1HLWA

Structure of the h122a mutant of the nucleoside diphosphate kinase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIAGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Chemical rescue of phosphoryl transfer in a cavity mutant: a cautionary tale for site-directed mutagenesis.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2000-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1hlwA00
4W98A 1NCLA 3G2XA 1S59A 3VGUA 3ETMA 3PJ9A 2DY9A 3BBCA 3EICA 1MN7A 3EE3A 1VYAA 3Q8YA 3R9LA 1NDCA 3ZTRA 1KDNA 3Q8VA 5IOLA 4ANCA 1JXVA 1NSPA 1K44A 1XQIA 2BX6A 2HURA 3GP9A 3Q89A 1LEOA 5CABA 3Q86A 4DUTA 3VGVA 3EMTA 3FBEA 5C7PA 3BBFA 3NGUA 5BXIA 2DYAA 3ZTOA 1HHQA 1WKKA 3FKBA 3Q83A 3ENAA 3VGSA 3NGTA 1UCNA 1NDKA 3FC9A 3VVUA 2DXEA 2NCKL 1WKJA 2DXDA 3B6BA 2DXFA 3EVMA 4CP5A 1F3FA 2HVEA 3FBCA 1BE4A 1WKLA 2B8PA 3ELHA 2B8QA 1LWXA 3EVWA 3EVOA 2AZ3A 1NHKL 3B54A 2AZ1A 1NB2A 4UOFA 4KPCA 1HIYA 3DKDA 2CWKA 3WX8A 3FCWA 3FBBA 4HR2A 3DDIA 3ZTQA 1PAEX 1NLKL 1NSQA 1B99A 1BHNA 1NUEA 1S5ZA 1NSKL 3GPAA 4ANEA 4DI6A 3MPDA 4F36A 4UOGA 3BH6B 1NDLA 1ZS6A 3VVTA 1W7WA 3Q8UA 3EJMA 4ANDA 4EK2A 4DZ6A 1S57A 4C6AA 4UOHA 3ZTPA 1NPKA 1B4SA 1BUXA 2HVDA 3FBFA 1EHWA 2ZUAA 1NDPA 3PRVA 4WBFA 4FKYA 4O0NA 1U8WA 2VU5A 3EM1A 3JS9A 3BH7B 3NGSA 1XIQA 5CAAA 3BBBA 2BEFA 3L7UA 1F6TA 4FKXA 3VGTA 3FCVA 1PKUA 3ZTSA 4ENOA 4F4AA 3NGRA 1MN9A 1HLWA 4S0MA
chains in the Genus database with same CATH superfamily
3W2WB 3D0HE 4NLYA 2ZE2A 2G1HA 4P73A 3H7HB 1SQFA 4JV0A 1UL3A 4FYXB 4KPYA 2A6MA 3BV8A 1DQ9A 1I6JA 2K2PA 3C2PA 2NXCA 1RAIB 3PW5A 4DR3J 4LF5J 1BD6A 2MKYA 3UD3P 5GAHI 4P2MA 4EWTA 3DLJA 4G1QA 4N8NA 1LWXA 1R0BG 5KG0A 4GVLA 3LTOA 1BXNA 1MMNA 2XI2A 5J2NA 4AYBD 2GMLA 1GXLA 3OL8A 3LP1A 3OR1B 3DGVA 4C11A 1BHNA 2CVEA 2PN6A 3OXLA 4JI4J 1BQNA 1HQUB 4M63A 2JEGA 3HHLB 1KQGB 5T7LB 4LVNP 3HFVA 2J6TA 3T1AA 1Q79A 3W3SA 4QW9A 3OHAA 1UAWA 1H6KX 2XMMA 5J1EB 4Q2MA 3F56A 2RILA 4KQZA 2HNZB 4HL9A 4YQWA 5GMDA 2HFUA 4OHZA 2OSQA 3FGVA 4DN9A 2NREA 2KL8A 1R0AB 2P8IA 3LWLA 1T94A 4RJVA 3GV8B 3JTOA 3TVZA 3QO9A 1K0TA 2ZE2B 3VV2B 3IMQJ 1FRLA 4DV0F 4WFAQ 2CDRB 2V2KA 1F2GA 1JNZB 1VRUA 4KSEB 3GWCA 2HGNA 3MOJB 1RLCL 2MZTA 1WKKA 2QLFB 2IRYA 2C2OB 3AFGA 1J5OA 2ERRA 1NK5A 1XNRJ 1FWLA 5D4OA 2QL7B 3QPIA 4XAKA 3FEZA 3CDBA 2FVQA 4F3QA 3PV8A 3AA8A 4B9SA 4DR2F 4G1QB 4UUXA 1KKHA 1V9OA 5B0GA 4Z7YA 1YBUA 1B7YB 5J2NB 3G87A 1FJEB 2DNHA 3LP1B 4C11B 1UW4A 5LXRA 2XMVA 2HRUA 2KTQA 2HIQA 1ZM4A 4M95A 2H4WB 1FRMA 2KT5A 1L3SA 4EFAC 4EYIB 3F44A 3BPSP 4O3NA 4F3OA 2YKPA 3FUYA 1MROA 1JJHA 3QGGA 2RIJA 1ZAVA 1Q16B 2LFVA 2IIHA 3SMZA 2WVFA 4CLKA 3BKUA 3W5XA 1SL1A 1EJ7L 2HPUA 2YWKA 2MKHA 4PG7A 3OJUA 4K2XA 1J5OB 2QLXA 4WIIA 3DGPA 2H5EA 3MPYA 2ZJPQ 4LF6J 4JI0J 1FX4A 2CWKA 4BHQA 2KXNB 4G65A 4MT1A 3NS6A 4MK7A 1I94F 4FXDA 3QYYA 1Y7PA 1WEYA 1WORA 3CWJA 2FLPA 1KTQA 2HVZA 4KGMA 4GVBA 5M2RA 1YI2S 3AAWB 1FTCA 1LNQA 3O2IA 2XMWA 1X31C 4J9LA 1IN0A 2AJ0A 4QOTA 2MKKA 3MUMP 1N34J 2YH0A 4M5NA 5CZVA 2PO4A 4NXMJ 2BQRA 1NKEA 4JOUA 5CHCB 4XIUA 1VQOS 2W9BA 4BBYA 3MAAB 1RBAA 5EX3A 3QGHA 1MROB 1KOOA 1R0CB 5A6PA 3BGLA 2LECA 1RAFB 4DR6F 4AQYF 2LU1A 1HPZB 2EC2A 2DXDA 2HHHJ 3HSJA 2MKCA 1QSYA 7AT1B 4KGZB 3PW7A 5HANA 4WYLA 4UQTA 4EGLA 3QT5A 4DSIA 5DETA 3DGPB 3CO9A 4KAIA 3FMBA 3IAS9 3GFZA 2D1CA 3F73A 2DD8S 1GMVA 3D66A 2PFFB 4CO0A 5KFTA 2EXUA 3FBFA 4LF7J 4OYOA 4DX6A 2ACYA 4A48A 2HSEB 4G6VB 4ES1A 4GVBB 2M4MA 2R7RA 3H2LA 2E5LJ 1HNIA 2IC3A 3N5BA 4FBTA 1GXUA 5A76A 2OLWA 4UZBA 2W01A 3E2EA 3D4JA 1T0TV 2CPZA 1IKWA 1T05A 2DR8A 3Q8VA 1N33F 4U6PA 4WK1A 2QMUB 2W9BB 4LRBA 1LQ9A 4WE1A 2L9DA 4FF1A 2ZH4A 1WKLA 2QMXA 1WACA 3GFHA 3SFGA 5KFXA 2B43A 4Q5VA 4A8FA 3G71S 4UOFA 1HNWJ 3MWBA 5DG9A 3FCWA 3GFXA 4HR2A 2ZH6A 4TU7A 2LEPA 4ELVA 2IDEA 1RSCA 1UVLA 1FESA 3BSCA 3M2RA 2VB6A 2XHWA 1HNVA 1U2CA 5L1LA 3UD4P 2GMJA 2C3YA 2H65B 3AOCA 1TAUA 1RK8A 3GIIA 2DEIA 1S1VB 2C42A 4A47A 2J0SD 1IBMF 3DC2A 3T19A 5KT4A 1HNIB 3PM9A 2IC3B 3CCUS 4OI6A 4LMZA 4HHHA 2BJ9A 2RDIA 2ZHBA 3LO3A 1IKWB 1T05B 2ASLA 1TV6A 3EXCX 1N36F 5E3PA 2GQCA 1Q1KA 4WE1B 2O3DA 1RABB 1UEKA 2HMIA 3D3BJ 5AJ3J 3U27A 4C3LA 4ZVTB 2BJ7A 2V68A 1IBLJ 1YIJS 1DURA 2Q3PA 4ZPAA 3CDWA 1TMMA 5B0EA 4FPRA 3TQEA 2XWXA 1X4HA 1KVKA 8ATCB 2C3UA 3CDEA 2W9CB 3M2RB 1HNVB 3A8KA 1TL3A 5EWEA 2VA2A 2UVVA 1PBAA 1C1BA 2BUNA 2HS0A 2WB1D 3NL0A 1CLFA 1JKHA 2DPIA 1ITPA 2AT1B 2MHNA 2MDAA 4XTTA 1OSDA 2M52A 5KFFA 1PC5A 4F26A 2DITA 5CCLA 3HP6A 3D6HB 1IWAA 5JVGQ 5KFPA 2VL1A 3GR0A 3PFEA 1TV6B 2YQ1A 1NJXA 5HAOA 1KC8T 1HNZJ 5F9LA 2ZH5A 4DHVA 3CCRS 3DDIA 1VQ5S 1NBEB 4NPOA 2HHWA 1WELA 1FRKA 2Q79A 4KGXB 4IRKA 4KH1B 2R7UA 4YDXA 4LQ9A 2NYHA 1MMLA 1WOPA 2KXHA 2KT3A 2MSSA 5CAAA 3TI0A 4ES2A 3QFHA 3BB5A 4ZITA 2BXJA 5DDPC 1LWCA 4C8NA 4HH0A 4URQU 2LP4A 2K7JA 1TL3B 5M2PA 2B9EA 3G96A 4LFCJ 3EE3A 3W1YC 1GMUA 1C1BB 3TP2A 4B3SJ 5KFIA 1XN9A 1JKHB 4A8YA 4OZ1A 4ILRA 3OLAA 1PBUA 5L9NA 5RUBA 1JJ2R 2WSFC 1B0PA 2DNGA 2DHXA 4J9OA 3TRGA 1PJ7A 2ZH9A 2LKZA 3EVWA 1F5AA 1NHVA 4USMA 2I8EA 2IJNA 2DB1A 4KHPJ 2BW7A 4A8KA 2YWFA 3BR9A 1F9FA 1D09B 2LQ9A 4F36A 5C25A 2KM8B 1PSDA 4K50A 3KLIA 4C8KA 4DV2J 1UJ6A 5IC4B 3CCQS 4B3TJ 2X3GA 4F02A 2ZHOA 4AUKA 4YN3B 1G2EA 2AP6A 1XEZA 1LWCB 1X4CA 2HGMA 3R2CJ 2COLA 1WWHA 3HVWA 1YK9A 2CG8A 3PKMA 1Q53A 1VLOA 2A0FB 2MHEA 2YKQA 3G6ES 3N6MA 4TVAB 1UWBA 2H9ZA 2HZCA 1S49A 2Q66A 3H40A 3DM2A 2ZWPA 2ZOMA 4C3KA 3IR7B 3AQOA 3W60A 2XNQA 1ZH5A 3NS7B 5FIIA 4O4GA 2F4FA 2ZH3A 2DHSA 4DPWA 4CYUA 2KT2A 4QZVB 2VD3A 3OD2A 4TU8A 2DHAA 2X1GA 4X4NA 3ENWA 4OX9F 4E8UA 2EWHA 2FVCA 2YWGA 3DLHA 3A8IA 3IWLA 5EDWA 3VAJA 1DY3A 2V8GA 4CLLA 3B8HA 3CMAS 5KFGA 1WC0A 2YQ0A 5C25B 1RAAB 2V6AA 2UUCF 2HQGA 1KR4A 5DM6Q 3KJFB 5KFUA 3KLIB 5J2PA 1FWKA 1AXQA 3HT3A 1FJGF 1HHTP 1HFEL 1RTIA 1X4FA 3UCGA 1LWEA 2HK3A 2V2ZA 4L75A 2UXBJ 1O8BA 5HP1A 1TUWA 1VIXA 2MKIA 4NRTA 2FJBB 2HQCA 4ZVPB 1NK8A 1X0PA 1NSAA 4GC6A 2J9CA 2MJUA 2KO1A 3G82A 3FJ2A 4HI2A 1VQPS 3C6TA 1WC5A 4PWUA 3V4MA 1UWBB 4RBUA 5AE2A 4ED3A 4RW4A 1NB2A 1NKCA 1TTHB 1YHQS 4AXIA 2PA8D 2D3O1 4FF4A 3HHLD 3DM2B 2JFKA 3DDNA 4I1TA 3CC2S 2D41A 1IM6A 1YZ7A 1U6FA 2XZTB 1RBOB 4O4GB 5A6WA 4TXSA 4BC9A 4I64A 2F63A 1FFWB 1SJRA 2F4VF 1TUVA 4BLGA 4M5GA 3ZZPA 2C1EB 2FD2A 5HQMA 3G2XA 3SZ2A 3LH2S 5AXKA 4PWDB 1Q86T 3O3LA 3K89A 4QCLA 5J2PB 1XQIA 6AT1B 3TEHB 4PG8A 4RW8A 4C8OA 1RTIB 4IO9Q 4KFBB 3VVUA 3OL6A 3CCVS 3FVYA 1N5SA 1FEEA 4WIQA 3TUIC 3CXCR 4N5SA 4DPXA 1SB6A 4PXCA 3D6TB 4C97A 3MECA 2LCWA 3WX8A 2K7KA 4ZJLA 3C6TB 5IQQA 2DNOA 2XMUA 4ZCLA 2XSJB 4RW4B 5KFLA 3OW2R 3HFZB 4Y2KA 4Q44A 3GJTB 4USKA 1GMWA 2HHUA 1HWKA 3NRBA 4JV1A 3NNCA 1OPZA 1VBZA 5GAEI 1H2UX 1TL7A 3L7OA 2BM1A 3DNCA 2VOOA 4ZJOA 4NRUA 2DGSA 3L7UA 2AJFE 3MZIA 3VGTA 3CJKA 2I5JA 3L9ZA 1LXNA 2E9ZA 3EZ5A 2OSRA 2DY9A 1QTNB 1XWLA 3KTQA 3C8YA 4OYXA 3WDOA 1UETA 1UTAA 4JI1J 4ANCA 2E7XA 4LSLA 2CQBA 3JSMA 1PC4A 1W2IA 3AXKA 3T6BA 3KFWX 2CQ1A 4RW8B 1TFWA 5GADI 1M1KT 1TL5A 3BYRA 3GZ7A 2J6SA 1JLCA 4OJ3A 5KT3A 3T9NA 2V5HG 5ETOA 4KJIA 2F7VA 5HK4A 1S5ZA 3FNNA 3MECB 2XLKA 2MLZA 3KMSA 1GFWB 3N79A 3TJ9A 4WZMA 1AA1B 2XI3A 1WD6A 3OR2A 2CQDA 3BQ0A 1WJ9A 3T3FA 1FDNA 4KR0B 2MZQA 2BANA 1Y5NB 4JI2J 5HLFA 3CJ8A 1TL7B 2XLJA 2M88A 1SXLA 1RUSA 2VFRA 2LA6A 3KLGA 1X4BA 4P2FA 3IN5A 3CJKB 1R43A 2I5JB 4EZ9A 1P9QC 3GIKA 2YNIA 2BM0A 4DV7J 1S9GA 2XYHB 2DNPA 5ETMA 3R5GA 3IXQA 2B56A 5DDRC 1F60B 3OFFA 2WSEC 4ICLA 1U26A 4LSLB 3JSMB 4G3IA 2UUAJ 4JI4F 2VKZG 2AJ1A 3GJQB 3P4UB 1XMQF 4LF1A 4OYZA 2W2NP 1JLCB 2FHKA 4NLTA 2UUWA 3WC0A 2YQ3A 3I4PA 4JV5J 1U6ZA 1UVIA 1QAJA 4OHWA 1Q8IA 3KHHA 4C8ZA 1RYRA 4X84A 5L9XA 3HVRA 2ZVSA 1RHMB 1JLQA 3OR2B 3SSQA 5B0FA 3ADAC 1QVGR 5EX0A 4LR9A 2WVEA 4DSKA 2YBVA 3J7AN 1U49A 2BANB 4DUYF 5HLFB 2HBZB 4NI2A 2GIFA 3AJ1A 2B9YA 4JBCA 3KLGB 4CLSA 3DOKA 5LSLA 4C7QA 1QAIA 3ONQA 1G1XA 4DUZF 5D0HA 3VGVA 3AQPA 3HCXA 3BR8A 3ZZOA 1H2VZ 1NDKA 2YNIB 2NCKL 4OI2A 1HQEA 1FNMA 1KFDA 1S9GB 1GT8A 1TL1A 4ILMA 4NMXA 3MCMA 1NH8A 1XNQJ 4XK8C 4DV3F 2H5IB 2XMKA 3TNVA 2XGQA 2JLGA 3WQPA 1FD8A 2PGCA 3KDOA 5E0OA 2D7SA 1RAJA 1APSA 2CJYB 2JDJA 3SXLA 4YS2A 1R89A 4FYVB 3VR1A 2YH1A 3SFUA 3PIPQ 2HG4A 4YY3F 4ECUA 5JVHQ 1SIZA 5SZTA 3Q22A 3BSAA 3T1HJ 3CCZA 1RKIA 2HBQB 3Q2TC 2C22A 5EHHA 1OIAA 4DOZA 4ZJQA 5KFRA 2MPUA 2DR6A 1JLQB 2JC1A 2J6UA 2RHQB 1PYOB 3Q2SC 3CDAA 2DO4A 3I9ZA 3H42A 5K9FA 1WSVA 4K7QA 1RQ0A 3JQKA 3CT9A 3PO4A 1EQMA 2CQ0A 3CJ3A 5KG4A 3DOKB 1MU2A 4WF9Q 4DCPB 3K5OA 1PO6A 1V6HA 3W62A 3MM5A 3R8YA 4X65J 4N76A 4J9VA 1IKXA 1HQEB 2ZZTA 1IXKA 4UT4A 1KNZA 4NLSA 1TL1B 5K8OA 1XMOF 3ENVA 4J9MA 2P9GA 2AJQA 4K4ZA 3WZ0A 5DRKA 2Y0BB 4I6WA 3G8QA 2XGPA 1U47A 1N34F 1RTHA 2RMLA 2HVDA 1PYSB 4NXMF 1KRPA 4UOCA 3HHNB 5LXYA 2DIUA 3J7ZT 5DQGA 5MLCV 2R8KA 2J8AA 3DOMA 3IRXB 3LW5C 1U2FA 4NLQA 2HAFA 1TP7A 3TOQA 2NSBA 4XPCA 1FNOA 2CJQA 3L7PA 2JL9A 2KDOA 4A4JA 2QSWA 1FDDA 2JX2A 3FC9A 3P96A 3KLVA 1P1TA 1WOSA 1SC1B 2XSFA 1MU2B 3QRPA 3W65A 4RW9A 3FZBA 2M5YA 4DL4A 2W9AA 3MM5B 4QPXA 5KFEA 1HW9A 1OYEA 2G0IA 3QFWA 1ZM9A 2HAIA 4LF7F 3L3CA 4ANDA 4KV8B 1NPKA 4U7CA 4OZLA 2CWXA 4RW6A 4QR2A 4O0NA 1F9HA 1TKDA 4PRFA 5C24A 2A10A 1RTHB 3G9CA 1YWXA 3FK4A 4ILLA 3P49B 3SV3A 2R7WA 4Q8EA 1IKYA 2GJFA 4QBUA 2XHCA 3M1VB 4FNHA 2PI5A 4DV0J 3GR1A 4IQXA 4DR1J 1VHIA 4OYWA 3BBFA 1Q95G 4ZA1A 2OKQA 5HSPA 5KOXA 1JLFA 1RADB 4NEZA 2RD5C 4O0IA 5LSOA 5HQLA 1VC6A 3IAM9 3MD1A 2VV5A 4OV1A 3QZ7A 1OY9A 4ZVRB 3R7BB 4WFNQ 2HQIA 4TY9A 3ILJA 4DJBA 3EZUA 2Y8YA 2QFIA 3S8SA 2AJ2A 4DL7A 3CJTA 2XCPA 1RT2A 3Q8QB 2HLUA 2OEKA 4JI3J 4IRDA 1ZA2B 2AU0A 4YUDA 1M5HA 3KHLA 4RW6B 2OAUA 4ZOSA 1W2BR 5KG6A 2KFNA 4RUCA 3L09A 2X1BA 3KJQB 3IC1A 2XYGB 3ISZA 1RWVB 2XYPB 3SDEA 5T41A 4RNFA 1U1KA 4CO4A 2MLYA 1IKYB 1Y5LB 1UVNA 3SI8A 1XR7A 2OMOA 3NY0A 3SCKE 4QU7A 3Q83A 3ENAA 2UU9F 4I7FA 4DF8A 1IBLF 2ACMA 2OMLA 1JLFB 4Q8FA 1QE1B 1EKSA 3BM7A 1T03A 1PAEX 2G0CA 4ALZA 4K2JA 1FKAF 2M2BA 4EI2A 2WBMA 1KVIA 3PXGa 3MURP 2VUGA 1RZMA 1MWYA 1YJTA 4CI0B 3DLLQ 3DYAA 4IOBA 3O44A 1EX8A 1RT6A 2RNEA 2V8HA 3M30B 4U67Q 3QMQA 1RT2B 3C14A 3OPKA 3GIJA 2E1RA 2Q6BA 1FWPA 3EGWB 1O6XA 2B4VA 2Q1LA 2WVBA 4W98A 1H74A 3TAQA 1N5TA 2ZC4A 5C2GA 4CT9A 3GYNA 2N3LA 1QDUB 1JLEB 3ZNUA 1RI7A 5HO4A 2BX6A 4Y2IA 1LEOA 4AQYJ 1S4FA 1AT1B 2CQ4A 1BQXA 3SDEB 1J2VA 3W9JA 2YPYA 4Y2AA 1SIWB 3T9ZA 3OV7A 2RE1A 1SL2A 2RKIA 5BYRA 1CG2A 3EZOA 4DL2A 2YKNB 4N8OA 3MMAA 1Y4ZB 1UFLA 4PYAA 3PR4A 3KKFA 1QLNA 3IFEA 2WW4A 2ALYB 5ETPA 3I5BA 1T03B 2QSFA 4UOGA 2MKSA 1SVDA 3WIVA 2GS8A 4TNOA 4FBUA 4DQIA 4I68A 4NLRA 3LGMA 4LFCF 3HZEA 3DYAB 1RAOA 1RT6B 3BEGB 4RNOA 3PKYA 1OY6A 2HQFA 5KG2A 1EQ0A 2Z57B 3C14B 2AGOA 3P5BP 4I56A 5KFHA 3W66A 2AGPA 2GMHA 5KFVA 3I6PA 4V19X 3HSDA 3DN9A 4WK3A 2QV6A 3TWZA 1AB8A 4GRSA 2E66A 2HURA 1QAXA 2WOMA 9RUBA 3I82A 4ECVA 5A8RA 4FYYB 5E3QA 3TO8A 4ZLPA 2EFQA 4QJVA 1KP6A 3FZ2A 4IKAA 2RKIB 2BKNA 4RL1A 2DVIA 3MMAB 4QYRA 4LRCA 4USTA 2CZ4A 1M1HA 4DV2F 1LWFA 4B3TF 4Q45A 3DHWC 4PPDA 1TMJA 5GAGI 3PRBA 2KG0A 3NCQA 2V69A 1Y00A 4PQAA 4TQSA 2GV1A 4F4AA 4Y34A 4CLWA 2Y9HA 2QLBB 3W64A 2GW8A 1KEKA 4V1Ak 1WEXA 2Q6CA 3CJ0A 1U45A 1FRJA 1TR0A 4O23A 1ZETA 3GP9A 2EBGA 1S1XA 1DJ0A 2V0NA 2QA2A 4CLZA 2HLTA 2W4PA 3QLHA 3PX0A 2XY7A 2IY5B 5BYSA 4YHHF 5ETKA 2WOMB 4F0MA 1U0SA 3HHDA 1QM9A 2HHQA 5DLFA 3SV4A 3W2VA 5A8RB 3DHXA 2CNKB 2O1PA 5B08A 1HIYA 3TX0A 2DH8A 2VPWB 3N9UC 4OZ5A 2Q43A 2FZCB 3MGJA 4M5KA 2DO0A 3VZIA 1HR0F 1X9WA 2M3DA 1VDHA 4DI6A 4Y2CA 4F4KA 5IV4A 3N0VA 4AT1B 1HBUA 2R4FA 3UR3C 4L74A 1KWMA 4KC5A 1GX5A 5DG8A 4DSFA 5CYQA 3FQKA 2I1RA 3HSZA 1LWFB 1WI8A 2B3TB 1UJ5A 1AFIA 2BJ3A 4DR4J 4F4XA 2R8IA 3JAMU 3FQLA 1HWLA 1K0VA 3K2YA 2R7SA 4UZCA 2J9DE 4IR1A 1RKJA 2J7UA 2UXBF 4MYUA 3HX9A 2AKWB 2LQJA 3TZWA 2AEFA 3ZTRA 4YR0A 2F40A 2PIIA 2HKEA 4MIWA 2P2CB 2GGPA 4EBDA 4ZP7A 4FXVA 2LYVA 3UQSA 1OQ3A 3JSBA 1XMBA 4OZJA 2CVIA 3LQVA 2XMAA 1RU2A 5A8KA 1WC3A 2GHVC 4CRJA 2ILZA 1WNEA 2KB2A 4DFMA 3QLHB 1HWJA 5AXMA 1VC5A 2XG8A 1T9VA 3BGOP 1VQLS 4FP9A 1PGZA 1S1WA 3JQJA 3A12A 3W2VB 1TELA 2QC3A 5F9NA 4GKJF 3V6JA 2BBEA 2AV5A 2UUTA 3BO4A 3MUVP 2OD6A 3K57A 2YX7A 2R2TA 3KLHA 2AEJA 2EPIA 3Q8SB 3IS9A 4F0KA 4D3HA 3QGIA 1HBUB 2ABYA 4KIAA 4CLYA 1WSRA 2J5AA 2QZ8A 4UY8T 5H9FJ 4K59A 5CYQB 1S7IA 5H9FK 5L39A 1KQFB 2PEHA 2FDNA 5HMWA 2ZC3A 2E1CA 2RF2A 3R3TA 1A6LA 2FQQB 3CCMS 2FJVA 3RB6A 2GO9A 1Q81T 3TQ1A 4M5MA 3AJDA 1D8ZA 1U24A 1VI7A 2FLLA 1HWUA 1QUPA 5K8PA 5I3QA 2GGPB 2CDQA 2AGQA 4ZKAA 2R7XA 1TAQA 2F9DA 2PFDA 3I55S 4CH7A 4ZPCA 4X4QA 3HJFA 3GQCA 1VCTA 1D3WA 2A2CA 2IJFA 3VWSA 3UWTA 1NRKA 2GHWA 5D78A 1FFGB 1NJIT 1Q5YA 1S6UA 1F0XA 3NNAA 4KGVB 2B4UA 1S1WB 3VVTA 4JP8A 3H5XA 4QQBA 4EBEA 2DNZA 2AX1A 2VG6A 4CT8A 4ECXA 3PRVA 4LFAJ 3MEEA 5LMNJ 1UKUA 4QIFA 1G7CB 1YSJA 2WZ1A 5C5JA 4IRCA 2BE7D 3Q8RB 2VASA 3H25A 3ETMA 5J2MA 3JYTA 3BSNA 4N47A 3M6UA 1HBOB 2RF2B 3BDPA 2MQMA 4B9UA 2KH9A 5I3UA 1VQSA 3C66A 3KK3A 2CZVC 1TQLA 4YOEA 5KFWA 4XO0A 2W8KA 4QR1A 3IR6B 4RBTA 4CLFA 4OHYA 3P6YC 2Y8WA 4O44B 2VH7A 1WHXA 3QJLA 3AD8C 3OVAA 4M5IA 2GVZA 4A46A 3M8SA 2DNYA 4OX9J 1M5KC 4Z7CA 3SYZA 4Q2LA 2J7WA 2XLIA 2B4PA 4CQ1A 2UUCJ 2NUHA 1HMVA 4QU6A 2Z8QA 4F4YA 4JI6F 2ZNYA 3MUTP 3HJVA 3ISNC 4P52A 5L1IA 5LT5A 3MEEB 1FJGJ 4DV7F 4OI1A 4ECRA 2CQPA 2HYIB 3EUNA 1IR1A 4P72A 1R8CA 2EK6A 4OJ1A 1U1PA 4IOCQ 5B0BA 3KG4A 5J2MB 2J0WA 3JYTB 4ZP9A 2D9PA 1VQ8S 4ZCKA 3EMTA 4MK8A 4K5RA 2HWIA 4K4VA 3RW6A 1WTFA 5I3UB 4NLWA 4HTIA 1U1RA 4OYIA 1GXTA 3KK3B 3FFIA 3J81Y 2XEXA 4OJHA 4CZCA 3BYPA 4K4XA 3KYLA 3EVOA 3TVKA 4OYMA 5KFJA 1H7WA 5D4LA 5HVGA 1YJ7A 5HJXA 2FVPA 4L3NA 4PG4A 4ZP6A 2EKNA 3R7NB 1KOHA 2QTWA 1WHWA 1XBWA 1G4CA 2GVZB 4UOHA 3D1HA 1C4CA 3OFGA 3DRPA 4WBFA 3CMQA 2ZDOA 2HNYA 4H4KA 1OMSA 4NLDA 1HMVB 1QSSA 5L38A 4ZPBA 1HI1A 3GV7B 1S59A 4RU2A 4MK9A 2EFVA 4FYWB 1F9EB 2FHJD 3Q8YA 2JEJA 4FXWA 4LF9F 2YXLA 4F8RA 2IYIA 3OVSA 3QJPA 4HDGA 1KFSA 2DYAA 4N56A 3N01A 1R31A 3I9V9 3O5TB 4KRWA 4Y0FA 3B54A 1VR6A 4F50A 3MHYA 2DISA 1S4EA 3FFIB 1KLNA 3BQ1A 4WJBA 2ZNZA 4ECYA 4C4WA 3W2WA 1NSKL 4JI5F 4ANEA 4UQGA 5HMZA 2JH3A 1AFJA 3THVA 4J9QA 2O01C 4ZVEA 2FGOA 3QIDA 3BKTA 4IG0A 3UI3A 2QT7A 5HVFA 3DRPB 3R27A 1DHMA 1CC8A 2W7AA 2AF6A 2RS2A 5KAKA 5EN1A 4B17A 1YJ9S 1BQMA 3TUZC 4CM0A 4DLEA 3VAMA 3SCLE 1KQSR 3ZZTA 5KFKA 2RSQA 2ZOGA 4RNMA 2OH2A 4FNIA 1NZAA 3MM9A 4O3RA 5T7LA 3RAMA 3KLFA 3FBCA 3QIPA 1AUSL 2OJ3A 3OVBA 2J9EA 3GJSB 2DNRA 2WAQD 3M2VA 2CAJA 1CJUA 1RHJB 1VQYA 5KG1A 3EGZA 3EPGA 5DGAA 3P3DA 4Y3CA 2AD9A 4LF8F 4ZLJA 1GX6A 1S9FA 2EC0A 3RW7A 4YB1P 3DXBA 4YR3A 5K8MA 2CPEA 4IG0B 3BO3A 2F5GA 3E3XA 1NK7A 4DL5A 3T6JA 3W7BA 1NNDA 1QAYA 1Y5IB 1LK7A 4CO2A 1V5VA 3N4WA 4NA1A 4NYOA 1FI4A 1RU1A 4AL5A 3PDNA 2OD4A 4NZ6A 3IBFB 3I0RA 3ZNJ1 1CQNA 2D3OR 3D6MB 1U1LA 1BQMB 1UCNA 2H5JB 2E44A 2RQMA 2LQ8A 3OSNA 1FE4A 4NX9A 5BR8F 3NGDA 1XMQJ 2W4DA 3Q23A 2R3VA 3MM9B 3KG0A 3CW2C 3KLFB 3QIPB 2WCXA 2ZH1A 2OPSA 1VLYA 3R5JB 3M2VB 2NXNA 4KKOA 2BOPA 3H5SA 1FRHA 1C4AA 2DBBA 1W26A 2C2EA 1T11A 1CJUB 4DQQA 1M5SA 1YJVA 4KHMA 3QJJA 1HW8A 3BO2A 3NCRA 1FRXA 4RR5A 1K1QA 1M0SA 5E3AA 4DUYJ 2CJXB 2MZSA 3V6DA 4WU3A 2ZVIA 2ZJQQ 5I3PA 4DR1F 1E6VA 2DCUB 2BR0A 3RBDA 1N6QA 3R5CA 4DUZJ 4GMKA 2BJEA 5IQ6A 1JXLA 1FHTA 3PX6A 3E51A 4KH0B 4USJC 3J7YU 2Z2LA 1NM2A 3I0RB 3VAKA 3R5BA 5ETTA 4N41A 1TUGB 2JFDA 1N8RT 4TY8A 4ED2A 1PG5B 2N4CA 1R7IA 1DTQA 2EW9A 4DV3J 2JOQA 2AZ1A 3R2DJ 1S1UA 2BRKA 4ETZA 5EGYA 3GJRB 1VQ9S 5D3GA 1OQ6A 1N5VA 3DRSB 1B99A 2KJWA 2EBEA 4DZDA 2OPSB 2CJAA 4ED1A 4JI3F 4YY3J 1I1GA 4I69A 1L5UA 3DRYA 4L73A 3ILIA 4KKOB 1M5PC 1FK9A 1UMJA 3MAAA 2MGZA 3CC4S 4C8YA 3B4DA 1X4EA 2CFXA 3GSDA 2JC0A 1R8AA 3J81U 2VG5A 4USWA 4DV6F 1X7VA 3S1TA 1HPZA 4BS2A 3VCDA 1NPRA 2DH7A 3I5AA 1HLWA 3KNGA 3NWRA 3BS9A 5DQIA 4QR0A 3V6DB 2BVZA 2UVUA 4I2PA 2PDAA 2QJ3A 1RWMB 4Y65A 4DX5A 1UVKA 3OTDA 5F8HA 1E6VB 4ELTA 4W90B 1TKZA 3SIPB 1N54B 5F8LA 2ZD1A 1N6QB 3SBMA 1FXDA 4AXJA 4X4TA 5E33A 4RNHA 3TZYA 2DNMA 3Q8PB 1XMOJ 3QRRA 4U95A 2CPFA 4TY8B 4WKRA 1DTQB 1HBMA 2GVDA 3P8BB 1D9FA 4NLPA 1S7HA 5KT5A 2VOPA 3PEHA 1S1UB 3MR3A 1BC6A 5D3GB 4HI1A 5AXLA 3K8WA 5LJ5Y 4ZVFA 1CJKA 2V8PA 5JXSA 1VBXA 3C3LA 1FK9B 1SBRA 2MGZB 2BEFA 2MQ8A 1QUVA 2E1MC 2IRXA 4CLUA 3A4TA 3HD1A 1FKOA 2VG5B 4U8VA 1X60A 1A9NB 1PILA 1U1OA 4PR6A 2HHVA 2M9KA 4NZ0A 4I2PB 1JJ4A 2KZZA 3ENQA 4MKVA 1H98A 4IUFA 1IUJA 4C9DA 3NBPA 1TKZB 1YLXA 1LW2A 2ZD1B 3UVJB 1K1SA 1BE4A 2D74B 1ZTTA 4HHUA 1IM4A 3SCIE 4NEYA 3OTEA 2VPXB 3ICLA 1RWUA 4PQUB 1UA0A 2FZKB 4ZVOB 4OI3A 4ZLLA 4ZK7M 2RAQA 2RUGA 3ZZRA 3MFHA 3RR8A 4ECTA 2KG1A 4PG5A 1RT5A 2AQ4A 1S1VA 3W5YA 3NMRA 4USIA 2V4QA 1HBMB 2GVDB 3KDNA 4X4UA 1WDDA 1X9SA 2ZH7A 5I42A 2HHSA 3DRRA 3PO5A 1HD0A 2L41A 4F25A 4W4MA 3MMJA 3QT7A 4OYBA 5C42A 1D1UA 4OV6A 1CJKB 2CQ2A 4MMOA 2NZCA 2OGUA 1IVZA 4LREA 2B5JA 3MMCA 2KRRA 1FKOB 2ROEA 1WF0A 1Y11A 2YY3A 3RBZA 2RS8A 3CJ5A 2MQQA 1KLMA 4DS4A 4DFPA 3D3CJ 3D2WA 4TU9A 1NK0A 3U7JA 2BMBA 3TUJC 3B6BA 3UDCA 1S6PB 3A3OB 1T9TA 4EU0A 1RT7A 3PFOA 1KSPA 3UCUP 3NBPB 4DSEA 1LW2B 2W9CA 1F5BA 1S1TB 4ID5A 1NSQA 1AROP 1RWPB 3T5HA 3PTWA 1ZYQA 2F3JA 2VJVA 5KOWA 1JLGA 3S7RA 1RT5B 4EK2A 5GMEA 1MW7A 3RBEA 2AYBA 1IJEB 4LRFA 2AYGA 2YTCA 2LU2A 3HULA 4DN0A 4B9TA 5I42B 1HKAA 3MR5A 1S76D 3DRRB 2DJWA 4ECWA 1QD1A 4DCOB 4ES3A 2NXUA 3GCWP 2R2RA 2DGUA 5C42B 3AA9A 1RHKB 2R7TA 2EEYA 4P71A 1WI6A 1XERA 2YKAA 2CG4A 2B5JB 3MMCB 5IOLA 1RWNB 1RWXB 1GAOA 4MAKA 4NXNF 2HQ3A 2ASYA 5DS7A 3H20A 2UU9J 3VQSA 2F65A 5CYJA 1HYSB 1FFSB 1KLMB 1UW9A 4ITSA 1N52B 1T3NA 1S6OA 2RQCA 3A13A 5IT9U 1S48A 5E3RA 2MYFA 1PCAA 3W61A 4DCJB 2I2YA 1RT7B 1J27A 4OLOA 3TZXA 1H38A 4EO6A 5HBMA 2UUBJ 4BWMA 3WIUA 1LW0A 3HLUA 5KFYA 4ID5B 3TJ8A 2CPJA 4GO7X 3ITHA 3W9IA 4DR4F 2CPYA 4B9NA 2H1YA 2Y1RI 1EHWA 4NYZA 4P2XA 1JLGB 4FKYA 5LJ3Y 3MR7A 4USUA 4DFJA 3UDEA 1FJ7A 3N28A 3FSIA 4OHVA 1I3OB 2JRSA 1JJCB 3R1LA 4J37A 4DV5F 1U0HA 1HD1A 5HQ8A 3QAEA 2QA4S 3QWUA 1RP5A 9ATCB 3RJMB 1VRQC 4JV2A 4YB5A 4QWAA 4ERDA 1TFYA 3T5KA 5D0RA 2H54B 2BDPA 2B8PA 3MTKA 2XNRA 1VIOA 3BZQA 2OI2A 4ZN1A 3MXHP 3IR5B 4WP8A 1JXEA 2HBYB 3CJQA 2YWWA 2GC8A 2GCFA 1O5JA 2DCLA 3GB0A 1OWXA 3UO0A 3S6EA 1NDLA 1ZS6A 4X64F 2Z2MA 2R8GA 2AYMA 4C8MA 3BPDA 3M8ZA 4C6AA 1UP1A 3I4HX 1FNXH 4RW7B 5HBMB 2PA3A 3J7A1 1LW0B 3UNYA 2C3OA 2LQBA 3QSYB 3LAKA 3ITHB 2X51A 3PRDA 1XIQA 4M8LA 3C6UA 3PCOB 5D4PA 2QN6B 3MTJA 2ZZMA 5THWA 3VGUA 4DV1F 1FXRA 2R2SA 2IAJA 4ED8A 5HN0A 5G0RA 1VC0A 1HBNA 2MQPA 1U0HB 2FB0A 3NGTA 1OJ4A 5B7WA 3CC7S 4HYKA 3M8RA 2CKWA 4J91A 2RB7A 4X4OA 2XMJA 4RUAA 3RG6A 5ETLA 1K47A 4NLVA 3AXMA 4LFAF 3MMBB 4KYZA 2OP5A 5LMNF 2JLFA 4ZIVA 4LVOP 3LPYA 2G2ZA 3KOAA 1S77D 3G8TA 2APOA 5M2UA 2FHOB 3CD7A 4IFYA 2J0XA 3KK1A 4FN5A 4MTPA 3BBBA 2DGVA 4F67A 5IS2A 3U1LA 2DRAA 1YJUA 2DGXA 2X7IA 2CPDA 1WEZA 3C6UB 4B3OA 2M7SA 3H5YA 4K4WA 1YZ6A 2HQDA 2VFTA 5ETRA 2UXDF 3RYLA 4CO3A 2GAHC 3NMAA 4ZVSB 2IAJB 4OHXA 1CS4A 3HZGA 3SQGA 5G0RB 4CLPA 2JZ5A 3VZHA 2EKYA 2JHEA 2ZITA 1L3UA 4YHHJ 1HBNB 4M94A 3MD3A 1ZBTA 4CTAA 2YKMA 1S0VA 3B82A 3RRHA 4WXOA 4M5DA 2FLNA 2F8HA 1S6QB 4X4PA 3DOLA 2NXJA 1HR0J 1F3VA 4WP3A 3GIRA 3PYFA 2R8JA 2ASDA 2G4BA 2V50A 2O66A 5B0CA 4PWDA 2D3ZA 4EZ6A 4LF2A 5DZ6A 1T8EA 1D9DA 1RHUB 3N5FA 2WHOA 1HNXF 4YP3A 1V3ZA 2N82B 3AB2B 5H9EK 1FE0A 3C15A 4KFBA 3MFIA 3H90A 4IFYB 3QGPA 3KK1B 2B7CB 4J9NA 1ZM3A 4A8WA 1UA1A 3L95X 3KG1A 2DNQA 1XJWB 3OLBA 4CNZA 2YWHA 2KZMA 1S99A 4WXWA 2QEXS 4IYQA 4LSZB 4B3OB 4DR7J 2XSJA 3CE8A 3RUBL 1EIYB 2IRUA 5GMKa 3VGSA 5F8NA 1CS4B 1X5PA 3SQGB 3BN4A 4F3MA 2L3MA 4MKAA 4OX6A 1CPZA 1IBCB 1RACB 4WPAA 2V8DA 2R8HA 2V2QA 4JI7F 3KJVA 2HGLA 2W25A 4CTAB 2YKMB 4GKJJ 4M5DB 2PEBA 3FRYA 5E5NA 3DOLB 2NXEA 3T5JA 4URSA 1VS3A 3HD2A 2ILYA 2QIFA 2VBXA 1J5EF 2KJVA 3V81B 3KHGA 4NLGA 3MM8A 1UFWA 1GH8A 5JJBA 3H5UA 3HMJG 2OEJA 4RNNA 1SC3B 4OLPA 1C1CA 1ZOTA 2R7VA 2W7OA 3D1OA 3C15B 4CDIA 2QO3A 1SJ1A 2V8VA 3NOCA 3K5MA 2GA7A 4ER8A 4DF4A 5K8NA 2WBRA 4C0HA 3HKWA 1RYSA 1X5OA 2ROPA 2M70A 3C19A 5IV3A 3RTVA 4HDHA 3K59A 3MAHA 4NASA 1JWWA 2E1PA 2MJNA 2RU9A 1RTZA 5KFSA 1MLAA 4USHA 3DMJA 2AHOB 4J90A 4WFXA 1PJ6A 4WWSA 1JB0C 5D0EA 3OBIA 2FY8A 4JI8J 1ULRA 2KKHA 3KJVB 3G6VA 1T95A 3VHQA 5KG5A 2ZUAA 1NDPA 3LUYA 1U8WA 1WF2A 4HTJA 3MM8B 3J80U 2VONA 4ED5A 1TU0B 2E5GA 1P27B 1V5IB 3WX4A 3OTOF 1URNA 1C1CB 4A8XA 4DQSA 3THTA 1R8PA 3UDVA 1BWVA 2FVRA 5I4MA 3DRXA 4WKYA 1M1GA 4Y6IA 2CNLB 2IM0A 1VQKS 1D9AA 1WF1A 2HVIA 3LGHA 4PXEA 4U96A 5GAHU 4YB7A 1NAQA 3N6NA 3C46A 1YRTA 2XTJP 2VHGA 3DMJB 1Q7LB 4C0BA 3HHLC 5LM7E 1RWKB 5L8RC 2G0JA 1RJJA 2YX1A 2GO8A 5A2QU 5KT2A 4HVZA 4I6YA 2Z0GA 3CD0A 3LP2A 3K8VA 3MEGA 3D0GE 1N4LA 3IP0A 2DGTA 3VF0B 3KNAA 2MY8A 1XR5A 1GTHA 2UVWA 4JI6J 1SQGA 1C2PA 2ZBRA 5CA5A 1LFPA 1RA7A 4ZPDA 1PJ5A 3BGFA 4DPTA 3LANA 2J8SA 3NP5A 1MMDA 1AUDA 1BQNB 5F8GA 2CQHA 2POKA 3THPA 3PJXA 3R9LA 4OX8A 2L48A 1N32F 3D0IE 5KT7A 1OSCA 1WHVA 1RWWB 4PXDA 3FKBA 3TYTA 1E6YA 4OIXA 4FZVA 1SC4B 3M6XA 4N7TA 4RLEA 2V4JA 4ZDNA 2ZHAA 1S0MA 5HATA 5DLGA 4PXBA 2HZVA 5KFCA 3M8QA 3QO9B 4CLTA 3KUEA 4OI4A 4Y2MA 2XZWA 3R97A 1NUEA 1YBTA 3OUYA 2H4YB 4P10A 4RO0A 4DBQA 1VRUB 1I5OB 4M5LA 1HARA 1TKTA 1OY8A 3HVAA 1SKSA 3KUHA 2QLJB 3DFEA 1RAGB 4X66F 2MMYA 2MB0B 2IA0A 1B4SA 3LP2B 3OL9A 2LXIA 1SC6A 3M8YA 3MEGB 2V63A 4LR8A 4RU9A 5GVQA 2A3JA 1B7FA 3EDRB 4Z2XA 1JK9B 1TK8A 2G9OA 4JYAF 1IBKF 4NA3A 3R1HA 4P2SA 2V2VA 3T5LA 2BJ8A 2GNKA 1U02A 5KFOA 4LF9J 2CADA 2XS5A 4ZN3A 2QFJA 2J7KA 2JNJA 1NK6A 2VC0A 4WU2A 2N4DA 3H4BA 5F3ZA 1R6YA 3K17A 3CUNA 4A8MP 2N7CA 5D6GA 3IM9A 1I51B 2GHPA 2XY6A 4K8RA 2XQCA 2OPRA 2HWTA 3JSRA 1N48A 2NUUG 1E6YB 3CCJS 1HQ2A 3V6HA 2MQOA 1ZZNA 2V4JB 3KHRA 2DNNA 4I6AA 2BA9A 2HRYA 4JI5J 4F04B 1Z2LA 4X62F 3M8QB 3MR6A 5J1NA 3SSRA 1NPPA 3NGKA 2R7OA 3H98A 1Q8LA 3IRXA 2FY1A 3Q8UA 3RZAA 1S57A 3OUYB 2DEJA 3HK2A 4PYDA 1Z1ZA 1TKTB 1KBRA 1ROFA 4B9MA 4ZIWA 4F2RA 4X4SA 1KHVA 3BH7B 3PYGA 2XZDB 1R27B 1CSJA 2Z56B 4DR5F 4DDFA 1R8BA 4USVA 3UD5A 2BE9B 2UXCF 3UNGC 1RTDA 5ITHA 4IDKA 3H0PA 1VJWA 4DV4F 2KYXA 2JSXA 5DG7A 4DSJA 2CZ9A 4ZLNA 4HLBA 4ZHRA 3KJNB 2V67A 5EUHA 2MLXA 2HS3A 2R7QA 4KV8A 1DQAA 2K3KA 1B0VA 2DKOB 2R9LA 2EFPA 3IG1A 2X1FA 1UVJA 1SJQA 5MAOA 4YMEA 2XO6A 2OPRB 6FDRA 4H4MA 1HI0P 2VPYB 3EDQB 1WC1A 4ZVQB 2CYYA 2YPZA 1H0HB 3E8OA 4URGA 2DTJA 3RGIA 1FJCA 2C2DA 3GPAA 3PR5B 4YFUA 2ZBCA 4LF8J 3BH6B 4PAAA 3M1VA 4LR7A 4ED7A 1Y3JA 5L46A 4UF4A 2FHJA 3ILOA 3JS9A 4ECQA 2F1FA 4C8LA 2MY7A 2GIRA 1NU4A 4C2MA 2HEKA 4FKXA 3GILA 1ZM2A 5IM0A 1SUQA 2I38A 4DL0C 1M5VC 2E29A 3JQMA 2LLZA 1F2HA 3QZ8A 2OO4A 1T9WA 3EICA 4PKDB 2LMIA 2OFGX 2HFNA 4PZVA 2P9EA 2CQ3A 2GX8A 3CVKA 3HXMA 2RU3A 1RTDB 4IDKB 5JMNA 2HWHA 2OTLS 3BJYA 5LMUF 1UEUA 5BXIA 4TQRA 5BR8J 4ZHRB 3G8SA 1TZ0A 3HO1A 1RDRA 1SPBP 5JUMA 1U25A 1JMTA 3K7RA 1FXLA 2IM3A 4NLOA 1IR2A 1NJYA 4O4RA 4LRDA 3TX8A 4K0KF 1P8GA 4L72B 3IG1B 3CMES 4EBCA 3NCPA 2ZBIA 4DQPA 3HSGA 2GJ2A 5F8MA 3I87A 4H4MB 2WVDA 2LQ5A 3MPDA 1VK3A 1W7WA 4X2BA 1FDAA 4PWWA 4J9KA 3BSOA 3QRQA 2O5DA 2VU5A 3Q0AA 3UDLA 3PYEA 4CNYA 3OHBA 2MSTA 2G2OA 2B9XA 3CJSA 4NE9C 4E2FB 3AD9C 3MCSA 2H48B 4BDPA 5IM0B 1SUQB 3LGNA 1R6VA 3BF4A 2C28A 1FDBA 1QE1A 2V4RA 4DQRA 4YR2A 1VQ7S 4P6QA 5DZ7A 4ZCMA 3EWGA 2P9CA 1RHRB 4LFBF 5A0YA 3HPOA 3A3PB 3OTBA 1SL0A 1CJTA 4IH6A 2I6WA 5C7PA 3NGUA 3JAMY 5KFNA 1HA1A 5J2QA 4DPOA 3MEDA 2JEFA 1RHQB 3EVMA 3I31A 2GQQA 2IHR1 2FC9A 1XR6A 3M30A 2IM2A 4L6V3 4OZNA 4FVCA 1OO0B 3I96A 2WW8A 4WCEQ 1F5CA 1Y3KA 4ZPTR 1JLEA 1CULA 5IFMA 3AJ2A 3EGNA 1FVSA 1IQZA 4DV6J 4CH1A 3M05A 4K4SA 5CYMA 1IWGA 2HMIB 1PKUA 2N7YA 2KRBA 2PC6A 2ZM6F 1VJQA 3F0NA 1KTVA 2BQUA 1T02A 3TA2A 2YKNA 1P6TA 5KFZA 2QMWA 3RBXA 1S79A 3AT1B 1GTEA 5B0DA 1EB0A 1NXIA 2RUSA 3M9MB 5A0YB 3FRZA 3TARA 4LRAA 1CJTB 3A1YG 3PHEA 3T1YJ 3FCHA 1FF2A 4D3GA 5J2QB 2UUBF 2AZ3A 3MEDB 2YNGA 3FEXB 3CCWA 3E01A 1OS5A 4U9RA 5F3TA 1RLDA 1WC4A 3NEKA 3H8YA 1Q5VA 2M8DB 4QWCA 2Y0SD 4EMDA 3ZZZA 2G2YA 3FSYA 1C0TA 2CJ9A 3US5A 2FGCA 1CULB 2E5HA 2C3MA 2FIUA 1U48A 4B3MF 3MCOA 1CQMA 1EKRA 4OZ2A 4KY3A 5DDQC 2EK1A 4Q7AA 2W24A 2XBPA 5CYMB 2QA4G 2IVMA 4J5OA 3GYGA 1DAXA 5KTQA 1SH2A 3OXFA 4AFFA 3CD5A 1WG1A 2XM3A 2UP1A 3H2VE 3K58A 1NSPA 4B02A 2B9WA 2OUGA 5CABA 4C48A 2QA1A 5EWGA 4C3MA 3KLEA 1SCJB 1U7LA 2HS4A 3NWGA 1AYEA 4HEA9 2ZH2A 3Q24A 4E0DA 1RTJA 4WFZA 2DK2A 3DCAA 3SCJE 1O51A 3T41A 4ED6A 4W92B 2WONA 3CTRA 2VF3A 3G6XA 1NLKL 2YNGB 2KM8C 3E01B 1PIEA 4U8YA 5FD1A 3RR7A 2AIRB 3J81j 1SKRA 3OQ2A 3ETOA 4QYZJ 1U4BA 2HZAA 2RVJA 3VAGA 4QYZK 3CDUA 2MTLA 1S0NA 3FEYB 2NR0A 1C0TB 2FZGB 4XDDA 4PPZA 1Q78A 2UVRA 3BBCA 3H2UB 4OJGA 4MJKA 3MOZA 2FLOA 4DX8H 2A18A 2ZH8A 1GK8A 5KT6A 3LOUA 2DR7A 4PG6A 2ALZA 4CP5A 1O0PA 4QPTA 3CF5Q 2WTFA 3TAMA 5L1KA 3KLEB 2BRLA 2G1DA 3PYDA 3I0SA 4IQMA 1X0FA 2BYCA 3G4SS 3M9OB 2Z58B 5F8JA 1RTJB 1S9EA 2QLWA 3KMQA 2LEAA 2BABA 2WONB 1XC9A 5DQHA 3EGVA 4K4YA 1VQ4S 3V5RA 4RUHA 3GG0A 2VQEF 4O3PA 3WBZA 2IVYA 2PD1A 4KT0C 2B51A 3RAXA 3U1MA 4FYDA 3I32A 2BZ2A 2QG9B 1KVJA 4NCGA 2HVHA 3TW0A 2CQIA 4Q43A 1VHFA 1KQKA 4CYUB 2BKPA 1DFDA 1WG4A 2KYZA 4NXNJ 2DH9A 2DT9A 2DGOA 4DUTA 1RE1B 4L3KA 1HL6A 1RCOB 1NJZA 4K5SA 4DLGA 1DARA 2KHCA 2M8HA 2IBKA 4RZRA 1GNKA 3FMWA 2BW2A 2NQPA 5D4NA 3TAMB 5IWAJ 3ZTQA 1LWEB 1VQNS 5ETQA 2ZKUA 1TK5A 2NZ4A 3DLEA 3I0SB 4HT7A 4QIEA 4F0HA 5SUHA 1SJFA 2HHXA 5HP1B 4XPEA 2BACA 2LA4A 1S9EB 4ETXA 1XK8A 3GONA 3X3UA 2MZRA 1P1LA 1FD2A 3G82B 3JSYA 5CZXA 4UTGA 3NGSA 1A7GE 5D15A 1FA0A 3V4IA 3DXSX 1YJRA 4QIWD 5KG7A 4DR7F 4ID8A 4DV5J 4WFBQ 4NCGB 1VK8A 3MAQA 2GFFA 2WRMA 3W63A 4DMZA 2MZ1A 4C0OC 2EFNA 3QBCA 5FDLA 5IZHA 2LDYA 1K44A 2E5JA 4L76A 3U1NA 4RX6A 3EX7B 2QE5A 1ACMB 4H54A 3LWMA 1SV5A 2CPXA 2V34A 3IM8A 3BGUA 1U1NA 4P75A 1QSLA 3SQOP 2ADCA 3HM9A 3GTYX 3OL7A 4YB6A 1YRXA 1BWEA 1Y10A 2VIHA 3RB4A 1YX2A 3LPEA 1KD1T 4LF4F 4X64J 3WC2A 2ASJA 2C2KB 4MKBA 2VQFF 3DLEB 3KXDA 3MCNA 3O6QA 4ED4A 1HBOA 5GAEU 2IMWP 4CO5A 1PYTA 4NLUA 2ZKTA 2F9JA 2PMHA 3A8JA 3QAUA 5DO2A 2ADBA 3UN3A 1ICEB 3UE2A 1TL4A 2PI4A 5F0WA 2Y1LB 4ENOA 4DV1J 4S0MA 3R6GB 2ATLA 2HBRB 4P9SA 3V4IB 3OXGA 1RCXB 3MPUB 3HHEA 1X8DA 1G6BA 4O44A 1VBYA 1Q4RA 2OFHX 1UEVA 2MKJA 1Y0HA 3UN5A 4HHJA 2VFUA 1FX2A 5FDLB 3GLJA 3SSSA 2W2QP 4WYWA 1YQHA 2Y3YA 1YJWS 3R5AA 2AX0A 4DR3F 5FJ4A 2XMTA 4LF5F 2CPHA 5GADU 3VAFA 3PIOQ 4JI8F 1SV5B 4DU7A 2YX4A 2RDJA 3IBWA 2YWEA 5IT4A 2FJXA 2FVSA 1P9YA 2DGWA 3M6VA 4ED0A 1BY9A 2W7PA 3BN7A 3CO0P 2DRBA 3ZZUA 1B64A 2XULA 2AW0A 3NLCA 4PCQA 5E3CA 3ZTPA 2OEMA 4KTQA 2MQLA 4R8UA 4TYAA 1WTBA 3D1QA 2UV8A 4B3RJ 4O3QA 4EUVA 2XWYA 2E5IA 3J7Z5 4AL6A 1KN6A 3QSIA 2FUG9 1SJ4P 1JX4A 2CA9A 3AH6A 3HF5A 2W2MP 2NPFA 2UXDJ 3OSPA 3TEGA 2HW3A 1DQ8A 4ZCIA 4KBIA 2NYIA 4OMFG 3QT6A 2G13A 5CQGA 1FKPA 2RQ4A 2ZDPA 3MF5A 2CNOB 2BJDA 3P5TL 1XNRF 1H3DA 2J0QD 2IPOB 2B6AA 1NHUA 1WUUA 2QYGA 4DPUA 1WC6A 3W8GA 2RDDA 1YG0A 2JEIA 1U8SA 2LDIA 3VAIA 3GU0A 4TN2A 1LKZA 2J76E 4MIBA 4ELUA 1N88A 4NLXA 2A2DA 3LF0A 4DZ6A 4ICLB 4M5JA 3B4MA 1HNXJ 2ZOFA 2R2UA 4R5PA 2OELA 4AD6A 2E1AA 3MM6A 2EG1A 4DEZA 4AE5A 3GCXP 3GV5B 4R8UB 3NGRA 1RB0A 1EZZB 1X5SA 1ELOA 2C2RA 4J9RA 3BGRA 1MWQA 2VG7A 3UFCX 2A1BA 5K5MA 2Z2YB 3AB4B 3S01A 2D69A 3Q89A 1FEHA 4FS1A 2VKRA 2MQNA 1NB7A 1PAUB 2A6OA 2M0GB 3AOBA 4J9PA 1FCAA 4CM2A 4CWBA 1FKPB 1FRIA 2U2FA 1ZPVA 4NI2B 3A8EA 3ET6A 3CD6S 3D9BA 4ZP8A 4JI7J 1R8HA 2UZAA 4KPCA 4FDFA 1NJWA 1URRA 4LF6F 2ZUGA 4JI0F 4WZQA 2B6AB 2OTJS 5CD4A 1K9MT 3MM7A 1GQEA 3ZXWA 2VICA 1LV5A 2P6SA 3H59A 1J5EJ 2YKOA 3ILLA 3EXYA 4A8OA 2WVCA 3L4BC 3M9NB 4JUZA 1QY7A 3AODA 1YVFA 2FJEB 1LXJA 1N56A 4J9SA 4IO1A 4NOHA 2Y1IA 2W8LA 2YVSA 4R5PB 1FVQA 4B08A 3MM6B 2H51B 4ECSA 4FVMA 5FLXY 3CCLS 1KONA 1NDCA 4GKKJ 2FC8A 3AOAA 3BGRB 1T3OA 4BC7A 2VG7B 3UPFA 3AY0A 1HHQA 1D0EA 4IG3A 1WG5A 2OIHA 1B0TA 2PSZA 3IGNA 2CRLA 2HFSA 3F41A 2CNNB 2HVEA 5KFMA 5AE3A 2YNFA 2HHHF 2AEMA 1EARA 2DHHA 2B8QA 1NHKL 3DKDA 4F7VA 2BKOA 3N6LA 3IA0A 3ET6B 1AZSA 1X4AA 4WTOB 3A3NB 3NOGA 2DGQA 1U1MA 3EJMA 3MM7B 3B78A 1YJNS 5CH7B 3ULHA 1SJ3P 4Q0BA 4HT5A 1L3KA 2HFVA 1IKXB 4ECZA 5F41A 2DPJA 2FPHX 3M8PA 1F6TA 5B0AA 1UZHA 1WOOA 2WB4A 1A0OB 3HI9A 4QWDA 1K8AT 2CJKA 3OTOJ 2QX0A 3PEJA 2E5LF 1DRZA 1NCLA 1SH0A 2I9SA 3QQCD 2LEBA 4DSLA 1JIHA 3EPIA 3W8PA 1B3TA 1RA6A 3P45B 3RB0A 1JLAA 4NA2A 2GQ2A 2VBYA 1VQ6S 3CJ4A 4ZS6A 4H4OA 2BJ1A 3JTNA 2HK2A 1KS2A 2DXEA 4IFVA 2L08A 2NPIA 4OZ0A 3FDSA 4UW2A 4EEYA 3DOMB 3PHTA 1QTMA 3ELHA 4IG3B 2HNDA 3K5LA 4ZPVR 3DLGA 4LIRA 4F4ZA 2YNFB 4G1PA 1HNWF 3RU0A 2QL9B 2B4OA 1V3RA 4FF2A 2ZJRQ 5LOQA 1AZSB 4DR2J 2V94A 2P6TA 3HDSA 4RW9B 2B7BB 3PNIA 4BWJA 4DU8A 1NEEA 1S10A 2EI5A 2QRRA 2KU7A 3UW1A 4RWXA 4Q0BB 3OFEA 1L3TA 2JVOA 3M8PB 2VA3A 1U1QA 1NKBA 1SH3A 1AW0A 3IGVA 1N32J 1EP4A 1W25A 2GJIA 4PUOA 3X1LB 2KFYA 3DRSA 1RISA 3UCZP 5ETVA 1U09A 3J7YI 1JNRB 4BCAA 4HKQA 5C24B 3NKYA 3ZTOA 1JLAB 1D8YA 3FSXA 1REGX 1MWZA 1T9UA 3CJRA 3M32A 4EYHB 1EETA 5K20B 5K14A 4J7CA 1BMQB 4M1KA 4H4OB 5DJBA 8RUCA 2IDLA 1SQEA 4IFVB 1SKWA 3HHKA 2DR5A 1S97A 2HNDB 4MKYA 1CVJA 2K06A 1HI8A 1UZDA 5AJ3F 4ZMMA 5CXTA 3DLGB 2AMCB 5G4DA 4CIOA 1YKWA 2HFOA 1M90T 1WDTA 4X66J 3CGIA 3M2UA 5IT9Y 5KFBA 4TLRA 2PT0A 4OFZA 1SI9A 3CULA 1I94J 3PG9A 1TVRA 4JYAJ 1IBKJ 4OYPA 1X5TA 4TKTA 4TYBA 2RT3A 1MN7A 3MDFA 5T14A 4RKUC 2VDHA 2W2PP 2KHDA 3CIMA 3RB3A 2GAGC 5HVHA 1X4GA 3AHPA 5H1SV 1EP4B 4DS5A 3TAPA 4PUOB 1ZA1B 3DLBA 3EYZA 1FERA 1NZ8A 3LALA 4Z37A 3IBCB 4ZVUB 1ZAXA 4M5HA 1HWIA 3CB4A 4QIGA 3M32B 2C2MB 3NXZA 4F4WA 4X4RA 4DR6J 2N3OA 1EETB 3D5MA 5K14B 2L9WA 4X62J 2C2NA 1HNZF 2U1AA 2IBOA 1UVMA 1HHSA 2K8GA 1Q8BA 2F8EX 4NMLA 4NYPA 5U47A 2VFSA 1S12A 4I7FB 1Q82T 4QWEA 4DL3A 5AXNA 1VQMS 3KWMA 3NAHA 3LA0A 3D54A 3R6LB 2VODA 2VC1A 4MIAA 4KB7A 3CIZA 4P7TA 2WSCC 3UN2A 3EM1A 4DR5J 3M2UB 2QGFB 4RWWA 4NZ7A 3OFHA 3RRGA 3MR2A 3R7SB 3UVJA 1TVRB 2UXCJ 4O3OA 4I2QA 4KO0A 7FD1A 4DV4J 1DBDA 4PQUA 2KI2A 2VJUA 7FDRA 2X1AA 4B3SF 4LT6A 3T1YF 3D68A 3FBEA 4DXLA 2VBZA 3CPWR 2CJBA 3WHIA 1WKJA 3CSKA 1N33J 2P5VA 1F3FA 3VQTA 4QIVA 5A8WA 5FLXU 2RRBA 4RPFA 2VZ9A 2CQGA 4J9UE 3D7SB 3DU5A 4KHPF 2DHGA 3ZZ0A 3C16A 2CXEA 3BQ2A 2BQ3A 1CEZA 3U02A 4A8QA 2PMWA 4LUBA 2YNHA 1T9YA 1BUXA 1YRUA 4ZPWR 2RJZA 2XB2D 4JB8B 2HRTA 3GIMA 3GE9A 2IA6A 4UY85 1S6PA 2HHPA 4DFKA 4HH1A 5KG3A 1Q7YT 3JB9k 3PJ9A 2VPZB 3LAMA 1L3VA 5F8IA 3KUGA 2D3UA 4I2QB 5HROA 4KO0B 1S1TA 5LMUJ 1ZAWA 2VFVA 4I67A 3IO1A 4IH5A 1IBMJ 2ZFHA 2VBWA 3BKFA 4LBPA 1N0VC 3OJSA 5ETNA 3TUPA 4IOAQ 2D9OA 2GIQA 4K0KJ 1REVA 3TA1A 4NWBA 2W2OP 4G1IA 3BDEA 4GC7A 2E9TA 2K1RA 4Y00A 2X3DA 1F1BB 3FBBA 3PX4A 1N36J 5CCMA 2KVQE 5A8WB 1FT8A 1VRTA 2XCAA 4YDDB 5B09A 2BOAA 2ZEJA 2V9KA 2HIYA 1WHYA 2L9NA 4WTYA 2B0GA 1H2TZ 4EO8A 1H72C 3C16B 2ATCB 2EFOA 3PW0A 3GMGA 5E2QA 1C0UA 5GAGU 1H73A 2I0XA 2E7WA 2YNHB 1GMWD 2QYCA 4C98A 1HYSA 2BV3A 2RHSB 4P7VA 1JQGA 1IJFB 4CO1A 2IFXA 2DRDA 2LVWA 4LFBJ 3D28A 4OI0A 4U7UK 1UFKA 1GEHA 4OZ3A 5HROB 5E7OB 2W1BA 2DNKA 1SKUB 2XY5A 2MEWA 4Y28C 2OPPA 1Q0NA 2MZJA 3HFKA 3IWNC 4CH0S 3TJAA 3PJWA 4ZVGA 2K3IA 1BGXT 2IM1A 3RAQA 1REVB 5CD4H 2OPQA 3NAIA 1S1XB 2K1RB 1M5OC 5HJYA 4WP9A 3VALA 1U2RA 1VRTB 4K4TA 2RQKA 3ZZYA 3M7VA 1UWAA 4FF3A 5D0GA 2FJWA 3TA0A 2ZM6J 3FCVA 4NCAA 1N5YA 2JJ4D 2Z4PA 3ISND 3V6KA 4IR9A 2CQCA 1C0UB 2VDIA 4DX7A 1KDNA 2IJRA 1TKXA 4QWBA 3Q86A 1EAYC 3QWPA 4KGKA 1RAEB 2LXUA 5IWAF 4OQJA 3PW2A 4MH8A 3D6FB 4RW7A 1IKVA 2CPIA 5HI7A 1DZ5A 5DGBA 2C3PA 4DG1A 1NK4A 3HT0A 3K5PA 1MSWD 2OPPB 2DY1A 1LFWA 4AL7A 4PABA 2C2ZB 3UR0A 4GO5X 1FO1A 2JWNA 1RBLA 3QNWB 2MXYA 2OPQB 2PE8A 1T7PA 3JTPA 5A8KB 1RXOB 1UPMB 2ZWOA 3CCES 2IVFB 4B3MJ 4IH7A 2F8MA 3M4XA 3DU6A 1MG7A 4O3SA 1RGVA 1CJVA 3O8WA 5DDOC 4NCBA 3DI6A 1N5YB 4OYAA 3V2UC 3MI7X 3G6YA 4I4BA 3KLHB 1NMEB 2XO7A 1JXVA 5KFDA 1VOMA 3BREA 3CJ2A 3IS9B 3J80Y 3GYXB 4JI1F 5F0UA 5KFAA 5ADZA 3MMBA 3JXOA 3DLKA 3QT8A 2R42A 1TKXB 1Y9OA 4WFYA 4YEAA 2LXFA 3HKZD 1VBKA 1DLOA 5BJRA 4UUWA 3POTA 1YTYA 2AJ4A 2NSCA 2FTRA 3RRKA 1YDLA 2Z30B 4LIWA 4LJMA 4R25A 1IKVB 4KE5A 2EFGA 1S0OA 1Z2ZA 2EG2A 4DG1B 5KFQA 2AYEA 4LSNA 2OHDA 1MNEA 1RWOB 2KN4A 1N0UA 1K73T 3PW4A 3GFYA 1H7XA 3TVYA 5E41A 2KXFA 2BE2A 1DTTA 4JI2F 4DWIA 4B9VA 3I5CA 4QW8A 1CC7A 5A2QY 5HMXA 3GG1A 1YITS 2QL5B 4OL8A 1YGYA 2NS1B 1VYAA 1T9XA 1LOUA 1CJVB 1S6QA 1Z4UA 3DI6B 2VG6B 5IC6B 5AT1B 4NL5A 4E98A 6FD1A 4HACA 3VAHA 2IYGA 3PACA 2DXFA 2KVIA 1U6BA 3ZO7A 1RT4A 2RH3A 3DLKB 1N5QA 3G86A 4LBIA 2ZZNA 2UUAF 5DM7Q 1KHWA 1VISA 1X4DA 5HMYA 1DLOB 2XS2A 3POTB 4DL6A 5ETSA 1VGYA 5J1PA 2Y1JA 2GZOA 3SEOA 3HVTA 5BYQA 4N77A 2Z2ZA 1V3SA 2VQEJ 4B3RF 4JV5F 3OTCA 2JVRA 4RBVA 3QATA 4B9LA 2H3EB 4MYTA 4LSNB 3PZPA 1ZTWA 8AT1B 4FPIA 4ATNA 3W5ZA 3W9HA 2RRAA 1S72S 3CEDA 2SXLA 1NO8A 3KK2A 3ZTSA 2CIMA 3CNQP 3TANA 2BE2B 1DTTB 1MN9A 3VTIA 2F4VJ 1UJ4A 3AD7C 2DNLA 3ZC4A 1BLUA 3H4DA 3M6WA 5LL6d 3MPWA 3TZZA 2AWZA 2IMOA 5HL7Q 1TK0A 4RUBA 4P74A 1JLBA 2WK4A 2PMZD 2XC9A 3V81A 1VFJA 2ROGA 4HACB 4I0WA 4DPYA 1XTZA 3M8WA 2HFZA 1RAHB 4FS2A 4XDCA 2ZBQA 1XNQF 5D8HB 5C2CA 1RT4B 1IQTA 5H9EJ 3OT9A 1UPPA 1VMBA 1YBAA 2FJDB 4R0JA 1ZPWX 1RT3A 4F2SA 3MPVA 4MFBA 3PY8A 3K0JA 4CCHA 3ZFVA 3HVTB 2HHTA 2KFZA 2E9RX 3DDKA 3LP0A 2EVZA 2CUYA 1RT1A 3T1HF 2JLEA 1NH7A 1R3NA 2ZBPA 1LK5A 2DR9A 4LQ3A 3O1LA 2NLWA 5EWFA 3KK2B 4LBHA 1ZZFA 3D67A 3MEKA 4ZVHA 5IT0A 2RRNA 1CBKA 3I56S 3IRWP 2XS7A 1NK9A 1QVFR 2HNYB 2J9DA 4OX7A 1G3OA 4A8SA 4X65F 3OR1A 1JLBB 2V9WA 1HQUA 2FHMA 3NG8A 2W4CA 3CCTA 2UV8G 1OYDA 3HHLA 3NS5A 4LF4J 5IXUA 2E7VA 5L1JA 1Q8KA 3R5DA 5AE1A 2VQFJ 4K4UA 3K5NA 2O67A 4V19J 1FTRA 4X4VA 1X9MA 1RT3B 4U7UD 4KHRA 5J1EA 5LSRA 2FJAB 4MFBB 2FYXA 5D77A 4PEOA 2HNZA 2DIVA 3TR5A 1OPIA 4H4KC 4R0EA 4TLQA 4GKKF 1IR0A 1B70B 3LP0B 3CCSS 3GSIA 1R0AA 1RT1B 1QJHA 3PVXA 3NNHA 3IWXA
chains in the Genus database with same CATH topology
4W98A 1NCLA 3G2XA 1S59A 3VGUA 3ETMA 3PJ9A 2DY9A 3BBCA 3EICA 1MN7A 3EE3A 1VYAA 3Q8YA 3R9LA 1NDCA 3ZTRA 1KDNA 3Q8VA 5IOLA 4ANCA 1JXVA 1NSPA 1K44A 1XQIA 2BX6A 2HURA 3GP9A 3Q89A 1LEOA 5CABA 3Q86A 4DUTA 3VGVA 3EMTA 3FBEA 5C7PA 3BBFA 3NGUA 5BXIA 2DYAA 3ZTOA 1HHQA 1WKKA 3FKBA 3Q83A 3ENAA 3VGSA 3NGTA 1UCNA 1NDKA 3FC9A 3VVUA 2DXEA 2NCKL 1WKJA 2DXDA 3B6BA 2DXFA 3EVMA 4CP5A 1F3FA 2HVEA 3FBCA 1BE4A 1WKLA 2B8PA 3ELHA 2B8QA 1LWXA 3EVWA 3EVOA 2AZ3A 1NHKL 3B54A 2AZ1A 1NB2A 4UOFA 4KPCA 1HIYA 3DKDA 2CWKA 3WX8A 3FCWA 3FBBA 4HR2A 3DDIA 3ZTQA 1PAEX 1NLKL 1NSQA 1B99A 1BHNA 1NUEA 1S5ZA 1NSKL 3GPAA 4ANEA 4DI6A 3MPDA 4F36A 4UOGA 3BH6B 1NDLA 1ZS6A 3VVTA 1W7WA 3Q8UA 3EJMA 4ANDA 4EK2A 4DZ6A 1S57A 4C6AA 4UOHA 3ZTPA 1NPKA 1B4SA 1BUXA 2HVDA 3FBFA 1EHWA 2ZUAA 1NDPA 3PRVA 4WBFA 4FKYA 4O0NA 1U8WA 2VU5A 3EM1A 3JS9A 3BH7B 3NGSA 1XIQA 5CAAA 3BBBA 2BEFA 3L7UA 1F6TA 4FKXA 3VGTA 3FCVA 1PKUA 3ZTSA 4ENOA 4F4AA 3NGRA 1MN9A 1HLWA 4S0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W98 A;  1NCL A;  3G2X A;  1S59 A;  3VGU A;  3ETM A;  3PJ9 A;  2DY9 A;  3BBC A;  3EIC A;  1MN7 A;  3EE3 A;  1VYA A;  3Q8Y A;  3R9L A;  1NDC A;  3ZTR A;  1KDN A;  3Q8V A;  5IOL A;  4ANC A;  1JXV A;  1NSP A;  1K44 A;  1XQI A;  2BX6 A;  2HUR A;  3GP9 A;  3Q89 A;  1LEO A;  5CAB A;  3Q86 A;  4DUT A;  3VGV A;  3EMT A;  3FBE A;  5C7P A;  3BBF A;  3NGU A;  5BXI A;  2DYA A;  3ZTO A;  1HHQ A;  1WKK A;  3FKB A;  3Q83 A;  3ENA A;  3VGS A;  3NGT A;  1UCN A;  1NDK A;  3FC9 A;  3VVU A;  2DXE A;  2NCK L;  1WKJ A;  2DXD A;  3B6B A;  2DXF A;  3EVM A;  4CP5 A;  1F3F A;  2HVE A;  3FBC A;  1BE4 A;  1WKL A;  2B8P A;  3ELH A;  2B8Q A;  1LWX A;  3EVW A;  3EVO A;  2AZ3 A;  1NHK L;  3B54 A;  2AZ1 A;  1NB2 A;  4UOF A;  4KPC A;  1HIY A;  3DKD A;  2CWK A;  3WX8 A;  3FCW A;  3FBB A;  4HR2 A;  3DDI A;  3ZTQ A;  1PAE X;  1NLK L;  1NSQ A;  1B99 A;  1BHN A;  1NUE A;  1S5Z A;  1NSK L;  3GPA A;  4ANE A;  4DI6 A;  3MPD A;  4F36 A;  4UOG A;  3BH6 B;  1NDL A;  1ZS6 A;  3VVT A;  1W7W A;  3Q8U A;  3EJM A;  4AND A;  4EK2 A;  4DZ6 A;  1S57 A;  4C6A A;  4UOH A;  3ZTP A;  1NPK A;  1B4S A;  1BUX A;  2HVD A;  3FBF A;  1EHW A;  2ZUA A;  1NDP A;  3PRV A;  4WBF A;  4FKY A;  4O0N A;  1U8W A;  2VU5 A;  3EM1 A;  3JS9 A;  3BH7 B;  3NGS A;  1XIQ A;  5CAA A;  3BBB A;  2BEF A;  3L7U A;  1F6T A;  4FKX A;  3VGT A;  3FCV A;  1PKU A;  3ZTS A;  4ENO A;  4F4A A;  3NGR A;  1MN9 A;  1HLW A;  4S0M A; 
#chains in the Genus database with same CATH topology
 3W2W B;  3D0H E;  4NLY A;  2ZE2 A;  2G1H A;  4P73 A;  3H7H B;  1SQF A;  4JV0 A;  1UL3 A;  4FYX B;  4KPY A;  2A6M A;  3BV8 A;  1DQ9 A;  1I6J A;  2K2P A;  3C2P A;  2NXC A;  1RAI B;  3PW5 A;  4DR3 J;  4LF5 J;  1BD6 A;  2MKY A;  3UD3 P;  5GAH I;  4P2M A;  4EWT A;  3DLJ A;  4G1Q A;  4N8N A;  1LWX A;  1R0B G;  5KG0 A;  4GVL A;  3LTO A;  1BXN A;  1MMN A;  2XI2 A;  5J2N A;  4AYB D;  2GML A;  1GXL A;  3OL8 A;  3LP1 A;  3OR1 B;  3DGV A;  4C11 A;  1BHN A;  2CVE A;  2PN6 A;  3OXL A;  4JI4 J;  1BQN A;  1HQU B;  4M63 A;  2JEG A;  3HHL B;  1KQG B;  5T7L B;  4LVN P;  3HFV A;  2J6T A;  3T1A A;  1Q79 A;  3W3S A;  4QW9 A;  3OHA A;  1UAW A;  1H6K X;  2XMM A;  5J1E B;  4Q2M A;  3F56 A;  2RIL A;  4KQZ A;  2HNZ B;  4HL9 A;  4YQW A;  5GMD A;  2HFU A;  4OHZ A;  2OSQ A;  3FGV A;  4DN9 A;  2NRE A;  2KL8 A;  1R0A B;  2P8I A;  3LWL A;  1T94 A;  4RJV A;  3GV8 B;  3JTO A;  3TVZ A;  3QO9 A;  1K0T A;  2ZE2 B;  3VV2 B;  3IMQ J;  1FRL A;  4DV0 F;  4WFA Q;  2CDR B;  2V2K A;  1F2G A;  1JNZ B;  1VRU A;  4KSE B;  3GWC A;  2HGN A;  3MOJ B;  1RLC L;  2MZT A;  1WKK A;  2QLF B;  2IRY A;  2C2O B;  3AFG A;  1J5O A;  2ERR A;  1NK5 A;  1XNR J;  1FWL A;  5D4O A;  2QL7 B;  3QPI A;  4XAK A;  3FEZ A;  3CDB A;  2FVQ A;  4F3Q A;  3PV8 A;  3AA8 A;  4B9S A;  4DR2 F;  4G1Q B;  4UUX A;  1KKH A;  1V9O A;  5B0G A;  4Z7Y A;  1YBU A;  1B7Y B;  5J2N B;  3G87 A;  1FJE B;  2DNH A;  3LP1 B;  4C11 B;  1UW4 A;  5LXR A;  2XMV A;  2HRU A;  2KTQ A;  2HIQ A;  1ZM4 A;  4M95 A;  2H4W B;  1FRM A;  2KT5 A;  1L3S A;  4EFA C;  4EYI B;  3F44 A;  3BPS P;  4O3N A;  4F3O A;  2YKP A;  3FUY A;  1MRO A;  1JJH A;  3QGG A;  2RIJ A;  1ZAV A;  1Q16 B;  2LFV A;  2IIH A;  3SMZ A;  2WVF A;  4CLK A;  3BKU A;  3W5X A;  1SL1 A;  1EJ7 L;  2HPU A;  2YWK A;  2MKH A;  4PG7 A;  3OJU A;  4K2X A;  1J5O B;  2QLX A;  4WII A;  3DGP A;  2H5E A;  3MPY A;  2ZJP Q;  4LF6 J;  4JI0 J;  1FX4 A;  2CWK A;  4BHQ A;  2KXN B;  4G65 A;  4MT1 A;  3NS6 A;  4MK7 A;  1I94 F;  4FXD A;  3QYY A;  1Y7P A;  1WEY A;  1WOR A;  3CWJ A;  2FLP A;  1KTQ A;  2HVZ A;  4KGM A;  4GVB A;  5M2R A;  1YI2 S;  3AAW B;  1FTC A;  1LNQ A;  3O2I A;  2XMW A;  1X31 C;  4J9L A;  1IN0 A;  2AJ0 A;  4QOT A;  2MKK A;  3MUM P;  1N34 J;  2YH0 A;  4M5N A;  5CZV A;  2PO4 A;  4NXM J;  2BQR A;  1NKE A;  4JOU A;  5CHC B;  4XIU A;  1VQO S;  2W9B A;  4BBY A;  3MAA B;  1RBA A;  5EX3 A;  3QGH A;  1MRO B;  1KOO A;  1R0C B;  5A6P A;  3BGL A;  2LEC A;  1RAF B;  4DR6 F;  4AQY F;  2LU1 A;  1HPZ B;  2EC2 A;  2DXD A;  2HHH J;  3HSJ A;  2MKC A;  1QSY A;  7AT1 B;  4KGZ B;  3PW7 A;  5HAN A;  4WYL A;  4UQT A;  4EGL A;  3QT5 A;  4DSI A;  5DET A;  3DGP B;  3CO9 A;  4KAI A;  3FMB A;  3IAS 9;  3GFZ A;  2D1C A;  3F73 A;  2DD8 S;  1GMV A;  3D66 A;  2PFF B;  4CO0 A;  5KFT A;  2EXU A;  3FBF A;  4LF7 J;  4OYO A;  4DX6 A;  2ACY A;  4A48 A;  2HSE B;  4G6V B;  4ES1 A;  4GVB B;  2M4M A;  2R7R A;  3H2L A;  2E5L J;  1HNI A;  2IC3 A;  3N5B A;  4FBT A;  1GXU A;  5A76 A;  2OLW A;  4UZB A;  2W01 A;  3E2E A;  3D4J A;  1T0T V;  2CPZ A;  1IKW A;  1T05 A;  2DR8 A;  3Q8V A;  1N33 F;  4U6P A;  4WK1 A;  2QMU B;  2W9B B;  4LRB A;  1LQ9 A;  4WE1 A;  2L9D A;  4FF1 A;  2ZH4 A;  1WKL A;  2QMX A;  1WAC A;  3GFH A;  3SFG A;  5KFX A;  2B43 A;  4Q5V A;  4A8F A;  3G71 S;  4UOF A;  1HNW J;  3MWB A;  5DG9 A;  3FCW A;  3GFX A;  4HR2 A;  2ZH6 A;  4TU7 A;  2LEP A;  4ELV A;  2IDE A;  1RSC A;  1UVL A;  1FES A;  3BSC A;  3M2R A;  2VB6 A;  2XHW A;  1HNV A;  1U2C A;  5L1L A;  3UD4 P;  2GMJ A;  2C3Y A;  2H65 B;  3AOC A;  1TAU A;  1RK8 A;  3GII A;  2DEI A;  1S1V B;  2C42 A;  4A47 A;  2J0S D;  1IBM F;  3DC2 A;  3T19 A;  5KT4 A;  1HNI B;  3PM9 A;  2IC3 B;  3CCU S;  4OI6 A;  4LMZ A;  4HHH A;  2BJ9 A;  2RDI A;  2ZHB A;  3LO3 A;  1IKW B;  1T05 B;  2ASL A;  1TV6 A;  3EXC X;  1N36 F;  5E3P A;  2GQC A;  1Q1K A;  4WE1 B;  2O3D A;  1RAB B;  1UEK A;  2HMI A;  3D3B J;  5AJ3 J;  3U27 A;  4C3L A;  4ZVT B;  2BJ7 A;  2V68 A;  1IBL J;  1YIJ S;  1DUR A;  2Q3P A;  4ZPA A;  3CDW A;  1TMM A;  5B0E A;  4FPR A;  3TQE A;  2XWX A;  1X4H A;  1KVK A;  8ATC B;  2C3U A;  3CDE A;  2W9C B;  3M2R B;  1HNV B;  3A8K A;  1TL3 A;  5EWE A;  2VA2 A;  2UVV A;  1PBA A;  1C1B A;  2BUN A;  2HS0 A;  2WB1 D;  3NL0 A;  1CLF A;  1JKH A;  2DPI A;  1ITP A;  2AT1 B;  2MHN A;  2MDA A;  4XTT A;  1OSD A;  2M52 A;  5KFF A;  1PC5 A;  4F26 A;  2DIT A;  5CCL A;  3HP6 A;  3D6H B;  1IWA A;  5JVG Q;  5KFP A;  2VL1 A;  3GR0 A;  3PFE A;  1TV6 B;  2YQ1 A;  1NJX A;  5HAO A;  1KC8 T;  1HNZ J;  5F9L A;  2ZH5 A;  4DHV A;  3CCR S;  3DDI A;  1VQ5 S;  1NBE B;  4NPO A;  2HHW A;  1WEL A;  1FRK A;  2Q79 A;  4KGX B;  4IRK A;  4KH1 B;  2R7U A;  4YDX A;  4LQ9 A;  2NYH A;  1MML A;  1WOP A;  2KXH A;  2KT3 A;  2MSS A;  5CAA A;  3TI0 A;  4ES2 A;  3QFH A;  3BB5 A;  4ZIT A;  2BXJ A;  5DDP C;  1LWC A;  4C8N A;  4HH0 A;  4URQ U;  2LP4 A;  2K7J A;  1TL3 B;  5M2P A;  2B9E A;  3G96 A;  4LFC J;  3EE3 A;  3W1Y C;  1GMU A;  1C1B B;  3TP2 A;  4B3S J;  5KFI A;  1XN9 A;  1JKH B;  4A8Y A;  4OZ1 A;  4ILR A;  3OLA A;  1PBU A;  5L9N A;  5RUB A;  1JJ2 R;  2WSF C;  1B0P A;  2DNG A;  2DHX A;  4J9O A;  3TRG A;  1PJ7 A;  2ZH9 A;  2LKZ A;  3EVW A;  1F5A A;  1NHV A;  4USM A;  2I8E A;  2IJN A;  2DB1 A;  4KHP J;  2BW7 A;  4A8K A;  2YWF A;  3BR9 A;  1F9F A;  1D09 B;  2LQ9 A;  4F36 A;  5C25 A;  2KM8 B;  1PSD A;  4K50 A;  3KLI A;  4C8K A;  4DV2 J;  1UJ6 A;  5IC4 B;  3CCQ S;  4B3T J;  2X3G A;  4F02 A;  2ZHO A;  4AUK A;  4YN3 B;  1G2E A;  2AP6 A;  1XEZ A;  1LWC B;  1X4C A;  2HGM A;  3R2C J;  2COL A;  1WWH A;  3HVW A;  1YK9 A;  2CG8 A;  3PKM A;  1Q53 A;  1VLO A;  2A0F B;  2MHE A;  2YKQ A;  3G6E S;  3N6M A;  4TVA B;  1UWB A;  2H9Z A;  2HZC A;  1S49 A;  2Q66 A;  3H40 A;  3DM2 A;  2ZWP A;  2ZOM A;  4C3K A;  3IR7 B;  3AQO A;  3W60 A;  2XNQ A;  1ZH5 A;  3NS7 B;  5FII A;  4O4G A;  2F4F A;  2ZH3 A;  2DHS A;  4DPW A;  4CYU A;  2KT2 A;  4QZV B;  2VD3 A;  3OD2 A;  4TU8 A;  2DHA A;  2X1G A;  4X4N A;  3ENW A;  4OX9 F;  4E8U A;  2EWH A;  2FVC A;  2YWG A;  3DLH A;  3A8I A;  3IWL A;  5EDW A;  3VAJ A;  1DY3 A;  2V8G A;  4CLL A;  3B8H A;  3CMA S;  5KFG A;  1WC0 A;  2YQ0 A;  5C25 B;  1RAA B;  2V6A A;  2UUC F;  2HQG A;  1KR4 A;  5DM6 Q;  3KJF B;  5KFU A;  3KLI B;  5J2P A;  1FWK A;  1AXQ A;  3HT3 A;  1FJG F;  1HHT P;  1HFE L;  1RTI A;  1X4F A;  3UCG A;  1LWE A;  2HK3 A;  2V2Z A;  4L75 A;  2UXB J;  1O8B A;  5HP1 A;  1TUW A;  1VIX A;  2MKI A;  4NRT A;  2FJB B;  2HQC A;  4ZVP B;  1NK8 A;  1X0P A;  1NSA A;  4GC6 A;  2J9C A;  2MJU A;  2KO1 A;  3G82 A;  3FJ2 A;  4HI2 A;  1VQP S;  3C6T A;  1WC5 A;  4PWU A;  3V4M A;  1UWB B;  4RBU A;  5AE2 A;  4ED3 A;  4RW4 A;  1NB2 A;  1NKC A;  1TTH B;  1YHQ S;  4AXI A;  2PA8 D;  2D3O 1;  4FF4 A;  3HHL D;  3DM2 B;  2JFK A;  3DDN A;  4I1T A;  3CC2 S;  2D41 A;  1IM6 A;  1YZ7 A;  1U6F A;  2XZT B;  1RBO B;  4O4G B;  5A6W A;  4TXS A;  4BC9 A;  4I64 A;  2F63 A;  1FFW B;  1SJR A;  2F4V F;  1TUV A;  4BLG A;  4M5G A;  3ZZP A;  2C1E B;  2FD2 A;  5HQM A;  3G2X A;  3SZ2 A;  3LH2 S;  5AXK A;  4PWD B;  1Q86 T;  3O3L A;  3K89 A;  4QCL A;  5J2P B;  1XQI A;  6AT1 B;  3TEH B;  4PG8 A;  4RW8 A;  4C8O A;  1RTI B;  4IO9 Q;  4KFB B;  3VVU A;  3OL6 A;  3CCV S;  3FVY A;  1N5S A;  1FEE A;  4WIQ A;  3TUI C;  3CXC R;  4N5S A;  4DPX A;  1SB6 A;  4PXC A;  3D6T B;  4C97 A;  3MEC A;  2LCW A;  3WX8 A;  2K7K A;  4ZJL A;  3C6T B;  5IQQ A;  2DNO A;  2XMU A;  4ZCL A;  2XSJ B;  4RW4 B;  5KFL A;  3OW2 R;  3HFZ B;  4Y2K A;  4Q44 A;  3GJT B;  4USK A;  1GMW A;  2HHU A;  1HWK A;  3NRB A;  4JV1 A;  3NNC A;  1OPZ A;  1VBZ A;  5GAE I;  1H2U X;  1TL7 A;  3L7O A;  2BM1 A;  3DNC A;  2VOO A;  4ZJO A;  4NRU A;  2DGS A;  3L7U A;  2AJF E;  3MZI A;  3VGT A;  3CJK A;  2I5J A;  3L9Z A;  1LXN A;  2E9Z A;  3EZ5 A;  2OSR A;  2DY9 A;  1QTN B;  1XWL A;  3KTQ A;  3C8Y A;  4OYX A;  3WDO A;  1UET A;  1UTA A;  4JI1 J;  4ANC A;  2E7X A;  4LSL A;  2CQB A;  3JSM A;  1PC4 A;  1W2I A;  3AXK A;  3T6B A;  3KFW X;  2CQ1 A;  4RW8 B;  1TFW A;  5GAD I;  1M1K T;  1TL5 A;  3BYR A;  3GZ7 A;  2J6S A;  1JLC A;  4OJ3 A;  5KT3 A;  3T9N A;  2V5H G;  5ETO A;  4KJI A;  2F7V A;  5HK4 A;  1S5Z A;  3FNN A;  3MEC B;  2XLK A;  2MLZ A;  3KMS A;  1GFW B;  3N79 A;  3TJ9 A;  4WZM A;  1AA1 B;  2XI3 A;  1WD6 A;  3OR2 A;  2CQD A;  3BQ0 A;  1WJ9 A;  3T3F A;  1FDN A;  4KR0 B;  2MZQ A;  2BAN A;  1Y5N B;  4JI2 J;  5HLF A;  3CJ8 A;  1TL7 B;  2XLJ A;  2M88 A;  1SXL A;  1RUS A;  2VFR A;  2LA6 A;  3KLG A;  1X4B A;  4P2F A;  3IN5 A;  3CJK B;  1R43 A;  2I5J B;  4EZ9 A;  1P9Q C;  3GIK A;  2YNI A;  2BM0 A;  4DV7 J;  1S9G A;  2XYH B;  2DNP A;  5ETM A;  3R5G A;  3IXQ A;  2B56 A;  5DDR C;  1F60 B;  3OFF A;  2WSE C;  4ICL A;  1U26 A;  4LSL B;  3JSM B;  4G3I A;  2UUA J;  4JI4 F;  2VKZ G;  2AJ1 A;  3GJQ B;  3P4U B;  1XMQ F;  4LF1 A;  4OYZ A;  2W2N P;  1JLC B;  2FHK A;  4NLT A;  2UUW A;  3WC0 A;  2YQ3 A;  3I4P A;  4JV5 J;  1U6Z A;  1UVI A;  1QAJ A;  4OHW A;  1Q8I A;  3KHH A;  4C8Z A;  1RYR A;  4X84 A;  5L9X A;  3HVR A;  2ZVS A;  1RHM B;  1JLQ A;  3OR2 B;  3SSQ A;  5B0F A;  3ADA C;  1QVG R;  5EX0 A;  4LR9 A;  2WVE A;  4DSK A;  2YBV A;  3J7A N;  1U49 A;  2BAN B;  4DUY F;  5HLF B;  2HBZ B;  4NI2 A;  2GIF A;  3AJ1 A;  2B9Y A;  4JBC A;  3KLG B;  4CLS A;  3DOK A;  5LSL A;  4C7Q A;  1QAI A;  3ONQ A;  1G1X A;  4DUZ F;  5D0H A;  3VGV A;  3AQP A;  3HCX A;  3BR8 A;  3ZZO A;  1H2V Z;  1NDK A;  2YNI B;  2NCK L;  4OI2 A;  1HQE A;  1FNM A;  1KFD A;  1S9G B;  1GT8 A;  1TL1 A;  4ILM A;  4NMX A;  3MCM A;  1NH8 A;  1XNQ J;  4XK8 C;  4DV3 F;  2H5I B;  2XMK A;  3TNV A;  2XGQ A;  2JLG A;  3WQP A;  1FD8 A;  2PGC A;  3KDO A;  5E0O A;  2D7S A;  1RAJ A;  1APS A;  2CJY B;  2JDJ A;  3SXL A;  4YS2 A;  1R89 A;  4FYV B;  3VR1 A;  2YH1 A;  3SFU A;  3PIP Q;  2HG4 A;  4YY3 F;  4ECU A;  5JVH Q;  1SIZ A;  5SZT A;  3Q22 A;  3BSA A;  3T1H J;  3CCZ A;  1RKI A;  2HBQ B;  3Q2T C;  2C22 A;  5EHH A;  1OIA A;  4DOZ A;  4ZJQ A;  5KFR A;  2MPU A;  2DR6 A;  1JLQ B;  2JC1 A;  2J6U A;  2RHQ B;  1PYO B;  3Q2S C;  3CDA A;  2DO4 A;  3I9Z A;  3H42 A;  5K9F A;  1WSV A;  4K7Q A;  1RQ0 A;  3JQK A;  3CT9 A;  3PO4 A;  1EQM A;  2CQ0 A;  3CJ3 A;  5KG4 A;  3DOK B;  1MU2 A;  4WF9 Q;  4DCP B;  3K5O A;  1PO6 A;  1V6H A;  3W62 A;  3MM5 A;  3R8Y A;  4X65 J;  4N76 A;  4J9V A;  1IKX A;  1HQE B;  2ZZT A;  1IXK A;  4UT4 A;  1KNZ A;  4NLS A;  1TL1 B;  5K8O A;  1XMO F;  3ENV A;  4J9M A;  2P9G A;  2AJQ A;  4K4Z A;  3WZ0 A;  5DRK A;  2Y0B B;  4I6W A;  3G8Q A;  2XGP A;  1U47 A;  1N34 F;  1RTH A;  2RML A;  2HVD A;  1PYS B;  4NXM F;  1KRP A;  4UOC A;  3HHN B;  5LXY A;  2DIU A;  3J7Z T;  5DQG A;  5MLC V;  2R8K A;  2J8A A;  3DOM A;  3IRX B;  3LW5 C;  1U2F A;  4NLQ A;  2HAF A;  1TP7 A;  3TOQ A;  2NSB A;  4XPC A;  1FNO A;  2CJQ A;  3L7P A;  2JL9 A;  2KDO A;  4A4J A;  2QSW A;  1FDD A;  2JX2 A;  3FC9 A;  3P96 A;  3KLV A;  1P1T A;  1WOS A;  1SC1 B;  2XSF A;  1MU2 B;  3QRP A;  3W65 A;  4RW9 A;  3FZB A;  2M5Y A;  4DL4 A;  2W9A A;  3MM5 B;  4QPX A;  5KFE A;  1HW9 A;  1OYE A;  2G0I A;  3QFW A;  1ZM9 A;  2HAI A;  4LF7 F;  3L3C A;  4AND A;  4KV8 B;  1NPK A;  4U7C A;  4OZL A;  2CWX A;  4RW6 A;  4QR2 A;  4O0N A;  1F9H A;  1TKD A;  4PRF A;  5C24 A;  2A10 A;  1RTH B;  3G9C A;  1YWX A;  3FK4 A;  4ILL A;  3P49 B;  3SV3 A;  2R7W A;  4Q8E A;  1IKY A;  2GJF A;  4QBU A;  2XHC A;  3M1V B;  4FNH A;  2PI5 A;  4DV0 J;  3GR1 A;  4IQX A;  4DR1 J;  1VHI A;  4OYW A;  3BBF A;  1Q95 G;  4ZA1 A;  2OKQ A;  5HSP A;  5KOX A;  1JLF A;  1RAD B;  4NEZ A;  2RD5 C;  4O0I A;  5LSO A;  5HQL A;  1VC6 A;  3IAM 9;  3MD1 A;  2VV5 A;  4OV1 A;  3QZ7 A;  1OY9 A;  4ZVR B;  3R7B B;  4WFN Q;  2HQI A;  4TY9 A;  3ILJ A;  4DJB A;  3EZU A;  2Y8Y A;  2QFI A;  3S8S A;  2AJ2 A;  4DL7 A;  3CJT A;  2XCP A;  1RT2 A;  3Q8Q B;  2HLU A;  2OEK A;  4JI3 J;  4IRD A;  1ZA2 B;  2AU0 A;  4YUD A;  1M5H A;  3KHL A;  4RW6 B;  2OAU A;  4ZOS A;  1W2B R;  5KG6 A;  2KFN A;  4RUC A;  3L09 A;  2X1B A;  3KJQ B;  3IC1 A;  2XYG B;  3ISZ A;  1RWV B;  2XYP B;  3SDE A;  5T41 A;  4RNF A;  1U1K A;  4CO4 A;  2MLY A;  1IKY B;  1Y5L B;  1UVN A;  3SI8 A;  1XR7 A;  2OMO A;  3NY0 A;  3SCK E;  4QU7 A;  3Q83 A;  3ENA A;  2UU9 F;  4I7F A;  4DF8 A;  1IBL F;  2ACM A;  2OML A;  1JLF B;  4Q8F A;  1QE1 B;  1EKS A;  3BM7 A;  1T03 A;  1PAE X;  2G0C A;  4ALZ A;  4K2J A;  1FKA F;  2M2B A;  4EI2 A;  2WBM A;  1KVI A;  3PXG a;  3MUR P;  2VUG A;  1RZM A;  1MWY A;  1YJT A;  4CI0 B;  3DLL Q;  3DYA A;  4IOB A;  3O44 A;  1EX8 A;  1RT6 A;  2RNE A;  2V8H A;  3M30 B;  4U67 Q;  3QMQ A;  1RT2 B;  3C14 A;  3OPK A;  3GIJ A;  2E1R A;  2Q6B A;  1FWP A;  3EGW B;  1O6X A;  2B4V A;  2Q1L A;  2WVB A;  4W98 A;  1H74 A;  3TAQ A;  1N5T A;  2ZC4 A;  5C2G A;  4CT9 A;  3GYN A;  2N3L A;  1QDU B;  1JLE B;  3ZNU A;  1RI7 A;  5HO4 A;  2BX6 A;  4Y2I A;  1LEO A;  4AQY J;  1S4F A;  1AT1 B;  2CQ4 A;  1BQX A;  3SDE B;  1J2V A;  3W9J A;  2YPY A;  4Y2A A;  1SIW B;  3T9Z A;  3OV7 A;  2RE1 A;  1SL2 A;  2RKI A;  5BYR A;  1CG2 A;  3EZO A;  4DL2 A;  2YKN B;  4N8O A;  3MMA A;  1Y4Z B;  1UFL A;  4PYA A;  3PR4 A;  3KKF A;  1QLN A;  3IFE A;  2WW4 A;  2ALY B;  5ETP A;  3I5B A;  1T03 B;  2QSF A;  4UOG A;  2MKS A;  1SVD A;  3WIV A;  2GS8 A;  4TNO A;  4FBU A;  4DQI A;  4I68 A;  4NLR A;  3LGM A;  4LFC F;  3HZE A;  3DYA B;  1RAO A;  1RT6 B;  3BEG B;  4RNO A;  3PKY A;  1OY6 A;  2HQF A;  5KG2 A;  1EQ0 A;  2Z57 B;  3C14 B;  2AGO A;  3P5B P;  4I56 A;  5KFH A;  3W66 A;  2AGP A;  2GMH A;  5KFV A;  3I6P A;  4V19 X;  3HSD A;  3DN9 A;  4WK3 A;  2QV6 A;  3TWZ A;  1AB8 A;  4GRS A;  2E66 A;  2HUR A;  1QAX A;  2WOM A;  9RUB A;  3I82 A;  4ECV A;  5A8R A;  4FYY B;  5E3Q A;  3TO8 A;  4ZLP A;  2EFQ A;  4QJV A;  1KP6 A;  3FZ2 A;  4IKA A;  2RKI B;  2BKN A;  4RL1 A;  2DVI A;  3MMA B;  4QYR A;  4LRC A;  4UST A;  2CZ4 A;  1M1H A;  4DV2 F;  1LWF A;  4B3T F;  4Q45 A;  3DHW C;  4PPD A;  1TMJ A;  5GAG I;  3PRB A;  2KG0 A;  3NCQ A;  2V69 A;  1Y00 A;  4PQA A;  4TQS A;  2GV1 A;  4F4A A;  4Y34 A;  4CLW A;  2Y9H A;  2QLB B;  3W64 A;  2GW8 A;  1KEK A;  4V1A k;  1WEX A;  2Q6C A;  3CJ0 A;  1U45 A;  1FRJ A;  1TR0 A;  4O23 A;  1ZET A;  3GP9 A;  2EBG A;  1S1X A;  1DJ0 A;  2V0N A;  2QA2 A;  4CLZ A;  2HLT A;  2W4P A;  3QLH A;  3PX0 A;  2XY7 A;  2IY5 B;  5BYS A;  4YHH F;  5ETK A;  2WOM B;  4F0M A;  1U0S A;  3HHD A;  1QM9 A;  2HHQ A;  5DLF A;  3SV4 A;  3W2V A;  5A8R B;  3DHX A;  2CNK B;  2O1P A;  5B08 A;  1HIY A;  3TX0 A;  2DH8 A;  2VPW B;  3N9U C;  4OZ5 A;  2Q43 A;  2FZC B;  3MGJ A;  4M5K A;  2DO0 A;  3VZI A;  1HR0 F;  1X9W A;  2M3D A;  1VDH A;  4DI6 A;  4Y2C A;  4F4K A;  5IV4 A;  3N0V A;  4AT1 B;  1HBU A;  2R4F A;  3UR3 C;  4L74 A;  1KWM A;  4KC5 A;  1GX5 A;  5DG8 A;  4DSF A;  5CYQ A;  3FQK A;  2I1R A;  3HSZ A;  1LWF B;  1WI8 A;  2B3T B;  1UJ5 A;  1AFI A;  2BJ3 A;  4DR4 J;  4F4X A;  2R8I A;  3JAM U;  3FQL A;  1HWL A;  1K0V A;  3K2Y A;  2R7S A;  4UZC A;  2J9D E;  4IR1 A;  1RKJ A;  2J7U A;  2UXB F;  4MYU A;  3HX9 A;  2AKW B;  2LQJ A;  3TZW A;  2AEF A;  3ZTR A;  4YR0 A;  2F40 A;  2PII A;  2HKE A;  4MIW A;  2P2C B;  2GGP A;  4EBD A;  4ZP7 A;  4FXV A;  2LYV A;  3UQS A;  1OQ3 A;  3JSB A;  1XMB A;  4OZJ A;  2CVI A;  3LQV A;  2XMA A;  1RU2 A;  5A8K A;  1WC3 A;  2GHV C;  4CRJ A;  2ILZ A;  1WNE A;  2KB2 A;  4DFM A;  3QLH B;  1HWJ A;  5AXM A;  1VC5 A;  2XG8 A;  1T9V A;  3BGO P;  1VQL S;  4FP9 A;  1PGZ A;  1S1W A;  3JQJ A;  3A12 A;  3W2V B;  1TEL A;  2QC3 A;  5F9N A;  4GKJ F;  3V6J A;  2BBE A;  2AV5 A;  2UUT A;  3BO4 A;  3MUV P;  2OD6 A;  3K57 A;  2YX7 A;  2R2T A;  3KLH A;  2AEJ A;  2EPI A;  3Q8S B;  3IS9 A;  4F0K A;  4D3H A;  3QGI A;  1HBU B;  2ABY A;  4KIA A;  4CLY A;  1WSR A;  2J5A A;  2QZ8 A;  4UY8 T;  5H9F J;  4K59 A;  5CYQ B;  1S7I A;  5H9F K;  5L39 A;  1KQF B;  2PEH A;  2FDN A;  5HMW A;  2ZC3 A;  2E1C A;  2RF2 A;  3R3T A;  1A6L A;  2FQQ B;  3CCM S;  2FJV A;  3RB6 A;  2GO9 A;  1Q81 T;  3TQ1 A;  4M5M A;  3AJD A;  1D8Z A;  1U24 A;  1VI7 A;  2FLL A;  1HWU A;  1QUP A;  5K8P A;  5I3Q A;  2GGP B;  2CDQ A;  2AGQ A;  4ZKA A;  2R7X A;  1TAQ A;  2F9D A;  2PFD A;  3I55 S;  4CH7 A;  4ZPC A;  4X4Q A;  3HJF A;  3GQC A;  1VCT A;  1D3W A;  2A2C A;  2IJF A;  3VWS A;  3UWT A;  1NRK A;  2GHW A;  5D78 A;  1FFG B;  1NJI T;  1Q5Y A;  1S6U A;  1F0X A;  3NNA A;  4KGV B;  2B4U A;  1S1W B;  3VVT A;  4JP8 A;  3H5X A;  4QQB A;  4EBE A;  2DNZ A;  2AX1 A;  2VG6 A;  4CT8 A;  4ECX A;  3PRV A;  4LFA J;  3MEE A;  5LMN J;  1UKU A;  4QIF A;  1G7C B;  1YSJ A;  2WZ1 A;  5C5J A;  4IRC A;  2BE7 D;  3Q8R B;  2VAS A;  3H25 A;  3ETM A;  5J2M A;  3JYT A;  3BSN A;  4N47 A;  3M6U A;  1HBO B;  2RF2 B;  3BDP A;  2MQM A;  4B9U A;  2KH9 A;  5I3U A;  1VQS A;  3C66 A;  3KK3 A;  2CZV C;  1TQL A;  4YOE A;  5KFW A;  4XO0 A;  2W8K A;  4QR1 A;  3IR6 B;  4RBT A;  4CLF A;  4OHY A;  3P6Y C;  2Y8W A;  4O44 B;  2VH7 A;  1WHX A;  3QJL A;  3AD8 C;  3OVA A;  4M5I A;  2GVZ A;  4A46 A;  3M8S A;  2DNY A;  4OX9 J;  1M5K C;  4Z7C A;  3SYZ A;  4Q2L A;  2J7W A;  2XLI A;  2B4P A;  4CQ1 A;  2UUC J;  2NUH A;  1HMV A;  4QU6 A;  2Z8Q A;  4F4Y A;  4JI6 F;  2ZNY A;  3MUT P;  3HJV A;  3ISN C;  4P52 A;  5L1I A;  5LT5 A;  3MEE B;  1FJG J;  4DV7 F;  4OI1 A;  4ECR A;  2CQP A;  2HYI B;  3EUN A;  1IR1 A;  4P72 A;  1R8C A;  2EK6 A;  4OJ1 A;  1U1P A;  4IOC Q;  5B0B A;  3KG4 A;  5J2M B;  2J0W A;  3JYT B;  4ZP9 A;  2D9P A;  1VQ8 S;  4ZCK A;  3EMT A;  4MK8 A;  4K5R A;  2HWI A;  4K4V A;  3RW6 A;  1WTF A;  5I3U B;  4NLW A;  4HTI A;  1U1R A;  4OYI A;  1GXT A;  3KK3 B;  3FFI A;  3J81 Y;  2XEX A;  4OJH A;  4CZC A;  3BYP A;  4K4X A;  3KYL A;  3EVO A;  3TVK A;  4OYM A;  5KFJ A;  1H7W A;  5D4L A;  5HVG A;  1YJ7 A;  5HJX A;  2FVP A;  4L3N A;  4PG4 A;  4ZP6 A;  2EKN A;  3R7N B;  1KOH A;  2QTW A;  1WHW A;  1XBW A;  1G4C A;  2GVZ B;  4UOH A;  3D1H A;  1C4C A;  3OFG A;  3DRP A;  4WBF A;  3CMQ A;  2ZDO A;  2HNY A;  4H4K A;  1OMS A;  4NLD A;  1HMV B;  1QSS A;  5L38 A;  4ZPB A;  1HI1 A;  3GV7 B;  1S59 A;  4RU2 A;  4MK9 A;  2EFV A;  4FYW B;  1F9E B;  2FHJ D;  3Q8Y A;  2JEJ A;  4FXW A;  4LF9 F;  2YXL A;  4F8R A;  2IYI A;  3OVS A;  3QJP A;  4HDG A;  1KFS A;  2DYA A;  4N56 A;  3N01 A;  1R31 A;  3I9V 9;  3O5T B;  4KRW A;  4Y0F A;  3B54 A;  1VR6 A;  4F50 A;  3MHY A;  2DIS A;  1S4E A;  3FFI B;  1KLN A;  3BQ1 A;  4WJB A;  2ZNZ A;  4ECY A;  4C4W A;  3W2W A;  1NSK L;  4JI5 F;  4ANE A;  4UQG A;  5HMZ A;  2JH3 A;  1AFJ A;  3THV A;  4J9Q A;  2O01 C;  4ZVE A;  2FGO A;  3QID A;  3BKT A;  4IG0 A;  3UI3 A;  2QT7 A;  5HVF A;  3DRP B;  3R27 A;  1DHM A;  1CC8 A;  2W7A A;  2AF6 A;  2RS2 A;  5KAK A;  5EN1 A;  4B17 A;  1YJ9 S;  1BQM A;  3TUZ C;  4CM0 A;  4DLE A;  3VAM A;  3SCL E;  1KQS R;  3ZZT A;  5KFK A;  2RSQ A;  2ZOG A;  4RNM A;  2OH2 A;  4FNI A;  1NZA A;  3MM9 A;  4O3R A;  5T7L A;  3RAM A;  3KLF A;  3FBC A;  3QIP A;  1AUS L;  2OJ3 A;  3OVB A;  2J9E A;  3GJS B;  2DNR A;  2WAQ D;  3M2V A;  2CAJ A;  1CJU A;  1RHJ B;  1VQY A;  5KG1 A;  3EGZ A;  3EPG A;  5DGA A;  3P3D A;  4Y3C A;  2AD9 A;  4LF8 F;  4ZLJ A;  1GX6 A;  1S9F A;  2EC0 A;  3RW7 A;  4YB1 P;  3DXB A;  4YR3 A;  5K8M A;  2CPE A;  4IG0 B;  3BO3 A;  2F5G A;  3E3X A;  1NK7 A;  4DL5 A;  3T6J A;  3W7B A;  1NND A;  1QAY A;  1Y5I B;  1LK7 A;  4CO2 A;  1V5V A;  3N4W A;  4NA1 A;  4NYO A;  1FI4 A;  1RU1 A;  4AL5 A;  3PDN A;  2OD4 A;  4NZ6 A;  3IBF B;  3I0R A;  3ZNJ 1;  1CQN A;  2D3O R;  3D6M B;  1U1L A;  1BQM B;  1UCN A;  2H5J B;  2E44 A;  2RQM A;  2LQ8 A;  3OSN A;  1FE4 A;  4NX9 A;  5BR8 F;  3NGD A;  1XMQ J;  2W4D A;  3Q23 A;  2R3V A;  3MM9 B;  3KG0 A;  3CW2 C;  3KLF B;  3QIP B;  2WCX A;  2ZH1 A;  2OPS A;  1VLY A;  3R5J B;  3M2V B;  2NXN A;  4KKO A;  2BOP A;  3H5S A;  1FRH A;  1C4A A;  2DBB A;  1W26 A;  2C2E A;  1T11 A;  1CJU B;  4DQQ A;  1M5S A;  1YJV A;  4KHM A;  3QJJ A;  1HW8 A;  3BO2 A;  3NCR A;  1FRX A;  4RR5 A;  1K1Q A;  1M0S A;  5E3A A;  4DUY J;  2CJX B;  2MZS A;  3V6D A;  4WU3 A;  2ZVI A;  2ZJQ Q;  5I3P A;  4DR1 F;  1E6V A;  2DCU B;  2BR0 A;  3RBD A;  1N6Q A;  3R5C A;  4DUZ J;  4GMK A;  2BJE A;  5IQ6 A;  1JXL A;  1FHT A;  3PX6 A;  3E51 A;  4KH0 B;  4USJ C;  3J7Y U;  2Z2L A;  1NM2 A;  3I0R B;  3VAK A;  3R5B A;  5ETT A;  4N41 A;  1TUG B;  2JFD A;  1N8R T;  4TY8 A;  4ED2 A;  1PG5 B;  2N4C A;  1R7I A;  1DTQ A;  2EW9 A;  4DV3 J;  2JOQ A;  2AZ1 A;  3R2D J;  1S1U A;  2BRK A;  4ETZ A;  5EGY A;  3GJR B;  1VQ9 S;  5D3G A;  1OQ6 A;  1N5V A;  3DRS B;  1B99 A;  2KJW A;  2EBE A;  4DZD A;  2OPS B;  2CJA A;  4ED1 A;  4JI3 F;  4YY3 J;  1I1G A;  4I69 A;  1L5U A;  3DRY A;  4L73 A;  3ILI A;  4KKO B;  1M5P C;  1FK9 A;  1UMJ A;  3MAA A;  2MGZ A;  3CC4 S;  4C8Y A;  3B4D A;  1X4E A;  2CFX A;  3GSD A;  2JC0 A;  1R8A A;  3J81 U;  2VG5 A;  4USW A;  4DV6 F;  1X7V A;  3S1T A;  1HPZ A;  4BS2 A;  3VCD A;  1NPR A;  2DH7 A;  3I5A A;  1HLW A;  3KNG A;  3NWR A;  3BS9 A;  5DQI A;  4QR0 A;  3V6D B;  2BVZ A;  2UVU A;  4I2P A;  2PDA A;  2QJ3 A;  1RWM B;  4Y65 A;  4DX5 A;  1UVK A;  3OTD A;  5F8H A;  1E6V B;  4ELT A;  4W90 B;  1TKZ A;  3SIP B;  1N54 B;  5F8L A;  2ZD1 A;  1N6Q B;  3SBM A;  1FXD A;  4AXJ A;  4X4T A;  5E33 A;  4RNH A;  3TZY A;  2DNM A;  3Q8P B;  1XMO J;  3QRR A;  4U95 A;  2CPF A;  4TY8 B;  4WKR A;  1DTQ B;  1HBM A;  2GVD A;  3P8B B;  1D9F A;  4NLP A;  1S7H A;  5KT5 A;  2VOP A;  3PEH A;  1S1U B;  3MR3 A;  1BC6 A;  5D3G B;  4HI1 A;  5AXL A;  3K8W A;  5LJ5 Y;  4ZVF A;  1CJK A;  2V8P A;  5JXS A;  1VBX A;  3C3L A;  1FK9 B;  1SBR A;  2MGZ B;  2BEF A;  2MQ8 A;  1QUV A;  2E1M C;  2IRX A;  4CLU A;  3A4T A;  3HD1 A;  1FKO A;  2VG5 B;  4U8V A;  1X60 A;  1A9N B;  1PIL A;  1U1O A;  4PR6 A;  2HHV A;  2M9K A;  4NZ0 A;  4I2P B;  1JJ4 A;  2KZZ A;  3ENQ A;  4MKV A;  1H98 A;  4IUF A;  1IUJ A;  4C9D A;  3NBP A;  1TKZ B;  1YLX A;  1LW2 A;  2ZD1 B;  3UVJ B;  1K1S A;  1BE4 A;  2D74 B;  1ZTT A;  4HHU A;  1IM4 A;  3SCI E;  4NEY A;  3OTE A;  2VPX B;  3ICL A;  1RWU A;  4PQU B;  1UA0 A;  2FZK B;  4ZVO B;  4OI3 A;  4ZLL A;  4ZK7 M;  2RAQ A;  2RUG A;  3ZZR A;  3MFH A;  3RR8 A;  4ECT A;  2KG1 A;  4PG5 A;  1RT5 A;  2AQ4 A;  1S1V A;  3W5Y A;  3NMR A;  4USI A;  2V4Q A;  1HBM B;  2GVD B;  3KDN A;  4X4U A;  1WDD A;  1X9S A;  2ZH7 A;  5I42 A;  2HHS A;  3DRR A;  3PO5 A;  1HD0 A;  2L41 A;  4F25 A;  4W4M A;  3MMJ A;  3QT7 A;  4OYB A;  5C42 A;  1D1U A;  4OV6 A;  1CJK B;  2CQ2 A;  4MMO A;  2NZC A;  2OGU A;  1IVZ A;  4LRE A;  2B5J A;  3MMC A;  2KRR A;  1FKO B;  2ROE A;  1WF0 A;  1Y11 A;  2YY3 A;  3RBZ A;  2RS8 A;  3CJ5 A;  2MQQ A;  1KLM A;  4DS4 A;  4DFP A;  3D3C J;  3D2W A;  4TU9 A;  1NK0 A;  3U7J A;  2BMB A;  3TUJ C;  3B6B A;  3UDC A;  1S6P B;  3A3O B;  1T9T A;  4EU0 A;  1RT7 A;  3PFO A;  1KSP A;  3UCU P;  3NBP B;  4DSE A;  1LW2 B;  2W9C A;  1F5B A;  1S1T B;  4ID5 A;  1NSQ A;  1ARO P;  1RWP B;  3T5H A;  3PTW A;  1ZYQ A;  2F3J A;  2VJV A;  5KOW A;  1JLG A;  3S7R A;  1RT5 B;  4EK2 A;  5GME A;  1MW7 A;  3RBE A;  2AYB A;  1IJE B;  4LRF A;  2AYG A;  2YTC A;  2LU2 A;  3HUL A;  4DN0 A;  4B9T A;  5I42 B;  1HKA A;  3MR5 A;  1S76 D;  3DRR B;  2DJW A;  4ECW A;  1QD1 A;  4DCO B;  4ES3 A;  2NXU A;  3GCW P;  2R2R A;  2DGU A;  5C42 B;  3AA9 A;  1RHK B;  2R7T A;  2EEY A;  4P71 A;  1WI6 A;  1XER A;  2YKA A;  2CG4 A;  2B5J B;  3MMC B;  5IOL A;  1RWN B;  1RWX B;  1GAO A;  4MAK A;  4NXN F;  2HQ3 A;  2ASY A;  5DS7 A;  3H20 A;  2UU9 J;  3VQS A;  2F65 A;  5CYJ A;  1HYS B;  1FFS B;  1KLM B;  1UW9 A;  4ITS A;  1N52 B;  1T3N A;  1S6O A;  2RQC A;  3A13 A;  5IT9 U;  1S48 A;  5E3R A;  2MYF A;  1PCA A;  3W61 A;  4DCJ B;  2I2Y A;  1RT7 B;  1J27 A;  4OLO A;  3TZX A;  1H38 A;  4EO6 A;  5HBM A;  2UUB J;  4BWM A;  3WIU A;  1LW0 A;  3HLU A;  5KFY A;  4ID5 B;  3TJ8 A;  2CPJ A;  4GO7 X;  3ITH A;  3W9I A;  4DR4 F;  2CPY A;  4B9N A;  2H1Y A;  2Y1R I;  1EHW A;  4NYZ A;  4P2X A;  1JLG B;  4FKY A;  5LJ3 Y;  3MR7 A;  4USU A;  4DFJ A;  3UDE A;  1FJ7 A;  3N28 A;  3FSI A;  4OHV A;  1I3O B;  2JRS A;  1JJC B;  3R1L A;  4J37 A;  4DV5 F;  1U0H A;  1HD1 A;  5HQ8 A;  3QAE A;  2QA4 S;  3QWU A;  1RP5 A;  9ATC B;  3RJM B;  1VRQ C;  4JV2 A;  4YB5 A;  4QWA A;  4ERD A;  1TFY A;  3T5K A;  5D0R A;  2H54 B;  2BDP A;  2B8P A;  3MTK A;  2XNR A;  1VIO A;  3BZQ A;  2OI2 A;  4ZN1 A;  3MXH P;  3IR5 B;  4WP8 A;  1JXE A;  2HBY B;  3CJQ A;  2YWW A;  2GC8 A;  2GCF A;  1O5J A;  2DCL A;  3GB0 A;  1OWX A;  3UO0 A;  3S6E A;  1NDL A;  1ZS6 A;  4X64 F;  2Z2M A;  2R8G A;  2AYM A;  4C8M A;  3BPD A;  3M8Z A;  4C6A A;  1UP1 A;  3I4H X;  1FNX H;  4RW7 B;  5HBM B;  2PA3 A;  3J7A 1;  1LW0 B;  3UNY A;  2C3O A;  2LQB A;  3QSY B;  3LAK A;  3ITH B;  2X51 A;  3PRD A;  1XIQ A;  4M8L A;  3C6U A;  3PCO B;  5D4P A;  2QN6 B;  3MTJ A;  2ZZM A;  5THW A;  3VGU A;  4DV1 F;  1FXR A;  2R2S A;  2IAJ A;  4ED8 A;  5HN0 A;  5G0R A;  1VC0 A;  1HBN A;  2MQP A;  1U0H B;  2FB0 A;  3NGT A;  1OJ4 A;  5B7W A;  3CC7 S;  4HYK A;  3M8R A;  2CKW A;  4J91 A;  2RB7 A;  4X4O A;  2XMJ A;  4RUA A;  3RG6 A;  5ETL A;  1K47 A;  4NLV A;  3AXM A;  4LFA F;  3MMB B;  4KYZ A;  2OP5 A;  5LMN F;  2JLF A;  4ZIV A;  4LVO P;  3LPY A;  2G2Z A;  3KOA A;  1S77 D;  3G8T A;  2APO A;  5M2U A;  2FHO B;  3CD7 A;  4IFY A;  2J0X A;  3KK1 A;  4FN5 A;  4MTP A;  3BBB A;  2DGV A;  4F67 A;  5IS2 A;  3U1L A;  2DRA A;  1YJU A;  2DGX A;  2X7I A;  2CPD A;  1WEZ A;  3C6U B;  4B3O A;  2M7S A;  3H5Y A;  4K4W A;  1YZ6 A;  2HQD A;  2VFT A;  5ETR A;  2UXD F;  3RYL A;  4CO3 A;  2GAH C;  3NMA A;  4ZVS B;  2IAJ B;  4OHX A;  1CS4 A;  3HZG A;  3SQG A;  5G0R B;  4CLP A;  2JZ5 A;  3VZH A;  2EKY A;  2JHE A;  2ZIT A;  1L3U A;  4YHH J;  1HBN B;  4M94 A;  3MD3 A;  1ZBT A;  4CTA A;  2YKM A;  1S0V A;  3B82 A;  3RRH A;  4WXO A;  4M5D A;  2FLN A;  2F8H A;  1S6Q B;  4X4P A;  3DOL A;  2NXJ A;  1HR0 J;  1F3V A;  4WP3 A;  3GIR A;  3PYF A;  2R8J A;  2ASD A;  2G4B A;  2V50 A;  2O66 A;  5B0C A;  4PWD A;  2D3Z A;  4EZ6 A;  4LF2 A;  5DZ6 A;  1T8E A;  1D9D A;  1RHU B;  3N5F A;  2WHO A;  1HNX F;  4YP3 A;  1V3Z A;  2N82 B;  3AB2 B;  5H9E K;  1FE0 A;  3C15 A;  4KFB A;  3MFI A;  3H90 A;  4IFY B;  3QGP A;  3KK1 B;  2B7C B;  4J9N A;  1ZM3 A;  4A8W A;  1UA1 A;  3L95 X;  3KG1 A;  2DNQ A;  1XJW B;  3OLB A;  4CNZ A;  2YWH A;  2KZM A;  1S99 A;  4WXW A;  2QEX S;  4IYQ A;  4LSZ B;  4B3O B;  4DR7 J;  2XSJ A;  3CE8 A;  3RUB L;  1EIY B;  2IRU A;  5GMK a;  3VGS A;  5F8N A;  1CS4 B;  1X5P A;  3SQG B;  3BN4 A;  4F3M A;  2L3M A;  4MKA A;  4OX6 A;  1CPZ A;  1IBC B;  1RAC B;  4WPA A;  2V8D A;  2R8H A;  2V2Q A;  4JI7 F;  3KJV A;  2HGL A;  2W25 A;  4CTA B;  2YKM B;  4GKJ J;  4M5D B;  2PEB A;  3FRY A;  5E5N A;  3DOL B;  2NXE A;  3T5J A;  4URS A;  1VS3 A;  3HD2 A;  2ILY A;  2QIF A;  2VBX A;  1J5E F;  2KJV A;  3V81 B;  3KHG A;  4NLG A;  3MM8 A;  1UFW A;  1GH8 A;  5JJB A;  3H5U A;  3HMJ G;  2OEJ A;  4RNN A;  1SC3 B;  4OLP A;  1C1C A;  1ZOT A;  2R7V A;  2W7O A;  3D1O A;  3C15 B;  4CDI A;  2QO3 A;  1SJ1 A;  2V8V A;  3NOC A;  3K5M A;  2GA7 A;  4ER8 A;  4DF4 A;  5K8N A;  2WBR A;  4C0H A;  3HKW A;  1RYS A;  1X5O A;  2ROP A;  2M70 A;  3C19 A;  5IV3 A;  3RTV A;  4HDH A;  3K59 A;  3MAH A;  4NAS A;  1JWW A;  2E1P A;  2MJN A;  2RU9 A;  1RTZ A;  5KFS A;  1MLA A;  4USH A;  3DMJ A;  2AHO B;  4J90 A;  4WFX A;  1PJ6 A;  4WWS A;  1JB0 C;  5D0E A;  3OBI A;  2FY8 A;  4JI8 J;  1ULR A;  2KKH A;  3KJV B;  3G6V A;  1T95 A;  3VHQ A;  5KG5 A;  2ZUA A;  1NDP A;  3LUY A;  1U8W A;  1WF2 A;  4HTJ A;  3MM8 B;  3J80 U;  2VON A;  4ED5 A;  1TU0 B;  2E5G A;  1P27 B;  1V5I B;  3WX4 A;  3OTO F;  1URN A;  1C1C B;  4A8X A;  4DQS A;  3THT A;  1R8P A;  3UDV A;  1BWV A;  2FVR A;  5I4M A;  3DRX A;  4WKY A;  1M1G A;  4Y6I A;  2CNL B;  2IM0 A;  1VQK S;  1D9A A;  1WF1 A;  2HVI A;  3LGH A;  4PXE A;  4U96 A;  5GAH U;  4YB7 A;  1NAQ A;  3N6N A;  3C46 A;  1YRT A;  2XTJ P;  2VHG A;  3DMJ B;  1Q7L B;  4C0B A;  3HHL C;  5LM7 E;  1RWK B;  5L8R C;  2G0J A;  1RJJ A;  2YX1 A;  2GO8 A;  5A2Q U;  5KT2 A;  4HVZ A;  4I6Y A;  2Z0G A;  3CD0 A;  3LP2 A;  3K8V A;  3MEG A;  3D0G E;  1N4L A;  3IP0 A;  2DGT A;  3VF0 B;  3KNA A;  2MY8 A;  1XR5 A;  1GTH A;  2UVW A;  4JI6 J;  1SQG A;  1C2P A;  2ZBR A;  5CA5 A;  1LFP A;  1RA7 A;  4ZPD A;  1PJ5 A;  3BGF A;  4DPT A;  3LAN A;  2J8S A;  3NP5 A;  1MMD A;  1AUD A;  1BQN B;  5F8G A;  2CQH A;  2POK A;  3THP A;  3PJX A;  3R9L A;  4OX8 A;  2L48 A;  1N32 F;  3D0I E;  5KT7 A;  1OSC A;  1WHV A;  1RWW B;  4PXD A;  3FKB A;  3TYT A;  1E6Y A;  4OIX A;  4FZV A;  1SC4 B;  3M6X A;  4N7T A;  4RLE A;  2V4J A;  4ZDN A;  2ZHA A;  1S0M A;  5HAT A;  5DLG A;  4PXB A;  2HZV A;  5KFC A;  3M8Q A;  3QO9 B;  4CLT A;  3KUE A;  4OI4 A;  4Y2M A;  2XZW A;  3R97 A;  1NUE A;  1YBT A;  3OUY A;  2H4Y B;  4P10 A;  4RO0 A;  4DBQ A;  1VRU B;  1I5O B;  4M5L A;  1HAR A;  1TKT A;  1OY8 A;  3HVA A;  1SKS A;  3KUH A;  2QLJ B;  3DFE A;  1RAG B;  4X66 F;  2MMY A;  2MB0 B;  2IA0 A;  1B4S A;  3LP2 B;  3OL9 A;  2LXI A;  1SC6 A;  3M8Y A;  3MEG B;  2V63 A;  4LR8 A;  4RU9 A;  5GVQ A;  2A3J A;  1B7F A;  3EDR B;  4Z2X A;  1JK9 B;  1TK8 A;  2G9O A;  4JYA F;  1IBK F;  4NA3 A;  3R1H A;  4P2S A;  2V2V A;  3T5L A;  2BJ8 A;  2GNK A;  1U02 A;  5KFO A;  4LF9 J;  2CAD A;  2XS5 A;  4ZN3 A;  2QFJ A;  2J7K A;  2JNJ A;  1NK6 A;  2VC0 A;  4WU2 A;  2N4D A;  3H4B A;  5F3Z A;  1R6Y A;  3K17 A;  3CUN A;  4A8M P;  2N7C A;  5D6G A;  3IM9 A;  1I51 B;  2GHP A;  2XY6 A;  4K8R A;  2XQC A;  2OPR A;  2HWT A;  3JSR A;  1N48 A;  2NUU G;  1E6Y B;  3CCJ S;  1HQ2 A;  3V6H A;  2MQO A;  1ZZN A;  2V4J B;  3KHR A;  2DNN A;  4I6A A;  2BA9 A;  2HRY A;  4JI5 J;  4F04 B;  1Z2L A;  4X62 F;  3M8Q B;  3MR6 A;  5J1N A;  3SSR A;  1NPP A;  3NGK A;  2R7O A;  3H98 A;  1Q8L A;  3IRX A;  2FY1 A;  3Q8U A;  3RZA A;  1S57 A;  3OUY B;  2DEJ A;  3HK2 A;  4PYD A;  1Z1Z A;  1TKT B;  1KBR A;  1ROF A;  4B9M A;  4ZIW A;  4F2R A;  4X4S A;  1KHV A;  3BH7 B;  3PYG A;  2XZD B;  1R27 B;  1CSJ A;  2Z56 B;  4DR5 F;  4DDF A;  1R8B A;  4USV A;  3UD5 A;  2BE9 B;  2UXC F;  3UNG C;  1RTD A;  5ITH A;  4IDK A;  3H0P A;  1VJW A;  4DV4 F;  2KYX A;  2JSX A;  5DG7 A;  4DSJ A;  2CZ9 A;  4ZLN A;  4HLB A;  4ZHR A;  3KJN B;  2V67 A;  5EUH A;  2MLX A;  2HS3 A;  2R7Q A;  4KV8 A;  1DQA A;  2K3K A;  1B0V A;  2DKO B;  2R9L A;  2EFP A;  3IG1 A;  2X1F A;  1UVJ A;  1SJQ A;  5MAO A;  4YME A;  2XO6 A;  2OPR B;  6FDR A;  4H4M A;  1HI0 P;  2VPY B;  3EDQ B;  1WC1 A;  4ZVQ B;  2CYY A;  2YPZ A;  1H0H B;  3E8O A;  4URG A;  2DTJ A;  3RGI A;  1FJC A;  2C2D A;  3GPA A;  3PR5 B;  4YFU A;  2ZBC A;  4LF8 J;  3BH6 B;  4PAA A;  3M1V A;  4LR7 A;  4ED7 A;  1Y3J A;  5L46 A;  4UF4 A;  2FHJ A;  3ILO A;  3JS9 A;  4ECQ A;  2F1F A;  4C8L A;  2MY7 A;  2GIR A;  1NU4 A;  4C2M A;  2HEK A;  4FKX A;  3GIL A;  1ZM2 A;  5IM0 A;  1SUQ A;  2I38 A;  4DL0 C;  1M5V C;  2E29 A;  3JQM A;  2LLZ A;  1F2H A;  3QZ8 A;  2OO4 A;  1T9W A;  3EIC A;  4PKD B;  2LMI A;  2OFG X;  2HFN A;  4PZV A;  2P9E A;  2CQ3 A;  2GX8 A;  3CVK A;  3HXM A;  2RU3 A;  1RTD B;  4IDK B;  5JMN A;  2HWH A;  2OTL S;  3BJY A;  5LMU F;  1UEU A;  5BXI A;  4TQR A;  5BR8 J;  4ZHR B;  3G8S A;  1TZ0 A;  3HO1 A;  1RDR A;  1SPB P;  5JUM A;  1U25 A;  1JMT A;  3K7R A;  1FXL A;  2IM3 A;  4NLO A;  1IR2 A;  1NJY A;  4O4R A;  4LRD A;  3TX8 A;  4K0K F;  1P8G A;  4L72 B;  3IG1 B;  3CME S;  4EBC A;  3NCP A;  2ZBI A;  4DQP A;  3HSG A;  2GJ2 A;  5F8M A;  3I87 A;  4H4M B;  2WVD A;  2LQ5 A;  3MPD A;  1VK3 A;  1W7W A;  4X2B A;  1FDA A;  4PWW A;  4J9K A;  3BSO A;  3QRQ A;  2O5D A;  2VU5 A;  3Q0A A;  3UDL A;  3PYE A;  4CNY A;  3OHB A;  2MST A;  2G2O A;  2B9X A;  3CJS A;  4NE9 C;  4E2F B;  3AD9 C;  3MCS A;  2H48 B;  4BDP A;  5IM0 B;  1SUQ B;  3LGN A;  1R6V A;  3BF4 A;  2C28 A;  1FDB A;  1QE1 A;  2V4R A;  4DQR A;  4YR2 A;  1VQ7 S;  4P6Q A;  5DZ7 A;  4ZCM A;  3EWG A;  2P9C A;  1RHR B;  4LFB F;  5A0Y A;  3HPO A;  3A3P B;  3OTB A;  1SL0 A;  1CJT A;  4IH6 A;  2I6W A;  5C7P A;  3NGU A;  3JAM Y;  5KFN A;  1HA1 A;  5J2Q A;  4DPO A;  3MED A;  2JEF A;  1RHQ B;  3EVM A;  3I31 A;  2GQQ A;  2IHR 1;  2FC9 A;  1XR6 A;  3M30 A;  2IM2 A;  4L6V 3;  4OZN A;  4FVC A;  1OO0 B;  3I96 A;  2WW8 A;  4WCE Q;  1F5C A;  1Y3K A;  4ZPT R;  1JLE A;  1CUL A;  5IFM A;  3AJ2 A;  3EGN A;  1FVS A;  1IQZ A;  4DV6 J;  4CH1 A;  3M05 A;  4K4S A;  5CYM A;  1IWG A;  2HMI B;  1PKU A;  2N7Y A;  2KRB A;  2PC6 A;  2ZM6 F;  1VJQ A;  3F0N A;  1KTV A;  2BQU A;  1T02 A;  3TA2 A;  2YKN A;  1P6T A;  5KFZ A;  2QMW A;  3RBX A;  1S79 A;  3AT1 B;  1GTE A;  5B0D A;  1EB0 A;  1NXI A;  2RUS A;  3M9M B;  5A0Y B;  3FRZ A;  3TAR A;  4LRA A;  1CJT B;  3A1Y G;  3PHE A;  3T1Y J;  3FCH A;  1FF2 A;  4D3G A;  5J2Q B;  2UUB F;  2AZ3 A;  3MED B;  2YNG A;  3FEX B;  3CCW A;  3E01 A;  1OS5 A;  4U9R A;  5F3T A;  1RLD A;  1WC4 A;  3NEK A;  3H8Y A;  1Q5V A;  2M8D B;  4QWC A;  2Y0S D;  4EMD A;  3ZZZ A;  2G2Y A;  3FSY A;  1C0T A;  2CJ9 A;  3US5 A;  2FGC A;  1CUL B;  2E5H A;  2C3M A;  2FIU A;  1U48 A;  4B3M F;  3MCO A;  1CQM A;  1EKR A;  4OZ2 A;  4KY3 A;  5DDQ C;  2EK1 A;  4Q7A A;  2W24 A;  2XBP A;  5CYM B;  2QA4 G;  2IVM A;  4J5O A;  3GYG A;  1DAX A;  5KTQ A;  1SH2 A;  3OXF A;  4AFF A;  3CD5 A;  1WG1 A;  2XM3 A;  2UP1 A;  3H2V E;  3K58 A;  1NSP A;  4B02 A;  2B9W A;  2OUG A;  5CAB A;  4C48 A;  2QA1 A;  5EWG A;  4C3M A;  3KLE A;  1SCJ B;  1U7L A;  2HS4 A;  3NWG A;  1AYE A;  4HEA 9;  2ZH2 A;  3Q24 A;  4E0D A;  1RTJ A;  4WFZ A;  2DK2 A;  3DCA A;  3SCJ E;  1O51 A;  3T41 A;  4ED6 A;  4W92 B;  2WON A;  3CTR A;  2VF3 A;  3G6X A;  1NLK L;  2YNG B;  2KM8 C;  3E01 B;  1PIE A;  4U8Y A;  5FD1 A;  3RR7 A;  2AIR B;  3J81 j;  1SKR A;  3OQ2 A;  3ETO A;  4QYZ J;  1U4B A;  2HZA A;  2RVJ A;  3VAG A;  4QYZ K;  3CDU A;  2MTL A;  1S0N A;  3FEY B;  2NR0 A;  1C0T B;  2FZG B;  4XDD A;  4PPZ A;  1Q78 A;  2UVR A;  3BBC A;  3H2U B;  4OJG A;  4MJK A;  3MOZ A;  2FLO A;  4DX8 H;  2A18 A;  2ZH8 A;  1GK8 A;  5KT6 A;  3LOU A;  2DR7 A;  4PG6 A;  2ALZ A;  4CP5 A;  1O0P A;  4QPT A;  3CF5 Q;  2WTF A;  3TAM A;  5L1K A;  3KLE B;  2BRL A;  2G1D A;  3PYD A;  3I0S A;  4IQM A;  1X0F A;  2BYC A;  3G4S S;  3M9O B;  2Z58 B;  5F8J A;  1RTJ B;  1S9E A;  2QLW A;  3KMQ A;  2LEA A;  2BAB A;  2WON B;  1XC9 A;  5DQH A;  3EGV A;  4K4Y A;  1VQ4 S;  3V5R A;  4RUH A;  3GG0 A;  2VQE F;  4O3P A;  3WBZ A;  2IVY A;  2PD1 A;  4KT0 C;  2B51 A;  3RAX A;  3U1M A;  4FYD A;  3I32 A;  2BZ2 A;  2QG9 B;  1KVJ A;  4NCG A;  2HVH A;  3TW0 A;  2CQI A;  4Q43 A;  1VHF A;  1KQK A;  4CYU B;  2BKP A;  1DFD A;  1WG4 A;  2KYZ A;  4NXN J;  2DH9 A;  2DT9 A;  2DGO A;  4DUT A;  1RE1 B;  4L3K A;  1HL6 A;  1RCO B;  1NJZ A;  4K5S A;  4DLG A;  1DAR A;  2KHC A;  2M8H A;  2IBK A;  4RZR A;  1GNK A;  3FMW A;  2BW2 A;  2NQP A;  5D4N A;  3TAM B;  5IWA J;  3ZTQ A;  1LWE B;  1VQN S;  5ETQ A;  2ZKU A;  1TK5 A;  2NZ4 A;  3DLE A;  3I0S B;  4HT7 A;  4QIE A;  4F0H A;  5SUH A;  1SJF A;  2HHX A;  5HP1 B;  4XPE A;  2BAC A;  2LA4 A;  1S9E B;  4ETX A;  1XK8 A;  3GON A;  3X3U A;  2MZR A;  1P1L A;  1FD2 A;  3G82 B;  3JSY A;  5CZX A;  4UTG A;  3NGS A;  1A7G E;  5D15 A;  1FA0 A;  3V4I A;  3DXS X;  1YJR A;  4QIW D;  5KG7 A;  4DR7 F;  4ID8 A;  4DV5 J;  4WFB Q;  4NCG B;  1VK8 A;  3MAQ A;  2GFF A;  2WRM A;  3W63 A;  4DMZ A;  2MZ1 A;  4C0O C;  2EFN A;  3QBC A;  5FDL A;  5IZH A;  2LDY A;  1K44 A;  2E5J A;  4L76 A;  3U1N A;  4RX6 A;  3EX7 B;  2QE5 A;  1ACM B;  4H54 A;  3LWM A;  1SV5 A;  2CPX A;  2V34 A;  3IM8 A;  3BGU A;  1U1N A;  4P75 A;  1QSL A;  3SQO P;  2ADC A;  3HM9 A;  3GTY X;  3OL7 A;  4YB6 A;  1YRX A;  1BWE A;  1Y10 A;  2VIH A;  3RB4 A;  1YX2 A;  3LPE A;  1KD1 T;  4LF4 F;  4X64 J;  3WC2 A;  2ASJ A;  2C2K B;  4MKB A;  2VQF F;  3DLE B;  3KXD A;  3MCN A;  3O6Q A;  4ED4 A;  1HBO A;  5GAE U;  2IMW P;  4CO5 A;  1PYT A;  4NLU A;  2ZKT A;  2F9J A;  2PMH A;  3A8J A;  3QAU A;  5DO2 A;  2ADB A;  3UN3 A;  1ICE B;  3UE2 A;  1TL4 A;  2PI4 A;  5F0W A;  2Y1L B;  4ENO A;  4DV1 J;  4S0M A;  3R6G B;  2ATL A;  2HBR B;  4P9S A;  3V4I B;  3OXG A;  1RCX B;  3MPU B;  3HHE A;  1X8D A;  1G6B A;  4O44 A;  1VBY A;  1Q4R A;  2OFH X;  1UEV A;  2MKJ A;  1Y0H A;  3UN5 A;  4HHJ A;  2VFU A;  1FX2 A;  5FDL B;  3GLJ A;  3SSS A;  2W2Q P;  4WYW A;  1YQH A;  2Y3Y A;  1YJW S;  3R5A A;  2AX0 A;  4DR3 F;  5FJ4 A;  2XMT A;  4LF5 F;  2CPH A;  5GAD U;  3VAF A;  3PIO Q;  4JI8 F;  1SV5 B;  4DU7 A;  2YX4 A;  2RDJ A;  3IBW A;  2YWE A;  5IT4 A;  2FJX A;  2FVS A;  1P9Y A;  2DGW A;  3M6V A;  4ED0 A;  1BY9 A;  2W7P A;  3BN7 A;  3CO0 P;  2DRB A;  3ZZU A;  1B64 A;  2XUL A;  2AW0 A;  3NLC A;  4PCQ A;  5E3C A;  3ZTP A;  2OEM A;  4KTQ A;  2MQL A;  4R8U A;  4TYA A;  1WTB A;  3D1Q A;  2UV8 A;  4B3R J;  4O3Q A;  4EUV A;  2XWY A;  2E5I A;  3J7Z 5;  4AL6 A;  1KN6 A;  3QSI A;  2FUG 9;  1SJ4 P;  1JX4 A;  2CA9 A;  3AH6 A;  3HF5 A;  2W2M P;  2NPF A;  2UXD J;  3OSP A;  3TEG A;  2HW3 A;  1DQ8 A;  4ZCI A;  4KBI A;  2NYI A;  4OMF G;  3QT6 A;  2G13 A;  5CQG A;  1FKP A;  2RQ4 A;  2ZDP A;  3MF5 A;  2CNO B;  2BJD A;  3P5T L;  1XNR F;  1H3D A;  2J0Q D;  2IPO B;  2B6A A;  1NHU A;  1WUU A;  2QYG A;  4DPU A;  1WC6 A;  3W8G A;  2RDD A;  1YG0 A;  2JEI A;  1U8S A;  2LDI A;  3VAI A;  3GU0 A;  4TN2 A;  1LKZ A;  2J76 E;  4MIB A;  4ELU A;  1N88 A;  4NLX A;  2A2D A;  3LF0 A;  4DZ6 A;  4ICL B;  4M5J A;  3B4M A;  1HNX J;  2ZOF A;  2R2U A;  4R5P A;  2OEL A;  4AD6 A;  2E1A A;  3MM6 A;  2EG1 A;  4DEZ A;  4AE5 A;  3GCX P;  3GV5 B;  4R8U B;  3NGR A;  1RB0 A;  1EZZ B;  1X5S A;  1ELO A;  2C2R A;  4J9R A;  3BGR A;  1MWQ A;  2VG7 A;  3UFC X;  2A1B A;  5K5M A;  2Z2Y B;  3AB4 B;  3S01 A;  2D69 A;  3Q89 A;  1FEH A;  4FS1 A;  2VKR A;  2MQN A;  1NB7 A;  1PAU B;  2A6O A;  2M0G B;  3AOB A;  4J9P A;  1FCA A;  4CM2 A;  4CWB A;  1FKP B;  1FRI A;  2U2F A;  1ZPV A;  4NI2 B;  3A8E A;  3ET6 A;  3CD6 S;  3D9B A;  4ZP8 A;  4JI7 J;  1R8H A;  2UZA A;  4KPC A;  4FDF A;  1NJW A;  1URR A;  4LF6 F;  2ZUG A;  4JI0 F;  4WZQ A;  2B6A B;  2OTJ S;  5CD4 A;  1K9M T;  3MM7 A;  1GQE A;  3ZXW A;  2VIC A;  1LV5 A;  2P6S A;  3H59 A;  1J5E J;  2YKO A;  3ILL A;  3EXY A;  4A8O A;  2WVC A;  3L4B C;  3M9N B;  4JUZ A;  1QY7 A;  3AOD A;  1YVF A;  2FJE B;  1LXJ A;  1N56 A;  4J9S A;  4IO1 A;  4NOH A;  2Y1I A;  2W8L A;  2YVS A;  4R5P B;  1FVQ A;  4B08 A;  3MM6 B;  2H51 B;  4ECS A;  4FVM A;  5FLX Y;  3CCL S;  1KON A;  1NDC A;  4GKK J;  2FC8 A;  3AOA A;  3BGR B;  1T3O A;  4BC7 A;  2VG7 B;  3UPF A;  3AY0 A;  1HHQ A;  1D0E A;  4IG3 A;  1WG5 A;  2OIH A;  1B0T A;  2PSZ A;  3IGN A;  2CRL A;  2HFS A;  3F41 A;  2CNN B;  2HVE A;  5KFM A;  5AE3 A;  2YNF A;  2HHH F;  2AEM A;  1EAR A;  2DHH A;  2B8Q A;  1NHK L;  3DKD A;  4F7V A;  2BKO A;  3N6L A;  3IA0 A;  3ET6 B;  1AZS A;  1X4A A;  4WTO B;  3A3N B;  3NOG A;  2DGQ A;  1U1M A;  3EJM A;  3MM7 B;  3B78 A;  1YJN S;  5CH7 B;  3ULH A;  1SJ3 P;  4Q0B A;  4HT5 A;  1L3K A;  2HFV A;  1IKX B;  4ECZ A;  5F41 A;  2DPJ A;  2FPH X;  3M8P A;  1F6T A;  5B0A A;  1UZH A;  1WOO A;  2WB4 A;  1A0O B;  3HI9 A;  4QWD A;  1K8A T;  2CJK A;  3OTO J;  2QX0 A;  3PEJ A;  2E5L F;  1DRZ A;  1NCL A;  1SH0 A;  2I9S A;  3QQC D;  2LEB A;  4DSL A;  1JIH A;  3EPI A;  3W8P A;  1B3T A;  1RA6 A;  3P45 B;  3RB0 A;  1JLA A;  4NA2 A;  2GQ2 A;  2VBY A;  1VQ6 S;  3CJ4 A;  4ZS6 A;  4H4O A;  2BJ1 A;  3JTN A;  2HK2 A;  1KS2 A;  2DXE A;  4IFV A;  2L08 A;  2NPI A;  4OZ0 A;  3FDS A;  4UW2 A;  4EEY A;  3DOM B;  3PHT A;  1QTM A;  3ELH A;  4IG3 B;  2HND A;  3K5L A;  4ZPV R;  3DLG A;  4LIR A;  4F4Z A;  2YNF B;  4G1P A;  1HNW F;  3RU0 A;  2QL9 B;  2B4O A;  1V3R A;  4FF2 A;  2ZJR Q;  5LOQ A;  1AZS B;  4DR2 J;  2V94 A;  2P6T A;  3HDS A;  4RW9 B;  2B7B B;  3PNI A;  4BWJ A;  4DU8 A;  1NEE A;  1S10 A;  2EI5 A;  2QRR A;  2KU7 A;  3UW1 A;  4RWX A;  4Q0B B;  3OFE A;  1L3T A;  2JVO A;  3M8P B;  2VA3 A;  1U1Q A;  1NKB A;  1SH3 A;  1AW0 A;  3IGV A;  1N32 J;  1EP4 A;  1W25 A;  2GJI A;  4PUO A;  3X1L B;  2KFY A;  3DRS A;  1RIS A;  3UCZ P;  5ETV A;  1U09 A;  3J7Y I;  1JNR B;  4BCA A;  4HKQ A;  5C24 B;  3NKY A;  3ZTO A;  1JLA B;  1D8Y A;  3FSX A;  1REG X;  1MWZ A;  1T9U A;  3CJR A;  3M32 A;  4EYH B;  1EET A;  5K20 B;  5K14 A;  4J7C A;  1BMQ B;  4M1K A;  4H4O B;  5DJB A;  8RUC A;  2IDL A;  1SQE A;  4IFV B;  1SKW A;  3HHK A;  2DR5 A;  1S97 A;  2HND B;  4MKY A;  1CVJ A;  2K06 A;  1HI8 A;  1UZD A;  5AJ3 F;  4ZMM A;  5CXT A;  3DLG B;  2AMC B;  5G4D A;  4CIO A;  1YKW A;  2HFO A;  1M90 T;  1WDT A;  4X66 J;  3CGI A;  3M2U A;  5IT9 Y;  5KFB A;  4TLR A;  2PT0 A;  4OFZ A;  1SI9 A;  3CUL A;  1I94 J;  3PG9 A;  1TVR A;  4JYA J;  1IBK J;  4OYP A;  1X5T A;  4TKT A;  4TYB A;  2RT3 A;  1MN7 A;  3MDF A;  5T14 A;  4RKU C;  2VDH A;  2W2P P;  2KHD A;  3CIM A;  3RB3 A;  2GAG C;  5HVH A;  1X4G A;  3AHP A;  5H1S V;  1EP4 B;  4DS5 A;  3TAP A;  4PUO B;  1ZA1 B;  3DLB A;  3EYZ A;  1FER A;  1NZ8 A;  3LAL A;  4Z37 A;  3IBC B;  4ZVU B;  1ZAX A;  4M5H A;  1HWI A;  3CB4 A;  4QIG A;  3M32 B;  2C2M B;  3NXZ A;  4F4W A;  4X4R A;  4DR6 J;  2N3O A;  1EET B;  3D5M A;  5K14 B;  2L9W A;  4X62 J;  2C2N A;  1HNZ F;  2U1A A;  2IBO A;  1UVM A;  1HHS A;  2K8G A;  1Q8B A;  2F8E X;  4NML A;  4NYP A;  5U47 A;  2VFS A;  1S12 A;  4I7F B;  1Q82 T;  4QWE A;  4DL3 A;  5AXN A;  1VQM S;  3KWM A;  3NAH A;  3LA0 A;  3D54 A;  3R6L B;  2VOD A;  2VC1 A;  4MIA A;  4KB7 A;  3CIZ A;  4P7T A;  2WSC C;  3UN2 A;  3EM1 A;  4DR5 J;  3M2U B;  2QGF B;  4RWW A;  4NZ7 A;  3OFH A;  3RRG A;  3MR2 A;  3R7S B;  3UVJ A;  1TVR B;  2UXC J;  4O3O A;  4I2Q A;  4KO0 A;  7FD1 A;  4DV4 J;  1DBD A;  4PQU A;  2KI2 A;  2VJU A;  7FDR A;  2X1A A;  4B3S F;  4LT6 A;  3T1Y F;  3D68 A;  3FBE A;  4DXL A;  2VBZ A;  3CPW R;  2CJB A;  3WHI A;  1WKJ A;  3CSK A;  1N33 J;  2P5V A;  1F3F A;  3VQT A;  4QIV A;  5A8W A;  5FLX U;  2RRB A;  4RPF A;  2VZ9 A;  2CQG A;  4J9U E;  3D7S B;  3DU5 A;  4KHP F;  2DHG A;  3ZZ0 A;  3C16 A;  2CXE A;  3BQ2 A;  2BQ3 A;  1CEZ A;  3U02 A;  4A8Q A;  2PMW A;  4LUB A;  2YNH A;  1T9Y A;  1BUX A;  1YRU A;  4ZPW R;  2RJZ A;  2XB2 D;  4JB8 B;  2HRT A;  3GIM A;  3GE9 A;  2IA6 A;  4UY8 5;  1S6P A;  2HHP A;  4DFK A;  4HH1 A;  5KG3 A;  1Q7Y T;  3JB9 k;  3PJ9 A;  2VPZ B;  3LAM A;  1L3V A;  5F8I A;  3KUG A;  2D3U A;  4I2Q B;  5HRO A;  4KO0 B;  1S1T A;  5LMU J;  1ZAW A;  2VFV A;  4I67 A;  3IO1 A;  4IH5 A;  1IBM J;  2ZFH A;  2VBW A;  3BKF A;  4LBP A;  1N0V C;  3OJS A;  5ETN A;  3TUP A;  4IOA Q;  2D9O A;  2GIQ A;  4K0K J;  1REV A;  3TA1 A;  4NWB A;  2W2O P;  4G1I A;  3BDE A;  4GC7 A;  2E9T A;  2K1R A;  4Y00 A;  2X3D A;  1F1B B;  3FBB A;  3PX4 A;  1N36 J;  5CCM A;  2KVQ E;  5A8W B;  1FT8 A;  1VRT A;  2XCA A;  4YDD B;  5B09 A;  2BOA A;  2ZEJ A;  2V9K A;  2HIY A;  1WHY A;  2L9N A;  4WTY A;  2B0G A;  1H2T Z;  4EO8 A;  1H72 C;  3C16 B;  2ATC B;  2EFO A;  3PW0 A;  3GMG A;  5E2Q A;  1C0U A;  5GAG U;  1H73 A;  2I0X A;  2E7W A;  2YNH B;  1GMW D;  2QYC A;  4C98 A;  1HYS A;  2BV3 A;  2RHS B;  4P7V A;  1JQG A;  1IJF B;  4CO1 A;  2IFX A;  2DRD A;  2LVW A;  4LFB J;  3D28 A;  4OI0 A;  4U7U K;  1UFK A;  1GEH A;  4OZ3 A;  5HRO B;  5E7O B;  2W1B A;  2DNK A;  1SKU B;  2XY5 A;  2MEW A;  4Y28 C;  2OPP A;  1Q0N A;  2MZJ A;  3HFK A;  3IWN C;  4CH0 S;  3TJA A;  3PJW A;  4ZVG A;  2K3I A;  1BGX T;  2IM1 A;  3RAQ A;  1REV B;  5CD4 H;  2OPQ A;  3NAI A;  1S1X B;  2K1R B;  1M5O C;  5HJY A;  4WP9 A;  3VAL A;  1U2R A;  1VRT B;  4K4T A;  2RQK A;  3ZZY A;  3M7V A;  1UWA A;  4FF3 A;  5D0G A;  2FJW A;  3TA0 A;  2ZM6 J;  3FCV A;  4NCA A;  1N5Y A;  2JJ4 D;  2Z4P A;  3ISN D;  3V6K A;  4IR9 A;  2CQC A;  1C0U B;  2VDI A;  4DX7 A;  1KDN A;  2IJR A;  1TKX A;  4QWB A;  3Q86 A;  1EAY C;  3QWP A;  4KGK A;  1RAE B;  2LXU A;  5IWA F;  4OQJ A;  3PW2 A;  4MH8 A;  3D6F B;  4RW7 A;  1IKV A;  2CPI A;  5HI7 A;  1DZ5 A;  5DGB A;  2C3P A;  4DG1 A;  1NK4 A;  3HT0 A;  3K5P A;  1MSW D;  2OPP B;  2DY1 A;  1LFW A;  4AL7 A;  4PAB A;  2C2Z B;  3UR0 A;  4GO5 X;  1FO1 A;  2JWN A;  1RBL A;  3QNW B;  2MXY A;  2OPQ B;  2PE8 A;  1T7P A;  3JTP A;  5A8K B;  1RXO B;  1UPM B;  2ZWO A;  3CCE S;  2IVF B;  4B3M J;  4IH7 A;  2F8M A;  3M4X A;  3DU6 A;  1MG7 A;  4O3S A;  1RGV A;  1CJV A;  3O8W A;  5DDO C;  4NCB A;  3DI6 A;  1N5Y B;  4OYA A;  3V2U C;  3MI7 X;  3G6Y A;  4I4B A;  3KLH B;  1NME B;  2XO7 A;  1JXV A;  5KFD A;  1VOM A;  3BRE A;  3CJ2 A;  3IS9 B;  3J80 Y;  3GYX B;  4JI1 F;  5F0U A;  5KFA A;  5ADZ A;  3MMB A;  3JXO A;  3DLK A;  3QT8 A;  2R42 A;  1TKX B;  1Y9O A;  4WFY A;  4YEA A;  2LXF A;  3HKZ D;  1VBK A;  1DLO A;  5BJR A;  4UUW A;  3POT A;  1YTY A;  2AJ4 A;  2NSC A;  2FTR A;  3RRK A;  1YDL A;  2Z30 B;  4LIW A;  4LJM A;  4R25 A;  1IKV B;  4KE5 A;  2EFG A;  1S0O A;  1Z2Z A;  2EG2 A;  4DG1 B;  5KFQ A;  2AYE A;  4LSN A;  2OHD A;  1MNE A;  1RWO B;  2KN4 A;  1N0U A;  1K73 T;  3PW4 A;  3GFY A;  1H7X A;  3TVY A;  5E41 A;  2KXF A;  2BE2 A;  1DTT A;  4JI2 F;  4DWI A;  4B9V A;  3I5C A;  4QW8 A;  1CC7 A;  5A2Q Y;  5HMX A;  3GG1 A;  1YIT S;  2QL5 B;  4OL8 A;  1YGY A;  2NS1 B;  1VYA A;  1T9X A;  1LOU A;  1CJV B;  1S6Q A;  1Z4U A;  3DI6 B;  2VG6 B;  5IC6 B;  5AT1 B;  4NL5 A;  4E98 A;  6FD1 A;  4HAC A;  3VAH A;  2IYG A;  3PAC A;  2DXF A;  2KVI A;  1U6B A;  3ZO7 A;  1RT4 A;  2RH3 A;  3DLK B;  1N5Q A;  3G86 A;  4LBI A;  2ZZN A;  2UUA F;  5DM7 Q;  1KHW A;  1VIS A;  1X4D A;  5HMY A;  1DLO B;  2XS2 A;  3POT B;  4DL6 A;  5ETS A;  1VGY A;  5J1P A;  2Y1J A;  2GZO A;  3SEO A;  3HVT A;  5BYQ A;  4N77 A;  2Z2Z A;  1V3S A;  2VQE J;  4B3R F;  4JV5 F;  3OTC A;  2JVR A;  4RBV A;  3QAT A;  4B9L A;  2H3E B;  4MYT A;  4LSN B;  3PZP A;  1ZTW A;  8AT1 B;  4FPI A;  4ATN A;  3W5Z A;  3W9H A;  2RRA A;  1S72 S;  3CED A;  2SXL A;  1NO8 A;  3KK2 A;  3ZTS A;  2CIM A;  3CNQ P;  3TAN A;  2BE2 B;  1DTT B;  1MN9 A;  3VTI A;  2F4V J;  1UJ4 A;  3AD7 C;  2DNL A;  3ZC4 A;  1BLU A;  3H4D A;  3M6W A;  5LL6 d;  3MPW A;  3TZZ A;  2AWZ A;  2IMO A;  5HL7 Q;  1TK0 A;  4RUB A;  4P74 A;  1JLB A;  2WK4 A;  2PMZ D;  2XC9 A;  3V81 A;  1VFJ A;  2ROG A;  4HAC B;  4I0W A;  4DPY A;  1XTZ A;  3M8W A;  2HFZ A;  1RAH B;  4FS2 A;  4XDC A;  2ZBQ A;  1XNQ F;  5D8H B;  5C2C A;  1RT4 B;  1IQT A;  5H9E J;  3OT9 A;  1UPP A;  1VMB A;  1YBA A;  2FJD B;  4R0J A;  1ZPW X;  1RT3 A;  4F2S A;  3MPV A;  4MFB A;  3PY8 A;  3K0J A;  4CCH A;  3ZFV A;  3HVT B;  2HHT A;  2KFZ A;  2E9R X;  3DDK A;  3LP0 A;  2EVZ A;  2CUY A;  1RT1 A;  3T1H F;  2JLE A;  1NH7 A;  1R3N A;  2ZBP A;  1LK5 A;  2DR9 A;  4LQ3 A;  3O1L A;  2NLW A;  5EWF A;  3KK2 B;  4LBH A;  1ZZF A;  3D67 A;  3MEK A;  4ZVH A;  5IT0 A;  2RRN A;  1CBK A;  3I56 S;  3IRW P;  2XS7 A;  1NK9 A;  1QVF R;  2HNY B;  2J9D A;  4OX7 A;  1G3O A;  4A8S A;  4X65 F;  3OR1 A;  1JLB B;  2V9W A;  1HQU A;  2FHM A;  3NG8 A;  2W4C A;  3CCT A;  2UV8 G;  1OYD A;  3HHL A;  3NS5 A;  4LF4 J;  5IXU A;  2E7V A;  5L1J A;  1Q8K A;  3R5D A;  5AE1 A;  2VQF J;  4K4U A;  3K5N A;  2O67 A;  4V19 J;  1FTR A;  4X4V A;  1X9M A;  1RT3 B;  4U7U D;  4KHR A;  5J1E A;  5LSR A;  2FJA B;  4MFB B;  2FYX A;  5D77 A;  4PEO A;  2HNZ A;  2DIV A;  3TR5 A;  1OPI A;  4H4K C;  4R0E A;  4TLQ A;  4GKK F;  1IR0 A;  1B70 B;  3LP0 B;  3CCS S;  3GSI A;  1R0A A;  1RT1 B;  1QJH A;  3PVX A;  3NNH A;  3IWX A; 
#chains in the Genus database with same CATH homology
 4W98 A;  1NCL A;  3G2X A;  1S59 A;  3VGU A;  3ETM A;  3PJ9 A;  2DY9 A;  3BBC A;  3EIC A;  1MN7 A;  3EE3 A;  1VYA A;  3Q8Y A;  3R9L A;  1NDC A;  3ZTR A;  1KDN A;  3Q8V A;  5IOL A;  4ANC A;  1JXV A;  1NSP A;  1K44 A;  1XQI A;  2BX6 A;  2HUR A;  3GP9 A;  3Q89 A;  1LEO A;  5CAB A;  3Q86 A;  4DUT A;  3VGV A;  3EMT A;  3FBE A;  5C7P A;  3BBF A;  3NGU A;  5BXI A;  2DYA A;  3ZTO A;  1HHQ A;  1WKK A;  3FKB A;  3Q83 A;  3ENA A;  3VGS A;  3NGT A;  1UCN A;  1NDK A;  3FC9 A;  3VVU A;  2DXE A;  2NCK L;  1WKJ A;  2DXD A;  3B6B A;  2DXF A;  3EVM A;  4CP5 A;  1F3F A;  2HVE A;  3FBC A;  1BE4 A;  1WKL A;  2B8P A;  3ELH A;  2B8Q A;  1LWX A;  3EVW A;  3EVO A;  2AZ3 A;  1NHK L;  3B54 A;  2AZ1 A;  1NB2 A;  4UOF A;  4KPC A;  1HIY A;  3DKD A;  2CWK A;  3WX8 A;  3FCW A;  3FBB A;  4HR2 A;  3DDI A;  3ZTQ A;  1PAE X;  1NLK L;  1NSQ A;  1B99 A;  1BHN A;  1NUE A;  1S5Z A;  1NSK L;  3GPA A;  4ANE A;  4DI6 A;  3MPD A;  4F36 A;  4UOG A;  3BH6 B;  1NDL A;  1ZS6 A;  3VVT A;  1W7W A;  3Q8U A;  3EJM A;  4AND A;  4EK2 A;  4DZ6 A;  1S57 A;  4C6A A;  4UOH A;  3ZTP A;  1NPK A;  1B4S A;  1BUX A;  2HVD A;  3FBF A;  1EHW A;  2ZUA A;  1NDP A;  3PRV A;  4WBF A;  4FKY A;  4O0N A;  1U8W A;  2VU5 A;  3EM1 A;  3JS9 A;  3BH7 B;  3NGS A;  1XIQ A;  5CAA A;  3BBB A;  2BEF A;  3L7U A;  1F6T A;  4FKX A;  3VGT A;  3FCV A;  1PKU A;  3ZTS A;  4ENO A;  4F4A A;  3NGR A;  1MN9 A;  1HLW A;  4S0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...