1HL6A

A novel mode of rbd-protein recognition in the y14-mago complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
143
structure length
119
Chain Sequence
b'AEEFEVDEDGDQGIVRLKEKAKHRKGRGFGPGPQRSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVDWCFVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG8781 PROTEIN
publication title A Novel Mode of Rbd-Protein Recognition in the Y14-Mago Complex
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signal protein
total genus 27
structure length 119
sequence length 143
chains with identical sequence C
ec nomenclature
pdb deposition date 2003-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hl6A00
2D9OA 1YITS 2ZJPQ 3IRWP 2MQPA 3G8SA 2LA6A 2DO0A 2YKAA 4CH0S 1W2BR 1X4BA 2ZJQQ 2M70A 1U2FA 3J7YU 1JMTA 2MMYA 2G4BA 2ZJRQ 3EGZA 1X4AA 1VQ7S 1DZ5A 3B4MA 4F02A 2LMIA 2MZQA 4Y0FA 2DNGA 3CTRA 1X5TA 4QU6A 2OSQA 2J76E 4TU8A 2KXNB 3UE2A 4QU7A 2KRRA 2DHXA 1M5KC 2M52A 5D77A 3BEGB 2RQCA 1WEYA 4P6QA 3VAHA 4UQTA 2M8DB 2MJNA 2DNMA 2MYFA 2CPIA 1P27B 2DNYA 5BJRA 5LSLA 2K3KA 2PEHA 2DIVA 2MZJA 5DDRC 2M0GB 1WHWA 1U6BA 1ZZFA 2E5IA 4V19X 2OSRA 1KOHA 2E5HA 1U1RA 4Y00A 1UFWA 1WEXA 5ITHA 3CPWR 2BOPA 1WTBA 1RK8A 2RT3A 5IM0A 4CQ1A 1YIJS 1YWXA 2N82B 4ERDA 2CPJA 1OO0B 1U1KA 3MUMP 3P6YC 2KN4A 2SXLA 4IUFA 1SXLA 3ULHA 3EGNA 2M7SA 1VC6A 2FHOB 3I55S 2DGXA 2MKJA 1KQSR 2MQLA 3G9CA 3S8SA 1JJHA 5D78A 2DH9A 1YJWS 2RRBA 1VC5A 4PR6A 2E5GA 2J0QD 2LXUA 2MQQA 1Q86T 2KH9A 2DGUA 1D9AA 1Q82T 2MKCA 1DHMA 1X4DA 1X5PA 2MZ1A 5JVHQ 2AYGA 1WI8A 3CF5Q 1NJIT 2DHGA 2KRBA 3BS9A 4LIRA 2PE8A 1ZZNA 4OZ0A 3MUVP 1VQMS 2RS2A 3H2VE 1WHXA 2DHAA 1S72S 2N3OA 2MKKA 4BS2A 3CC2S 1WEZA 1M5OC 2HGMA 2M4MA 3US5A 2DGQA 1N88A 1L3KA 3UCGA 2CQIA 2M2BA 3FEYB 2O3DA 3MI7X 1OPIA 3R27A 4QPTA 2XS2A 3BO2A 4PRFA 4W92B 1Q81T 4WF9Q 2CQDA 2KM8C 5MLCV 4TU7A 5IQQA 3RW7A 2DGTA 2DH8A 2MSTA 3VAGA 5DDPC 1S79A 1X0FA 1WELA 5LJ3Y 1K8AT 5DDQC 4F25A 5GADU 5GAHU 3BO3A 1FXLA 4ED5A 5HL7Q 3I56S 1OWXA 2B0GA 2U2FA 4IOAQ 2DIUA 2MQMA 3THTA 2LCWA 2XSFA 4FXVA 2KFYA 2HGLA 2KYXA 3VAKA 2JVOA 2MGZA 2Q79A 1AUDA 4CIOA 2I38A 3DXBA 1FNXH 2CPFA 1R8PA 4W90B 3UCZP 4TU9A 2MSSA 1ZH5A 4U67Q 3CXCR 3NS5A 3TO8A 2JVRA 2OTJS 1O0PA 1OIAA 2I2YA 3ZZZA 2CQPA 2X1GA 1X5OA 1VQLS 1VQ4S 1X4HA 1KC8T 1VQPS 4FXWA 1FJCA 3CCRS 2JX2A 2K8GA 2JRSA 1X4EA 2YTCA 2CQ3A 4WFNQ 2AD9A 3NNHA 3MOJB 1WG4A 2DGVA 2MY8A 3SMZA 3VF0B 2KXFA 3S6EA 1HD1A 2LEBA 2V94A 2CPHA 3V4MA 3SDEB 5HO4A 2MQNA 1H2UX 1M5PC 3P5TL 2LXIA 2J8AA 3LPYA 1U1OA 1VBZA 1FJ7A 1RKJA 5CYJA 1JJ2R 2MB0B 2XB2D 5DM7Q 2G1DA 2FPHX 1H6KX 1HA1A 2AYEA 1URNA 5DM6Q 3CULA 2XNQA 5DETA 1WF0A 2ERRA 4IO9Q 1VQ9S 1U6FA 1VQ6S 2FC8A 3P49B 3UD3P 1VQ8S 1KD1T 1WHVA 5GAEU 1WWHA 2OJ3A 2RUGA 1WG5A 4QQBA 5DDOC 2EVZA 3MURP 2YH0A 1X4FA 3NNCA 3DLLQ 1B7FA 2FC9A 2KG0A 2MZSA 3TP2A 3VAIA 1NO8A 2DGOA 2ADBA 1XN9A 1A9NB 2DNZA 3PIOQ 2LECA 2D3OR 1SJ3P 2LQ5A 4RU2A 2XS7A 2N3LA 2L08A 2CPDA 2DNOA 2RVJA 2DNRA 3MD1A 2MJUA 3OW2R 1QVFR 3CMES 2VONA 4J5OA 2CQGA 2G0CA 4OZ1A 2DNKA 2OIHA 1DRZA 2DNQA 2A3JA 3G71S 2F9DA 2M9KA 3CUNA 2VOOA 1VQKS 1WI6A 2RRAA 1UW4A 2KI2A 3MD3A 4M5DB 3CC7S 1HL6A 3HHNB 1YHQS 1SJFA 3L3CA 2CQ1A 3CCQS 2DITA 2M88A 2JWNA 1WHYA 2NLWA 1PGZA 1U1PA 1QVGR 1X4GA 2MKSA 3N9UC 1YTYA 1U1MA 5LXYA 3NNAA 3VALA 2KVIA 3CD6S 1VBXA 2KHCA 2KU7A 1KOOA 3NMRA 4C0OC 1K9MT 1VBYA 2MXYA 1WF1A 1X4CA 4Z2XA 3G96A 2N7CA 2GHPA 2F9JA 4YB1P 2OTLS 2ADCA 3VAFA 2QEXS 2KXHA 4EGLA 1N52B 1FO1A 4YUDA 1YJ9S 1YI2S 1PO6A 1WG1A 2RNEA 2CPEA 4A8XA 5IM0B 1CVJA 3CMAS 1M1KT 3VAJA 1H2VZ 2GO9A 3CCVS 4F26A 4UY8T 5LXRA 5LSOA 1VQOS 2DNLA 1M90T 1N54B 2KT5A 5GVQA 2E5JA 2U1AA 2WBRA 1D8ZA 2CQBA 2LA4A 3CCUS 1R8HA 3FEXB 4IOCQ 2XS5A 1X5SA 1IQTA 2CJKA 1BY9A 1A7GE 2MKIA 1UAWA 3G4SS 4CH1A 1JJ4A 2DNHA 2CQ4A 5CA5A 3TYTA 5LJ5Y 2UP1A 1H2TZ 2CQCA 2CQ0A 2CPYA 3UCUP 2HZCA 2E44A 3CCES 3U1MA 2CPXA 3MDFA 1P1TA 3B4DA 3MUTP 4LJMA 1Q7YT 1SJRA 5FJ4A 3J7ZT 3CCMS 5GMKa 2YWKA 4WIIA 2L9WA 4WFBQ 1UP1A 1YJNS 1FHTA 2MQOA 2HGNA 2MZRA 3JB9k 1G2EA 5CXTA 3S01A 2HYIB 3Q2TC 1U1QA 3IWNC 2MZTA 2DK2A 3H2UB 5EN1A 2DGSA 1M5VC 3P3DA 2RS8A 5IFMA 2NZ4A 1VQ5S 3G8TA 1K73T 2YH1A 2LKZA 2M8HA 3Q2SC 2RU3A 3BO4A 1U1LA 2CQHA 3THPA 1SJ4P 2EK1A 4LMZA 2DNPA 2AYMA 2VOPA 2BZ2A 3VAMA 2MY7A 3SDEA 3U1LA 5GAGU 3R1HA 2QFJA 1FT8A 2KG1A 4WFAQ 2MGZB 3CCLS 4C4WA 3K0JA 3HI9A 3S7RA 3ZZYA 4WCEQ 1U1NA 1HD0A 1F9FA 3PIPQ 3UWTA 3CC4S 4ZKAA 3CCJS 2KM8B 1FJEB 3D2WA 3UD4P 2L41A 1QM9A 2RQ4A 1VC0A 1N8RT 4WKRA 3SXLA 2F3JA 2EK6A 2QA4S 4PKDB 2AYBA 2DISA 2DB1A 3EX7B 3NS6A 2XNRA 4C7QA 3CCSS 2X1BA 1SJQA 2X1AA 2VODA 2DGWA 2DHSA 2HVZA 2D9PA 2LEAA 1VQNS 2LYVA 3MXHP 1WF2A 3LQVA 5H1SV 2X1FA 2MHNA 3RW6A 2J0SD 1DBDA 2FY1A 1NU4A 2DNNA 4YOEA 2DH7A 2MPUA 2CQ2A 4TLQA 2DO4A 5JVGQ 3R1LA 2CPZA 2MKHA 3G6ES
chains in the Genus database with same CATH superfamily
1V5VA 3IRXA 2ZM6F 3DOMA 4QZVB 2B51A 3GV8B 3QLHA 4WFZA 3OTDA 4N56A 4DPOA 4TU8A 5B0EA 4DPXA 3IR7B 3MEGA 3BEGB 3MEEA 2DR7A 3VV2B 2DNMA 2VHGA 2MZJA 1J5EF 1WHWA 1U6BA 4QIGA 4V19X 2YPYA 2CJBA 1PYSB 4CQ1A 3MUMP 1ZYQA 2R7TA 1B99A 3D9BA 2MKJA 1VC5A 4H54A 4CLSA 2DGUA 5D15A 2F1FA 1DHMA 3D6TB 1KBRA 2DHHA 2CZVC 4DPUA 4M63A 1S72S 3I9V9 1TMMA 3DLKB 4ZVTB 3FC9A 1T0TV 1PSDA 5F8GA 1HBNB 2W4PA 1XR6A 4L74A 3RW7A 3MMCA 3GJTB 2V9WA 2GW8A 2ZM6J 4DV5F 4J9QA 5J2PB 3I56S 2B0GA 1R8AA 5KFFA 4YFUA 4H4OB 1XR5A 2QIFA 2Q79A 3FRYA 5IWAF 2NQPA 3DXBA 2V4JA 1DQAA 1RXOB 4U67Q 1CEZA 2VBYA 4CO2A 2I2YA 3TEHB 1FX4A 3AXKA 1VQPS 2VD3A 1J5EJ 4ZLPA 3GPAA 3D54A 3DLJA 2JRSA 4WZMA 4URSA 4WFNQ 4RUBA 2ZC3A 5AXNA 2LP4A 1H2UX 5H9FJ 1M5PC 3M2RA 4DWIA 4LF7F 4NMLA 3CJKA 1GXLA 1HA1A 2GMLA 5K8OA 1HQUB 1WC3A 3LTOA 3LGNA 2OFHX 3K5PA 3CD5A 2UV8A 3CJ5A 2XZTB 4DSLA 1WHVA 1KHVA 1TFWA 3V5RA 1LW0B 4U7CA 3D3CJ 4IDKA 1A9NB 1NHKL 1EZZB 5KFUA 3BQ0A 4FKXA 3OW2R 5M2RA 2RKIA 2FDNA 5GAGI 1BXNA 2OPRB 2WW4A 2M9KA 2N4CA 2RRNA 1B3TA 1MN9A 5ETPA 3GJQB 3D6MB 3VHQA 4DQSA 2ZBIA 3SCLE 3SQGB 2A6OA 3PX6A 5IWAJ 1BMQB 3IM9A 1VI7A 1DQ9A 4DQRA 4H4KA 2J8SA 3NWRA 4GVLA 2HRUA 3LALA 2VQEF 1N52B 3SV4A 2KKHA 2FIUA 1YK9A 4DSFA 2MQ8A 3DDNA 1M1KT 4USJC 4RNFA 1JLQB 1G1XA 3H40A 5CABA 2LDYA 3TUPA 3BREA 3POTA 2E1MC 4OI6A 2W25A 1LNQA 3H25A 4LF7J 3T1AA 3M30A 3ISNC 3N6NA 3VGUA 1IQTA 3LP0A 2ZE2A 3SV3A 5K8NA 2HZAA 5CA5A 3TNVA 2ZNYA 4NLQA 2V4RA 1X0PA 2ZOMA 3U1NA 3W64A 3H42A 4ED6A 2CZ9A 2BJ8A 3FJ2A 1FHTA 2G1HA 2WW8A 3M8PB 2HGNA 3JB9k 4HACA 2QZ8A 5FLXU 1S99A 1C1CB 3FGVA 1L5UA 3UPFA 4RUAA 2DR9A 4M5JA 2QA1A 1ZETA 5T7LB 4PG7A 3O1LA 4RR5A 3AJDA 3R97A 3SDEA 4UZBA 3BBFA 3MM9A 2QFJA 1IUJA 3TEGA 5DJBA 4K4TA 3GSIA 3G8QA 2EEYA 4ANEA 4Q45A 1VOMA 2XMWA 2PFFB 1NJXA 4DJBA 3IXQA 3OTCA 5SZTA 2VKRA 2VDIA 1EJ7L 4PG4A 9RUBA 4K4VA 4FYYB 1N6QA 1GXUA 3ZC4A 4NXMJ 5IV4A 3I5CA 2FLLA 4CLZA 3VR1A 2ZJQQ 1YGYA 1YITS 1FRHA 4WK3A 1UPPA 2WB4A 3HK2A 1QE1A 1PAEX 4P10A 2XCPA 5A6WA 1WC5A 2NYHA 3EGZA 1VQ7S 4TYAA 3M6UA 4F02A 2FHKA 4KH0B 2B43A 1S1XB 1HWUA 2LMIA 1X5TA 3UE2A 3TJ9A 4ZVHA 4IRKA 1DTTB 4FNIA 3FBFA 1RWNB 2QGFB 3CDWA 4I68A 3AT1B 4RWXA 4ILRA 2P9GA 3CNQP 3A3OB 2ZHAA 2N82B 1LW2A 3NY0A 4EYIB 4DSJA 2W2QP 2HQDA 1TU0B 4PPZA 3OD2A 1KQSR 1Q86T 3V6KA 3KYLA 5T14A 4OYPA 1U47A 3G82B 5IQ6A 2AHOB 1GXTA 4HYKA 5A76A 1MW7A 2LFVA 1U48A 4I0WA 3PFEA 1OPIA 2XQCA 4RUCA 3GP9A 2CJAA 3OFHA 4IG0B 5CQGA 3MM8A 4TU7A 3TARA 3PG9A 1RT6A 4USVA 1K8AT 2Y8YA 2XULA 2RE1A 4OX9F 2BA9A 2HQFA 1OSCA 1XBWA 1UWBA 3O44A 4DU8A 1NJWA 5HL7Q 5ETRA 2HIYA 4Y28C 1RI7A 5F8HA 2OI2A 2NUUG 3ITHA 4OHZA 4QCLA 1HNVA 3W2VA 3EVWA 3A8EA 4J9LA 5KOXA 2GC8A 3ZZTA 4CO0A 8ATCB 3GIJA 2QYCA 4X4RA 1XEZA 3M2VB 3ENAA 4NEZA 3OTEA 1FJCA 5LMNF 4F4ZA 1CQMA 4NI2B 4DZDA 3IO1A 1UVIA 1S5ZA 2Q1LA 5KT2A 4OMFG 2LXIA 2J8AA 3K5OA 1VBZA 3F44A 2G1DA 3MCSA 3HSGA 1FRLA 1CJKA 4CZCA 3EDRB 4ZP8A 4QOTA 2ERRA 2P6SA 1AT1B 3ELHA 2WBMA 4N77A 4TQSA 3M1VA 5KFOA 3F56A 2H9ZA 1W26A 2DRBA 4ED1A 1NDLA 4FPRA 1X4FA 2FVRA 1RTJA 2K3IA 4RW8A 3W65A 2QG9B 2CIMA 4FDFA 3PYGA 5LM7E 4PQAA 1GTHA 4U95A 1GNKA 1JLEB 2W1BA 4IH5A 1R27B 3JXOA 5FIIA 4OX9J 4IKAA 1PILA 5KFIA 4ED3A 4M5DB 3TWZA 3MR6A 3GFXA 1FCAA 1S7IA 2M88A 4PPDA 2OH2A 5F41A 1HBOA 4QPXA 1ZTTA 1R0AA 5B09A 1S6UA 3KHLA 4X2BA 2AQ4A 4BLGA 1T03B 4KO0A 3QIPB 3VAFA 3DRPB 5E2QA 1B70B 4RL1A 4ZCMA 1YJ9S 3D1HA 5HK4A 4WU2A 3U7JA 5RUBA 2B5JA 2WRMA 4A8XA 5CCLA 3TA1A 4J9KA 5LMNJ 4CP5A 3DN9A 4L73A 4KQZA 4F2RA 3I0RB 2GO9A 3KWMA 2L48A 2F7VA 3KG1A 5GVQA 3MCNA 2WBRA 2CWKA 2EPIA 2NCKL 1RBOB 3FQKA 1RWXB 2FJXA 5AXLA 1F0XA 1K0TA 1JJ4A 3K5NA 1XMQF 2VU5A 3MUTP 4EO6A 3QRQA 1REGX 4IG3B 2A18A 4HT5A 2HHWA 3Q2TC 1S1TA 3GR0A 4FS1A 1H74A 2Q6BA 1FNOA 2PA8D 2Z30B 2ZH1A 2E7WA 2FLOA 5D4PA 4USUA 2YNFA 2EK1A 1XMOF 1HNIA 1VCTA 2XLJA 4DR4J 3GE9A 4QBUA 1HWLA 1HR0F 4JUZA 3GV5B 2HRTA 2WZ1A 1SB6A 3IAM9 5EWFA 1RAOA 1F5BA 1NDCA 3TUJC 3H4DA 1WKJA 4RNMA 1VLYA 4GKKJ 4NCAA 3JQJA 1U2RA 2BM0A 1T11A 1OY9A 3U27A 4J37A 3RW6A 4PXBA 4USWA 3R5GA 3SCIE 3VWSA 4AQYF 4F3QA 2VBWA 2DYAA 1RA6A 2PIIA 1L3UA 4YY3F 3C15A 4RW9B 1IKXA 1TAQA 4YR0A 4WP9A 1S4FA 3AH6A 1UEVA 1XMQJ 1NPPA 3DHWC 3ET6B 2AJQA 2M52A 4EU0A 1I3OB 2HAIA 2GGPB 1G3OA 4FYWB 1WDTA 4P75A 2F4FA 4ZPCA 4IFVA 2Q3PA 2NXEA 3ZXWA 3PXGa 4AT1B 3K5MA 3P45B 1S6QA 1WKLA 3HHLB 2RT3A 3RGIA 3FBBA 3QFHA 2AEJA 2GS8A 3PW7A 4IUFA 1XMOJ 3UR0A 5J1EB 3OLAA 2R2RA 4ZCKA 2MKCA 3HKZD 2H54B 2AJ2A 3CF5Q 1HR0J 5D4LA 3PJXA 1R3NA 3QRRA 2QMXA 1F3VA 4G1QA 4QR2A 4ZVRB 1WEZA 2KVQE 1T9XA 2M4MA 2YKOA 2VA2A 1YBUA 1F1BB 4KTQA 2R7QA 2XS2A 4ECUA 5KG1A 2LLZA 4ZPDA 2YNGB 4NCGB 4AQYJ 1S79A 3MPWA 4K2XA 3SSRA 3FDSA 3OL8A 4Y6IA 1WSVA 3Q8YA 3PW4A 4FYXB 1FXLA 1WC6A 5KFBA 4YY3J 2V50A 3THTA 4WE1B 3D67A 4DQPA 1S97A 1RT4B 4ZVPB 4CIOA 3KK2B 4ZK7M 2CFXA 1N5QA 2NPFA 3NS5A 2HFNA 2KZMA 3HZGA 3R2CJ 1X5OA 1SIZA 1YQHA 4K4SA 1KONA 4HR2A 2Z2ZA 4KBIA 3M9NB 4URQU 1X4EA 3MAQA 2OKQA 5C25B 1P1LA 2PA3A 1RHRB 4M5NA 2GAGC 4I6AA 2AGPA 5E3RA 1FDBA 3Q8RB 5J2PA 2HFUA 3D1QA 3CEDA 1GH8A 4JI5F 2BJDA 4MT1A 5DETA 4IO9Q 3SI8A 3UDCA 1Y4ZB 5B0AA 4Q44A 4TNOA 1KLNA 4QWEA 3MURP 5FD1A 5IV3A 3UFCX 3IG1B 5KFXA 2IJNA 1RU2A 1NXIA 2WVEA 3CIZA 1SI9A 3QQCD 2HNYB 2GVZA 2G2OA 2IAJB 2C1EB 4RU2A 2M5YA 3MD1A 4CLPA 3K8WA 5IT0A 3HCXA 2GQCA 1HBMB 4H4MB 4X4PA 1RBLA 4OI1A 1HQUA 2WHOA 2ZFHA 4IRCA 1VQKS 1RAHB 1HBUA 2N7YA 2KI2A 2PFDA 4RW6B 3FUYA 2IM3A 3H0PA 2JWNA 3E8OA 1U1PA 4YN3B 1I5OB 4LFBJ 5CZXA 1S1UA 5C5JA 3T6JA 2VG6B 2F9JA 3T6BA 2YPZA 1PO6A 1WG1A 4I2QB 2W2PP 2QLJB 3K59A 1S6PA 2W4CA 3MM5B 4P2FA 2KO1A 2JDJA 3BR8A 5H9FK 4BWJA 1RHJB 3J7YI 4LQ3A 2LA4A 1RAFB 4ZLNA 1VGYA 3HSJA 2V8HA 1RCXB 1U24A 4U9RA 2MKIA 3AAWB 4CH1A 3DOLA 3O3LA 3OFEA 4JI5J 1YDLA 4ED7A 1FFWB 1FKOB 4ETZA 1K1QA 2YWKA 2PDAA 1UP1A 2ACYA 4NLPA 4C6AA 4JV2A 2HYIB 1T3NA 3CO9A 2E1AA 3IWNC 2BQRA 3AQPA 3RYLA 1EETA 2QL7B 1MMDA 2YNHB 3UN2A 5DGBA 1Y9OA 4EO8A 4ID5A 3U1LA 1KFDA 1HD0A 3FQLA 3BBCA 4NA2A 3M8QB 1DURA 2OGUA 4AL7A 1T02A 4A47A 3ADAC 1UMJA 4JV1A 4O4GB 3AB2B 1WC1A 4MKYA 1RAEB 2DISA 5J2MA 4G65A 4LFAJ 1Y3KA 4OYZA 3M7VA 3EX7B 2PI5A 3F41A 1S9EA 2JC1A 1NK5A 2HIQA 3FVYA 2IBKA 1HKAA 2J6TA 4C8NA 5T7LA 4MJKA 2DY9A 2ZDPA 2CJ9A 2DNNA 2FY8A 2HS0A 1PCAA 3DLGA 4XAKA 4MK8A 4WZQA 4NZ0A 2V68A 4YDXA 1REVA 4E8UA 4N8OA 2AMCB 1NEEA 1DZ5A 3I32A 5I3QA 3BV8A 5JUMA 5ETMA 2HHQA 3KLIA 1EP4B 3D68A 4ANCA 1FTRA 1YJ7A 3QSIA 2RQCA 4MYTA 3GG0A 4EBCA 1V6HA 4HH0A 2MJNA 2X3GA 2LDIA 4ENOA 5J1NA 4DLEA 1KOHA 4I2PA 5K8MA 3EWGA 1RT3B 2XWYA 1SL2A 4F50A 4MKVA 3FKBA 2FJEB 3RB4A 3HJVA 2DGXA 2IVFB 3OUYA 1JJHA 3NLCA 3KLHB 5IC6B 3BGUA 2C2RA 3H5UA 3JSYA 4W98A 3MUVP 1FK9B 2N3OA 1M5OC 1N88A 3IP0A 1IJEB 2O3DA 4X84A 4C48A 2K2PA 4DV4F 3JTNA 2R7XA 2A2DA 2G2YA 4MYUA 2E5LJ 2ABYA 1RT1A 3BQ2A 5G4DA 1V3ZA 4F25A 3VGTA 2V5HG 1TQLA 7FDRA 2IBOA 3PX0A 2ROGA 2B4OA 3BF4A 3VAKA 3L7UA 3ZTPA 1HYSB 5HMYA 1U2CA 1S12A 4FF2A 2OTJS 5D4NA 1O0PA 4B9UA 3V81A 4U7UD 1JB0C 2X1GA 1KC8T 1D9DA 2QRRA 4DSEA 4ZS6A 4IG0A 1VYAA 3CDEA 1FX2A 3H98A 3KLGA 3CE8A 3NNHA 3LP2B 3FMBA 2NXNA 1KDNA 3S6EA 4DPYA 2ZD1B 4HDHA 1RWVB 2HFSA 3D6FB 2QSFA 1HWJA 2YNIA 4U96A 4FBTA 1JIHA 2BJ9A 2EBEA 4NASA 3M6XA 1TK5A 2BANB 3ONQA 3NBPA 3DGPB 2DCUB 4O3OA 2EFOA 4RUHA 4ECWA 4OX7A 2RH3A 2HLTA 1SH0A 2KFNA 4LF2A 2BRLA 1RKIA 4DV4J 1LWCB 3HF5A 2YWHA 4ZVEA 1N36J 5KFLA 3SCKE 1IM4A 1TR0A 1NMEB 1HQEB 4ILMA 3IM8A 2E1RA 3RB3A 2B6AA 1TKXA 3OSNA 4I7FB 4F67A 2OUGA 2VOOA 3KMSA 1HPZB 4FN5A 3CDAA 5D0RA 4C3LA 3DYAA 2ZH3A 2UVRA 3MM7B 1UFKA 1PGZA 4UZCA 3DCAA 1Z2LA 1FESA 2R8IA 3CD6S 4KV8B 5CH7B 1UZHA 2B3TB 1IM6A 4TY8B 4DR6F 2NUHA 1WKKA 1IWAA 4QIFA 4ZVUB 5DLGA 4NRTA 1J5OB 2OPPB 1CVJA 4F4YA 5E3CA 1JLEA 4UOFA 3CO0P 4M5KA 5KFTA 1N34F 3D0IE 4A8OA 2KL8A 1TTHB 4PUOB 3N4WA 1BE4A 4NLXA 4J7CA 2YWGA 2C2ZB 1FDDA 3C6TB 3NL0A 1AFIA 1RTIB 4N5SA 4HL9A 1TZ0A 5DS7A 2LQBA 1T94A 2V2VA 2E44A 4FYVB 3NGUA 4OYIA 5CZVA 4DBQA 3V2UC 3AOBA 2XYGB 2EG2A 3PRVA 1KKHA 2RB7A 5LOQA 2UXBJ 3MPUB 3H5XA 4LQ9A 3OLBA 3W9HA 2EKNA 1DY3A 2K7JA 2F4VF 5JMNA 3ILOA 1YBAA 3BJYA 3CSKA 3AA8A 3R6GB 2YQ0A 1O6XA 2OPSB 3THPA 4TY9A 4OZNA 3JSBA 1VK8A 4H4KC 4X64F 2KG1A 3MM6B 1ZS6A 3N6MA 1SVDA 4ZKAA 2XGQA 3H59A 1RLDA 5DQHA 2ZH9A 1NH8A 2RQ4A 5IZHA 3CJQA 4OQJA 3Q24A 4DR6J 4WKRA 4WTOB 4WK1A 4PKDB 2KZZA 4JI8J 2ROEA 1QSYA 2V63A 2X1BA 5BYRA 4L3KA 5K9FA 1ZM4A 1N32J 4M5LA 1N34J 4YOEA 2YVSA 2R3VA 2VH7A 1PAUB 2V8DA 4GC6A 1AB8A 4PWUA 1U0HB 2IA0A 3EZOA 5AXKA 4Q8EA 1MLAA 1DTQB 4QU7A 3R3TA 1SUQB 1G7CB 3QGHA 3QWPA 4XIUA 3MR2A 2DNYA 3MPVA 1HHSA 4OYMA 2W9CB 2ZH6A 4RBVA 1RGVA 1UFWA 3KLFA 2F4VJ 4B3OB 2O66A 5IM0A 1OO0B 1P6TA 2EFGA 1RTHB 5GMDA 1B7YB 2M7SA 2PGCA 4Q0BB 4RW9A 3GJSB 2CNNB 4X64J 2RRBA 2J0QD 4A4JA 3OV7A 5JVHQ 2AYGA 2MZ1A 4R5PA 1WI8A 1KS2A 1NJIT 2DHGA 1O8BA 2KRBA 2VPXB 3BS9A 1SL1A 3ICLA 3H2VE 3KNGA 4PXEA 4AUKA 1LWFB 3GB0A 5J2NB 4KFBB 2DGQA 3BGOP 2ALZA 2HHSA 3MI7X 4ZPWR 5A8RB 1JQGA 2B56A 3PHTA 3IS9B 5HP1B 2Y8WA 1Z2ZA 3HD2A 2KM8C 3ENVA 2IFXA 1X0FA 1NCLA 2O5DA 4B9MA 3PR4A 4UQGA 3IA0A 5GADU 2FHJA 4ED5A 1CJTB 5F8IA 1OWXA 3ISND 3ZNUA 1SV5B 2MQMA 1VHFA 3PTWA 2R7UA 3HVRA 2IIHA 1TL7A 5DZ6A 5L38A 5E33A 3L7OA 4TN2A 1UVKA 1FNXH 3MAAB 2K1RA 1R8PA 2HWHA 4CLLA 4C9DA 3MECB 2AJ1A 3CJ3A 5U47A 3J80U 5L46A 1RLCL 3EVOA 2H5JB 3J81U 2FLPA 1N56A 2AD9A 3OQ2A 3D0GE 2CPHA 2HHTA 2VFRA 3P5TL 4C8OA 1NM2A 2GQ2A 1RHQB 4P74A 1URNA 2N4DA 2JLFA 3KK2A 3RUBL 1WF0A 4R25A 2L3MA 1KD1T 4R8UB 1WWHA 1ZAXA 5EX3A 1YZ6A 2R7VA 3NNCA 3DLLQ 2MZSA 1RWKB 3VAIA 4HTIA 2IYIA 2LECA 4EK2A 4B3RF 5DGAA 5C25A 4CLYA 4ICLA 2DNOA 2UVUA 1DQ8A 1DAXA 4MK7A 4CM2A 2G0CA 2HW3A 3IRXB 3JYTB 4ZP9A 4DFPA 3DOMB 3CJSA 4NEYA 1Q7LB 2NSBA 4DUZF 5DQGA 1FKPB 3QLHB 3ZNJ1 3CCQS 2B9XA 1NSAA 4ZPVR 4K4WA 3N9UC 3BH7B 3MEGB 1FVSA 1KOOA 3MEEB 3DLEA 1F9HA 2GJFA 4FYDA 4ECXA 4KH1B 2VKZG 3NAHA 1JLBA 3DHXA 2CJXB 1FO1A 5K8PA 2HPUA 4L75A 5HBMA 3CJ2A 2AGOA 4KKOB 4KJIA 1FFSB 2IDEA 3VZHA 3FCWA 4DI6A 1O51A 5KFJA 2E5JA 2U1AA 1AZSB 1D8ZA 4DFKA 3WIUA 4RW6A 2V2ZA 4ELTA 5L9XA 1BY9A 4YQWA 5HQ8A 2CRLA 1BQNA 1DARA 1HHQA 4P73A 4NL5A 3D5MA 4I2QA 1QSSA 3QJJA 1WNEA 2DGSA 4B3RJ 3MMCB 1J2VA 1C4AA 4ZITA 2RQKA 3LWLA 2BZ2A 2AT1B 3THVA 4DUZJ 5HROA 1PC4A 3HI9A 4ZVGA 3CC4S 2BACA 4ZPBA 2V4JB 5I4MA 4RNOA 1LWEA 1N8RT 3SXLA 1S1VA 2I8EA 2QA4S 1FRMA 1NSKL 2VFVA 2XNRA 2W01A 2X1AA 1UJ5A 3Q8QB 1VQNS 1LK5A 3JAMU 3M2RB 2Y1LB 1PKUA 2MPUA 1RHUB 5JVGQ 2EFPA 1UZDA 2MKHA 3TQEA 2D9OA 3BGRB 3K89A 4CH0S 5ETOA 3IFEA 2YKNA 2MMYA 3DM2A 3ENQA 2KRRA 3PRDA 4PABA 4O3NA 4L6V3 2Y1RI 3VAHA 3D7SB 2HK2A 2E5HA 1R8CA 3WZ0A 1WEXA 3QO9B 2RKIB 1RK8A 4DHVA 3C14A 4X62F 3PEJA 5IXUA 4JOUA 1JWWA 2YX1A 1TFYA 1VHIA 1VC6A 2FHOB 2ZWOA 1N4LA 4M5HA 4DZ6A 4IQXA 3T5JA 3R8YA 4XPEA 2QL5B 1TMJA 2DKOB 3OXGA 3BR9A 3F0NA 3SBMA 4KC5A 1XQIA 4JI0F 3RZAA 1ZM2A 2BQ3A 4YB7A 3H5SA 4I6YA 2CQIA 1U6ZA 2ATCB 1FRXA 3QWUA 3MFHA 5AJ3F 4A46A 4DDFA 2VFSA 1RT3A 5K14A 3POTB 1S76D 3CCZA 4WP8A 4ECZA 1U09A 3ZZPA 5HQLA 3M30B 1SKWA 4BC9A 3KLHA 2ZE2B 4FNHA 4FVCA 3CJTA 3JS9A 4DF4A 3UDEA 2VASA 1NNDA 2HGLA 5CYQA 1BWEA 2EG1A 4IYQA 2ZWPA 2I38A 2CZ4A 1G4CA 5D0HA 4YP3A 4TU9A 5KFCA 2OELA 2C2KB 4HACB 4EEYA 2VC1A 3C16A 3FRZA 1KLMB 2JZ5A 1I94F 4JI7F 3QATA 3B82A 3E51A 2WVDA 2MY8A 2F8HA 3SMZA 4X62J 2RQMA 2VPZB 3SDEB 4OV6A 3MM9B 1YZ7A 1JLGA 4OZLA 1NUEA 4ZPAA 5DM6Q 1U8SA 1HYSA 1FE0A 4DUYF 3B78A 4Z37A 4UOGA 4HKQA 1U49A 2FVPA 4JI0J 5GAEU 5KFDA 2VUGA 4PEOA 4WYWA 1WG5A 4JI6F 4MIAA 4Y2CA 1B7FA 5ETNA 2DR8A 1FFGB 5AJ3J 1N6QB 3LP2A 4ED0A 1OYDA 5E3AA 1RHMB 4I67A 2CPDA 3CDUA 2CQGA 3HHKA 1Q95G 2OIHA 2DNQA 1QE1B 4XO0A 1IKWB 3MHYA 3HHNB 1SJFA 1GMWA 2CQ1A 1RWUA 5L1IA 1Q5VA 3DGPA 2F8EX 4DCJB 2X51A 2BE2A 2J0XA 2XMUA 4J9OA 2C22A 1UEUA 2B8PA 1WF1A 2FZKB 4WPAA 4YEAA 1TL1A 3ZZ0A 1LWCA 3V4IA 2VG5A 3KHRA 4QJVA 1I94J 4R0EA 5DG9A 1LW2B 5CD4A 2D3UA 4DR7F 4KT0C 5CD4H 1UL3A 2V0NA 4K7QA 1S4EA 3FBEA 3ILJA 1CS4B 2CQBA 4I64A 2IRXA 3FEXB 1X5SA 2GMJA 4F4XA 2JHEA 3PNIA 4KHRA 5LJ5Y 3SCJE 2QYGA 1ZAVA 2CPYA 1X9WA 1QUVA 5KFQA 4ZVQB 2CPXA 2CDQA 1XNRF 4OYWA 4OLOA 4JI6J 4K50A 2Z2YB 1J5OA 2MZRA 5CXTA 2OPPA 4J9PA 1AROP 1SH3A 5JXSA 3MM8B 1Q79A 1M5VC 1UW9A 1RT6B 2YH1A 4LF9F 1UWBB 2RU3A 5EUHA 1SIWB 4AXIA 3C6TA 4NXNF 5KFKA 3NCPA 4QR0A 1HNVB 3KNAA 3PVXA 3PIPQ 5E7OB 2PN6A 2MLZA 1Q4RA 7FD1A 2E9ZA 4DL2A 3ISZA 3A3PB 2F3JA 4MH8A 3KJFB 3H7HB 2VODA 3UVJB 4OI0A 4IFYA 3B8HA 3H4BA 2QO3A 2P9EA 2FY1A 3QT7A 2XCAA 2VFTA 1VRTA 5FDLB 1X9MA 4DR5F 4LFCJ 4DV0J 2ZH8A 1JLFA 1Y5IB 2J9DA 2FJBB 2W24A 1B0VA 1JMTA 3M1VB 4AXJA 2LQ9A 3W62A 1OS5A 2BXJA 4QU6A 1R43A 1VRUA 3D0HE 3PX4A 1XNRJ 2W8KA 2HHHF 1RTJB 4RW8B 3M9MB 4KGZB 5B0CA 1WEYA 3OL9A 3KG0A 5LSLA 1C0TB 2G0JA 4G3IA 4ZVOB 1YBTA 4NYZA 4LF9J 3IGNA 4ALZA 4F4AA 3I55S 2XY7A 1S0OA 3S8SA 1HBOB 2BW7A 2LXUA 4AYBD 4NZ7A 2KH9A 2VIHA 1R0AB 1X4DA 2XZDB 1ICEB 3OHBA 4XTTA 4V1Ak 4ZMMA 4KO0B 1H38A 3DOKA 3W7BA 4JI4F 3LA0A 3AD9C 2UVWA 1S0MA 4DPWA 4YR3A 4QPTA 2W9CA 3D66A 2F5GA 3HT0A 4ZCLA 4OHYA 2JEFA 4WF9Q 3KOAA 3ETOA 2E29A 1D0EA 4J91A 2H4YB 5DDPC 1S1WA 1KTQA 1N5VA 4LT6A 2XSFA 3AD7C 5D8HB 2QMWA 1OY6A 2ZZTA 1WSRA 2MKYA 3R6LB 4MFBA 2NREA 4KB7A 3PR5B 3TO8A 4LSNB 2HHHJ 2O67A 1S1TB 2OD4A 2EW9A 4XDDA 5FLXY 3IS9A 1RBAA 2JNJA 2RILA 4IQMA 4EBDA 1VMBA 2YNFB 2AX0A 1WG4A 5B08A 3KDNA 1P9QC 1HNIB 3LGHA 1A6LA 5HO4A 3PO4A 1RAGB 1C4CA 4D3GA 1CJTA 1FJ7A 3Q8UA 1RKJA 4TKTA 1IBKF 1JJ2R 2MB0B 4DEZA 2XEXA 4RZRA 4C2MA 3NWGA 4F7VA 3MAAA 2W9BA 1YLXA 6AT1B 1VQ6S 2OO4A 3FZBA 3H90A 5DG8A 5KFVA 3QGIA 4JI4J 3M4XA 3CD0A 3O8WA 2ZH4A 1XN9A 2WVBA 1RDRA 5KFWA 2Q66A 2ZUGA 4EMDA 2MJUA 4JP8A 5J2QA 2BBEA 3C15B 1IKXB 2XY6A 3P8BB 1WI6A 1YRXA 4DMZA 2DITA 3A8IA 4EZ6A 1GTEA 4KIAA 5B7WA 1QVGR 2WSEC 1X31C 3IAS9 3NNAA 1RHKB 2HVDA 3NAIA 1S49A 2PI4A 3TRGA 2KYZA 4IFVB 4HLBA 3HDSA 4YHHF 2GNKA 3BZQA 1S6QB 4C0HA 3R5BA 1JNRB 3DC2A 3JQKA 4K5RA 3P4UB 3JYTA 5LXRA 2HURA 4GO5X 5HMZA 2R7WA 1UVNA 3O2IA 1FKPA 2E1PA 4EZ9A 3OL7A 3CCUS 2DJWA 2DT9A 4RU9A 3VGVA 4HT7A 2QE5A 4OIXA 3CCTA 2B9YA 4G1QB 3RJMB 3DI6A 2XMJA 2YXLA 4EFAC 1Y5LB 1Q7YT 2CWXA 2X3DA 3CGIA 8RUCA 2I5JA 2XHCA 4B08A 4TLRA 2FYXA 5CCMA 2C28A 4KKOA 3FZ2A 3WX4A 2RHQB 1AZSA 4X4UA 1LWXA 1RACB 3MTJA 4RW4B 1BC6A 3QBCA 1KWMA 2NYIA 5L1KA 2PO4A 4WFAQ 3S7RA 1U1NA 5HJYA 1D3WA 4M94A 1QTMA 3OR2A 4N76A 3PO5A 4K4UA 2V8PA 2V2KA 4CDIA 4YHHJ 1FRJA 5B0DA 3QT6A 1H3DA 1FD8A 5THWA 1DBDA 2LU2A 3BBBA 2ZHBA 4ECQA 1S9GA 2LA6A 3OTBA 1X4BA 3JSMA 2IY5B 3SEOA 3HXMA 3DU5A 1PBUA 1R7IA 4L3NA 3W2WA 4Y3CA 1Q1KA 4P7TA 3T41A 1F60B 4F3OA 2E66A 2AGQA 5D77A 1TKZA 2NSCA 4USTA 2LXFA 2GVZB 4FP9A 3CJ8A 1SC6A 3A8KA 5K20B 4Y00A 2ZBPA 5HQMA 1WC4A 1YSJA 5EDWA 2J0WA 3BGRA 1HBUB 2C2DA 4Q7AA 2VL1A 3NKYA 3NG8A 2DXDA 5E5NA 4DL4A 5D4OA 2MQQA 1IKYA 1X5PA 1ZPWX 4DCOB 1S1UB 3X1LB 4NLTA 3N79A 3TZWA 2EFNA 1VQMS 3I4PA 1WHXA 3I6PA 4ED8A 2CYYA 1TK0A 4DS4A 5AXMA 5IT9U 3GQCA 1VJQA 4BHQA 4KSEB 2JFKA 4C3MA 4LF6F 3QO9A 1S6PB 4B9TA 3DRRA 4UOCA 2HNDB 2JL9A 1SC3B 5GMEA 5MLCV 2PSZA 4DV5J 1WELA 4RW7A 2V6AA 3SSSA 1QAXA 5GAHU 3I0SA 3P5BP 3DOLB 2XC9A 5M2PA 1RSCA 1Y7PA 3Q22A 4AL6A 2CJYB 1RCOB 5E41A 2UVVA 1EQ0A 4NLSA 1KHWA 3DU6A 5HVGA 5F0WA 1F5AA 4L72B 2EI5A 2JVRA 1OIAA 5K5MA 2WSFC 1NDPA 2ZOFA 1EETB 1F3FA 3JTPA 2NZCA 2DGVA 3OHAA 1HD1A 3Q23A 2LEBA 3KUHA 4A48A 4ID5B 2RSQA 2OLWA 3AJ2A 1IN0A 5DM7Q 4CT8A 3K57A 4DF8A 2FGCA 4DL3A 1KQKA 1H72C 3SIPB 4DQQA 1SCJB 4DCPB 1KSPA 3HHLC 1VQ8S 2ALYB 4XPCA 4M95A 3K58A 2AEFA 5J2MB 3OPKA 4J9MA 2VC0A 1KLMA 4F2SA 1S9EB 2FC9A 1JX4A 2ADBA 2XG8A 4LF6J 1S0NA 3NP5A 3TA2A 2LQ5A 3W66A 5HAOA 3CMES 1PBAA 2HFZA 1PJ7A 3DLGB 2AP6A 2DNKA 3UN5A 4FS2A 1N0UA 1RWWB 3SZ2A 2RRAA 4ID8A 1REVB 2Z0GA 2A1BA 2CDRB 1WHYA 2ZVSA 4OZ2A 2MKSA 3AY0A 3KLIB 2VQEJ 2JSXA 1JKHA 4C0OC 2WVCA 4KRWA 3G96A 2N7CA 2WCXA 3TR5A 3TAMA 1QY7A 2V8VA 4I2PB 4OYBA 2R4FA 2PD1A 2IM1A 4IOBA 1RE1B 3VAJA 3C3LA 4HHUA 3OUYB 2KT5A 3EGVA 1IKWA 1UA1A 3RU0A 1RAJA 3NOCA 3VVTA 3G4SS 2WONA 2DNHA 4C8KA 3QIDA 4USMA 3O6QA 1X60A 1HARA 3MEKA 1NK6A 2XMTA 4ZPTR 1SJRA 1HWIA 5A0YB 2KB2A 3W5XA 1YRUA 2RUSA 2ZKUA 5CAAA 3EM1A 2EKYA 3O5TB 2ZITA 4O3QA 4DX7A 2AU0A 3P3DA 1RT1B 3W8PA 4JI3F 1YRTA 1RTDA 1HWKA 1CS4A 5G0RA 4NX9A 1FWKA 3DRXA 3ZTQA 2DNPA 2W2NP 1FT8A 5LMUF 5A8WA 1V3RA 5C42A 3MPYA 3A3NB 5BYSA 3V81B 4S0MA 5H9EK 1W7WA 5ETKA 3LWMA 1KP6A 3KLGB 1T9UA 2DHSA 4JBCA 7AT1B 1U8WA 4NLGA 2LEAA 1T8EA 1HNXF 2BEFA 4PYDA 2IMWP 1WOOA 2AIRB 5EWGA 3D4JA 1T9TA 1TELA 2YNIB 4CLFA 3IRWP 2MQPA 1YJRA 3T1HF 2IRUA 2XM3A 4K8RA 5J1PA 2E9RX 3DNCA 1X7VA 4J9UE 1AXQA 3NBPB 3NMAA 1GQEA 4OJGA 4JV5F 4NOHA 4Q43A 2ZJRQ 4Y2MA 4DG1A 1R89A 2FD2A 2VBXA 4Y0FA 2GMHA 2AF6A 2BJ3A 2H1YA 2ASJA 2CNKB 3UVJA 1NKCA 2K3KA 5KT4A 2XO7A 5DDRC 1JLCA 2OEKA 2OFGX 2E5IA 2OSRA 2KTQA 1SC4B 3RR7A 5FDLA 4BDPA 4JI3J 2BOPA 3GSDA 1YIJS 5DQIA 1VQYA 2B6AB 4LF4F 1TKXB 3HVTA 1F9EB 5M2UA 1OJ4A 3DYAB 2DH9A 1YJWS 4TYBA 5LMUJ 2DEJA 2CVEA 2PE8A 1N33F 4WXOA 2H48B 3HULA 5L8RC 4ETXA 4YS2A 3N28A 2VQFF 4HI1A 4LR9A 4DR1F 4LRAA 1C0TA 2J6UA 2W7OA 4AD6A 3FSIA 3BO2A 4ZA1A 1MWZA 1E6VA 2POKA 4UTGA 3KJVB 3OJUA 1HNXJ 1T9YA 1ZPVA 3MPDA 1UJ4A 1S57A 1AUSL 3CW2C 3GCWP 3EICA 4IOAQ 2LCWA 2JFDA 1FDAA 4FXVA 3W9IA 4JV5J 3BKFA 2KYXA 2MGZA 4A8MP 2C42A 5IOLA 3LPEA 2VJUA 4W90B 4OI3A 4F8RA 1DFDA 3P96A 3T5KA 4ECVA 4USIA 4PYAA 4RPFA 2WK4A 2HZVA 2R2TA 3DXSX 1YX2A 1CBKA 3X3UA 2YTCA 2H3EB 3V4MA 4LF4J 1LK7A 2BUNA 4WBFA 4BC7A 1U1OA 4K0KF 2AEMA 1EKSA 3J7A1 4HEA9 4NPOA 5KFNA 3CJ0A 4DV1F 1UKUA 3HSDA 1OSDA 3MWBA 3CULA 1WUUA 1RABB 5A2QU 4OYAA 4B17A 2R8KA 3EVMA 4ZN1A 3UD3P 1N33J 4LSNA 2VQFJ 4CTAA 4DR1J 4ZJQA 3RBEA 1ZM3A 2QJ3A 3C46A 2B4UA 4Y34A 2DGOA 4GMKA 4A8SA 2V69A 4NMXA 4OJHA 4QIWD 1QVFR 4F0MA 3EXCX 2MHEA 4DS5A 1D09B 1Q8KA 2GZOA 3G71S 1BQMA 2HMIA 4DR3F 1QDUB 2CA9A 2GIRA 2PMHA 2XSJA 4NE9C 3OVAA 4NLDA 4FPIA 5KOWA 3QGGA 5ETLA 4Z2XA 2GHPA 3OXFA 3R5DA 2F63A 1FWLA 3CT9A 1YI2S 4OFZA 2RDIA 3KLFB 5IM0B 3GYGA 2C2OB 3IMQJ 2HQGA 3CMAS 1Q53A 2C3OA 3I9ZA 4K2JA 4IR1A 1VQOS 5KFSA 4YMEA 2AJ0A 4K0KJ 5F0UA 2R7RA 2NXUA 3BSOA 4DV1J 4R5PB 4F4WA 1RWOB 2CJKA 5ETQA 1A7GE 1UAWA 5A8KA 3GG1A 3KXDA 2Z2MA 3BN4A 1TUVA 3CCES 2JLGA 3MDFA 1P1TA 3B4DA 2FLNA 2FGOA 3J7ZT 4C0BA 3M8YA 1YJNS 3Q89A 5I3PA 1VBKA 3KFWX 4C11A 3TVKA 2BYCA 2ZBRA 2XMVA 3TX0A 3AJ1A 3PW5A 1Y0HA 2ASYA 1RTZA 1NJYA 2RDDA 2H51B 1U1LA 3PYEA 4C8LA 4DR3J 4DXLA 1TL7B 3QNWB 2HRYA 3UWTA 1A0OB 2K1RB 4WKYA 1TUWA 3QRPA 4OI4A 1KNZA 4HI2A 1R6YA 1KVKA 2FJAB 4DL6A 1MMLA 3EZ5A 4C97A 3F73A 4LVNP 3BYRA 3R5JB 1C0UA 4MIBA 3WC2A 2B4VA 1WF2A 5H1SV 3KUEA 3KUGA 2HHUA 4RW4A 4GVBA 2HWIA 1M5HA 3GIKA 3A1YG 3RAQA 4WTYA 5E3PA 4B9LA 3B4MA 1F5CA 1CJVA 1M5SA 1MMNA 3I5BA 4I1TA 1W25A 2NR0A 4D3HA 2X7IA 4NYPA 1PYOB 4UQTA 2CPIA 4CCHA 4N47A 4M5GA 3J7AN 3DMJB 3SSQA 1NK8A 4ICLB 2BW2A 1GEHA 3W61A 1WTBA 3QAUA 3HHDA 3HD1A 1NK0A 2KN4A 4CO4A 1PJ5A 3BSAA 4ILLA 5BR8F 3EGNA 3HO1A 3TAPA 1CJUA 1CQNA 5AE1A 3MCOA 1K44A 3HFZB 4OHVA 3DLEB 4CNZA 2GJ2A 3UNGC 4RWWA 1EARA 1JLBB 2MKKA 1UVJA 2UUAF 1EAYC 3GFZA 4TQRA 4B9NA 3FEYB 5HBMB 4WFXA 1Q78A 3L7PA 1TUGB 3TI0A 2ZHOA 1RUSA 5EWEA 1P8GA 2DGTA 3OJSA 5C24A 5KG2A 2CUYA 3QZ8A 2LQJA 1NBEB 3T19A 2L9DA 1BQNB 4ZHRA 5I42A 2P2CB 4QIVA 1KTVA 2H65B 4F36A 2K06A 2BDPA 1SC1B 3UCZP 4C8MA 1ITPA 3Q83A 3OL6A 4RX6A 1Q8BA 4DL5A 3FSXA 1X4HA 4LRFA 4DPTA 2HNDA 2KJVA 3FCVA 2KHDA 4P71A 3MMBA 4CLKA 1HHTP 4RO0A 1HI8A 2AZ3A 2HS4A 3N01A 3W60A 5BR8J 5HROB 5KTQA 1J27A 1OMSA 4J9VA 2FPHX 1H6KX 4RKUC 2A6MA 1XIQA 4ZP7A 3EDQB 3M2UA 1QSLA 4NZ6A 2DVIA 4J9RA 1LWEB 3K17A 3T3FA 1HI0P 3QJPA 4NRUA 3H2LA 3K8VA 3K7RA 1N5YB 1S1VB 1LOUA 1R6VA 4RJVA 1GK8A 2UUAJ 2Z56B 2C3UA 1QUPA 2OPQA 3FCHA 3FBCA 4F04B 1NO8A 3UO0A 1XWLA 3HM9A 1RYSA 3HLUA 4K4YA 3OSPA 1D9FA 1FTCA 1GX6A 4OZ1A 4JI1F 4QR1A 3RTVA 4KPYA 2YKNB 3D1OA 3GIMA 3VZIA 2EC0A 1HL6A 2MTLA 2W4DA 3DM2B 1EKRA 2FHMA 3DKDA 2VG7A 3VALA 3KLVA 3NMRA 1K9MT 1VBYA 1X4CA 1RISA 2EXUA 3GILA 3NEKA 2GHVC 4ZN3A 2IYGA 2RNEA 3UR3C 2FZCB 3CD7A 2P8IA 3C14B 4DLGA 1XJWB 2JC0A 1H7WA 1KEKA 3IBFB 4USKA 1M90T 1IKVB 2YQ3A 1BLUA 3WIVA 3KJNB 1JJCB 1LEOA 3FK4A 3MTKA 4K4ZA 5B0GA 2DRDA 2P9CA 2CQ4A 3TYTA 2CQCA 1C1BA 4LVOP 5KT6A 1PIEA 3PKMA 1Q8LA 3KTQA 3U1MA 5KFPA 2FQQB 3PJWA 3VCDA 3A13A 3M32A 1FF2A 3LP1A 4Q2MA 3M8SA 3T5HA 3W8GA 3EPIA 5F8JA 5K14B 4CNYA 5IFMA 2NZ4A 1JLAB 1RU1A 3ILIA 1K73T 3NGDA 3JQMA 4V19J 1VJWA 3BO4A 2D41A 2CQHA 4JI1J 1SJ4P 4ZDNA 5C7PA 2A0FB 2J7UA 3GYXB 5CYQB 2DXFA 1SKUB 1WJ9A 1T9VA 4PG5A 1URRA 3OR1A 2B4PA 5A0YA 1VC0A 1TVRA 3IGVA 3C16B 3J80Y 5F3TA 5KFAA 3NS7B 4EWTA 3J81Y 2HHPA 3D6HB 3E01A 1NB2A 4O23A 1QTNB 5GADI 4PQUA 2YWWA 2DH7A 3V6DA 1JLGB 1WTFA 3RB0A 4TLQA 1XNQF 2C3YA 2GVDA 4DOZA 2ZJPQ 5D3GA 4NXMF 2EWHA 1UJ6A 2J9DE 3CMQA 2HBYB 4J9NA 2IJRA 4A8QA 1KRPA 2QA4G 4OLPA 3KLEB 2XYHB 5KG7A 4ECYA 2ZZMA 2VPYB 5HJXA 1ZZFA 5HLFA 3M6VA 1EQMA 1JNZB 1FE4A 4UOHA 4U7UK 3KKFA 4F3MA 2HHXA 1C2PA 2E7XA 2B7CB 2QA2A 2Z8QA 3IR6B 5ADZA 5I3UB 1AFJA 2BR0A 2E5GA 4DFMA 1Q82T 4TXSA 2R8GA 2BE2B 3ZFVA 1T05A 1ZZNA 1U45A 2UZAA 3PHEA 4OYOA 2YWEA 1TL1B 3US5A 3V4IB 2VG5B 1NK9A 4B02A 4PRFA 4WYLA 2ZOGA 4OJ1A 1RT7A 4W92B 3QT5A 1FERA 1ZBTA 2ZNZA 4DV2F 3MMAB 3ZZRA 4UY85 1XNQJ 2C2NA 4DV3F 4G1PA 1F2GA 3TAQA 1XMBA 4K5SA 1TV6A 2C3MA 3FMWA 3BKUA 1N0VC 4U6PA 3HFKA 1AUDA 3L4BC 3HT3A 3CXCR 5KFHA 2GCFA 1S48A 1YJVA 2AV5A 4CH7A 1RT5A 5L1LA 1SPBP 4FXWA 3NOGA 3KJVA 2CG8A 2JX2A 3TANA 3MGJA 4B9VA 3LANA 2WTFA 2YY3A 2BV3A 4ECSA 2UUWA 2MQNA 4CRJA 3LPYA 2W8LA 2C2EA 5CYJA 2XNQA 5AE2A 1YKWA 3GLJA 1NB7A 1MG7A 3GR1A 3M8WA 3L95X 2FC8A 4DSIA 1FEHA 2RDJA 4QQBA 2KG0A 1N48A 1H98A 4IFYB 2DNZA 2D3OR 1U4BA 3JAMY 1VRTB 2HEKA 1SQGA 2DNRA 1JLFB 1NKBA 4I56A 4Q2LA 4DV6F 4J5OA 4DV2J 4IR9A 2A3JA 1UVLA 3W1YC 4DV3J 2JEJA 2WOMA 2MDAA 5E3QA 1UW4A 3MD3A 1NHVA 1FD2A 3RRHA 1YTYA 1VRUB 5LXYA 1XK8A 1WD6A 2KHCA 2BOAA 5CYMA 2IC3B 4YB1P 2QEXS 1MU2A 1IVZA 4DFJA 2Y3YA 2RF2A 3LO3A 3PY8A 4KHPF 2HBQB 2CAJA 5AT1B 3OFGA 1BUXA 3IC1A 1UETA 5LSOA 4CO5A 1VFJA 2QMUB 4P9SA 1T95A 4ZIVA 2G0IA 2JLEA 4DU7A 3ZTRA 2BVZA 3GJRB 2UP1A 2CQ0A 2V9KA 2R2UA 2KDOA 4JI2F 4YR2A 4PZVA 3DOKB 2FJDB 2RU9A 3B6BA 3L9ZA 2XMMA 3EJMA 3N5BA 3G6YA 1HMVB 1G2EA 3S01A 3PYFA 4CYUA 2KJWA 1BQXA 3TVYA 1S1WB 4HHJA 1MN7A 1SBRA 3C2PA 4DV6J 3OVBA 1ROFA 4UW2A 3C6UA 5GAGU 3R1HA 4C4WA 1MWYA 1TAUA 4CT9A 3ZZYA 4WCEQ 4DR4F 4MFBB 1Z4UA 4CLWA 1IWGA 3N5FA 1IR1A 3VQSA 1XR7A 8AT1B 3AFGA 2ASDA 4GO7X 3FFIA 2CG4A 4O4RA 3NS6A 3CCSS 4KHPJ 4LIWA 2MHNA 4K4XA 1NKEA 4GKKF 2UUCF 1R0BG 1LV5A 2DR6A 4FF3A 1RWPB 3G6ES 4OX6A 4M5IA 4NLYA 1DLOA 4LREA 1W2BR 4X65F 5CHCB 2W9BB 3MZIA 1WOPA 1Y3JA 1FXRA 4ZJLA 1NHUA 3MEDA 4JI2J 3BQ1A 2GIFA 3HHLD 3J7Z5 2HS3A 2J76E 3B54A 2YX4A 4ECRA 2DHXA 3AB4B 1TL3A 2EFVA 4KAIA 2KFZA 2M8DB 4LSLA 4B3SF 2FHJD 5F8LA 1OYEA 5J2QB 4WJBA 2IPOB 2CPJA 3AHPA 4KGKA 4E98A 3BKTA 1UTAA 4UUXA 3GWCA 2QSWA 4X4QA 1BHNA 3G9CA 4E2FB 3VQTA 4LRBA 4BCAA 3RR8A 1SL0A 4YB6A 5GAEI 6FDRA 2D1CA 3ETMA 4WFYA 2D7SA 2AW0A 3CWJA 3D28A 1JXLA 2UUTA 5EGYA 2OD6A 5IT4A 5F9LA 4O44A 3CVKA 4BS2A 2HGMA 1L3KA 2LQ8A 3UCGA 3ZZUA 3DMJA 3D3BJ 3ZO7A 1B0PA 3OBIA 3AQOA 2ZKTA 4OYXA 3NRBA 5IQQA 2DH8A 2GA7A 3VAGA 2UUCJ 3Q86A 2IDLA 2R9LA 1K47A 3IWLA 3K5LA 3IR5B 4X65J 4P2SA 5HATA 4P7VA 2DIUA 4DX8H 4M8LA 3DI6B 3EYZA 2WAQD 4A8YA 3FNNA 5KFZA 2W2OP 1FWPA 2MEWA 3N6LA 2J6SA 2I5JB 2BKNA 2CQPA 3DLHA 2Q43A 3BH6B 3WDOA 4B3SJ 3PZPA 1E6YB 4OZ5A 4KGXB 1K1SA 2UXDF 3PRBA 2CQ3A 2E1CA 5ETVA 1Q0NA 3RRGA 2DPJA 4KYZA 3BDPA 1NZAA 2OHDA 4CM0A 3OR2B 3OVSA 4LF8F 1SKRA 3QSYB 3RBZA 1NPKA 5IS2A 4LRDA 1B0TA 3I87A 2HVIA 3PDNA 4EUVA 5LSRA 4MMOA 4USHA 3PIOQ 2ASLA 1SJ3P 3CB4A 2QTWA 1NDKA 1I1GA 2XMAA 4OHWA 4MTPA 1HW8A 2VONA 3TOQA 4Z7YA 1PYTA 1S9GB 5DZ7A 3MOZA 1YJUA 2VV5A 4EBEA 1DRZA 4QYZK 3JSMB 1S10A 4M1KA 3CC7S 4A8WA 1YHQS 5F8MA 3W2WB 3G6XA 2DBBA 1N5YA 4IH6A 1AA1B 4M5MA 2KVIA 1IQZA 1TKZB 2MXYA 4Y2AA 2BJEA 4QWDA 1KQGB 1HLWA 4LFBF 4YUDA 2CNOB 1ZOTA 3A4TA 3DLKA 4NLWA 2IVYA 4AL5A 1NK4A 1M1GA 2DCLA 2UXDJ 1H2VZ 1FRIA 3CCVS 1HBNA 2BJ1A 4X4TA 1KN6A 1N54B 1MROB 2V34A 3WX8A 4MIWA 1IKYB 5LL6d 4RNNA 2OAUA 2XS5A 3BYPA 3RAMA 4H4OA 4CLTA 4NWBA 4LF8J 1SH2A 3HVWA 1N5TA 1ELOA 2ZBQA 3NGSA 5FJ4A 4GC7A 4IRDA 2IM2A 4WIIA 4WFBQ 1EB0A 3VVUA 3V6JA 2MQOA 3DRRB 3TZYA 2DK2A 2J9CA 2BQUA 3G8TA 1IKVA 2P6TA 4URGA 4RW7B 1RAIB 4P72A 2R8HA 3I0SB 5L9NA 4WIQA 3QJLA 3VAMA 4OZ3A 3T5LA 2GFFA 1LXNA 4ZP6A 4U8YA 1VQSA 3H8YA 1RJJA 2IJFA 1FJEB 1QM9A 2BE9B 2Z4PA 2Z2LA 2XLIA 4B3MF 3PCOB 1Y5NB 1SJQA 2BX6A 1JLAA 1LW0A 4I69A 4PWDB 3LQVA 2RJZA 4LFAF 1HW9A 3CCWA 2B9WA 3C19A 2ZH5A 2CPZA 2ZH7A 3G8SA 1SQEA 2YKAA 2OPRA 5L39A 3W63A 5AE3A 3SQGA 2ILYA 3CDBA 3M8RA 3BB5A 3G6VA 1V5IB 4HDGA 2WB1D 4RBUA 4FZVA 5KG4A 3PKYA 2DXEA 1GMUA 4Z7CA 1U1RA 4ELVA 4ES3A 1YWXA 2Z57B 1JLQA 2XGPA 3W5YA 5D78A 4R0JA 5BXIA 2IA6A 5HSPA 1D9AA 4QWAA 5HVFA 4PCQA 1JKHB 5C2GA 4OZ0A 1QAIA 3DDIA 2DHAA 4NLOA 1Z1ZA 4Q8FA 3CC2S 3KLEA 3TAMB 2GJIA 3BSCA 1Q8IA 1N5SA 3R27A 4MKAA 4B3MJ 4LUBA 3R7SB 4B9SA 2HFOA 2G2ZA 3M8PA 3PM9A 2HBRB 3C8YA 2CQDA 1C1CA 4RNHA 2C3PA 2YKMB 4EI2A 1ZTWA 2R42A 5I3UA 1RT2B 2E5LF 1FXDA 2WONB 2XI3A 3AA9A 1UFLA 2A2CA 1CG2A 3HSZA 2JVOA 2HBZB 1W2IA 5H9EJ 2CPFA 4ZJOA 4OL8A 1ZH5A 3BDEA 4ZLJA 3QMQA 4JI7J 1FDNA 2ZZNA 3NCQA 4IH7A 1RTDB 3CCRS 4A8KA 5F9NA 3PW2A 2D74B 2IM0A 5G0RB 1GMWD 2YWFA 3MMAA 3VF0B 1CC7A 2HSEB 4DUYJ 2I1RA 3Q8SB 5A8WB 5C42B 2VA3A 1NPRA 2FVCA 2XZWA 3I31A 4DR2F 1WOSA 4G1IA 4PAAA 5F8NA 4QYRA 1S1XA 4HVZA 5KT3A 1MSWD 1DTTA 1F6TA 3WHIA 1B64A 2H4WB 2XS7A 2RVJA 3R2DJ 1UCNA 5MAOA 1N36F 4K59A 2FJWA 3L3CA 4CI0B 4DG1B 2LVWA 1X4GA 2UU9F 3G82A 4CLUA 1R0CB 2KU7A 3HZEA 3NXZA 1S0VA 2VB6A 3S1TA 2CADA 1JLCB 2ADCA 4OZJA 4DR7J 2VF3A 3I82A 1FKAF 2CPEA 3I96A 5KT5A 4X66F 3FEZA 3HVTB 3WBZA 3FSYA 5LT5A 3HKWA 2EBGA 4OX8A 5KFMA 4DR2J 1JXEA 3E2EA 3CIMA 4Y2KA 5KG6A 2D69A 5IT9Y 2IC3A 4LJMA 2HNZB 3Q8PB 1X9SA 1T3OA 5GMKa 5BYQA 2L9WA 3DRYA 2Y1JA 1E6VB 4DQIA 1S77D 4NLUA 5DO2A 2Q6CA 3VGSA 3M2VA 1YG0A 2RS8A 2UXBF 2QLBB 5D6GA 4NXNJ 2LKZA 4NI2A 3DLBA 1Y11A 2ROPA 4UUWA 2MY7A 3LW5C 2JOQA 5KFYA 2XBPA 2MGZB 1O5JA 3HPOA 3T9ZA 1OQ3A 4JV0A 2UU9J 4YDDB 3MR7A 2EK6A 1HMVA 2GX8A 2DB1A 3QAEA 3W9JA 2YBVA 1HQ2A 4DR5J 1U02A 3A12A 3DRSB 2LYVA 4JI8F 4X66J 4PXDA 5GAHI 2PC6A 3R5CA 2DO4A 3R1LA 1WORA 1T9WA 3MMJA 2KT3A 2VPWB 1N32F 3EE3A 1IJFB 1Y00A 2M70A 1U2FA 3J7YU 4M5DA 2APOA 4CO1A 2AZ1A 2RAQA 3IBWA 4FKYA 4WU3A 1TKTB 4C8YA 2DNGA 3GCXP 2Y0SD 4CTAB 2OSQA 2KXNB 2F65A 3OXLA 3BGFA 2AJFE 2JEIA 1M5KC 1NLKL 3ZTOA 4PG8A 3OT9A 1Q5YA 4P6QA 4I4BA 2VICA 3GTYX 1P27B 1T03A 2PEHA 2FJVA 3QIPA 3DRPA 2D3O1 2UXCF 2OP5A 3EGWB 3KG4A 1RB0A 3RB6A 4ERDA 3P6YC 1BQMB 2ZUAA 3I0RA 2HMIB 1RA7A 1WACA 5HVHA 1HNWF 1QAJA 2MQLA 2IRYA 5L1JA 2XSJB 5SUHA 4AFFA 3KHHA 4QW9A 2ILZA 2RS2A 4F4KA 4KHMA 4ATNA 4WP3A 1RZMA 1NAQA 5DLFA 3LH2S 3K2YA 2ZDOA 1M1HA 2ZVIA 4IG3A 3DDKA 4C98A 3LF0A 1FI4A 4CO3A 3W3SA 4QWBA 4PG6A 2AJ4A 3HFVA 4XK8C 5LJ3Y 1VDHA 2GAHC 2NPIA 2MLXA 3I5AA 1NZ8A 3MCMA 5A8KB 2EFQA 2U2FA 2F40A 1H0HB 4ZIWA 2IMOA 1YVFA 3RRKA 1ZA1B 4J9SA 2FUG9 4KR0B 2QLWA 4L76A 4C11B 2HWTA 2M3DA 3ZZZA 2GO8A 3LUYA 4MAKA 5B0FA 2VDHA 1G6BA 2UXCJ 2DEIA 1KQFB 3KMQA 1R8BA 4NCBA 1IBKJ 2IVMA 1BWVA 2VZ9A 1XERA 3GFYA 1HNWJ 1FJGF 4NLRA 4DN9A 1I51B 5KG3A 4NA3A 2XYPB 2HFVA 3PYDA 4XDCA 1CC8A 2YKQA 1HIYA 3W5ZA 3QFWA 2Y0BB 3V6HA 3H5YA 1RP5A 2XHWA 3SYZA 4GRSA 4RBTA 3ET6A 2RUGA 4N7TA 3IBCB 2QV6A 1C0UB 2VJVA 4GKJF 4IO1A 2H5IB 4CWBA 2GGPA 3QYYA 1E6YA 5JJBA 2ATLA 2QC3A 2GV1A 2PT0A 2YX7A 2L08A 2XO6A 4GVBB 3TUIC 2BABA 3R7NB 3HHLA 4F0KA 3NGTA 1M0SA 5T41A 2ZH2A 1WDDA 3BN7A 1CULB 3I4HX 2QN6B 3CJ4A 2HAFA 5J1EA 1CJVB 2NXCA 1ZAWA 5KG5A 5KAKA 1H7XA 1NH7A 2V4QA 3G86A 2FVQA 1R31A 5HI7A 4ER8A 2KXHA 4EGLA 3G2XA 2ACMA 3TW0A 4ECTA 3KK1B 3GIIA 2OEMA 4F26A 4OV1A 2YNGA 1GX5A 4NCGA 1CJUB 4WXWA 1FJGJ 4IOCQ 3OFFA 4O3PA 2R2SA 4WE1A 1U0SA 3Q8VA 1RT4A 3JTOA 4X4NA 1IXKA 2AX1A 3KK3B 3M9OB 1CLFA 4GKJJ 4HHHA 4W4MA 1TL5A 1VQ5S 3GYNA 3RG6A 5C24B 5E0OA 3U02A 1MROA 2GIQA 1S9FA 3WQPA 3Q2SC 3QPIA 4DN0A 3EPGA 1QJHA 3R5AA 1GT8A 2DRAA 1SQFA 5HANA 5A6PA 1PC5A 4ZHRB 5I42B 2HQIA 1OQ6A 4NLVA 4PWWA 3K0JA 1F9FA 3C66A 1NK7A 2WSCC 4ZVFA 2GQQA 2HLUA 1V3SA 3D2WA 2DPIA 4MKBA 3TJAA 1RAAB 1KR4A 2AYBA 1LFWA 2XLKA 3MMBB 3BGLA 3J81j 2ZC4A 3SQOP 3IG1A 4ITSA 4E0DA 2J0SD 4O3SA 2HNYA 1NU4A 2IAJA 1NSPA 2CQ2A 2QX0A 2RIJA 3M2UB 1HBMA 2DO0A 1U26A 2V8GA 4H4MA 5A2QY 1VR6A 4KGMA 4WWSA 1RADB 2G4BA 1X4AA 2OEJA 4RLEA 2MZQA 3UDVA 4JB8B 4N8NA 2OPQB 5DRKA 4ZLLA 3UI3A 1L3TA 3AODA 5HMWA 2JH3A 1VLOA 3DGVA 2Y9HA 2VG6A 1JK9B 2MYFA 5BJRA 3QZ7A 4PWDA 2UV8G 3TJ8A 4KPCA 3GONA 5ETSA 5ITHA 1OPZA 1U1KA 4ELUA 3MM5A 1FRKA 3LAKA 1HI1A 3GIRA 4F0HA 3RBXA 3HHEA 4TVAB 3EXYA 4PR6A 1LFPA 3LOUA 2BKOA 4UT4A 2VG7B 3ILLA 4C3KA 2BM1A 3AOCA 2OMOA 3MR5A 3KDOA 4B3TF 3MAHA 4JYAF 5KG0A 1FKOA 4Q5VA 4QW8A 4ZCIA 1BGXT 1IBLF 2H5EA 9ATCB 3GMGA 3UDLA 2UUBF 3HX9A 1VISA 2OMLA 3T9NA 2R7OA 2YNHA 3TQ1A 2QL9B 1MNEA 3CJKB 3RAXA 1C1BB 2AKWB 2BMBA 1RQ0A 1ACMB 4ES1A 3M32B 3TX8A 3LP1B 2LEPA 4Y65A 2MSSA 3M8QA 1MWQA 2NXJA 4O4GA 5C2CA 2JEGA 1IR2A 4IDKB 3BSNA 3NGRA 2XWXA 2YKMA 4DX6A 3TZZA 2CVIA 1RT2A 2V94A 2CJQA 2DY1A 4QIEA 1EX8A 2I9SA 1VRQC 2DTJA 2XB2D 5B0BA 2AYEA 1GFWB 3UD5A 2HQ3A 4ANDA 3HP6A 3R7BB 3OR1B 4FF4A 1U6FA 3TVZA 1VS3A 1TVRB 1BD6A 4B3TJ 4JYAJ 2OJ3A 5DDOC 2EVZA 3AXMA 3BPSP 1EP4A 2YH0A 4MK9A 3E01B 1IBLJ 1NSQA 4X4SA 4PQUB 3HMJG 3EZUA 2N3LA 4DL0C 3V6DB 2J9EA 2BKPA 1Y10A 2UUBJ 2GVDB 2XTJP 5D3GB 1DJ0A 4LRCA 1AW0A 3CUNA 1L3SA 3QT8A 2Y1IA 1D1UA 1OY8A 2NLWA 3LP0B 3PACA 1U1MA 2EC2A 4P2XA 1FK9A 6FD1A 5HLFB 5DG7A 3M6WA 4DV7F 1KVJA 2QLXA 4UY8T 4LF5F 3SFUA 4OJ3A 4EYHB 2IHR1 1UVMA 2HVEA 1R8HA 3NCRA 1T05B 2HKEA 3PFOA 2XI2A 2E7VA 1H2TZ 4ZVSB 2LU1A 2HZCA 2A10A 1FNMA 1FA0A 2PMWA 2O1PA 4P2MA 2HHVA 3CCMS 5EHHA 2B9EA 2CXEA 2QLFB 3HVAA 3IWXA 3TZXA 1RT7B 1U1QA 4PXCA 2RMLA 3QGPA 4J90A 4UF4A 3JSRA 2FTRA 2HVHA 3L09A 1TV6B 1HNZF 2ZD1A 4X4VA 2E9TA 2P5VA 2W9AA 2F8MA 1Q16B 1UWAA 2G9OA 4O3RA 2KM8B 1UPMB 4ES2A 2HNZA 2BANA 2L41A 3GU0A 1RT5B 2V2QA 4ED4A 2PEBA 3GZ7A 3E3XA 3UN3A 4C7QA 3PW0A 3GFHA 1T7PA 3TA0A 2BJ7A 3UQSA 1D8YA 4DV7J 4HH1A 4Y2IA 3BPDA 2X1FA 1RYRA 3PJ9A 3T1HJ 4LF5J 3EUNA 1APSA 2AWZA 2FZGB 4KE5A 2BRKA 1HQEA 2KT2A 4BBYA 2Z58B 4LF1A 4LFCF 4DV0F 1AYEA 2BE7D 4I7FA 5KFRA 4LBIA 1HPZA 4O0IA 1RWMB 3CJRA 1UA0A 3MM7A 4OHXA 3CTRA 2COLA 3KJQB 3DFEA 4KV8A 1ULRA 4TY8A 3AD8C 1GAOA 4G6VB 3DRSA 2DIVA 2M0GB 1X8DA 5KFEA 4LR7A 3CPWR 3BM7A 4NA1A 2J5AA 2SXLA 2WOMB 1SKSA 5ETTA 1SXLA 3ULHA 2JJ4D 1HNZJ 2ZEJA 2K7KA 4PUOA 2CKWA 1TKTA 2YKPA 3OTOF 3RBDA 1RTIA 1CSJA 3EMTA 4N41A 2VFUA 2FVSA 4LIRA 1UEKA 3PEHA 1QLNA 5CYMB 3ITHB 1I6JA 3VTIA 3W2VB 1MU2B 1QAYA 1NRKA 4NYOA 2RF2B 2PMZD 4U8VA 3HJFA 2M2BA 3M8ZA 2DR5A 2FB0A 4YB5A 1V9OA 3MF5A 4FBUA 1Q81T 4I6WA 2J7WA 4LSZB 3GV7B 5KFGA 2MSTA 1VIXA 2GHWA 5DDQC 1F2HA 3LGMA 2D3ZA 3BO3A 2OPSA 1PG5B 2R8JA 2KFYA 1IR0A 1CJKB 2L9NA 3MM6A 1IBMF 4LBPA 1U25A 4A8FA 3N0VA 2VBZA 3T1YF 2MLYA 4AE5A 3NGKA 1VQLS 1TL4A 4CYUB 1VQ4S 3UW1A 1LXJA 2I0XA 3WC0A 3SFGA 2K8GA 2I6WA 3MOJB 4FXDA 3TUZC 2KXFA 2NS1B 3C6UB 1K0VA 2CNLB 1TK8A 2G13A 4ZOSA 1SJ1A 1TKDA 4ED2A 3G87A 3OTOJ 1U0HA 1VQ9S 1FEEA 3P49B 3A8JA 1GMVA 1LQ9A 1CPZA 1HFEL 3FFIB 1DTQA 1SUQA 2O01C 3TP2A 1KFSA 1H73A 2W2MP 2B5JB 1S7HA 3M05A 3IN5A 3Q0AA 2C2MB 4BWMA 4B3OA 2W7AA 1DLOB 2DD8S 3H20A 3MFIA 2F9DA 1RTHA 4Q0BA 4QWCA 3PV8A 3MEDB 1XC9A 2V67A 5KT7A 2HQCA 1IBMJ 1VBXA 2B7BB 1TL3B 3T1YJ 1YJTA 2OTLS 5D0EA 1LWFA 4LSLB 5J2NA 4KFBA 1U7LA 4KY3A 5A8RA 2RD5C 4FVMA 2YQ1A 5HP1A 1FVQA 2DNLA 4LBHA 1CULA 4OI2A 2XMKA 1EHWA 5EX0A 3UNYA 1SV5A 2ZBCA 1B4SA 2RHSB 3UCUP 4O44B 3R9LA 5HN0A 2J7KA 4KGVB 2B8QA 3ENWA 1NJZA 1KVIA 3MECA 2MZTA 3KK1A 3H2UB 4C8ZA 5D0GA 1XTZA 3AOAA 5EN1A 4DUTA 1L3VA 1QD1A 1LKZA 2HG4A 2M8HA 4LR8A 1ZM9A 1EIYB 4LMZA 1ZA2B 2AYMA 3LAMA 4P52A 2VOPA 1P9YA 2R7SA 1PJ6A 2QT7A 3CCLS 2WVFA 3KHGA 4HTJA 4O0NA 1VK3A 3CCJS 5F3ZA 2XY5A 4FF1A 1S59A 2W7PA 3KK3A 3UD4P 1JXVA 2HK3A 1WC0A 4X4OA 4R8UA 4DX5A 4DL7A 3ZTSA 3ZZOA 5IC4B 2QFIA 5HMXA 3MR3A 1S6OA 2DGWA 2HVZA 2D9PA 3MXHP 4DSKA 4QYZJ 1IBCB 1TP7A 1VIOA
chains in the Genus database with same CATH topology
2ZH7A 2YNIB 3IRXA 2V8DA 3IRWP 2MQPA 2ZM6F 1YJRA 3G8SA 4GC6A 1SQEA 2YKAA 3DOMA 4QZVB 3T1HF 2IRUA 4PWUA 5J1PA 2OPRA 2E9RX 5L39A 3DNCA 1X7VA 1AXQA 3NBPB 3NMAA 1GQEA 4OJGA 4JV5F 2IA0A 4NOHA 2B51A 4Q43A 2ZJRQ 4Y2MA 3GV8B 3QLHA 4WFZA 3OTDA 4DG1A 1R89A 2FD2A 2VBXA 4Y0FA 4N56A 2GMHA 5AXKA 3SQGA 5AE3A 2AF6A 4DPOA 4TU8A 4Q8EA 2ILYA 1DTQB 5B0EA 4QU7A 3R3TA 1SUQB 3CDBA 3IR7B 3M8RA 1G7CB 3MEGA 3BEGB 3QGHA 3QWPA 3MEEA 2DR7A 3BB5A 3G6VA 2ASJA 4XIUA 3MR2A 2DNMA 2DNYA 3MPVA 1NKCA 2K3KA 5KT4A 2XO7A 1HHSA 2MZJA 4HDGA 5DDRC 2WB1D 1JLCA 4RBUA 1J5EF 2OFGX 1WHWA 4FZVA 5KG4A 1U6BA 3PKYA 2E5IA 4QIGA 2W9CB 4V19X 2ZH6A 2OSRA 2KTQA 4RBVA 3RR7A 1RGVA 1U1RA 1UFWA 2CJBA 5FDLA 3KLFA 4BDPA 4ELVA 4B3OB 2BOPA 3GSDA 2O66A 4ES3A 1YIJS 5IM0A 4CQ1A 1YWXA 5DQIA 1OO0B 3MUMP 1ZYQA 1VQYA 1P6TA 2B6AB 2R7TA 4LF4F 1TKXB 1JLQA 1RTHB 2EFGA 3HVTA 2XGPA 5M2UA 2M7SA 2PGCA 4Q0BB 4RW9A 2MKJA 3DYAB 5D78A 2DH9A 1YJWS 2RRBA 1VC5A 4TYBA 4R0JA 2J0QD 4A4JA 4H54A 3OV7A 2IA6A 2DGUA 1D9AA 4QWAA 2F1FA 2CVEA 1DHMA 5JVHQ 2AYGA 2MZ1A 4R5PA 1WI8A 1KS2A 1NJIT 2DHGA 1O8BA 4PCQA 2KRBA 2VPXB 1JKHB 3BS9A 1SL1A 2PE8A 4OZ0A 2CZVC 3ICLA 4M63A 1QAIA 3H2VE 3KNGA 1N33F 4WXOA 2DHAA 4NLOA 5L8RC 4ETXA 1S72S 4PXEA 4AUKA 1Z1ZA 4Q8FA 3N28A 1LWFB 2VQFF 4HI1A 3CC2S 3KLEA 3GB0A 5J2NB 4KFBB 3TAMB 3I9V9 4DR1F 2GJIA 2DGQA 3BSCA 1C0TA 3DLKB 2ALZA 2HHSA 1Q8IA 1N5SA 2J6UA 3MI7X 3R27A 2W7OA 4MKAA 4ZPWR 3FSIA 5A8RB 4LUBA 3BO2A 4ZA1A 4B9SA 1MWZA 1PSDA 2B56A 2HFOA 3M8PA 5F8GA 3PM9A 1E6VA 2POKA 3C8YA 1HBNB 3IS9B 5HP1B 1Z2ZA 2CQDA 2KM8C 3KJVB 3OJUA 1C1CA 4RNHA 2W4PA 1XR6A 2C3PA 2YKMB 3RW7A 3ENVA 3MMCA 1ZTWA 2IFXA 1X0FA 2O5DA 4B9MA 1ZPVA 1UJ4A 3PR4A 4UQGA 5I3UA 2V9WA 1RT2B 3IA0A 2GW8A 5GADU 2E5LF 2FHJA 4DV5F 4J9QA 1FXDA 5J2PB 4ED5A 2WONB 5F8IA 1OWXA 3ISND 2B0GA 1SV5B 2XI3A 3I56S 1R8AA 2MQMA 1VHFA 3AA9A 1UFLA 5KFFA 2LCWA 4YFUA 2JFDA 4H4OB 1FDAA 2A2CA 4FXVA 2R7UA 1CG2A 2KYXA 3HVRA 2JVOA 1XR5A 2QIFA 2MGZA 2Q79A 4A8MP 5L38A 1W2IA 2C42A 3FRYA 5E33A 5IWAF 5H9EJ 2NQPA 3L7OA 4TN2A 3DXBA 1UVKA 1FNXH 2CPFA 1R8PA 2K1RA 4W90B 2V4JA 4OL8A 1DQAA 3BDEA 4OI3A 4U67Q 4F8RA 1ZH5A 1DFDA 2HWHA 3P96A 3QMQA 3T5KA 1CEZA 4ECVA 2VBYA 4CO2A 4C9DA 3MECB 2AJ1A 3CJ3A 4USIA 2I2YA 1FDNA 5U47A 2ZZNA 3NCQA 1VQPS 2VD3A 2WK4A 4ZLPA 4IH7A 1RTDB 3CCRS 4A8KA 2R2TA 5F9NA 3DXSX 3PW2A 2D74B 2FLPA 1N56A 3D54A 3DLJA 2JRSA 4WZMA 4URSA 3X3UA 2IM0A 2YTCA 5G0RB 4WFNQ 2AD9A 2YWFA 3OQ2A 3MMAA 3D0GE 3VF0B 2ZC3A 5AXNA 1CC7A 2CPHA 1LK7A 3V4MA 1H2UX 2BUNA 2HHTA 5H9FJ 1M5PC 2VFRA 3M2RA 4DWIA 3P5TL 4BC7A 1U1OA 4LF7F 4C8OA 4K0KF 4NMLA 2I1RA 3CJKA 3Q8SB 3J7A1 4HEA9 1GXLA 2GQ2A 4NPOA 5KFNA 3CJ0A 4DV1F 5A8WB 1UKUA 1HA1A 2GMLA 5C42B 1URNA 2VA3A 2FVCA 1HQUB 1OSDA 2XZWA 3I31A 5K8OA 3MWBA 4DR2F 3CULA 2N4DA 3LGNA 2OFHX 3K5PA 3CD5A 2UV8A 2JLFA 3CJ5A 4G1IA 4B17A 3KK2A 1WF0A 2R8KA 4R25A 5F8NA 4QYRA 4DSLA 2L3MA 3UD3P 1KD1T 4R8UB 4LSNA 1WHVA 1KHVA 1TFWA 1WWHA 1ZAXA 5EX3A 1S1XA 4HVZA 5KT3A 4CTAA 1MSWD 3V5RA 3RBEA 2R7VA 3NNCA 3DLLQ 1ZM3A 1LW0B 1DTTA 2MZSA 3C46A 3VAIA 2B4UA 4Y34A 4U7CA 2DGOA 4IDKA 4HTIA 2IYIA 4GMKA 4A8SA 1A9NB 1B64A 2LECA 4B3RF 4OJHA 5DGAA 5C25A 5KFUA 3BQ0A 4QIWD 2XS7A 4ICLA 2DNOA 2UVUA 2RVJA 1DQ8A 3OW2R 1QVFR 3EXCX 1DAXA 2MHEA 4MK7A 2G0CA 2RKIA 2FDNA 3IRXB 5M2RA 5GAGI 2HW3A 3JYTB 4ZP9A 4DFPA 2OPRB 3G71S 2M9KA 5MAOA 2N4CA 1BQMA 2RRNA 1N36F 1Q7LB 4DR3F 2HMIA 2NSBA 4DUZF 5DQGA 4K59A 2FJWA 1FKPB 3QLHB 2GIRA 3L3CA 3CCQS 4CI0B 4DQSA 4DG1B 2B9XA 2LVWA 4ZPVR 2ZBIA 4K4WA 3SCLE 1X4GA 3SQGB 3N9UC 2PMHA 2XSJA 2UU9F 3PX6A 3OVAA 4NLDA 5KOWA 3MEGB 3QGGA 2KU7A 1FVSA 1KOOA 3MEEB 1VI7A 1DQ9A 3DLEA 4FYDA 4ECXA 3HZEA 4DQRA 4H4KA 1S0VA 4Z2XA 2VB6A 2GHPA 2VKZG 2HRUA 1JLBA 3NAHA 3OXFA 3LALA 3R5DA 3S1TA 1JLCB 2VQEF 2ADCA 4OZJA 1N52B 3DHXA 1FO1A 3SV4A 5K8PA 3CT9A 2KKHA 2FIUA 3I82A 1YI2S 4OFZA 2RDIA 3KLFB 1FKAF 2CPEA 2HPUA 5IM0B 4DSFA 3I96A 5HBMA 3DDNA 5KT5A 3CJ2A 3CMAS 1M1KT 2AGOA 4USJC 4RNFA 1Q53A 1JLQB 2C3OA 3I9ZA 3FEZA 3HVTB 4KKOB 4X66F 3H40A 4KJIA 1G1XA 2LDYA 3WBZA 4IR1A 3BREA 3FSYA 1VQOS 3POTA 2E1MC 4OI6A 2W25A 3VZHA 5LT5A 1UA0A 5KFSA 3HKWA 1O51A 2EBGA 4YMEA 5KFJA 4OX8A 3H25A 2AJ0A 2E5JA 2U1AA 1D8ZA 4DFKA 4RW6A 5F0UA 2R7RA 3T1AA 2NXUA 3BSOA 3M30A 3ISNC 3N6NA 4R5PB 1IQTA 4ELTA 3LP0A 4F4WA 2ZE2A 3SV3A 5K8NA 5KFMA 2CJKA 5L9XA 1BY9A 1A7GE 4YQWA 1UAWA 5HQ8A 5A8KA 2CRLA 3GG1A 5CA5A 2Z2MA 3BN4A 1JXEA 1TUVA 3E2EA 1BQNA 3TNVA 2ZNYA 1DARA 4NLQA 3CIMA 2V4RA 4Y2KA 3CCES 2JLGA 1X0PA 5KG6A 3MDFA 1P1TA 3B4DA 2FLNA 5IT9Y 2IC3A 2ZOMA 2FGOA 3U1NA 4LJMA 2HNZB 3Q8PB 3J7ZT 4NL5A 4C0BA 1T3OA 1X9SA 4IOAQ 5GMKa 5BYQA 2L9WA 4ED6A 3DRYA 1YJNS 3FJ2A 3D5MA 5I3PA 4I2QA 1FHTA 2WW8A 3KFWX 3M8PB 2HGNA 4C11A 3TVKA 2Y1JA 3JB9k 1E6VB 1QSSA 4DQIA 2BYCA 1S77D 4NLUA<