZMMA 2E9ZA 2NQPA 4NWBA 1H73A 5L9NA 2RS8A 4ELTA 3FBBA 3DOKB 3MXHP 3CCSS 1SKUB 3HVTA 1YJ7A 1SPBP 1LWFA 3D7SB 1BE4A 1V5VA 4V19X 3W60A 5B0BA 1HBNA 1HNZF 4G1IA 2IYGA 5LMUJ 2JJ4D 3RRKA 2FJAB 1OQ6A 4O4RA 1OY9A 2GIQA 1NU4A 1RTIB 3HFVA 4EBEA 2IVFB 2Z58B 5KAKA 1QAIA 2VBZA 1GAOA 1U1OA 1JK9B 2FDNA 4I64A 4CYUA 2WONB 5KFBA 4TLQA 5HP1B 4X66J 4QWDA 3CCVS 2HMIA 3DHWC 1LW0B 1FRKA 1FWLA 1XNRJ 3D1QA 1YI2S 3IO1A 3M6UA 5ITHA 1R89A 1HWUA 2QGFB 1YZ7A 3SSSA 3NS5A 1N5TA 1M5HA 4C8OA 2R7OA 3CD0A 4JV5J 2QLFB 2CJAA 1XQIA 2B43A 3GV8B 1DTTA 6FD1A 1N56A 2CPFA 1FX4A 3RB6A 3BB5A 3DLKB 3LP0B 5BR8J 4K50A 3IR5B 2BJ3A 4LR7A 4J91A 4H4KA 1UEKA 1EETA 2I0XA 1APSA 4QCLA 4I6YA 1X4HA 3ISNC 2CJYB 3M7VA 4UTGA 2E5JA 4PG8A 2G4BA 3HLUA 2G2YA 3HULA 4ED0A 2E7XA 1AB8A 4GKJJ 5L46A 1GXTA 4X62F 5ETMA 4ED4A 1WG1A 1SB6A 1UW4A 1NZAA 2Z2ZA 4HT5A 3TRGA 4U96A 1K73T 2KH9A 2EKYA 1MMDA 5DO2A 5KT3A 2BR0A 4WXWA 3D1HA 4Z7CA 4JI5F 5I4MA 2I6WA 2ROPA 1OS5A 2K1RB 1XNQF 4DN9A 4NRTA 2DITA 2V8HA 4IQXA 2HSEB 3PFOA 5IT0A 4ZLJA 2DHAA 2MHEA 3RAMA 3P8BB 3GJRB 5DZ6A 2XWYA 5DZ7A 1TV6A 4C0BA 2UUAJ 4YOEA 2QA2A 3CCWA 2GFFA 4RW4B 3TUIC 3TUPA 1YSJA 2DH7A 3THTA 3K5OA 2C2OB 1N5QA 4PG6A 3SSQA 4BWMA 3IN5A 2K3KA 1YZ6A 1N6QB 3ZFVA 3T5HA 4MAKA 3ZZTA 1W2BR 3VR1A 3IP0A 2GJ2A 5AXLA 2VC0A 2KYZA 4ZPTR 1H7XA 5F3TA 5HK4A 2OPRA 2JOQA 3C19A 3GCWP 3I31A 1NSPA 2A10A 1TELA 2HVIA 1HHTP 3UVJA 2BKPA 3QT7A 3SZ2A 2KU7A 5IZHA 4DUYJ 3T1HF 1TMJA 3D67A 3DOLB 3FK4A 3W2VA 3RUBL 1LXNA 1VMBA 2FHOB 2V69A 2HK2A 2IM0A 4CO5A 4KJIA 1X9MA 2AD9A 2H48B 1OYEA 3IC1A 3D3BJ 4AYBD 3IG1B 2F40A 1KS2A 3M1VA 1U6BA 2F8HA 2UXCJ 3OLAA 4CZCA 1FFGB 1HQUA 3PX0A 1FNMA 2VUGA 3DOMB 2CPJA 1LK5A 4WFYA 2E1MC 1S0OA 4DCPB 2RQKA 4OX9J 1U48A 2EBGA 2ZBPA 5KFGA 5ETKA 3CJKB 4L76A 1UAWA 3N5FA 3CDEA 5LMNJ 4NL5A 1EAYC 2QT7A 3KLGA 5LJ5Y 1CQNA 4DR1J 2DY1A 4MH8A 4OFZA 5KG5A 4UOFA 1HW9A 2HZVA 1WEXA 2V4QA 2ZHAA 1JNZB 3ISND 1MSWD 2FD2A 4M5MA 1QD1A 3P5BP 2FUG9 2YVSA 2BRKA 3OTOF 2IBKA 2ZH6A 3B4MA 4NXMJ 2KVQE 2GW8A 4PKDB 3TWZA 3DOKA 3OT9A 1Q78A 2DGOA 2VQEJ 2XS7A 1K8AT 2M0GB 3E2EA 2Y1RI 2HW3A 2DR5A 3MHYA 1RA6A 4W4MA 1XN9A 4PEOA 4OI3A 5T7LA 4RW8A 5BXIA 3OSPA 1F5CA 5IT4A 1N8RT 4NXNF 2MYFA 3RW6A 2PD1A 4I56A 3JQKA 3IXQA 2DRBA 4DR6J 4EBDA 1XMOJ 2WONA 2ZBRA 4P52A 1LWEA 5HP1A 1Y5NB 1Z4UA 4KGXB 4DXLA 3MM8B 1N48A 1LW0A 4ZVGA 1NB2A 3OVSA 3PW7A
chains in the Genus database with same CATH topology
1R0AA 5J1NA 2KRBA 5JJBA 1FE0A 1W2IA 3QO9A 4L3NA 2PA8D 4QYRA 2IHR1 5MAOA 1NJZA 3PJXA 2IM3A 1BY9A 1XNRF 3G86A 3HHLC 3C6UB 2BYCA 1FDNA 3V6JA 2OFGX 2O5DA 3JTOA 2AJ1A 3DRXA 4MK7A 2LMIA 1HD0A 4OV1A 1MWYA 4I6AA 2JVOA 3DLJA 3J7YU 1R3NA 3OSNA 1REVB 3OLBA 1U1QA 3U7JA 3IR7B 2HFNA 3OR2B 3OTCA 1SJ4P 1CSJA 3HKZD 4A8WA 1TL3A 4UUWA 4RKUC 2AU0A 1IUJA 2AX1A 1TP7A 1IBLF 4NPOA 4V19J 2R8HA 4WE1A 3K5NA 4HYKA 1F60B 2C2DA 5IQ6A 3UD4P 3C6TB 1UMJA 3MEKA 4NYOA 4F3OA 4CI0B 3O3LA 1FESA 4KV8B 1NH7A 4O44B 5AXMA 1JLQA 1WWHA 1O51A 2DNNA 2HGMA 3E3XA 3RW7A 3SFGA 4F4XA 3V6DA 3UE2A 5AE1A 3IWNC 3FNNA 3G9CA 5KFZA 1DFDA 4WZQA 2YWKA 1NK6A 3MMBA 1KTQA 3HI9A 2AYBA 3MEGB 1JLBA 3KHLA 2FVRA 3L7PA 3BN4A 4IFYB 2Q66A 2LVWA 3NKYA 1TZ0A 3QJPA 1I94F 4NX9A 1KRPA 1Q86T 2WW8A 4B9LA 2YWEA 4Y65A 2YNHB 3QAUA 1S1WB 5GADI 4LIWA 2W9CA 2B4PA 1JLAA 4O4GB 4O3PA 3TI0A 5C42A 3CXCR 4K2XA 4OX7A 5C25B 1IKVB 5F9NA 2J9EA 5B7WA 2VFSA 2YX7A 2YKAA 2VC1A 3OFFA 1KOOA 4M8LA 2NREA 4F2SA 1H2UX 2WHOA 3OPKA 4MKAA 3NBPB 2JHEA 4ZCLA 2NPFA 4M95A 2F8EX 4OX8A 2D1CA 2RIJA 1GTEA 3N6MA 3IR6B 4WK3A 1SKSA 3Q2TC 1VQOS 2KB2A 2R8GA 5J2PA 1HWLA 2W24A 2BE2B 2RQMA 1ZETA 4FXVA 2VFRA 2ZKUA 1WHWA 2OO4A 3VAHA 2DCUB 4GKJF 2F7VA 1VBYA 1S6UA 2XGPA 4Q0BB 5D4LA 2RB7A 4DV5F 4YB7A 1WG4A 1NK4A 2ZBCA 2RSQA 1CEZA 4C8LA 2DRAA 1T05A 5B09A 1KHVA 1S1UA 2IJFA 4MKBA 2EFNA 1UVMA 4TYBA 4JI1F 2BBEA 3I6PA 4OZ5A 1RT7B 5M2UA 1MW7A 1UP1A 1Q53A 3DRPB 1NK0A 2OTJS 1L5UA 4X4NA 2XI2A 3MUVP 5DLGA 3Q8RB 5T7LB 1N5SA 2LU2A 4RW8B 1C1CA 2LXUA 4ZP6A 2PSZA 5FJ4A 3TARA 3SV4A 3AQOA 2FTRA 2B3TB 3RAXA 3M4XA 1AXQA 4ZVHA 2MJNA 1HNVA 3LWLA 3T5KA 3D0GE 4USJC 3UCZP 4E0DA 2J76E 3PHEA 2XY5A 1YWXA 5F9LA 1S4FA 2ZNYA 2JFKA 2K1RA 5EWEA 5B0GA 1V9OA 5DM6Q 1P9QC 4EGLA 5JUMA 1U2FA 3RU0A 2FC9A 3B82A 4HI2A 3T9ZA 4R0JA 4I7FA 4NRUA 3J81Y 1LXJA 5L38A 2NZ4A 3T3FA 4AXIA 4EBCA 3EGNA 4HTIA 1HNXF 2F1FA 4ZHRB 3HHEA 3PV8A 1WEYA 1HNIA 4TNOA 1LWEB 1A7GE 4XPCA 3VCDA 1X0PA 2W9BB 2OPPA 3K57A 1C4CA 5EX0A 1IQZA 2AQ4A 1TFYA 4UQTA 1ZM9A 1AUDA 3GFZA 3GIKA 1HR0F 5LXYA 3OUYB 3CGIA 3MR3A 2JVRA 4E98A 2Q1LA 3BR9A 3OL7A 4IUFA 3GMGA 2HZCA 1LKZA 1ZPVA 3D5MA 3VAKA 2QIFA 3M8PB 5KFJA 4JI6F 1VQ6S 4ED5A 5CYMA 2HPUA 1P1TA 2E1RA 3AY0A 2AJFE 1JLGB 1FDAA 1LW2A 1YRTA 1NB7A 1ZZFA 3MF5A 2FLNA 2L3MA 1IQTA 4B17A 1KONA 4K4VA 2WSFC 1U2RA 5FDLA 2IMWP 5KFOA 4NOHA 1C1BB 4NLTA 1J5OA 1QUVA 2GMHA 2KXNB 3CUNA 1WI6A 4C7QA 4O3QA 4DR3F 2XMKA 2VPXB 3LGMA 1KOHA 3I87A 4Y2IA 3K5LA 4A8YA 1QAJA 3HHNB 2UXDF 1S0NA 1RTJA 2P6SA 2DCLA 2MQPA 4FNHA 3DHXA 4KIAA 5T14A 2XY6A 3VAMA 2RT3A 2VBWA 5KFCA 4F67A 3DLGA 1DRZA 2COLA 1N6QA 3DU5A 3CCTA 5CYJA 2OIHA 1KNZA 2ZKTA 5CA5A 4K4YA 4IR9A 4YR2A 4HI1A 1SUQB 4AE5A 1JKHB 2R7RA 2GNKA 3NCQA 1XR5A 3D1OA 4Q7AA 1Y5LB 4KSEB 1YJNS 3DYAA 1Q82T 1S9GB 3K8VA 1HWJA 5KFFA 2VBYA 4IRDA 2PI4A 1P27B 1Z2LA 5D78A 3CJ5A 2HHQA 2P5VA 3HVAA 3PR5B 2YWGA 3CDBA 4EYIB 4PUOA 2JRSA 4HDGA 2Q6BA 1YJVA 5KFMA 4URSA 3N79A 5L1IA 4Y6IA 2W9CB 2L48A 1JLAB 3QGIA 3MI7X 2OD4A 1TK5A 4DFPA 1R31A 4FYDA 4K4TA 4NLWA 3AB4B 3HFKA 5C42B 1YJRA 3CD6S 1B64A 3DLEA 1RT1A 1YGYA 3I56S 4RUCA 2BJDA 3P3DA 4FNIA 3M2UB 3S1TA 4UQGA 2DGVA 2JLFA 2JEFA 3NNCA 2CQBA 3BQ2A 2JX2A 2C28A 2BACA 3I5CA 3UCGA 1YJUA 1RWUA 2PEHA 4Z2XA 4NLYA 3EZ5A 5IM0A 2CPEA 4P2SA 3L95X 2HIQA 1X4GA 3DOLA 2ZDPA 4KAIA 4PQAA 4R25A 2HFOA 3CCLS 4EYHB 1O5JA 4C98A 4K4UA 5DETA 5J2PB 4DUYF 2Y0SD 1FK9B 3OTEA 4TKTA 3UNGC 3H59A 1H2TZ 4LVNP 2GCFA 3PO4A 2CQDA 1VQYA 4K4SA 1D1UA 1K9MT 4XDDA 1E6VB 4FPRA 3EX7B 2MKSA 2ZC4A 3PACA 4ZP8A 5E7OB 4DEZA 3CE8A 3M30A 1RT3A 1T05B 1S1UB 5J2QB 3IG1A 1FKOB 2V4RA 2VA2A 4I1TA 4MFBA 2YKMA 2DNQA 2J0XA 1W25A 4ES2A 1KR4A 5K8MA 2CQGA 1JLCA 5AXKA 3R5CA 3SQGA 1C1CB 4H4OA 3O1LA 4I2PA 4DQIA 4IOAQ 4RU9A 5EUHA 3I0RB 5KG0A 4ZDNA 1BQMA 4ZP9A 3WX4A 4M94A 4KBIA 2FHJA 3HHLD 2EC0A 4KC5A 5GAHU 4RUAA 2VFTA 3HVRA 5B08A 4B9TA 3DOMA 4DJBA 3M9NB 1JXLA 1S9EA 3MM9A 2B56A 1QJHA 2CJBA 2M7SA 2ZM6F 1NK5A 1IJEB 2GJIA 2VONA 3T19A 5KT6A 1P1LA 2AJQA 3BSAA 1XMBA 2OLWA 4LT6A 4R8UA 1FRXA 1ZPWX 4A46A 1S6QB 2MQLA 3W3SA 2XC9A 1FXLA 1MROB 1L3KA 1P6TA 4ZCMA 4Q45A 4DV3F 5J2NB 2W7AA 3MOZA 1Q7LB 2BUNA 1KHWA 2R7WA 3G4SS 3BO3A 2KVIA 3UWTA 2UXBF 2MXYA 3ENQA 4IDKA 3MM6A 3DI6B 1HBOB 2P9EA 3UDLA 3CJKA 1U7LA 2RDJA 4K0KF 5L9XA 1U1LA 1VRUA 1F2GA 4PCQA 1FXRA 1WHXA 3R1HA 1RYSA 4QIWD 5D3GB 3IRXA 4IYQA 3AH6A 3VTIA 4OZ0A 3KLIB 3FGVA 4OHWA 3OJUA 2DVIA 1RT4B 2IYIA 2XLJA 1Q8IA 5LMNF 3N5BA 1G1XA 2NYIA 3MFHA 2H9ZA 2CQ4A 2M4MA 3DXBA 2A2DA 2LEBA 1VQ4S 1JB0C 3ZZPA 2JEJA 2LKZA 3RBDA 2FVPA 4DL6A 2LQBA 1QSSA 4DR1F 4FF3A 2J0SD 3MECB 2KXFA 3GV7B 4OJ3A 1X8DA 1KC8T 3MUTP 5L1KA 1IKXB 5E3AA 1DARA 1N5VA 1SC6A 4PR6A 3VF0B 3G6XA 4LQ9A 2LECA 1HNWF 1NK7A 2PT0A 4F26A 4UUXA 4I69A 5E3PA 2DK2A 3DLGB