1HLWA

Structure of the h122a mutant of the nucleoside diphosphate kinase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
150
structure length
150
Chain Sequence
VNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIAGSDSVESANREIALWFKPEELLTEVKPNPNLYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chemical rescue of phosphoryl transfer in a cavity mutant: a cautionary tale for site-directed mutagenesis.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
total genus 43
structure length 150
sequence length 150
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2000-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 1hlwA00
1HHQA 3EM1A 2DXEA 3FBBA 3ZTOA 3DDIA 4WBFA 3EVMA 4KPCA 4HR2A 2HVDA 1EHWA 1F3FA 1XIQA 2HVEA 3Q8VA 3ELHA 3Q86A 1UCNA 3PJ9A 3JS9A 4C6AA 4ANEA 1NCLA 3VGSA 1NDLA 1S57A 3Q8UA 4UOFA 2BEFA 4F36A 4O0NA 1LEOA 3Q89A 1BHNA 1NSPA 3ENAA 3FBCA 3ZTRA 4F4AA 1MN9A 1WKJA 3VGUA 1NDPA 3B54A 3EVOA 3FBFA 3DKDA 4UOHA 2NCKL 3FCVA 3PRVA 3GPAA 1HIYA 1S5ZA 1NUEA 3NGTA 4FKXA 1NHKL 1WKKA 2AZ3A 1HLWA 2BX6A 3B6BA 4ANCA 1K44A 1KDNA 3FKBA 4ANDA 3ZTQA 4W98A 1NLKL 3ZTSA 1JXVA 1S59A 1NSKL 1W7WA 3BBCA 4DI6A 4EK2A 3R9LA 3G2XA 3MPDA 3L7UA 1ZS6A 3BH7B 3Q83A 2HURA 4UOGA 3EVWA 2B8QA 1MN7A 5CABA 3EMTA 3VVTA 4DUTA 3VGVA 3VVUA 3WX8A 4ENOA 2DXDA 3FC9A 3Q8YA 1NDKA 1VYAA 2DY9A 5CAAA 1B99A 1PAEX 1PKUA 3NGSA 1BUXA 2CWKA 2B8PA 1F6TA 4FKYA 4S0MA 5BXIA 5IOLA 2VU5A 3NGUA 3FCWA 4CP5A 2DXFA 3VGTA 1U8WA 1NSQA 2AZ1A 4DZ6A 1XQIA 1NDCA 3BBFA 3BBBA 1B4SA 3GP9A 3NGRA 3ZTPA 3BH6B 3FBEA 3ETMA 1NB2A 5C7PA 2ZUAA 1WKLA 2DYAA 3EJMA 1NPKA 3EE3A 1BE4A 1LWXA 3EICA
chains in the Genus database with same CATH superfamily
4JI2F 5D6GA 1NAQA 4C8LA 1IQTA 2HSEB 2GW8A 2RJZA 1H74A 4PYAA 3VALA 4LF8J 2DR6A 2FD2A 2LDIA 2OFHX 3A4TA 3D6FB 4I7FA 2MKHA 2VFRA 4QYRA 3TR5A 5A8WA 3THVA 4H4KC 3L3CA 3QSYB 2CG8A 2MLYA 4OZNA 1Q7LB 2WZ1A 2AJ0A 3CJQA 3WIVA 1TAUA 3MM8A 4CO4A 2Z2LA 4AQYF 1FERA 1JQGA 1TP7A 4B3OB 4OJ3A 4DV1J 4CLYA 1JLCB 4A8KA 2HFVA 3SDEA 5B0AA 5HQLA 2PIIA 3GIRA 2ZH5A 1Y5IB 3IR5B 2R8JA 2CPIA 4P6QA 5A0YA 3NCPA 3TEGA 1QAXA 3FFIA 3KLFA 3QFWA 4CO3A 5G0RA 4RNMA 4CO2A 5HANA 2V8PA 4X64F 5HK4A 1IBLJ 5DG8A 2IA6A 4TU9A 4K4WA 2OTJS 3T41A 3VTIA 3EVOA 3GJSB 2X1AA 4KB7A 1ZAVA 2BOPA 1RXOB 2CQ3A 1WEXA 4M5MA 4O3NA 4CWBA 5E3QA 3TARA 1IBMF 1L3TA 4LF4J 5KT4A 4K0KJ 2H1YA 3DU6A 2CQHA 2OUGA 3R97A 2P9GA 3DRSB 3WC0A 4KT0C 1G1XA 1O8BA 1UPPA 4LT6A 5IV4A 2QZ8A 2E1MC 2Q1LA 3HHLD 3QWPA 3ISND 5EUHA 3CF5Q 2CQ4A 4FNHA 2QA2A 4RNOA 3KK3B 2NXEA 1X4BA 1YJVA 5L38A 2IC3B 3VAGA 3TJ8A 2F40A 3P3DA 5L1JA 5DM7Q 1UEKA 3AA9A 2D3OR 1Q16B 2AX1A 5D0HA 5J1PA 4ED0A 3FMBA 1CPZA 5ETPA 5HMZA 1ZTWA 4ES3A 2L9DA 4BBYA 5F3TA 4OYOA 2ILYA 1D3WA 3J81U 2HQIA 1E6VA 2Y0BB 5FD1A 2I38A 3WQPA 5HQ8A 4G65A 2D41A 3BH7B 4NA1A 2ZVIA 2IVYA 2JLFA 4DV3F 4A8MP 5ETMA 3WC2A 2ZZMA 3BYPA 1BQMA 1JLQA 1TL1A 3W9HA 1H73A 3C8YA 3IP0A 3MM9A 3VVTA 1F60B 1Y4ZB 1XN9A 1HNXF 2MJUA 3VVUA 2ZC3A 1GXTA 3ZZOA 4DR2F 3M9OB 2Q6BA 3FEZA 3QGPA 4O0IA 1S72S 1G3OA 2NSCA 2F4VJ 4B3TJ 3DOLB 3LF0A 2W9CB 1UJ4A 3PIOQ 3J80Y 1RT6B 5HMWA 5A2QY 2RIJA 2V68A 1Q79A 4O44B 5E41A 2ALZA 1NPPA 2XMMA 5KFTA 3L95X 2VHGA 1MU2A 3HO1A 1E6VB 1WC1A 3V4IB 1EKSA 3TEHB 2YWFA 1CC8A 4PG8A 4DPXA 1KVIA 2GX8A 3CJKB 5E2QA 1SKUB 1S7IA 2QIFA 5JVGQ 2E1AA 3CCWA 1MG7A 2G2OA 1MLAA 3A8JA 4BHQA 2XO6A 4ECRA 2DXFA 3KJFB 1X4HA 4RBVA 3NWGA 4ED8A 5IWAF 4FBTA 5KFFA 1KOHA 1WG5A 2ROPA 3C16A 1WHYA 1S6UA 2JNJA 3H40A 1T05B 2E5LF 2HNZA 4PUOB 1ZPVA 4PQUB 2IA0A 5A8RB 4RW8B 5F8HA 5DM6Q 2WTFA 2NLWA 2WOMB 3M30A 1JLBB 1S1WA 1VRTA 2F5GA 2G9OA 2DGUA 3PJWA 1QTMA 2XULA 3D6MB 1YQHA 4NYPA 3KJVA 1SJ3P 1LWCB 3PZPA 2HHSA 1UTAA 2K3KA 2J6SA 2YNFA 1SH0A 3CCQS 1RT3B 3N6LA 4K2XA 1RT4A 3D6HB 3ZTOA 1FDBA 4LQ9A 2LMIA 4BS2A 4CLLA 2K06A 4JI5J 1F2GA 1R8CA 1JXEA 5E5NA 2RVJA 3P8BB 3D9BA 2GAHC 4NLDA 3GV8B 2LXFA 5HVFA 4EBDA 2MGZA 2CNKB 2PI5A 3WX4A 5C42B 2B4UA 1KC8T 2ATLA 2C3UA 4X4TA 1FVQA 1M5SA 3CT9A 2LCWA 2BYCA 2ZZTA 2DKOB 3KDOA 4C8YA 2BBEA 4ZVOB 1Q81T 6AT1B 3V81B 3SCLE 4FXWA 4JP8A 1SB6A 2J0WA 3FSIA 3HK2A 3UCZP 3K5NA 4MK9A 4O0NA 1X9MA 1VC6A 2HHUA 1PC4A 1FF2A 2FHJA 4Y6IA 5BJRA 2RDIA 3ILOA 2GAGC 3KK3A 1U6BA 1GAOA 3GMGA 1S7HA 2FJVA 4ES1A 1SVDA 1SI9A 2GFFA 4LF2A 3NS7B 2E29A 4DX8H 1V5IB 2DGQA 2C2OB 2E5JA 2OEMA 3LGHA 3KLHA 3GPAA 1UAWA 2RAQA 4OHZA 2XCPA 1FWLA 4Y2MA 1J5OA 1K1QA 3KXDA 4WZMA 2M9KA 1NMEB 1IKYA 4LFAJ 1HA1A 2Y0SD 2J0XA 1RWUA 3H2VE 2P8IA 3W9JA 4QIGA 5LM7E 3HZGA 4NXMJ 1HPZA 1P1LA 2UP1A 2EFVA 2R7UA 1NZAA 2DHXA 3BQ2A 2VBZA 4K4XA 3JSMA 3ZTQA 5KT5A 1PIEA 1GQEA 2DH8A 3ZTSA 1FKOB 4NMXA 1NSKL 3MFIA 4DFMA 1DTTA 1FWPA 4QR2A 2IPOB 5F8MA 3RYLA 3MPDA 3UDCA 4FVMA 5B0DA 5J2MB 2W9CA 2POKA 4N8NA 5HROB 3Q2TC 4OL8A 4FPRA 4UOGA 4ED7A 3MM8B 3UD3P 5F8LA 4ID5A 3FZBA 2BACA 4WU3A 3S01A 4FXVA 4UQTA 2PFFB 3Q24A 3TAPA 5AXKA 4GKKJ 3MR5A 5CABA 1RT3A 1XR6A 2X51A 1KP6A 2YNHA 3JSYA 3QLHB 4MT1A 4TKTA 2MDAA 4URGA 2RU3A 2ZH1A 3NMRA 4LRAA 3JYTA 2OELA 3BPSP 1NU4A 1I94F 2XEXA 4KO0A 2ASDA 5HATA 1YBTA 2G4BA 1UP1A 1WG1A 4NYOA 4WFYA 5GAEI 1J27A 4X66F 1UVJA 2XZTB 2XY5A 1FKOA 5AE3A 8AT1B 1SQFA 3I0SA 1NXIA 2FLLA 3MGJA 2DNLA 2Q3PA 3OTBA 2CJKA 2UVRA 1J5EF 4ZHRB 3TWZA 1QUVA 2ZH4A 3V81A 5F8NA 1QSSA 3OXFA 4OV1A 1TL7A 4RNFA 1DJ0A 3W65A 3OBIA 3K59A 4C8OA 3EGZA 5E7OB 2DNYA 3I4HX 1I3OB 4I6YA 4CH0S 2YNFB 4DV4J 1MWZA 3D68A 1RHJB 1NNDA 4ZVHA 3G6ES 3RAXA 1S6PB 4ETZA 1NSAA 4HKQA 5B7WA 2M52A 2YKQA 3LOUA 4NI2A 3AB2B 3PVXA 4P74A 1XR5A 4A8OA 4DV0J 1Q82T 3TX8A 3IAS9 2AGPA 1E6YA 1R8BA 4Y2IA 1FEEA 1O5JA 4DMZA 2YQ0A 5IS2A 1T0TV 3N0VA 3CD6S 5DDQC 4YOEA 4LRDA 1RT6A 2U2FA 1JLFB 1S1XA 3JAMY 4M5DB 4ZOSA 1VIOA 2CUYA 3AFGA 4F3MA 1NPKA 4PAAA 3TYTA 4EYIB 3O44A 5KFGA 4GC6A 5CXTA 1OJ4A 2V2VA 1ZM2A 1S9GA 2VG7B 4USVA 5KTQA 2FJBB 3MAAB 5KFPA 3HD1A 4D3HA 3TOQA 3HVTB 3HFVA 1F0XA 2BV3A 2RHQB 3IRXB 3Q23A 2C3YA 4EI2A 4MK8A 3EVMA 2UV8G 5LL6d 2XSFA 1JXLA 2VBWA 3K5MA 5C2GA 4IFVA 1YK9A 3L7OA 3QT6A 3TVYA 3UQSA 3JAMU 3AD7C 4YDXA 5D4PA 2Y1IA 2C2DA 2KB2A 1FDDA 2VA3A 1IR0A 1DZ5A 1GK8A 3TA0A 2AYMA 2L9NA 1M90T 1RCOB 4PABA 1OYEA 4EEYA 2XCAA 3KK1A 2DEIA 3KG1A 4YMEA 2K2PA 4ZK7M 2BDPA 2OGUA 1PBUA 2B7BB 2L08A 1Y5NB 2RS8A 3FRZA 2W7OA 1JJ4A 3RBEA 4IH7A 3BB5A 1IKXB 1L3KA 3PO4A 4Q0BA 2DO4A 4IYQA 4ECQA 1NK9A 1O6XA 1WSRA 3ITHB 3NBPB 1E6YB 3M8YA 2BANA 3KHHA 4WTOB 3ZTRA 1F5AA 4BC9A 3M30B 5DJBA 1NRKA 4RNHA 2LU1A 3BZQA 2OPSB 1JIHA 3OSNA 4PUOA 3FCVA 2YX7A 3IMQJ 4TLRA 5AXNA 3CCVS 4IQXA 4KTQA 2H3EB 2HS4A 5CYMA 4EYHB 2KZZA 3PG9A 2IJNA 4FKXA 3MECB 4AT1B 2DCUB 3D1OA 3PRBA 1U0HA 4DL2A 3HSJA 3MM7B 1U1PA 4NLXA 4QIWD 4CI0B 1LWFB 3I96A 3WHIA 1HQEB 5LSOA 2YX4A 3GCWP 4IH6A 5KG5A 3BDPA 2LQ9A 3JTOA 4LRFA 4M5GA 4WP3A 2XYHB 3UN3A 5KFNA 1BC6A 2EKNA 3BPDA 3ET6A 2ASYA 2K7KA 2XMVA 1V9OA 1S48A 1U26A 5ETSA 3W60A 4JI4F 1TL7B 1VJQA 4IO1A 4RKUC 4Y2KA 3OR2B 4JI6J 4NCAA 1WSVA 1N54B 2RDJA 3KUEA 3BO4A 2BQUA 2GV1A 1XERA 1Y10A 2YVSA 5K8MA 2ZJQQ 1R6VA 4JI1F 4CYUA 3CD7A 4GKKF 4DG1A 4F0HA 5J1EA 5GADI 1N0VC 2HIYA 1M0SA 3R6GB 3GZ7A 2DGSA 2DISA 4FXDA 3CMES 1XBWA 3IBFB 1TKXB 3BSNA 2LECA 4XK8C 1RTIB 5KFEA 2I5JA 3W61A 3DRYA 2FHMA 4YQWA 3DLEA 4I7FB 3ZZYA 5KFJA 1UA1A 3HD2A 2D3ZA 2JC1A 2N3OA 5KG4A 4QBUA 4ITSA 3NKYA 5J2MA 2QRRA 2KFNA 2LA6A 4NXNJ 1TR0A 3IS9A 4HL9A 2QLJB 3US5A 4USJC 3NNAA 1YJUA 2OI2A 4DX5A 4R25A 2WBRA 2LP4A 4CNZA 1XTZA 2B6AA 5F8IA 3OVBA 2MKSA 4KHRA 4ZVRB 2XO7A 4B3RJ 1YBAA 4A47A 4URSA 1OQ3A 2V9KA 1U8WA 2XMJA 4J37A 2N4DA 1NSQA 4DZ6A 1XQIA 3BQ0A 5HP1A 4HT5A 3BREA 1G4CA 2VF3A 3BBBA 2UXCJ 4OZ2A 4PG4A 3LO3A 1EAYC 1HI1A 1XWLA 2AKWB 2ERRA 5IT9U 3BH6B 1CULB 2I2YA 1VQ8S 2UXDF 2FLPA 1FO1A 3I56S 3R7SB 2OPPA 2XNQA 2DBBA 2E44A 5DQHA 3V6DB 4XO0A 3R1HA 2FY1A 2CDQA 2KJWA 2QO3A 1X0FA 2GMJA 2ZM6J 2EFQA 2UUBJ 1S12A 2VG5B 4OYIA 5C25B 4IUFA 1JWWA 4USHA 4ZPBA 5EDWA 1HWIA 2CPJA 3NS6A 4HI2A 3GONA 3LP0B 4AFFA 2XY7A 2ASJA 4K7QA 1T03A 1N4LA 4WFAQ 4WYLA 2DTJA 2R7OA 3MEDA 3ZFVA 1TK5A 4N41A 2DK2A 3JS9A 1AB8A 3LH2S 5AJ3F 2MQ8A 2XS5A 2AGQA 2QL5B 4G1QB 3R1LA 2VPXB 1R0AA 3MCSA 2E7VA 1KBRA 2HFOA 3QT5A 4OX8A 5DLGA 2K7JA 2OFGX 2ZE2A 4DCOB 2XZWA 3MM6B 1ZPWX 3BGFA 3KLEA 4IRKA 1VGYA 2B51A 2YNGA 3DGPB 4QR1A 3TAMB 4YB1P 3HT3A 2MZTA 1J2VA 2GNKA 3SFUA 2KHDA 2RU9A 4DUYF 3C2PA 1N88A 2WK4A 5D4LA 2VC1A 4ZVTB 2CJBA 1RQ0A 2APOA 4B3MF 4HHUA 5J2NB 4F4AA 2R8HA 1RTZA 3PW7A 5I42A 2DHGA 1YTYA 4DFJA 4DOZA 3DMJB 1TU0B 1DHMA 2PI4A 3NNCA 1JLGA 4Y2AA 1RTHB 1VBYA 4WF9Q 3CCES 2EG1A 1FK9B 3T1AA 4B3SF 3H5UA 2QJ3A 4LF9F 1HHSA 5KFBA 4IKAA 2BW7A 2LQ5A 3FNNA 4WIQA 4X4RA 4J9SA 1YJNS 4DR6F 1S5ZA 2OPRB 3NGTA 5IXUA 1CQMA 2OPRA 2QC3A 4LR7A 1P8GA 1T9VA 4I64A 2RRAA 1N5YA 4Y65A 2E5LJ 2BX6A 3IGVA 2R8KA 2BE2A 4NLQA 4QZVB 1ELOA 3GR0A 3MCMA 4ATNA 2C28A 3QJLA 4X4UA 5KG2A 2GJIA 4USTA 3C3LA 3J7AN 3MTKA 1UKUA 1QAIA 4IG0B 2QA1A 4KY3A 1HBUB 1LFPA 1RGVA 4NEZA 3CC7S 4X4VA 4NX9A 3A3OB 3AXMA 2MQMA 5ETQA 5K5MA 4DU8A 3SV4A 1MU2B 1I6JA 2QYCA 5B09A 3DRRA 4IFVB 2CQIA 5F9LA 3KLEB 1HQUA 3CDEA 1PAUB 1V5VA 3HF5A 5KAKA 2DNPA 1D1UA 4K4ZA 1URRA 4R0EA 3PXGa 2RNEA 3MR3A 1D8ZA 1UETA 3CWJA 3ZNJ1 4CNYA 5K14A 1OIAA 4OFZA 3KJNB 2YH0A 3QZ8A 3SZ2A 2AQ4A 3QRRA 3AJDA 3W5XA 1CQNA 1V3SA 3LP0A 4DL4A 3GSIA 1TVRA 4L6V3 1NKEA 4F25A 3CO0P 3M8ZA 2B56A 2MHNA 4OYPA 4ED3A 2EBEA 5LMUJ 3KJVB 2GJ2A 4O3PA 1IKWA 1WHVA 2RRNA 4MTPA 1N5YB 3GJTB 1LWFA 2P9CA 3GCXP 4M5LA 3TQEA 4CLUA 4XPEA 5FIIA 4YP3A 4C11B 1ZAXA 4IQMA 5CH7B 4JV2A 2ADCA 1S6PA 4DX7A 3D2WA 3Q22A 1URNA 3H5XA 4LBIA 1NJXA 2MY7A 4B3RF 1DLOB 5I3PA 5KFXA 4FZVA 2WRMA 4ALZA 3NG8A 1U1OA 3EGNA 2OAUA 3ZXWA 2M5YA 2A6OA 2OPSA 3D0IE 1NB7A 2CZ4A 1GXLA 4LRBA 1P9QC 5ETVA 3D28A 2HNYA 2C2RA 3R3TA 2MB0B 2BRKA 3K5LA 2IJFA 1S9EB 2D69A 2HIQA 3TAMA 4CLZA 3HHLC 1YWXA 2OMLA 3OD2A 4DPUA 4RW6A 2ZVSA 5M2UA 3DOKA 1LWEB 3EDQB 3HLUA 6FD1A 1B0TA 1AT1B 1W2IA 2JLEA 4RU9A 2FJWA 2L41A 4F4XA 2EK1A 2DIVA 2J7KA 5HVHA 3M8QB 1FJGF 3UW1A 2B4VA 3BF4A 4RW4B 5GAHU 3M4XA 5A8WB 3PYGA 4WFBQ 4H4KA 4Z7YA 3KYLA 3BSOA 3HPOA 1RU2A 3M1VA 2YTCA 4A4JA 3K0JA 1K47A 1RT2A 2DNZA 5IZHA 4ZN3A 1MMDA 1RHMB 4OHVA 4KGMA 3CIZA 2MGZB 3NY0A 3DRRB 1I94J 1XC9A 1KWMA 5DETA 5HVGA 2OPPB 8RUCA 1RTDB 2HGMA 2KFYA 1QAJA 1REVB 2A0FB 4IG0A 2AGOA 1RT7B 2PC6A 4ZLNA 1WELA 2PN6A 1RABB 2CIMA 2FJDB 1WACA 2HK2A 3B4DA 4ZA1A 2BJ8A 3M2UB 1IXKA 4ZCKA 5KFSA 2F8EX 2GQCA 3GWCA 3G8TA 1N52B 3Q0AA 3T5HA 5CCMA 1U09A 2QG9B 1R89A 3AA8A 2B9WA 3CDBA 1IWGA 3LANA 4OZ1A 1RHQB 1TV6A 4ECTA 3J7ZT 2E7WA 3H90A 3R5AA 3BSCA 3UD5A 3GTYX 1HYSA 1WF2A 1X4FA 2CZ9A 2WVEA 4DR5J 3CDWA 1HIYA 2JL9A 1MMNA 5E3PA 1DQAA 4C7QA 4P2SA 2V94A 4WE1A 4EO6A 3BV8A 1UMJA 5T7LA 2A10A 3M8SA 1GX5A 4FF1A 2XSJB 4TY8A 1PJ5A 3B6BA 2V2QA 1ZOTA 3M2RB 1Q5YA 2Z2MA 5HMXA 3FSYA 2VQFJ 1S59A 2V4RA 3GV5B 4DWIA 5AXLA 3R2DJ 2ALYB 2CJXB 2XMTA 2KRBA 4XDCA 4WFNQ 3U7JA 3CJ2A 3DNCA 3AHPA 4EGLA 2DHAA 2J8SA 4KH1B 4CLKA 3FSXA 4F0MA 1IM4A 2C3PA 1UEVA 4FYXB 3NNHA 1ZZFA 2P5VA 4QIVA 1RT1B 1FFGB 1CS4B 4ZPDA 1S1VA 3Q8SB 1IQZA 1S1UA 2UVUA 3RW6A 2AWZA 2QX0A 2DY1A 2HLUA 4F3QA 3G8SA 3E8OA 2YWGA 2FJAB 3MD1A 2QLFB 3SFGA 1T3NA 3CJ5A 3GG0A 1BWEA 2MKCA 1N32F 2DY9A 2KRRA 3IRXA 1SH2A 1OMSA 4YN3B 1ZA2B 2HRTA 3TA1A 4DL3A 2R7TA 1K0VA 3N6NA 4OHYA 3VWSA 4Q8EA 1RCXB 1PYSB 2O66A 3OFHA 3TUJC 1A7GE 3JTNA 3V5RA 5G4DA 3QAEA 3NGSA 1RTJA 2CQ1A 3WIUA 1TK0A 2NZCA 4DEZA 2UVWA 1GH8A 5KG1A 2WVBA 1IN0A 2RT3A 3K17A 3K57A 4PWDA 1CJTB 4HACA 1VQMS 1EJ7L 3FRYA 1RDRA 3I5BA 3GU0A 4F0KA 2KTQA 3PX0A 5HP1B 4Q2MA 3SIPB 3NWRA 1LK7A 2MSSA 3IFEA 3BN7A 3RZAA 2HRYA 4MIBA 1IBKJ 3LP1A 3RRGA 2W7AA 1NEEA 4U6PA 1SL2A 2FJXA 3ITHA 3NBPA 3O1LA 2VH7A 3BGLA 5E0OA 4MIWA 3HSGA 4AXIA 3OW2R 2UVVA 1LK5A 1MW7A 4DUZJ 1H72C 3K8WA 3PR4A 2DYAA 1XMQF 1Q7YT 3MURP 3A1YG 1HNVA 4XPCA 1QVGR 4V19J 1FJ7A 1S6OA 1YGYA 2R4FA 2YWKA 4ZPVR 2OPQB 4TXSA 2ZNYA 4M8LA 3N9UC 2HEKA 3RAMA 5HSPA 2BJ9A 3GFXA 5H1SV 1M5VC 3PW0A 1FJGJ 2LQBA 2J9DE 3J7A1 5CQGA 1WNEA 2RQ4A 5H9FJ 1HBOA 4WBFA 4KO0B 4ZMMA 3R6LB 4IH5A 1EX8A 1RT2B 3IN5A 4GO7X 1BWVA 1NK7A 2Z30B 4PXEA 3CJ8A 2UUCF 1AUDA 3M8WA 3RW7A 3MM5A 3T19A 4FBUA 4JV1A 1HD0A 4X84A 1SJRA 1CJUA 4OI1A 3GV7B 4AL7A 4LSNA 4ECYA 3PJXA 3KHLA 3IBCB 2DGWA 3Q8UA 1CS4A 3SYZA 3T9NA 5HROA 3W3SA 1WEZA 4EUVA 3IM8A 3UCUP 4F36A 1L3SA 3T9ZA 1X0PA 3QPIA 2A1BA 3Q89A 1BHNA 3M8PA 4IG3B 1LXJA 2WVDA 3ENAA 5K8NA 3OXGA 1SKRA 2AEJA 4Z7CA 3SXLA 2HAFA 3IO1A 4DR7J 1S99A 2IIHA 2FUG9 4C98A 3HXMA 2ZFHA 1WDTA 1F9FA 5AXMA 3N28A 2AD9A 3FGVA 4ILRA 1QVFR 4FPIA 2VOPA 2Z2ZA 4TQSA 2N82B 5B08A 2BOAA 2H5EA 1H0HB 3AJ1A 3W64A 3OL7A 1D9DA 2JFKA 3AOBA 1X4AA 3C6TB 1SV5A 3OTEA 4B17A 3ZZTA 2OMOA 4XIUA 1OO0B 3EX7B 3H0PA 4C0OC 2WB4A 3FKBA 3MMJA 3H5YA 1VC5A 4UT4A 2UU9J 5DDOC 5D3GA 4O44A 1U1LA 1N33F 2E1PA 2J8AA 1FRJA 2WVFA 4DDFA 3C14B 4PCQA 3DLBA 1SQEA 2JC0A 2NYHA 3MHYA 3VQTA 1PBAA 3H5SA 4AYBD 4LR8A 3SQOP 2HURA 2OLWA 2DJWA 3GFHA 5DZ7A 1Z2ZA 3W62A 4FF2A 1R8AA 1WI6A 3NOCA 4PPZA 2XNRA 4MIAA 3EXYA 5H9FK 3CNQP 3H2UB 4NZ6A 1RAJA 4RW7A 3U1LA 4CO5A 1MN7A 4QWDA 3BM7A 2R7WA 4NPOA 2OSQA 3V6KA 2FQQB 2LA4A 1H2TZ 1PYTA 2NXNA 2A3JA 2CWXA 2OEKA 2W2OP 3HHKA 1IKVB 3HVTA 3MAAA 3DLGB 2M7SA 4KSEB 1UPMB 3POTA 1UVKA 4KV8B 1GEHA 2GS8A 4N7TA 4C3LA 4DJBA 3MFHA 5BR8F 3DI6A 3HDSA 1CULA 1WC5A 3D54A 4J9UE 4DSKA 2FHKA 5T7LB 1FCAA 3VV2B 4UZCA 2XLJA 1ITPA 3HVRA 1TKTB 2O01C 5I4MA 2CPZA 3LA0A 3BEGB 1XMOJ 1RZMA 2HVZA 3DLJA 1R27B 5BXIA 2R2UA 3D1QA 4NWBA 1T9UA 1WC3A 1U49A 4DV6J 2N7CA 3Q8QB 4ELUA 5LMNF 1RYSA 4WU2A 4MH8A 1D09B 4YB5A 3OLBA 4DSEA 2XY6A 3P5TL 1BMQB 2BJEA 1U1QA 2DR8A 3PFEA 3JQKA 2BABA 2W1BA 4KIAA 4QJVA 1B4SA 1Q4RA 4O4RA 2AMCB 2KXFA 3G86A 3IG1A 4NLYA 2R2SA 1U1NA 1WDDA 1U1RA 2E66A 1IBCB 2GHPA 4DZDA 4LF4F 5MLCV 3OL9A 5C7PA 4LR9A 2IFXA 1WORA 2KDOA 2QL9B 4JBCA 4LF8F 2BE9B 4QIEA 2NREA 2Z58B 3KG0A 4I6AA 2GMLA 3V4IA 1H2VZ 4ZS6A 2LQ8A 3DGPA 4LBPA 1WF1A 2CPXA 4YS2A 2J6TA 5GMDA 1N36F 4V1Ak 2HHHF 2DPJA 2LLZA 2MLZA 2I9SA 2JOQA 2VBYA 1UZDA 3NCRA 4PG6A 4JI8F 5L9XA 3Q2SC 3JYTB 3ICLA 1K9MT 2CQPA 2AHOB 1T9TA 3T1YF 2EFPA 3QIPB 5GAGU 1HKAA 4ZP9A 3ILIA 4MYUA 3DN9A 3ADAC 5KT6A 2W9BB 4B08A 2MQPA 2X1GA 4JI3F 1FRXA 1IWAA 1VQSA 2FTRA 2MZRA 2N3LA 2YKNB 2Z56B 3MEGB 2RF2A 4Y28C 1Y3KA 2HKEA 3GYNA 4B3TF 4QPTA 3AOCA 2NUUG 3LP2B 3CCRS 2KL8A 2XTJP 3L7PA 1X60A 3J81j 3C15B 1HMVA 5L39A 1HQUB 1BQNB 4DX6A 5DS7A 3D4JA 2HWIA 3NGDA 1H38A 2VFUA 1HBNB 2F4FA 2L9WA 3MI7X 3M7VA 3TW0A 4ED4A 1TQLA 4YDDB 2HVHA 1HPZB 5LJ5Y 1IJFB 1B70B 3LGMA 1R3NA 2MKIA 5GADU 1FRIA 3DKDA 3HHDA 2OEJA 2V4JB 3IWNC 2NCKL 1CC7A 2JHEA 3LWLA 2R2RA 4DLGA 1C1CA 2UV8A 3K58A 2HQDA 4NRUA 4F4WA 3QWUA 3GIKA 2D9OA 2WW4A 2W24A 1EKRA 2Z8QA 2RUGA 2DRDA 3CVKA 4LIWA 4P2XA 1JKHA 2YNIA 4WPAA 4CLPA 2HK3A 3PEHA 1RAAB 4BWMA 2MXYA 3I5CA 4UY8T 1N8RT 1YLXA 2JEJA 2WSCC 2UUTA 3H98A 3SSRA 5C24B 4PYDA 3LAMA 2IMWP 1VQYA 2N4CA 2RRBA 1NLKL 2R8IA 4DV3J 4A8YA 3MEEA 1JXVA 2CPHA 1FNOA 1RAOA 2W2QP 4ILMA 1T02A 2CVEA 2QL7B 4K2JA 4OQJA 3U02A 2XM3A 4B9VA 3JQJA 1HNXJ 1HR0F 2ZWOA 2J9CA 1DQ9A 4RJVA 7AT1B 2R2TA 2HFNA 3MMBA 1QJHA 2W2MP 4B02A 3RJMB 1S77D 2ASLA 1HMVB 2F8HA 3G9CA 5HJXA 2NZ4A 1RWVB 3RGIA 3U1MA 4DG1B 5HN0A 1Y9OA 2JJ4D 5IM0A 4I69A 1DARA 3DHXA 3TP2A 5KFVA 3QYYA 3THTA 2HHWA 3K5PA 4P7VA 2EBGA 1X5OA 1Q95G 3RRHA 3UN2A 3D66A 1RKIA 5LSLA 5KFWA 1FXLA 1UEUA 4ZJOA 1VS3A 2HW3A 2DCLA 1O51A 3HFZB 1NK5A 2IYGA 2P6TA 4IR1A 4DV7J 3MEKA 3N4WA 3QJJA 4ERDA 1GX6A 1BUXA 3PY8A 1OY8A 4OJ1A 2C3MA 3ENVA 3EZUA 1F6TA 3GLJA 4YB6A 4LFCJ 3PTWA 1JLAA 3QGIA 1R0BG 3QNWB 2VJVA 3PDNA 2KVQE 3BN4A 1Q1KA 4OYAA 2R7QA 4OYBA 3GE9A 1CJTA 4HACB 2LFVA 2XBPA 3AD9C 1KOOA 3VGTA 4IO9Q 5A8KA 5F0WA 2R42A 1NDCA 4DR4J 4DR3J 3TNVA 3FEYB 4MK7A 2XLIA 1X4EA 3DYAA 4I68A 4L72B 4OZJA 2PMWA 3FCHA 3RUBL 4EWTA 1T8EA 1BY9A 2LVWA 3KWMA 3KMSA 3OUYA 3FBEA 3I0SB 4PZVA 8ATCB 3DXBA 2YKPA 5DDPC 3AAWB 3PX6A 3IXQA 5ADZA 4GRSA 4DL7A 1TUGB 1LKZA 1WOSA 3IA0A 2HHHJ 1TUVA 4TU8A 2HNDB 3D1HA 4DLEA 5JUMA 1JB0C 5J2QA 4F2SA 1NJIT 4IFYB 2KM8C 3O6QA 4GC7A 4ECZA 2NS1B 4FVCA 4F3OA 3Q8VA 5E3RA 3POTB 4KV8A 1UZHA 3PJ9A 3UPFA 4ILLA 1VDHA 1NCLA 2L3MA 2Y1LB 3NS5A 1VIXA 1HNIA 4CRJA 2UXBF 5ETNA 2XS7A 3K2YA 1YSJA 1GTEA 2CNLB 2RKIB 4USKA 2J5AA 4ZP8A 1B64A 2KXHA 1S57A 2J7UA 4OZ3A 4B3OA 1SC1B 2CA9A 1C0TB 2X1BA 4MKBA 4CYUB 3HHNB 1VRUB 1FKPB 3HHLA 2XQCA 1VBXA 3PHTA 1OY6A 4J7CA 4KFBA 3MWBA 5KFOA 3VAKA 1K73T 3W2WB 3GIJA 3W1YC 5RUBA 1NM2A 4AD6A 3OHAA 2G2YA 4MFBB 4RBUA 4Y34A 3I31A 2BKPA 7FDRA 5J2PA 1TFYA 1ZH5A 1AA1B 2XGPA 2MSTA 2PSZA 4X65F 4MKYA 2VQEJ 3OVAA 3HKZD 4TY9A 4J9PA 1FJCA 3DGVA 1IBKF 3HSDA 1X9SA 1RACB 1N0UA 4OIXA 4Q7AA 3SSSA 2IAJB 1HNZF 3CJ4A 2HFUA 3OQ2A 4H54A 2CPEA 4JI0J 3P49B 2YWHA 1HARA 2DNHA 4DL6A 1KDNA 1LOUA 2M88A 4E8UA 2EXUA 3OTOJ 4K0KF 3HM9A 2W4CA 4RL1A 4LVNP 1M1GA 5BYQA 4RLEA 4ZVQB 5KFMA 3BBCA 3TUPA 2JWNA 1XMBA 1JLEA 2LXUA 4I2PB 1GFWB 5GVQA 3P4UB 4X4OA 2JSXA 4JI7J 2KU7A 2X1FA 1L3VA 4Q44A 4NLPA 2EI5A 3CJ3A 2W8KA 4YUDA 1APSA 4AL6A 4BWJA 1DTQA 2FHJD 4WYWA 4OLOA 4MYTA 2VODA 2NUHA 1U25A 2VB6A 4KGZB 2BJ7A 3G82B 2BM1A 4ZVSB 2BKNA 3M2VA 3KK2B 3KK1B 2HVIA 3W2VA 4DUTA 3KK2A 1SQGA 2WHOA 3E51A 3QGHA 5DZ6A 2JVRA 3A8EA 4YB7A 1W25A 2BE7D 2V8VA 3TA2A 3UD4P 1VQ5S 2ZHBA 2GGPB 2E1CA 4I2QB 4B9TA 2CXEA 4PEOA 1HHTP 2DD8S 2V8DA 5HO4A 1JLBA 1S1WB 1VRTB 2LEBA 1YJWS 4QQBA 1JLEB 2J7WA 3T6JA 3WDOA 1EIYB 4JV5J 1LW0A 3RB6A 4O3QA 4DR2J 3N5FA 2CVIA 5CYQB 2EKYA 3UVJA 1B3TA 3T1HJ 4C4WA 2FZCB 4ED1A 1HWLA 2HQGA 1S49A 4CP5A 5A8KB 1X7VA 2GZOA 2DR9A 1KQFB 1YHQS 1MROA 4Z2XA 2IBKA 3GJRB 4X4QA 4ED2A 3CDUA 1BXNA 4IOBA 4K8RA 2M8DB 2IYIA 1XNRF 2RB7A 2HQFA 1XK8A 3QJPA 1RADB 1IJEB 4ZPCA 2AJQA 4ZJQA 1ZAWA 4DU7A 2CNNB 4RNNA 2QSWA 3W9IA 1D9FA 1ZA1B 3ZZUA 3J81Y 4K4YA 2ZUGA 2KHCA 1CSJA 3EJMA 4W4MA 3CCZA 1TKTA 4A48A 5IWAJ 3BO2A 2BRLA 3W5YA 2M4MA 1OY9A 3CCLS 3BR8A 1PYOB 1LWXA 5I42B 2MQOA 4DFPA 4JI6F 3EPIA 1TKZB 3VQSA 2V50A 1S6QB 3CSKA 3RR8A 3V6HA 1S0OA 2HYIB 2F4VF 1O0PA 4IOAQ 2IBOA 2FC8A 4A8WA 1JJHA 1PG5B 1RWWB 5THWA 2ZH9A 1UCNA 2FZGB 2KKHA 3SI8A 3DLHA 4GKJF 1RP5A 1LXNA 1YX2A 2RF2B 4KHMA 4UW2A 4JUZA 4C3MA 2Q6CA 2W2PP 3MMBB 2CQCA 1CJVB 1RK8A 4UUXA 3BS9A 1M1KT 1QM9A 2AYEA 1VK3A 1U1MA 2H4YB 5DGAA 4JI1J 2HFZA 2AYGA 5KG3A 3BGRB 5CD4H 3UFCX 2HQ3A 2ZKUA 4U8VA 1C0UA 3TVZA 1PCAA 3I55S 5C24A 4QYZJ 1SXLA 5T41A 1T11A 3DOMA 5ETRA 2DHHA 3TUIC 1WKJA 2MPUA 2MLXA 3FBFA 2VQEF 1VQKS 4ZVGA 4CT9A 2Q66A 3KOAA 1ICEB 2VL1A 4B9SA 4PPDA 3G4SS 1QDUB 3CTRA 4KAIA 1MWQA 2VBXA 2YPYA 1S0VA 4NLGA 1W26A 3PYEA 2F7VA 5IT4A 2R9LA 4P9SA 1NKBA 1LV5A 3IM9A 2M0GB 3SCIE 3FZ2A 1FFSB 3NXZA 4KBIA 4P52A 1I51B 4NLVA 4MKVA 4JI0F 4NASA 4N56A 2F63A 4H4OA 3E2EA 2PFDA 3VHQA 3PACA 5CHCB 3OR1A 1N34J 4NCGB 3KLGA 1HBNA 3AQPA 1GT8A 1RBLA 2DNOA 2KT5A 2JRSA 3H20A 4W98A 4C48A 2AJFE 2PMHA 5I3QA 2WCXA 3CD0A 5K9FA 2AJ4A 3GFYA 1RJJA 1IKWB 1UVLA 3LQVA 1UW9A 4P73A 3TX0A 4DV2J 4IG3A 1R0AB 4Q5VA 2UUBF 4ZPTR 2W8LA 1ZS6A 3MEDB 1FJEB 2HAIA 1UWBA 2B5JA 2PMZD 3T1YJ 2BZ2A 1REVA 2JH3A 4RW9B 2WSFC 2E9RX 3M2VB 3A13A 2WVCA 4IOCQ 2ZH8A 1BQMB 1JLQB 2ILZA 5K14B 1Q8LA 2ZM6F 1DURA 3GIIA 2VUGA 3MTJA 2JX2A 3C19A 1N5SA 1RSCA 3M9MB 3MPYA 1Q78A 1HBOB 3K5OA 2O67A 1KRPA 4DFKA 5D15A 2BKOA 1U6FA 2ZNZA 2F9DA 2V2KA 4FS1A 2BQ3A 1S0NA 4KR0B 4OYWA 1D9AA 4QWBA 4TQRA 4DS4A 5AE2A 4NOHA 1ACMB 2BXJA 3DCAA 3UN5A 1P9YA 4ZIVA 4K4TA 1VQ9S 2XI3A 4C2MA 5HBMB 3HMJG 1S0MA 4W92B 3M8QA 2WONB 2IHR1 4KGVB 2VA2A 1J5OB 4Y3CA 4Q8FA 2XC9A 2CQDA 3MOJB 2CYYA 1N48A 1NJYA 1R8PA 4FYVB 3SMZA 2F1FA 4EBEA 2Z2YB 1KQSR 4PG5A 3RBDA 3I0RB 2QYGA 2V8GA 4U7UD 2HHXA 2BA9A 1HL6A 2O5DA 5KFCA 1DRZA 4B9MA 4LF9J 1RAFB 5IQ6A 5HLFB 1XNRJ 2JFDA 4FNIA 5DGBA 2HNZB 5ETTA 2HBYB 3W8GA 5FLXY 3C16B 4WXOA 3B8HA 2NR0A 1C1CB 1FK9A 2E5HA 4R0JA 2C2KB 5H9EK 1DQ8A 3V4MA 4N5SA 2YH1A 3BGRA 5D0GA 3R7NB 5BYSA 4OHXA 2MZQA 1IUJA 5A0YB 4ID8A 3I9ZA 1U2CA 3S6EA 1D8YA 2U1AA 2DITA 1C0TA 3B78A 3GSDA 4FDFA 4Q2LA 1TAQA 1CG2A 2WBMA 3RBXA 4YHHJ 1FKAF 4I67A 4R8UA 2FHOB 5B0GA 2PT0A 3KLIB 4ZJLA 3EZ5A 5KFUA 3GJQB 3MMAA 2FZKB 4KKOA 3UNYA 3VAIA 3TI0A 3C46A 2B4PA 2MQNA 3KUHA 4ETXA 1SL0A 4PKDB 2LDYA 1VLYA 2V67A 2IRUA 2GIFA 4X66J 3TRGA 1TVRB 5E3CA 4X2BA 2V0NA 4ZVFA 1H3DA 3LPYA 1JNRB 2DR5A 1KFDA 4J9KA 2AF6A 2B9EA 3BKTA 5LXYA 2A6MA 3OFEA 4RBTA 3UE2A 4DPWA 4X64J 2BQRA 1KLNA 2ACMA 4JYAJ 2OHDA 1LWCA 4FP9A 2C2EA 1TL1B 5C5JA 2HHQA 3IWLA 2DT9A 1EP4A 4KRWA 9RUBA 2RS2A 1YJRA 1QTNB 1Q86T 4I1TA 4IRCA 1SH3A 1Q8BA 4LVOP 1NKCA 4CT8A 1LW2B 3SQGA 3MD3A 3UI3A 5F0UA 1YG0A 4DR7F 4O23A 3G71S 1JMTA 2HFSA 1U45A 1FA0A 1CJKA 3DDKA 4DQSA 3L9ZA 2D3UA 1N6QB 1NO8A 3NL0A 4OYZA 4M5DA 3DRPB 4L3NA 4OZ5A 5D78A 2I6WA 4CLSA 3GIMA 3IBWA 2GIRA 1GXUA 4HDGA 3I82A 4TYBA 1FXDA 2W2NP 1U7LA 2BMBA 2FY8A 1WKKA 3K89A 1VHIA 2L48A 3H59A 4LSLB 1ZZNA 4LSLA 1EB0A 3PEJA 4K4SA 3IR6B 3LPEA 2JEIA 1R6YA 2CNOB 3AH6A 1K44A 4ED6A 1MROB 3DDNA 4J9QA 4G3IA 3EDRB 1GTHA 4YR2A 1AFIA 3VF0B 2AP6A 4DXLA 1XJWB 1JLGB 1OPZA 3UO0A 5E3AA 2LEPA 4NCBA 1YRTA 3DMJA 2ACYA 4HH0A 2BJ3A 2KYZA 1RISA 2DGTA 1KVKA 4KH0B 4NLOA 1V3RA 3IR7B 3L7UA 4F4KA 4H4MB 3Q83A 3C6UB 2G0CA 2QTWA 1EP4B 3EVWA 1FT8A 3E01B 4DN9A 4OX9J 1VLOA 1HWUA 4E2FB 4WZQA 2M8HA 4RZRA 4OYXA 4PRFA 4OMFG 1VFJA 2QV6A 5J1EB 1SCJB 3VGVA 1S6QA 2VG7A 5D4OA 1VMBA 3H2LA 2DEJA 3CEDA 3WZ0A 3W2VB 1HW8A 4ZDNA 4CLWA 4CO0A 4Q43A 4DF4A 3QIPA 3OR2A 2MKJA 4OI6A 1TL3A 1PO6A 1JLFA 1S1XB 1Q5VA 2DNNA 2ZEJA 3MOZA 4DL0C 3CCJS 1RHRB 1Q0NA 1UFWA 3I6PA 3RTVA 4L74A 4WKRA 4R8UB 1YVFA 2JEFA 4OZ0A 4LRCA 5GAGI 2AV5A 3VR1A 4RW6B 2F9JA 4C8KA 2ZBIA 2W7PA 3ULHA 3I0RA 3NGUA 3QGGA 3DM2B 4OLPA 2AYBA 1ZM3A 3MCOA 3FUYA 1ZYQA 4K5SA 5IC6B 3OTCA 2OD4A 4WK1A 3ZC4A 1H7XA 2X3GA 2YX1A 2PD1A 4URQU 4ES2A 5AE1A 4YR0A 5ETLA 4HTIA 3EWGA 5F9NA 3MUTP 2UUAF 4JI4J 4U67Q 2ZC4A 2IY5B 4YY3J 3TVKA 1YKWA 1B0VA 1UL3A 2YWWA 4DSJA 1PILA 4WCEQ 2VJUA 4F2RA 2AW0A 1LW0B 1R7IA 1RBOB 3DC2A 4ZKAA 1UJ6A 2CADA 2AEFA 1JLCA 2VQFF 2CQ2A 1FX4A 2GCFA 3C15A 4RUHA 5GMKa 2B43A 4TVAB 1TKDA 2MZ1A 5LT5A 1SJ1A 3QO9A 1U48A 4JI7F 4N8OA 2FIUA 2DNRA 2P9EA 4P71A 2CPYA 4QOTA 2HBRB 2J6UA 2ATCB 2YBVA 2C22A 4RX6A 3MR6A 1VBKA 2D9PA 2YY3A 1FTRA 1YIJS 4CLTA 3CCSS 2NSBA 3ENWA 4I56A 4ICLB 1WG4A 3TJ9A 2NXCA 5LOQA 3RB3A 4ANEA 4JI3J 2OSRA 4UQGA 2W4PA 1QUPA 2OO4A 2RQMA 3OXLA 4FYWB 3KTQA 4RPFA 2X7IA 1NDLA 1U6ZA 5LJ3Y 5JVHQ 2YWEA 1V3ZA 4UF4A 1FD2A 2XMKA 4ZP6A 1OQ6A 2RSQA 4TLQA 3JSMB 1WTFA 2BEFA 2EC0A 3HVAA 4NLTA 1WJ9A 4C8NA 1VQ7S 4ZPAA 3RG6A 2XB2D 2IM0A 4DR5F 4XAKA 4F4YA 3MEEB 1X31C 3QFHA 2J0QD 1T9YA 1Y0HA 2CJ9A 4LREA 4U8YA 1RTDA 3GYXB 4Y0FA 1N32J 5D8HB 5KG0A 2DGVA 1HQ2A 3NGKA 4ZIWA 3KLHB 1NJZA 1RE1B 1RI7A 4PG7A 4DUYJ 5HLFA 4OHWA 3TUZC 4NZ0A 4DCJB 5B0BA 4F50A 1WTBA 1HW9A 1HBMB 1S9EA 2C2MB 2DHSA 2W25A 1F9HA 1FD8A 4M5KA 4C97A 5M2PA 4B3MJ 2ZJRQ 4DV5J 3PV8A 1IBLF 4ELVA 1M5KC 3OJUA 1NK0A 2MJNA 3ISNC 5B0FA 4E0DA 2GC8A 5HAOA 3M2UA 3OHBA 2VFSA 1JX4A 2KZMA 4ANDA 3PYFA 1SJ4P 3TZYA 4IR9A 4DR6J 4KHPJ 1S1TA 4ZCIA 2HZVA 3B4MA 4Y2CA 4F04B 1DBDA 1SPBP 1W7WA 3M6XA 4EK2A 4IRDA 4BCAA 1FX2A 3MF5A 5AJ3J 5KFYA 1HR0J 1SC3B 2Z0GA 2GHWA 3MUVP 4JI2J 1FI4A 3QRQA 3E01A 2ZE2B 3CMQA 1IKXA 3D7SB 4DPTA 5JJBA 2WW8A 1WEYA 1RLDA 2BVZA 4IDKA 2YQ3A 4M63A 1XEZA 2FB0A 4KC5A 3UDVA 2HG4A 3IC1A 1RA6A 4PQAA 2DVIA 3OFGA 4RO0A 5I3UB 1MNEA 4CQ1A 4R5PB 2ZOFA 1S1VB 1SUQB 2NPIA 3WX8A 4CDIA 2MQQA 5L1KA 2HNDA 2CZVC 2YKAA 4O3SA 2RQKA 4ENOA 3FC9A 3D0HE 4OV6A 1AUSL 2W9AA 4L3KA 4DV1F 1N56A 1H6KX 2D3O1 2GVDA 2HLTA 1KR4A 3C14A 2P2CB 3GG1A 2GQQA 4XDDA 4ZVEA 5EWFA 1RU1A 3J7Z5 2WOMA 2VOOA 4RUAA 5A8RA 4DR1F 1MSWD 1S97A 1FEHA 3O8WA 2XGQA 2HS0A 3O3LA 5KOXA 1SJFA 4N76A 2EEYA 4DV0F 4FF3A 1A6LA 2DR7A 5CZVA 1U2FA 2H54B 1YZ6A 1MMLA 2VU5A 2IVMA 3F44A 2A2DA 6FDRA 4PXCA 2FVPA 5DLFA 3P6YC 2LYVA 3A8KA 2CPFA 4DQPA 2IC3A 3R2CJ 2E9TA 1XMQJ 3CCMS 2AZ1A 2FPHX 2KI2A 3BKUA 4O4GB 3SQGB 5GMEA 5ITHA 2ROEA 2UUAJ 3N79A 1FRLA 1YI2S 1HI8A 1FDNA 1HNWJ 2MHEA 1TL4A 1SC6A 2QE5A 2PDAA 2DRBA 4LFBF 5B0CA 4J9NA 4XTTA 5EGYA 2KN4A 4C0HA 3ETMA 2Q79A 2ZD1B 2VPWB 2UU9F 1BD6A 3ZZPA 3PW4A 2DIUA 2B9YA 3NEKA 4TNOA 1ZM9A 1FXRA 2CJQA 4ZP7A 1P6TA 3PW5A 2KT3A 1XNQF 2YKNA 4A8QA 1IR1A 2EG2A 4KFBB 4JV0A 5DQIA 1AROP 4R5PA 1HHQA 3MM9B 3EGVA 2I8EA 3LWMA 1Y11A 4RUBA 1RTIA 2DGXA 4RUCA 2V6AA 2RD5C 1RB0A 3R5CA 3AB4B 5KG7A 4DSIA 3RRKA 4I2QA 1YBUA 2WAQD 2XMWA 5ETKA 3ELHA 2FVRA 2A2CA 5KFKA 2YQ1A 1T9XA 1RWOB 2E5IA 3OJSA 2R8GA 2ZBPA 2R7VA 3C6UA 5EHHA 2CDRB 1P27B 4WKYA 3B82A 3EXCX 5LXRA 1S1UB 5IT0A 2KO1A 5D4NA 3ZZ0A 1S4FA 1KSPA 1KVJA 5LSRA 1BQXA 2C1EB 3MUMP 3QO9B 4X62F 2MTLA 4ECWA 4BLGA 5HQMA 3R27A 2GIQA 4DBQA 3MMAB 2J0SD 2R7RA 2GVZB 2QA4S 3AXKA 1XMOF 1SKSA 2VG6B 3DLKA 3NP5A 4FYYB 4I2PA 4Q45A 1NDPA 1AYEA 1KTQA 1R43A 4ECVA 3OUYB 3HT0A 5LMNJ 3CGIA 4RW8A 3MPWA 3V6DA 1IVZA 4DN0A 4J9VA 4WFXA 4I0WA 1UVIA 4WWSA 1NBEB 3JSRA 3M6WA 2MQLA 4ZCMA 1OSDA 2F65A 4P7TA 1WUUA 1VOMA 2AZ3A 3N01A 5HBMA 4NA3A 3HSZA 3FFIB 4OZLA 2RDDA 3AQOA 4J5OA 3DM2A 4HT7A 1R31A 4WE1B 5CYQA 3UVJB 4EO8A 3TZWA 4DV6F 1EQMA 2HZAA 1VRUA 4DHVA 5IFMA 4MAKA 3CJKA 1UVMA 5KOWA 2IRYA 1C1BA 1VR6A 1WC6A 5CD4A 1GNKA 2XHWA 3DLGA 3PHEA 4M5JA 4LQ3A 4G6VB 3DXSX 1QE1A 1PJ7A 2Y8YA 3R9LA 2A18A 4GMKA 1TL3B 4USUA 4X4PA 4QWAA 1TELA 2W9BA 4PXBA 1FDAA 1FKPA 3HHLB 5L46A 5KFRA 3G82A 2IRXA 1U02A 3PYDA 1RT1A 4HLBA 4WP8A 2ZH6A 1U24A 1RWPB 1IKVA 3I32A 3CC4S 1TKXA 2H9ZA 1F3VA 2CJYB 4DQQA 1U2RA 4JYAF 2M3DA 2YKMA 2ZITA 2Y1JA 1X5SA 3CJRA 2VONA 2B5JB 4DR1J 4LJMA 1TL5A 3UNGC 3H4DA 3LTOA 4RU2A 3L09A 3JQMA 4ZLPA 3J80U 1VBZA 2R3VA 1X5TA 3CO9A 5KFDA 2ZJPQ 3BQ1A 3CULA 4GVBB 2G1HA 3TZZA 2DRAA 4S0MA 4E98A 5FDLB 1X5PA 2OIHA 3P96A 3GFZA 2VKRA 2OJ3A 3KHGA 1EETA 1KLMA 1JKHB 1I5OB 2H4WB 2YNIB 2C3OA 1M5PC 4NCGA 3KLGB 1OPIA 1YJ9S 5F8JA 4C9DA 3ETOA 2VG6A 3DLKB 1UVNA 3DOMB 2CKWA 4LFBJ 3PNIA 3CCTA 3SEOA 3DRPA 1VQ4S 1QD1A 4P2FA 2XG8A 3NGRA 1T05A 2D7SA 1N6QA 1S10A 5KFHA 1LNQA 3PCOB 4NXMF 2V2ZA 2HGNA 1BGXT 2JZ5A 5T14A 4B9NA 4OI3A 3MCNA 5KFZA 2ZWPA 4QR0A 5IT9Y 4UY85 1XNQJ 2M2BA 1QY7A 2VKZG 3W63A 2Y9HA 1Y7PA 2R7SA 3FEXB 3UDEA 2GHVC 2FLOA 3LALA 4DF8A 4LF6J 2GGPA 3PM9A 2W4DA 3G6YA 2YKOA 3DDIA 4K5RA 1S9FA 1W2BR 3JTPA 4FN5A 2ZDPA 4LF1A 3F41A 1N5QA 1XIQA 3MAQA 4HH1A 2XZDB 4CTAA 2HVEA 2QLWA 3M1VB 1NZ8A 1U0SA 5GAHI 4WK3A 5KT2A 2FLNA 2KH9A 3PW2A 1S76D 2WSEC 1B7FA 2DNGA 2OPQA 4M5NA 4ID5B 2RILA 1DTQB 2Y8WA 1FHTA 3I87A 2ZDOA 3M32B 5A6PA 3T5LA 2JDJA 3CXCR 2RHSB 3G6VA 4M5HA 4TYAA 2G1DA 2AIRB 4X62J 3FQKA 2W01A 2V34A 3FVYA 1NSPA 3F0NA 1NK4A 2B7CB 2HWHA 2MKKA 3KUGA 1FRHA 1VRQC 2BJ1A 1MN9A 2PE8A 2G13A 2CQ0A 4W90B 2XI2A 1LQ9A 3P45B 4KKOB 3IG1B 3MECA 3S1TA 1MWYA 1T9WA 2XHCA 4USIA 5CA5A 1IBMJ 2HGLA 1PGZA 4KJIA 3S7RA 1JJ2R 4OI0A 1DY3A 3M9NB 4LFCF 4J90A 3X1LB 1RT5B 3R5DA 1AZSB 4AUKA 4CLFA 2PGCA 2DB1A 1RHKB 1BQNA 4ANCA 1U47A 3WBZA 2PA8D 1C0UB 1RWXB 3GR1A 1FFWB 4DR4F 1HWJA 2EW9A 2V4JA 1PSDA 4MFBA 3KNAA 4LIRA 3AJ2A 4DI6A 1DAXA 3NAIA 1D0EA 2NYIA 2ZH2A 3CJSA 4AXJA 2HPUA 3EPGA 1X9WA 1F5BA 1ZBTA 4MKAA 3BSAA 5AT1B 3EUNA 1AXQA 4HTJA 3BJYA 5IM0B 4DQIA 1HNWF 3SDEB 4C3KA 4QPXA 4ZLJA 2V8HA 5EWEA 3OL6A 3ZNUA 3OV7A 2B3TB 4EMDA 3CUNA 2COLA 4DSLA 1V6HA 3KMQA 3AY0A 4ZVUB 2VV5A 2AT1B 2G2ZA 3CE8A 4NLWA 5SUHA 3QLHA 2X3DA 1M5HA 2DXDA 3DRXA 4X4NA 3I4PA 5K8PA 2QMUB 1FNXH 1WC4A 2D74B 3JB9k 5FLXU 2KM8B 3MPUB 4YR3A 4O3OA 4ZVPB 1YRUA 4OI2A 4EU0A 1HI0P 1QSLA 1B99A 4J91A 2XYGB 1PAEX 2YPZA 2UXBJ 1JJCB 2VFTA 2ZD1A 1WF0A 2BE2B 3BKFA 2K8GA 5BYRA 3GYGA 4FKYA 3J7YI 4DL5A 1JK9B 3OR1B 5IOLA 4YEAA 3BGOP 3OSPA 3FJ2A 4H4OB 1TUWA 2H5IB 3FCWA 4MJKA 4O4GA 4TN2A 1HFEL 3TO8A 2QFIA 5H9EJ 1Q8KA 1Z1ZA 3DYAB 3PRDA 3S8SA 1YDLA 2M70A 4DV5F 4NXNF 3OT9A 3D3BJ 1HNZJ 5C2CA 4V19X 5CYMB 2CFXA 1RWMB 2Z57B 3UR3C 3M05A 4X65J 3GP9A 4CCHA 1UFKA 1VQ6S 4MMOA 2Z4PA 2QMWA 2GA7A 2EC2A 2D1CA 4ZCLA 1YRXA 2ZUAA 1KD1T 1HYSB 1JLAB 3QT7A 1J5EJ 4HDHA 3OFFA 1TZ0A 4RWXA 4KE5A 2RKIA 2H51B 3L4BC 3V6JA 1SL1A 1VQNS 4KPYA 2E9ZA 2ZOMA 5D77A 3MM6A 2KXNB 3EICA 1EARA 3EM1A 4QCLA 2DXEA 1KHVA 5HJYA 3FMWA 3OTDA 3DOLA 1SUQA 2UXDJ 3T5KA 1L3UA 2DH7A 1S79A 4CZCA 4KPCA 2XYPB 2HVDA 3H4BA 3NCQA 1OYDA 2I5JB 3Q86A 4J9LA 3PX4A 4M5IA 3R8YA 2HMIA 4HHHA 1N5TA 5KT7A 4KGKA 3SV3A 2MY8A 2HHVA 5KT3A 4NRTA 4NE9C 1ZTTA 1LWEA 2NXJA 1TFWA 2AEMA 1EZZB 3KFWX 3NMAA 2P6SA 2QT7A 3QAUA 3QT8A 1CEZA 3HHEA 2J9DA 2DPIA 4NZ7A 1LEOA 3THPA 3DLLQ 3SCKE 3RR7A 4FF4A 3ZO7A 1H2UX 3ILJA 1RT4B 4AL5A 2Q43A 3UR0A 5KG6A 3A8IA 5L9NA 3CCUS 3AT1B 1G7CB 3RB0A 2JVOA 5D3GB 4UOHA 1CVJA 2WB1D 4U7CA 5B0EA 3UDLA 3OTOF 1OSCA 3HJFA 1K0TA 3DRSA 2HNYB 1NHKL 2HZCA 1AZSA 5M2RA 4F7VA 3H8YA 4LFAF 1YITS 3O2IA 1EQ0A 1U0HB 3W8PA 1N36J 4QIFA 3H25A 3IS9B 1C2PA 3T5JA 1WI8A 2DNKA 2OKQA 4BC7A 2GO9A 3BDEA 3RB4A 3EZOA 4U9RA 5J2NA 2QLBB 2Y3YA 1LW2A 1FE4A 1QAYA 1RTJB 2NPFA 4ZN1A 2C2ZB 1CJVA 1K8AT 5EX0A 1KNZA 1RWKB 1NPRA 2YKMB 4L75A 5DRKA 3PIPQ 2H48B 2LU2A 2ZBQA 2O1PA 2V63A 3KDNA 3PFOA 4I4BA 2C42A 4K59A 4DPOA 3HZEA 4PWWA 1HNIB 1KKHA 4WP9A 5EWGA 1VC0A 5K8OA 4OX9F 1NH7A 5K20B 2GQ2A 3HX9A 3GQCA 2IVFB 4RW7B 2ZKTA 2B8QA 3CD5A 3D5MA 4U95A 4ZITA 3PKMA 3M32A 4HVZA 4TU7A 2B0GA 3MPVA 4F8RA 4IFYA 3A3PB 4F67A 4ED5A 2HWTA 2PEBA 1UFLA 2GJFA 4NA2A 2KVIA 4ZLLA 5J2QB 3RAQA 1Z4UA 4AQYJ 3PO5A 1G2EA 4EFAC 3Q8YA 1NDKA 3D0GE 3MMCB 1QE1B 3W5ZA 4CTAB 1RLCL 1FRKA 2QLXA 4F26A 3ISZA 4M1KA 1T7PA 1TK8A 4LSZB 3M6VA 2UUCJ 1DTTB 3D67A 2KG0A 1WOOA 3ZZZA 1PKUA 1RT5A 4ECXA 2QFJA 1KFSA 4KGXB 1T3OA 2EFNA 4OI4A 3PR5B 1S9GB 2XLKA 1U4BA 4K4UA 3I5AA 3VAMA 2QSFA 3C66A 1R0CB 4QWCA 2J76E 2DNMA 1VISA 4DV4F 2EWHA 2CQGA 2XSJA 2UZAA 3DHWC 4B3SJ 2VPZB 2V4QA 2C2NA 3SBMA 1X4GA 1NHUA 1NH8A 2G0JA 1VQOS 5EX3A 1RBAA 2V9WA 1U8SA 4LBHA 3UCGA 3Q8RB 3BBFA 5KFQA 1VQLS 4P75A 3G6XA 4CM2A 3VZIA 4YY3F 3T3FA 5D0EA 2FYXA 3ZTPA 1IM6A 1NHVA 3R5JB 1NK6A 3A12A 2DO0A 1WKLA 2K1RB 3HI9A 3KNGA 3LP2A 5JMNA 2WONA 2IM1A 1F2HA 4DR3F 1G6BA 1BE4A 2ZZNA 3MZIA 4CM0A 4Q0BB 1SKWA 2B4OA 4NEYA 2IDEA 2BW2A 5L1IA 2E1RA 3KJQB 4Z37A 5I3UA 3FBBA 2ZOGA 3KLFB 3CMAS 4USWA 4LUBA 1QSYA 2KT2A 3CW2C 3VAFA 2ZBCA 1F5CA 5U47A 3U27A 1EHWA 3QMQA 3BR9A 2EPIA 3IRWP 1CBKA 1C4AA 2MMYA 2V5HG 4C6AA 4DV7F 3VGSA 3U1NA 5A2QU 4H4MA 3MDFA 3K8VA 3JSBA 3F56A 3HJVA 3A3NB 4RW9A 4GVLA 4OX6A 1VI7A 2KJVA 1Y5LB 7FD1A 2G0IA 1VCTA 4WJBA 4J9OA 3VCDA 1KS2A 1YJ7A 3D6TB 5ETOA 3D3CJ 5LMUF 3LAKA 1VK8A 3FBCA 4A8FA 2I1RA 2QGFB 4OX7A 4OJGA 2EVZA 2O3DA 1Q8IA 1TTHB 3VGUA 3B54A 4AE5A 3HVWA 3HP6A 3N6MA 4DCPB 3RU0A 5BR8J 1GMVA 2EFGA 4EZ6A 2LEAA 3PRVA 2Y1RI 2OP5A 4UOCA 4HHJA 2IJRA 5DQGA 3KG4A 4PQUA 5FDLA 4FYDA 2QMXA 2EFOA 3NOGA 4GVBA 1NUEA 3M6UA 4TY8B 4QWEA 1RAIB 1FWKA 2ZHAA 4U7UK 4PWDB 3FK4A 3W2WA 1DLOA 1HLWA 3VAHA 3HCXA 4BDPA 2AJ1A 2PEHA 1RT7A 1U1KA 5FJ4A 2GMHA 5G0RB 1BLUA 2QEXS 2CRLA 3DI6B 1VHFA 4GO5X 4F4ZA 3HFKA 1RHUB 1T94A 5F8GA 2ADBA 1NK8A 5F41A 2AU0A 3OPKA 3MR2A 2FVQA 2BANB 5KFAA 2HS3A 3R5BA 4C8MA 1F1BB 1B0PA 3IGNA 4PWUA 2YXLA 3AOAA 3KLVA 4J9MA 4JOUA 1KTVA 3G2XA 2OH2A 3G87A 1I1GA 4LF6F 4WIIA 3QBCA 3DFEA 5L1LA 1T95A 1A9NB 1C4CA 3G8QA 1ZM4A 2AJ2A 4JI5F 3GILA 1CJUB 1FESA 3R5GA 5J1NA 2IM3A 1UWBB 4DSFA 1RYRA 4RW4A 1JNZB 1REGX 1TMMA 1VJWA 2CPDA 3QSIA 3NRBA 4YHHF 3X3UA 1SJQA 3K7RA 3Q8PB 4LF7J 1YZ7A 3IAM9 4CH1A 4JI8J 4M95A 1QLNA 3HKWA 2FVSA 5C25A 3LGNA 3R7BB 2I0XA 2V69A 2VC0A 2VG5A 3ENQA 5JXSA 4UZBA 3UWTA 1LFWA 4PR6A 3NLCA 3I9V9 4N47A 1FNMA 4CIOA 4J9RA 3ILLA 4P2MA 1TMJA 2HRUA 1KQKA 1RAGB 1SIWB 2MZJA 2NQPA 1HBUA 2CWKA 5GAEU 2B8PA 1RA7A 1HNVB 3QIDA 3G96A 2ZBRA 2B9XA 2N7YA 2E5GA 4EZ9A 3RBZA 3W66A 3BYRA 3CJ0A 3IWXA 1RWNB 2F3JA 2FJEB 1YJTA 2OTLS 1PC5A 2VPYB 4CO1A 4U96A 2CQBA 1CLFA 4Y00A 4LMZA 1P1TA 2LQJA 4L76A 1SV5B 3BGUA 1L5UA 2R7XA 1AW0A 3CJTA 1TV6B 2QA4G 2FGOA 2GVZA 5CCLA 3T1HF 3DU5A 1H98A 4G1PA 1M5OC 2UXCF 2AX0A 1XR7A 2F8MA 1RTHA 2MYFA 3H42A 1NB2A 2FGCA 2QN6B 3OLAA 4EBCA 3ZZRA 4B9UA 4LSNB 2ROGA 3EE3A 5D0RA 4A46A 2XWYA 4WFZA 1X4CA 2FVCA 3O5TB 5CZXA 4LF5F 1DFDA 1FRMA 2ABYA 2FC9A 4WXWA 4A8XA 4NLRA 1S4EA 2CAJA 1N33J 2J9EA 1FVSA 1RAEB 2E7XA 3M8PB 1Y00A 4KQZA 3QRPA 2IM2A 1WC0A 4DUZF 4K4VA 5DO2A 4HR2A 5C42A 4P72A 4ICLA 3MR7A 1A0OB 1F3FA 2GVDB 4QU7A 3TAQA 3LUYA 1X8DA 1B7YB 1RUSA 3MMCA 5HMYA 2HMIB 3QZ7A 3BO3A 4JV5F 4G1IA 2BUNA 2CJAA 3W7BA 2HBZB 1FTCA 4NL5A 2BM0A 5EN1A 3TZXA 2JEGA 2XS2A 2DH9A 3M8RA 3QATA 3KHRA 1KQGB 3KKFA 4UOFA 2JLGA 1VQPS 1UJ5A 3ET6B 2MEWA 5SZTA 3DOKB 3QQCD 2IDLA 3E3XA 2VASA 3GB0A 2VFVA 3NAHA 2DNQA 1HQEA 3ONQA 3V2UC 1GMUA 3LP1B 2BR0A 2K3IA 2OD6A 4NLUA 1ZETA 2RQCA 2RH3A 4D3GA 4F02A 1SIZA 3MAHA 4P10A 4KYZA 4K50A 2GO8A 3JXOA 1Y3JA 4NMLA 3T6BA 4QU6A 1IKYB 4ECSA 4DS5A 2KFZA 4FS2A 1WD6A 2RUSA 4C11A 1M1HA 1HWKA 2HHPA 4NYZA 4USMA 2B6AB 2VZ9A 3N5BA 4C8ZA 3AODA 4HI1A 1FE0A 1EETB 3TANA 5KFIA 1IR2A 1OWXA 2PO4A 2H65B 2XMUA 1GMWD 3MEGA 4CH7A 4G1QA 2MZSA 3OVSA 2LKZA 4GKJJ 1KEKA 1GMWA 2VDIA 3CIMA 2MKYA 1UW4A 3P5BP 3CPWR 4UUWA 1NJWA 4JB8B 4ZHRA 3PKYA 3MM5B 4A8SA 5DG7A 1SBRA 4IDKB 2HBQB 2ZH3A 4ECUA 1UA0A 3MXHP 2UUWA 5IQQA 1RKJA 2YNGB 2ZHOA 4PXDA 4DV2F 5IV3A 3FDSA 2HHTA 4LF7F 3TJAA 3KLIA 3CB4A 3EMTA 2XMAA 4DPYA 5E33A 5HI7A 1WWHA 4OJHA 5A76A 2RMLA 1TKZA 4QW8A 4X4SA 2CG4A 2H5JB 2YNHB 1T03B 3VAJA 1H7WA 1S1TB 2PA3A 5IC4B 1VYAA 2HQCA 1RAHB 2NXUA 4C0BA 5DG9A 2VIHA 4HYKA 2RE1A 4RWWA 2EK6A 3H7HB 3CDAA 1F9EB 5CAAA 1Z2LA 4YFUA 3J7YU 1ROFA 2IAJA 4UTGA 3SSQA 3FQLA 1WHXA 2LXIA 2K1RA 4I6WA 3CC2S 2XWXA 3HULA 1HBMA 1ULRA 5F3ZA 3EGWB 4NLSA 2ZH7A 1SC4B 4ER8A 4DQRA 1KLMB 2SXLA 1WHWA 2KG1A 1C1BB 3C6TA 4NI2B 4WTYA 1K1SA 1N34F 4L73A 3M2RA 3MM7A 1HD1A 1OS5A 5MAOA 2IMOA 1Q53A 1KHWA 2VDHA 4M94A 1CJKB 1PJ6A 5J2PB 1N5VA 1UWAA 4ZPWR 2FDNA 3F73A 4OYMA 4QW9A 2VICA 5KFLA 1KN6A 1X4DA 2DGOA 3AD8C 5HL7Q 3LW5C 3OL8A 3VZHA 3DLEB 3EYZA 2BJDA 4ELTA 5A6WA 5CYJA 4QYZK 1KONA 4KHPF 2VD3A 4B9LA 9ATCB 5DDRC 4O3RA 1R8HA 4N77A 4LF5J 1AFJA 2KYXA 3TQ1A 4RR5A 4HEA9 3SCJE 5L8RC 1WOPA
chains in the Genus database with same CATH topology
1HHQA 3EM1A 2DXEA 3FBBA 3ZTOA 3DDIA 4WBFA 3EVMA 4KPCA 4HR2A 2HVDA 1EHWA 1F3FA 1XIQA 2HVEA 3Q8VA 3ELHA 3Q86A 1UCNA 3PJ9A 3JS9A 4C6AA 4ANEA 1NCLA 3VGSA 1NDLA 1S57A 3Q8UA 4UOFA 2BEFA 4F36A 4O0NA 1LEOA 3Q89A 1BHNA 1NSPA 3ENAA 3FBCA 3ZTRA 4F4AA 1MN9A 1WKJA 3VGUA 1NDPA 3B54A 3EVOA 3FBFA 3DKDA 4UOHA 2NCKL 3FCVA 3PRVA 3GPAA 1HIYA 1S5ZA 1NUEA 3NGTA 4FKXA 1NHKL 1WKKA 2AZ3A 1HLWA 2BX6A 3B6BA 4ANCA 1K44A 1KDNA 3FKBA 4ANDA 3ZTQA 4W98A 1NLKL 3ZTSA 1JXVA 1S59A 1NSKL 1W7WA 3BBCA 4DI6A 4EK2A 3R9LA 3G2XA 3MPDA 3L7UA 1ZS6A 3BH7B 3Q83A 2HURA 4UOGA 3EVWA 2B8QA 1MN7A 5CABA 3EMTA 3VVTA 4DUTA 3VGVA 3VVUA 3WX8A 4ENOA 2DXDA 3FC9A 3Q8YA 1NDKA 1VYAA 2DY9A 5CAAA 1B99A 1PAEX 1PKUA 3NGSA 1BUXA 2CWKA 2B8PA 1F6TA 4FKYA 4S0MA 5BXIA 5IOLA 2VU5A 3NGUA 3FCWA 4CP5A 2DXFA 3VGTA 1U8WA 1NSQA 2AZ1A 4DZ6A 1XQIA 1NDCA 3BBFA 3BBBA 1B4SA 3GP9A 3NGRA 3ZTPA 3BH6B 3FBEA 3ETMA 1NB2A 5C7PA 2ZUAA 1WKLA 2DYAA 3EJMA 1NPKA 3EE3A 1BE4A 1LWXA 3EICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HHQ A;  3EM1 A;  2DXE A;  3FBB A;  3ZTO A;  3DDI A;  4WBF A;  3EVM A;  4KPC A;  4HR2 A;  2HVD A;  1EHW A;  1F3F A;  1XIQ A;  2HVE A;  3Q8V A;  3ELH A;  3Q86 A;  1UCN A;  3PJ9 A;  3JS9 A;  4C6A A;  4ANE A;  1NCL A;  3VGS A;  1NDL A;  1S57 A;  3Q8U A;  4UOF A;  2BEF A;  4F36 A;  4O0N A;  1LEO A;  3Q89 A;  1BHN A;  1NSP A;  3ENA A;  3FBC A;  3ZTR A;  4F4A A;  1MN9 A;  1WKJ A;  3VGU A;  1NDP A;  3B54 A;  3EVO A;  3FBF A;  3DKD A;  4UOH A;  2NCK L;  3FCV A;  3PRV A;  3GPA A;  1HIY A;  1S5Z A;  1NUE A;  3NGT A;  4FKX A;  1NHK L;  1WKK A;  2AZ3 A;  1HLW A;  2BX6 A;  3B6B A;  4ANC A;  1K44 A;  1KDN A;  3FKB A;  4AND A;  3ZTQ A;  4W98 A;  1NLK L;  3ZTS A;  1JXV A;  1S59 A;  1NSK L;  1W7W A;  3BBC A;  4DI6 A;  4EK2 A;  3R9L A;  3G2X A;  3MPD A;  3L7U A;  1ZS6 A;  3BH7 B;  3Q83 A;  2HUR A;  4UOG A;  3EVW A;  2B8Q A;  1MN7 A;  5CAB A;  3EMT A;  3VVT A;  4DUT A;  3VGV A;  3VVU A;  3WX8 A;  4ENO A;  2DXD A;  3FC9 A;  3Q8Y A;  1NDK A;  1VYA A;  2DY9 A;  5CAA A;  1B99 A;  1PAE X;  1PKU A;  3NGS A;  1BUX A;  2CWK A;  2B8P A;  1F6T A;  4FKY A;  4S0M A;  5BXI A;  5IOL A;  2VU5 A;  3NGU A;  3FCW A;  4CP5 A;  2DXF A;  3VGT A;  1U8W A;  1NSQ A;  2AZ1 A;  4DZ6 A;  1XQI A;  1NDC A;  3BBF A;  3BBB A;  1B4S A;  3GP9 A;  3NGR A;  3ZTP A;  3BH6 B;  3FBE A;  3ETM A;  1NB2 A;  5C7P A;  2ZUA A;  1WKL A;  2DYA A;  3EJM A;  1NPK A;  3EE3 A;  1BE4 A;  1LWX A;  3EIC A; 
#chains in the Genus database with same CATH topology
 4JI2 F;  5D6G A;  1NAQ A;  4C8L A;  1IQT A;  2HSE B;  2GW8 A;  2RJZ A;  1H74 A;  4PYA A;  3VAL A;  4LF8 J;  2DR6 A;  2FD2 A;  2LDI A;  2OFH X;  3A4T A;  3D6F B;  4I7F A;  2MKH A;  2VFR A;  4QYR A;  3TR5 A;  5A8W A;  3THV A;  4H4K C;  3L3C A;  3QSY B;  2CG8 A;  2MLY A;  4OZN A;  1Q7L B;  2WZ1 A;  2AJ0 A;  3CJQ A;  3WIV A;  1TAU A;  3MM8 A;  4CO4 A;  2Z2L A;  4AQY F;  1FER A;  1JQG A;  1TP7 A;  4B3O B;  4OJ3 A;  4DV1 J;  4CLY A;  1JLC B;  4A8K A;  2HFV A;  3SDE A;  5B0A A;  5HQL A;  2PII A;  3GIR A;  2ZH5 A;  1Y5I B;  3IR5 B;  2R8J A;  2CPI A;  4P6Q A;  5A0Y A;  3NCP A;  3TEG A;  1QAX A;  3FFI A;  3KLF A;  3QFW A;  4CO3 A;  5G0R A;  4RNM A;  4CO2 A;  5HAN A;  2V8P A;  4X64 F;  5HK4 A;  1IBL J;  5DG8 A;  2IA6 A;  4TU9 A;  4K4W A;  2OTJ S;  3T41 A;  3VTI A;  3EVO A;  3GJS B;  2X1A A;  4KB7 A;  1ZAV A;  2BOP A;  1RXO B;  2CQ3 A;  1WEX A;  4M5M A;  4O3N A;  4CWB A;  5E3Q A;  3TAR A;  1IBM F;  1L3T A;  4LF4 J;  5KT4 A;  4K0K J;  2H1Y A;  3DU6 A;  2CQH A;  2OUG A;  3R97 A;  2P9G A;  3DRS B;  3WC0 A;  4KT0 C;  1G1X A;  1O8B A;  1UPP A;  4LT6 A;  5IV4 A;  2QZ8 A;  2E1M C;  2Q1L A;  3HHL D;  3QWP A;  3ISN D;  5EUH A;  3CF5 Q;  2CQ4 A;  4FNH A;  2QA2 A;  4RNO A;  3KK3 B;  2NXE A;  1X4B A;  1YJV A;  5L38 A;  2IC3 B;  3VAG A;  3TJ8 A;  2F40 A;  3P3D A;  5L1J A;  5DM7 Q;  1UEK A;  3AA9 A;  2D3O R;  1Q16 B;  2AX1 A;  5D0H A;  5J1P A;  4ED0 A;  3FMB A;  1CPZ A;  5ETP A;  5HMZ A;  1ZTW A;  4ES3 A;  2L9D A;  4BBY A;  5F3T A;  4OYO A;  2ILY A;  1D3W A;  3J81 U;  2HQI A;  1E6V A;  2Y0B B;  5FD1 A;  2I38 A;  3WQP A;  5HQ8 A;  4G65 A;  2D41 A;  3BH7 B;  4NA1 A;  2ZVI A;  2IVY A;  2JLF A;  4DV3 F;  4A8M P;  5ETM A;  3WC2 A;  2ZZM A;  3BYP A;  1BQM A;  1JLQ A;  1TL1 A;  3W9H A;  1H73 A;  3C8Y A;  3IP0 A;  3MM9 A;  3VVT A;  1F60 B;  1Y4Z B;  1XN9 A;  1HNX F;  2MJU A;  3VVU A;  2ZC3 A;  1GXT A;  3ZZO A;  4DR2 F;  3M9O B;  2Q6B A;  3FEZ A;  3QGP A;  4O0I A;  1S72 S;  1G3O A;  2NSC A;  2F4V J;  4B3T J;  3DOL B;  3LF0 A;  2W9C B;  1UJ4 A;  3PIO Q;  3J80 Y;  1RT6 B;  5HMW A;  5A2Q Y;  2RIJ A;  2V68 A;  1Q79 A;  4O44 B;  5E41 A;  2ALZ A;  1NPP A;  2XMM A;  5KFT A;  3L95 X;  2VHG A;  1MU2 A;  3HO1 A;  1E6V B;  1WC1 A;  3V4I B;  1EKS A;  3TEH B;  2YWF A;  1CC8 A;  4PG8 A;  4DPX A;  1KVI A;  2GX8 A;  3CJK B;  5E2Q A;  1SKU B;  1S7I A;  2QIF A;  5JVG Q;  2E1A A;  3CCW A;  1MG7 A;  2G2O A;  1MLA A;  3A8J A;  4BHQ A;  2XO6 A;  4ECR A;  2DXF A;  3KJF B;  1X4H A;  4RBV A;  3NWG A;  4ED8 A;  5IWA F;  4FBT A;  5KFF A;  1KOH A;  1WG5 A;  2ROP A;  3C16 A;  1WHY A;  1S6U A;  2JNJ A;  3H40 A;  1T05 B;  2E5L F;  2HNZ A;  4PUO B;  1ZPV A;  4PQU B;  2IA0 A;  5A8R B;  4RW8 B;  5F8H A;  5DM6 Q;  2WTF A;  2NLW A;  2WOM B;  3M30 A;  1JLB B;  1S1W A;  1VRT A;  2F5G A;  2G9O A;  2DGU A;  3PJW A;  1QTM A;  2XUL A;  3D6M B;  1YQH A;  4NYP A;  3KJV A;  1SJ3 P;  1LWC B;  3PZP A;  2HHS A;  1UTA A;  2K3K A;  2J6S A;  2YNF A;  1SH0 A;  3CCQ S;  1RT3 B;  3N6L A;  4K2X A;  1RT4 A;  3D6H B;  3ZTO A;  1FDB A;  4LQ9 A;  2LMI A;  4BS2 A;  4CLL A;  2K06 A;  4JI5 J;  1F2G A;  1R8C A;  1JXE A;  5E5N A;  2RVJ A;  3P8B B;  3D9B A;  2GAH C;  4NLD A;  3GV8 B;  2LXF A;  5HVF A;  4EBD A;  2MGZ A;  2CNK B;  2PI5 A;  3WX4 A;  5C42 B;  2B4U A;  1KC8 T;  2ATL A;  2C3U A;  4X4T A;  1FVQ A;  1M5S A;  3CT9 A;  2LCW A;  2BYC A;  2ZZT A;  2DKO B;  3KDO A;  4C8Y A;  2BBE A;  4ZVO B;  1Q81 T;  6AT1 B;  3V81 B;  3SCL E;  4FXW A;  4JP8 A;  1SB6 A;  2J0W A;  3FSI A;  3HK2 A;  3UCZ P;  3K5N A;  4MK9 A;  4O0N A;  1X9M A;  1VC6 A;  2HHU A;  1PC4 A;  1FF2 A;  2FHJ A;  4Y6I A;  5BJR A;  2RDI A;  3ILO A;  2GAG C;  3KK3 A;  1U6B A;  1GAO A;  3GMG A;  1S7H A;  2FJV A;  4ES1 A;  1SVD A;  1SI9 A;  2GFF A;  4LF2 A;  3NS7 B;  2E29 A;  4DX8 H;  1V5I B;  2DGQ A;  2C2O B;  2E5J A;  2OEM A;  3LGH A;  3KLH A;  3GPA A;  1UAW A;  2RAQ A;  4OHZ A;  2XCP A;  1FWL A;  4Y2M A;  1J5O A;  1K1Q A;  3KXD A;  4WZM A;  2M9K A;  1NME B;  1IKY A;  4LFA J;  1HA1 A;  2Y0S D;  2J0X A;  1RWU A;  3H2V E;  2P8I A;  3W9J A;  4QIG A;  5LM7 E;  3HZG A;  4NXM J;  1HPZ A;  1P1L A;  2UP1 A;  2EFV A;  2R7U A;  1NZA A;  2DHX A;  3BQ2 A;  2VBZ A;  4K4X A;  3JSM A;  3ZTQ A;  5KT5 A;  1PIE A;  1GQE A;  2DH8 A;  3ZTS A;  1FKO B;  4NMX A;  1NSK L;  3MFI A;  4DFM A;  1DTT A;  1FWP A;  4QR2 A;  2IPO B;  5F8M A;  3RYL A;  3MPD A;  3UDC A;  4FVM A;  5B0D A;  5J2M B;  2W9C A;  2POK A;  4N8N A;  5HRO B;  3Q2T C;  4OL8 A;  4FPR A;  4UOG A;  4ED7 A;  3MM8 B;  3UD3 P;  5F8L A;  4ID5 A;  3FZB A;  2BAC A;  4WU3 A;  3S01 A;  4FXV A;  4UQT A;  2PFF B;  3Q24 A;  3TAP A;  5AXK A;  4GKK J;  3MR5 A;  5CAB A;  1RT3 A;  1XR6 A;  2X51 A;  1KP6 A;  2YNH A;  3JSY A;  3QLH B;  4MT1 A;  4TKT A;  2MDA A;  4URG A;  2RU3 A;  2ZH1 A;  3NMR A;  4LRA A;  3JYT A;  2OEL A;  3BPS P;  1NU4 A;  1I94 F;  2XEX A;  4KO0 A;  2ASD A;  5HAT A;  1YBT A;  2G4B A;  1UP1 A;  1WG1 A;  4NYO A;  4WFY A;  5GAE I;  1J27 A;  4X66 F;  1UVJ A;  2XZT B;  2XY5 A;  1FKO A;  5AE3 A;  8AT1 B;  1SQF A;  3I0S A;  1NXI A;  2FLL A;  3MGJ A;  2DNL A;  2Q3P A;  3OTB A;  2CJK A;  2UVR A;  1J5E F;  4ZHR B;  3TWZ A;  1QUV A;  2ZH4 A;  3V81 A;  5F8N A;  1QSS A;  3OXF A;  4OV1 A;  1TL7 A;  4RNF A;  1DJ0 A;  3W65 A;  3OBI A;  3K59 A;  4C8O A;  3EGZ A;  5E7O B;  2DNY A;  3I4H X;  1I3O B;  4I6Y A;  4CH0 S;  2YNF B;  4DV4 J;  1MWZ A;  3D68 A;  1RHJ B;  1NND A;  4ZVH A;  3G6E S;  3RAX A;  1S6P B;  4ETZ A;  1NSA A;  4HKQ A;  5B7W A;  2M52 A;  2YKQ A;  3LOU A;  4NI2 A;  3AB2 B;  3PVX A;  4P74 A;  1XR5 A;  4A8O A;  4DV0 J;  1Q82 T;  3TX8 A;  3IAS 9;  2AGP A;  1E6Y A;  1R8B A;  4Y2I A;  1FEE A;  1O5J A;  4DMZ A;  2YQ0 A;  5IS2 A;  1T0T V;  3N0V A;  3CD6 S;  5DDQ C;  4YOE A;  4LRD A;  1RT6 A;  2U2F A;  1JLF B;  1S1X A;  3JAM Y;  4M5D B;  4ZOS A;  1VIO A;  2CUY A;  3AFG A;  4F3M A;  1NPK A;  4PAA A;  3TYT A;  4EYI B;  3O44 A;  5KFG A;  4GC6 A;  5CXT A;  1OJ4 A;  2V2V A;  1ZM2 A;  1S9G A;  2VG7 B;  4USV A;  5KTQ A;  2FJB B;  3MAA B;  5KFP A;  3HD1 A;  4D3H A;  3TOQ A;  3HVT B;  3HFV A;  1F0X A;  2BV3 A;  2RHQ B;  3IRX B;  3Q23 A;  2C3Y A;  4EI2 A;  4MK8 A;  3EVM A;  2UV8 G;  5LL6 d;  2XSF A;  1JXL A;  2VBW A;  3K5M A;  5C2G A;  4IFV A;  1YK9 A;  3L7O A;  3QT6 A;  3TVY A;  3UQS A;  3JAM U;  3AD7 C;  4YDX A;  5D4P A;  2Y1I A;  2C2D A;  2KB2 A;  1FDD A;  2VA3 A;  1IR0 A;  1DZ5 A;  1GK8 A;  3TA0 A;  2AYM A;  2L9N A;  1M90 T;  1RCO B;  4PAB A;  1OYE A;  4EEY A;  2XCA A;  3KK1 A;  2DEI A;  3KG1 A;  4YME A;  2K2P A;  4ZK7 M;  2BDP A;  2OGU A;  1PBU A;  2B7B B;  2L08 A;  1Y5N B;  2RS8 A;  3FRZ A;  2W7O A;  1JJ4 A;  3RBE A;  4IH7 A;  3BB5 A;  1IKX B;  1L3K A;  3PO4 A;  4Q0B A;  2DO4 A;  4IYQ A;  4ECQ A;  1NK9 A;  1O6X A;  1WSR A;  3ITH B;  3NBP B;  1E6Y B;  3M8Y A;  2BAN A;  3KHH A;  4WTO B;  3ZTR A;  1F5A A;  4BC9 A;  3M30 B;  5DJB A;  1NRK A;  4RNH A;  2LU1 A;  3BZQ A;  2OPS B;  1JIH A;  3OSN A;  4PUO A;  3FCV A;  2YX7 A;  3IMQ J;  4TLR A;  5AXN A;  3CCV S;  4IQX A;  4KTQ A;  2H3E B;  2HS4 A;  5CYM A;  4EYH B;  2KZZ A;  3PG9 A;  2IJN A;  4FKX A;  3MEC B;  4AT1 B;  2DCU B;  3D1O A;  3PRB A;  1U0H A;  4DL2 A;  3HSJ A;  3MM7 B;  1U1P A;  4NLX A;  4QIW D;  4CI0 B;  1LWF B;  3I96 A;  3WHI A;  1HQE B;  5LSO A;  2YX4 A;  3GCW P;  4IH6 A;  5KG5 A;  3BDP A;  2LQ9 A;  3JTO A;  4LRF A;  4M5G A;  4WP3 A;  2XYH B;  3UN3 A;  5KFN A;  1BC6 A;  2EKN A;  3BPD A;  3ET6 A;  2ASY A;  2K7K A;  2XMV A;  1V9O A;  1S48 A;  1U26 A;  5ETS A;  3W60 A;  4JI4 F;  1TL7 B;  1VJQ A;  4IO1 A;  4RKU C;  4Y2K A;  3OR2 B;  4JI6 J;  4NCA A;  1WSV A;  1N54 B;  2RDJ A;  3KUE A;  3BO4 A;  2BQU A;  2GV1 A;  1XER A;  1Y10 A;  2YVS A;  5K8M A;  2ZJQ Q;  1R6V A;  4JI1 F;  4CYU A;  3CD7 A;  4GKK F;  4DG1 A;  4F0H A;  5J1E A;  5GAD I;  1N0V C;  2HIY A;  1M0S A;  3R6G B;  3GZ7 A;  2DGS A;  2DIS A;  4FXD A;  3CME S;  1XBW A;  3IBF B;  1TKX B;  3BSN A;  2LEC A;  4XK8 C;  1RTI B;  5KFE A;  2I5J A;  3W61 A;  3DRY A;  2FHM A;  4YQW A;  3DLE A;  4I7F B;  3ZZY A;  5KFJ A;  1UA1 A;  3HD2 A;  2D3Z A;  2JC1 A;  2N3O A;  5KG4 A;  4QBU A;  4ITS A;  3NKY A;  5J2M A;  2QRR A;  2KFN A;  2LA6 A;  4NXN J;  1TR0 A;  3IS9 A;  4HL9 A;  2QLJ B;  3US5 A;  4USJ C;  3NNA A;  1YJU A;  2OI2 A;  4DX5 A;  4R25 A;  2WBR A;  2LP4 A;  4CNZ A;  1XTZ A;  2B6A A;  5F8I A;  3OVB A;  2MKS A;  4KHR A;  4ZVR B;  2XO7 A;  4B3R J;  1YBA A;  4A47 A;  4URS A;  1OQ3 A;  2V9K A;  1U8W A;  2XMJ A;  4J37 A;  2N4D A;  1NSQ A;  4DZ6 A;  1XQI A;  3BQ0 A;  5HP1 A;  4HT5 A;  3BRE A;  1G4C A;  2VF3 A;  3BBB A;  2UXC J;  4OZ2 A;  4PG4 A;  3LO3 A;  1EAY C;  1HI1 A;  1XWL A;  2AKW B;  2ERR A;  5IT9 U;  3BH6 B;  1CUL B;  2I2Y A;  1VQ8 S;  2UXD F;  2FLP A;  1FO1 A;  3I56 S;  3R7S B;  2OPP A;  2XNQ A;  2DBB A;  2E44 A;  5DQH A;  3V6D B;  4XO0 A;  3R1H A;  2FY1 A;  2CDQ A;  2KJW A;  2QO3 A;  1X0F A;  2GMJ A;  2ZM6 J;  2EFQ A;  2UUB J;  1S12 A;  2VG5 B;  4OYI A;  5C25 B;  4IUF A;  1JWW A;  4USH A;  4ZPB A;  5EDW A;  1HWI A;  2CPJ A;  3NS6 A;  4HI2 A;  3GON A;  3LP0 B;  4AFF A;  2XY7 A;  2ASJ A;  4K7Q A;  1T03 A;  1N4L A;  4WFA Q;  4WYL A;  2DTJ A;  2R7O A;  3MED A;  3ZFV A;  1TK5 A;  4N41 A;  2DK2 A;  3JS9 A;  1AB8 A;  3LH2 S;  5AJ3 F;  2MQ8 A;  2XS5 A;  2AGQ A;  2QL5 B;  4G1Q B;  3R1L A;  2VPX B;  1R0A A;  3MCS A;  2E7V A;  1KBR A;  2HFO A;  3QT5 A;  4OX8 A;  5DLG A;  2K7J A;  2OFG X;  2ZE2 A;  4DCO B;  2XZW A;  3MM6 B;  1ZPW X;  3BGF A;  3KLE A;  4IRK A;  1VGY A;  2B51 A;  2YNG A;  3DGP B;  4QR1 A;  3TAM B;  4YB1 P;  3HT3 A;  2MZT A;  1J2V A;  2GNK A;  3SFU A;  2KHD A;  2RU9 A;  4DUY F;  3C2P A;  1N88 A;  2WK4 A;  5D4L A;  2VC1 A;  4ZVT B;  2CJB A;  1RQ0 A;  2APO A;  4B3M F;  4HHU A;  5J2N B;  4F4A A;  2R8H A;  1RTZ A;  3PW7 A;  5I42 A;  2DHG A;  1YTY A;  4DFJ A;  4DOZ A;  3DMJ B;  1TU0 B;  1DHM A;  2PI4 A;  3NNC A;  1JLG A;  4Y2A A;  1RTH B;  1VBY A;  4WF9 Q;  3CCE S;  2EG1 A;  1FK9 B;  3T1A A;  4B3S F;  3H5U A;  2QJ3 A;  4LF9 F;  1HHS A;  5KFB A;  4IKA A;  2BW7 A;  2LQ5 A;  3FNN A;  4WIQ A;  4X4R A;  4J9S A;  1YJN S;  4DR6 F;  1S5Z A;  2OPR B;  3NGT A;  5IXU A;  1CQM A;  2OPR A;  2QC3 A;  4LR7 A;  1P8G A;  1T9V A;  4I64 A;  2RRA A;  1N5Y A;  4Y65 A;  2E5L J;  2BX6 A;  3IGV A;  2R8K A;  2BE2 A;  4NLQ A;  4QZV B;  1ELO A;  3GR0 A;  3MCM A;  4ATN A;  2C28 A;  3QJL A;  4X4U A;  5KG2 A;  2GJI A;  4UST A;  3C3L A;  3J7A N;  3MTK A;  1UKU A;  1QAI A;  4IG0 B;  2QA1 A;  4KY3 A;  1HBU B;  1LFP A;  1RGV A;  4NEZ A;  3CC7 S;  4X4V A;  4NX9 A;  3A3O B;  3AXM A;  2MQM A;  5ETQ A;  5K5M A;  4DU8 A;  3SV4 A;  1MU2 B;  1I6J A;  2QYC A;  5B09 A;  3DRR A;  4IFV B;  2CQI A;  5F9L A;  3KLE B;  1HQU A;  3CDE A;  1PAU B;  1V5V A;  3HF5 A;  5KAK A;  2DNP A;  1D1U A;  4K4Z A;  1URR A;  4R0E A;  3PXG a;  2RNE A;  3MR3 A;  1D8Z A;  1UET A;  3CWJ A;  3ZNJ 1;  4CNY A;  5K14 A;  1OIA A;  4OFZ A;  3KJN B;  2YH0 A;  3QZ8 A;  3SZ2 A;  2AQ4 A;  3QRR A;  3AJD A;  3W5X A;  1CQN A;  1V3S A;  3LP0 A;  4DL4 A;  3GSI A;  1TVR A;  4L6V 3;  1NKE A;  4F25 A;  3CO0 P;  3M8Z A;  2B56 A;  2MHN A;  4OYP A;  4ED3 A;  2EBE A;  5LMU J;  3KJV B;  2GJ2 A;  4O3P A;  1IKW A;  1WHV A;  2RRN A;  4MTP A;  1N5Y B;  3GJT B;  1LWF A;  2P9C A;  3GCX P;  4M5L A;  3TQE A;  4CLU A;  4XPE A;  5FII A;  4YP3 A;  4C11 B;  1ZAX A;  4IQM A;  5CH7 B;  4JV2 A;  2ADC A;  1S6P A;  4DX7 A;  3D2W A;  3Q22 A;  1URN A;  3H5X A;  4LBI A;  1NJX A;  2MY7 A;  4B3R F;  1DLO B;  5I3P A;  5KFX A;  4FZV A;  2WRM A;  4ALZ A;  3NG8 A;  1U1O A;  3EGN A;  2OAU A;  3ZXW A;  2M5Y A;  2A6O A;  2OPS A;  3D0I E;  1NB7 A;  2CZ4 A;  1GXL A;  4LRB A;  1P9Q C;  5ETV A;  3D28 A;  2HNY A;  2C2R A;  3R3T A;  2MB0 B;  2BRK A;  3K5L A;  2IJF A;  1S9E B;  2D69 A;  2HIQ A;  3TAM A;  4CLZ A;  3HHL C;  1YWX A;  2OML A;  3OD2 A;  4DPU A;  4RW6 A;  2ZVS A;  5M2U A;  3DOK A;  1LWE B;  3EDQ B;  3HLU A;  6FD1 A;  1B0T A;  1AT1 B;  1W2I A;  2JLE A;  4RU9 A;  2FJW A;  2L41 A;  4F4X A;  2EK1 A;  2DIV A;  2J7K A;  5HVH A;  3M8Q B;  1FJG F;  3UW1 A;  2B4V A;  3BF4 A;  4RW4 B;  5GAH U;  3M4X A;  5A8W B;  3PYG A;  4WFB Q;  4H4K A;  4Z7Y A;  3KYL A;  3BSO A;  3HPO A;  1RU2 A;  3M1V A;  2YTC A;  4A4J A;  3K0J A;  1K47 A;  1RT2 A;  2DNZ A;  5IZH A;  4ZN3 A;  1MMD A;  1RHM B;  4OHV A;  4KGM A;  3CIZ A;  2MGZ B;  3NY0 A;  3DRR B;  1I94 J;  1XC9 A;  1KWM A;  5DET A;  5HVG A;  2OPP B;  8RUC A;  1RTD B;  2HGM A;  2KFY A;  1QAJ A;  1REV B;  2A0F B;  4IG0 A;  2AGO A;  1RT7 B;  2PC6 A;  4ZLN A;  1WEL A;  2PN6 A;  1RAB B;  2CIM A;  2FJD B;  1WAC A;  2HK2 A;  3B4D A;  4ZA1 A;  2BJ8 A;  3M2U B;  1IXK A;  4ZCK A;  5KFS A;  2F8E X;  2GQC A;  3GWC A;  3G8T A;  1N52 B;  3Q0A A;  3T5H A;  5CCM A;  1U09 A;  2QG9 B;  1R89 A;  3AA8 A;  2B9W A;  3CDB A;  1IWG A;  3LAN A;  4OZ1 A;  1RHQ B;  1TV6 A;  4ECT A;  3J7Z T;  2E7W A;  3H90 A;  3R5A A;  3BSC A;  3UD5 A;  3GTY X;  1HYS A;  1WF2 A;  1X4F A;  2CZ9 A;  2WVE A;  4DR5 J;  3CDW A;  1HIY A;  2JL9 A;  1MMN A;  5E3P A;  1DQA A;  4C7Q A;  4P2S A;  2V94 A;  4WE1 A;  4EO6 A;  3BV8 A;  1UMJ A;  5T7L A;  2A10 A;  3M8S A;  1GX5 A;  4FF1 A;  2XSJ B;  4TY8 A;  1PJ5 A;  3B6B A;  2V2Q A;  1ZOT A;  3M2R B;  1Q5Y A;  2Z2M A;  5HMX A;  3FSY A;  2VQF J;  1S59 A;  2V4R A;  3GV5 B;  4DWI A;  5AXL A;  3R2D J;  2ALY B;  2CJX B;  2XMT A;  2KRB A;  4XDC A;  4WFN Q;  3U7J A;  3CJ2 A;  3DNC A;  3AHP A;  4EGL A;  2DHA A;  2J8S A;  4KH1 B;  4CLK A;  3FSX A;  4F0M A;  1IM4 A;  2C3P A;  1UEV A;  4FYX B;  3NNH A;  1ZZF A;  2P5V A;  4QIV A;  1RT1 B;  1FFG B;  1CS4 B;  4ZPD A;  1S1V A;  3Q8S B;  1IQZ A;  1S1U A;  2UVU A;  3RW6 A;  2AWZ A;  2QX0 A;  2DY1 A;  2HLU A;  4F3Q A;  3G8S A;  3E8O A;  2YWG A;  2FJA B;  3MD1 A;  2QLF B;  3SFG A;  1T3N A;  3CJ5 A;  3GG0 A;  1BWE A;  2MKC A;  1N32 F;  2DY9 A;  2KRR A;  3IRX A;  1SH2 A;  1OMS A;  4YN3 B;  1ZA2 B;  2HRT A;  3TA1 A;  4DL3 A;  2R7T A;  1K0V A;  3N6N A;  4OHY A;  3VWS A;  4Q8E A;  1RCX B;  1PYS B;  2O66 A;  3OFH A;  3TUJ C;  1A7G E;  3JTN A;  3V5R A;  5G4D A;  3QAE A;  3NGS A;  1RTJ A;  2CQ1 A;  3WIU A;  1TK0 A;  2NZC A;  4DEZ A;  2UVW A;  1GH8 A;  5KG1 A;  2WVB A;  1IN0 A;  2RT3 A;  3K17 A;  3K57 A;  4PWD A;  1CJT B;  4HAC A;  1VQM S;  1EJ7 L;  3FRY A;  1RDR A;  3I5B A;  3GU0 A;  4F0K A;  2KTQ A;  3PX0 A;  5HP1 B;  4Q2M A;  3SIP B;  3NWR A;  1LK7 A;  2MSS A;  3IFE A;  3BN7 A;  3RZA A;  2HRY A;  4MIB A;  1IBK J;  3LP1 A;  3RRG A;  2W7A A;  1NEE A;  4U6P A;  1SL2 A;  2FJX A;  3ITH A;  3NBP A;  3O1L A;  2VH7 A;  3BGL A;  5E0O A;  4MIW A;  3HSG A;  4AXI A;  3OW2 R;  2UVV A;  1LK5 A;  1MW7 A;  4DUZ J;  1H72 C;  3K8W A;  3PR4 A;  2DYA A;  1XMQ F;  1Q7Y T;  3MUR P;  3A1Y G;  1HNV A;  4XPC A;  1QVG R;  4V19 J;  1FJ7 A;  1S6O A;  1YGY A;  2R4F A;  2YWK A;  4ZPV R;  2OPQ B;  4TXS A;  2ZNY A;  4M8L A;  3N9U C;  2HEK A;  3RAM A;  5HSP A;  2BJ9 A;  3GFX A;  5H1S V;  1M5V C;  3PW0 A;  1FJG J;  2LQB A;  2J9D E;  3J7A 1;  5CQG A;  1WNE A;  2RQ4 A;  5H9F J;  1HBO A;  4WBF A;  4KO0 B;  4ZMM A;  3R6L B;  4IH5 A;  1EX8 A;  1RT2 B;  3IN5 A;  4GO7 X;  1BWV A;  1NK7 A;  2Z30 B;  4PXE A;  3CJ8 A;  2UUC F;  1AUD A;  3M8W A;  3RW7 A;  3MM5 A;  3T19 A;  4FBU A;  4JV1 A;  1HD0 A;  4X84 A;  1SJR A;  1CJU A;  4OI1 A;  3GV7 B;  4AL7 A;  4LSN A;  4ECY A;  3PJX A;  3KHL A;  3IBC B;  2DGW A;  3Q8U A;  1CS4 A;  3SYZ A;  3T9N A;  5HRO A;  3W3S A;  1WEZ A;  4EUV A;  3IM8 A;  3UCU P;  4F36 A;  1L3S A;  3T9Z A;  1X0P A;  3QPI A;  2A1B A;  3Q89 A;  1BHN A;  3M8P A;  4IG3 B;  1LXJ A;  2WVD A;  3ENA A;  5K8N A;  3OXG A;  1SKR A;  2AEJ A;  4Z7C A;  3SXL A;  2HAF A;  3IO1 A;  4DR7 J;  1S99 A;  2IIH A;  2FUG 9;  4C98 A;  3HXM A;  2ZFH A;  1WDT A;  1F9F A;  5AXM A;  3N28 A;  2AD9 A;  3FGV A;  4ILR A;  1QVF R;  4FPI A;  2VOP A;  2Z2Z A;  4TQS A;  2N82 B;  5B08 A;  2BOA A;  2H5E A;  1H0H B;  3AJ1 A;  3W64 A;  3OL7 A;  1D9D A;  2JFK A;  3AOB A;  1X4A A;  3C6T B;  1SV5 A;  3OTE A;  4B17 A;  3ZZT A;  2OMO A;  4XIU A;  1OO0 B;  3EX7 B;  3H0P A;  4C0O C;  2WB4 A;  3FKB A;  3MMJ A;  3H5Y A;  1VC5 A;  4UT4 A;  2UU9 J;  5DDO C;  5D3G A;  4O44 A;  1U1L A;  1N33 F;  2E1P A;  2J8A A;  1FRJ A;  2WVF A;  4DDF A;  3C14 B;  4PCQ A;  3DLB A;  1SQE A;  2JC0 A;  2NYH A;  3MHY A;  3VQT A;  1PBA A;  3H5S A;  4AYB D;  4LR8 A;  3SQO P;  2HUR A;  2OLW A;  2DJW A;  3GFH A;  5DZ7 A;  1Z2Z A;  3W62 A;  4FF2 A;  1R8A A;  1WI6 A;  3NOC A;  4PPZ A;  2XNR A;  4MIA A;  3EXY A;  5H9F K;  3CNQ P;  3H2U B;  4NZ6 A;  1RAJ A;  4RW7 A;  3U1L A;  4CO5 A;  1MN7 A;  4QWD A;  3BM7 A;  2R7W A;  4NPO A;  2OSQ A;  3V6K A;  2FQQ B;  2LA4 A;  1H2T Z;  1PYT A;  2NXN A;  2A3J A;  2CWX A;  2OEK A;  2W2O P;  3HHK A;  1IKV B;  3HVT A;  3MAA A;  3DLG B;  2M7S A;  4KSE B;  1UPM B;  3POT A;  1UVK A;  4KV8 B;  1GEH A;  2GS8 A;  4N7T A;  4C3L A;  4DJB A;  3MFH A;  5BR8 F;  3DI6 A;  3HDS A;  1CUL A;  1WC5 A;  3D54 A;  4J9U E;  4DSK A;  2FHK A;  5T7L B;  1FCA A;  3VV2 B;  4UZC A;  2XLJ A;  1ITP A;  3HVR A;  1TKT B;  2O01 C;  5I4M A;  2CPZ A;  3LA0 A;  3BEG B;  1XMO J;  1RZM A;  2HVZ A;  3DLJ A;  1R27 B;  5BXI A;  2R2U A;  3D1Q A;  4NWB A;  1T9U A;  1WC3 A;  1U49 A;  4DV6 J;  2N7C A;  3Q8Q B;  4ELU A;  5LMN F;  1RYS A;  4WU2 A;  4MH8 A;  1D09 B;  4YB5 A;  3OLB A;  4DSE A;  2XY6 A;  3P5T L;  1BMQ B;  2BJE A;  1U1Q A;  2DR8 A;  3PFE A;  3JQK A;  2BAB A;  2W1B A;  4KIA A;  4QJV A;  1B4S A;  1Q4R A;  4O4R A;  2AMC B;  2KXF A;  3G86 A;  3IG1 A;  4NLY A;  2R2S A;  1U1N A;  1WDD A;  1U1R A;  2E66 A;  1IBC B;  2GHP A;  4DZD A;  4LF4 F;  5MLC V;  3OL9 A;  5C7P A;  4LR9 A;  2IFX A;  1WOR A;  2KDO A;  2QL9 B;  4JBC A;  4LF8 F;  2BE9 B;  4QIE A;  2NRE A;  2Z58 B;  3KG0 A;  4I6A A;  2GML A;  3V4I A;  1H2V Z;  4ZS6 A;  2LQ8 A;  3DGP A;  4LBP A;  1WF1 A;  2CPX A;  4YS2 A;  2J6T A;  5GMD A;  1N36 F;  4V1A k;  2HHH F;  2DPJ A;  2LLZ A;  2MLZ A;  2I9S A;  2JOQ A;  2VBY A;  1UZD A;  3NCR A;  4PG6 A;  4JI8 F;  5L9X A;  3Q2S C;  3JYT B;  3ICL A;  1K9M T;  2CQP A;  2AHO B;  1T9T A;  3T1Y F;  2EFP A;  3QIP B;  5GAG U;  1HKA A;  4ZP9 A;  3ILI A;  4MYU A;  3DN9 A;  3ADA C;  5KT6 A;  2W9B B;  4B08 A;  2MQP A;  2X1G A;  4JI3 F;  1FRX A;  1IWA A;  1VQS A;  2FTR A;  2MZR A;  2N3L A;  2YKN B;  2Z56 B;  3MEG B;  2RF2 A;  4Y28 C;  1Y3K A;  2HKE A;  3GYN A;  4B3T F;  4QPT A;  3AOC A;  2NUU G;  3LP2 B;  3CCR S;  2KL8 A;  2XTJ P;  3L7P A;  1X60 A;  3J81 j;  3C15 B;  1HMV A;  5L39 A;  1HQU B;  1BQN B;  4DX6 A;  5DS7 A;  3D4J A;  2HWI A;  3NGD A;  1H38 A;  2VFU A;  1HBN B;  2F4F A;  2L9W A;  3MI7 X;  3M7V A;  3TW0 A;  4ED4 A;  1TQL A;  4YDD B;  2HVH A;  1HPZ B;  5LJ5 Y;  1IJF B;  1B70 B;  3LGM A;  1R3N A;  2MKI A;  5GAD U;  1FRI A;  3DKD A;  3HHD A;  2OEJ A;  2V4J B;  3IWN C;  2NCK L;  1CC7 A;  2JHE A;  3LWL A;  2R2R A;  4DLG A;  1C1C A;  2UV8 A;  3K58 A;  2HQD A;  4NRU A;  4F4W A;  3QWU A;  3GIK A;  2D9O A;  2WW4 A;  2W24 A;  1EKR A;  2Z8Q A;  2RUG A;  2DRD A;  3CVK A;  4LIW A;  4P2X A;  1JKH A;  2YNI A;  4WPA A;  4CLP A;  2HK3 A;  3PEH A;  1RAA B;  4BWM A;  2MXY A;  3I5C A;  4UY8 T;  1N8R T;  1YLX A;  2JEJ A;  2WSC C;  2UUT A;  3H98 A;  3SSR A;  5C24 B;  4PYD A;  3LAM A;  2IMW P;  1VQY A;  2N4C A;  2RRB A;  1NLK L;  2R8I A;  4DV3 J;  4A8Y A;  3MEE A;  1JXV A;  2CPH A;  1FNO A;  1RAO A;  2W2Q P;  4ILM A;  1T02 A;  2CVE A;  2QL7 B;  4K2J A;  4OQJ A;  3U02 A;  2XM3 A;  4B9V A;  3JQJ A;  1HNX J;  1HR0 F;  2ZWO A;  2J9C A;  1DQ9 A;  4RJV A;  7AT1 B;  2R2T A;  2HFN A;  3MMB A;  1QJH A;  2W2M P;  4B02 A;  3RJM B;  1S77 D;  2ASL A;  1HMV B;  2F8H A;  3G9C A;  5HJX A;  2NZ4 A;  1RWV B;  3RGI A;  3U1M A;  4DG1 B;  5HN0 A;  1Y9O A;  2JJ4 D;  5IM0 A;  4I69 A;  1DAR A;  3DHX A;  3TP2 A;  5KFV A;  3QYY A;  3THT A;  2HHW A;  3K5P A;  4P7V A;  2EBG A;  1X5O A;  1Q95 G;  3RRH A;  3UN2 A;  3D66 A;  1RKI A;  5LSL A;  5KFW A;  1FXL A;  1UEU A;  4ZJO A;  1VS3 A;  2HW3 A;  2DCL A;  1O51 A;  3HFZ B;  1NK5 A;  2IYG A;  2P6T A;  4IR1 A;  4DV7 J;  3MEK A;  3N4W A;  3QJJ A;  4ERD A;  1GX6 A;  1BUX A;  3PY8 A;  1OY8 A;  4OJ1 A;  2C3M A;  3ENV A;  3EZU A;  1F6T A;  3GLJ A;  4YB6 A;  4LFC J;  3PTW A;  1JLA A;  3QGI A;  1R0B G;  3QNW B;  2VJV A;  3PDN A;  2KVQ E;  3BN4 A;  1Q1K A;  4OYA A;  2R7Q A;  4OYB A;  3GE9 A;  1CJT A;  4HAC B;  2LFV A;  2XBP A;  3AD9 C;  1KOO A;  3VGT A;  4IO9 Q;  5A8K A;  5F0W A;  2R42 A;  1NDC A;  4DR4 J;  4DR3 J;  3TNV A;  3FEY B;  4MK7 A;  2XLI A;  1X4E A;  3DYA A;  4I68 A;  4L72 B;  4OZJ A;  2PMW A;  3FCH A;  3RUB L;  4EWT A;  1T8E A;  1BY9 A;  2LVW A;  3KWM A;  3KMS A;  3OUY A;  3FBE A;  3I0S B;  4PZV A;  8ATC B;  3DXB A;  2YKP A;  5DDP C;  3AAW B;  3PX6 A;  3IXQ A;  5ADZ A;  4GRS A;  4DL7 A;  1TUG B;  1LKZ A;  1WOS A;  3IA0 A;  2HHH J;  1TUV A;  4TU8 A;  2HND B;  3D1H A;  4DLE A;  5JUM A;  1JB0 C;  5J2Q A;  4F2S A;  1NJI T;  4IFY B;  2KM8 C;  3O6Q A;  4GC7 A;  4ECZ A;  2NS1 B;  4FVC A;  4F3O A;  3Q8V A;  5E3R A;  3POT B;  4KV8 A;  1UZH A;  3PJ9 A;  3UPF A;  4ILL A;  1VDH A;  1NCL A;  2L3M A;  2Y1L B;  3NS5 A;  1VIX A;  1HNI A;  4CRJ A;  2UXB F;  5ETN A;  2XS7 A;  3K2Y A;  1YSJ A;  1GTE A;  2CNL B;  2RKI B;  4USK A;  2J5A A;  4ZP8 A;  1B64 A;  2KXH A;  1S57 A;  2J7U A;  4OZ3 A;  4B3O A;  1SC1 B;  2CA9 A;  1C0T B;  2X1B A;  4MKB A;  4CYU B;  3HHN B;  1VRU B;  1FKP B;  3HHL A;  2XQC A;  1VBX A;  3PHT A;  1OY6 A;  4J7C A;  4KFB A;  3MWB A;  5KFO A;  3VAK A;  1K73 T;  3W2W B;  3GIJ A;  3W1Y C;  5RUB A;  1NM2 A;  4AD6 A;  3OHA A;  2G2Y A;  4MFB B;  4RBU A;  4Y34 A;  3I31 A;  2BKP A;  7FDR A;  5J2P A;  1TFY A;  1ZH5 A;  1AA1 B;  2XGP A;  2MST A;  2PSZ A;  4X65 F;  4MKY A;  2VQE J;  3OVA A;  3HKZ D;  4TY9 A;  4J9P A;  1FJC A;  3DGV A;  1IBK F;  3HSD A;  1X9S A;  1RAC B;  1N0U A;  4OIX A;  4Q7A A;  3SSS A;  2IAJ B;  1HNZ F;  3CJ4 A;  2HFU A;  3OQ2 A;  4H54 A;  2CPE A;  4JI0 J;  3P49 B;  2YWH A;  1HAR A;  2DNH A;  4DL6 A;  1KDN A;  1LOU A;  2M88 A;  4E8U A;  2EXU A;  3OTO J;  4K0K F;  3HM9 A;  2W4C A;  4RL1 A;  4LVN P;  1M1G A;  5BYQ A;  4RLE A;  4ZVQ B;  5KFM A;  3BBC A;  3TUP A;  2JWN A;  1XMB A;  1JLE A;  2LXU A;  4I2P B;  1GFW B;  5GVQ A;  3P4U B;  4X4O A;  2JSX A;  4JI7 J;  2KU7 A;  2X1F A;  1L3V A;  4Q44 A;  4NLP A;  2EI5 A;  3CJ3 A;  2W8K A;  4YUD A;  1APS A;  4AL6 A;  4BWJ A;  1DTQ A;  2FHJ D;  4WYW A;  4OLO A;  4MYT A;  2VOD A;  2NUH A;  1U25 A;  2VB6 A;  4KGZ B;  2BJ7 A;  3G82 B;  2BM1 A;  4ZVS B;  2BKN A;  3M2V A;  3KK2 B;  3KK1 B;  2HVI A;  3W2V A;  4DUT A;  3KK2 A;  1SQG A;  2WHO A;  3E51 A;  3QGH A;  5DZ6 A;  2JVR A;  3A8E A;  4YB7 A;  1W25 A;  2BE7 D;  2V8V A;  3TA2 A;  3UD4 P;  1VQ5 S;  2ZHB A;  2GGP B;  2E1C A;  4I2Q B;  4B9T A;  2CXE A;  4PEO A;  1HHT P;  2DD8 S;  2V8D A;  5HO4 A;  1JLB A;  1S1W B;  1VRT B;  2LEB A;  1YJW S;  4QQB A;  1JLE B;  2J7W A;  3T6J A;  3WDO A;  1EIY B;  4JV5 J;  1LW0 A;  3RB6 A;  4O3Q A;  4DR2 J;  3N5F A;  2CVI A;  5CYQ B;  2EKY A;  3UVJ A;  1B3T A;  3T1H J;  4C4W A;  2FZC B;  4ED1 A;  1HWL A;  2HQG A;  1S49 A;  4CP5 A;  5A8K B;  1X7V A;  2GZO A;  2DR9 A;  1KQF B;  1YHQ S;  1MRO A;  4Z2X A;  2IBK A;  3GJR B;  4X4Q A;  4ED2 A;  3CDU A;  1BXN A;  4IOB A;  4K8R A;  2M8D B;  2IYI A;  1XNR F;  2RB7 A;  2HQF A;  1XK8 A;  3QJP A;  1RAD B;  1IJE B;  4ZPC A;  2AJQ A;  4ZJQ A;  1ZAW A;  4DU7 A;  2CNN B;  4RNN A;  2QSW A;  3W9I A;  1D9F A;  1ZA1 B;  3ZZU A;  3J81 Y;  4K4Y A;  2ZUG A;  2KHC A;  1CSJ A;  3EJM A;  4W4M A;  3CCZ A;  1TKT A;  4A48 A;  5IWA J;  3BO2 A;  2BRL A;  3W5Y A;  2M4M A;  1OY9 A;  3CCL S;  3BR8 A;  1PYO B;  1LWX A;  5I42 B;  2MQO A;  4DFP A;  4JI6 F;  3EPI A;  1TKZ B;  3VQS A;  2V50 A;  1S6Q B;  3CSK A;  3RR8 A;  3V6H A;  1S0O A;  2HYI B;  2F4V F;  1O0P A;  4IOA Q;  2IBO A;  2FC8 A;  4A8W A;  1JJH A;  1PG5 B;  1RWW B;  5THW A;  2ZH9 A;  1UCN A;  2FZG B;  2KKH A;  3SI8 A;  3DLH A;  4GKJ F;  1RP5 A;  1LXN A;  1YX2 A;  2RF2 B;  4KHM A;  4UW2 A;  4JUZ A;  4C3M A;  2Q6C A;  2W2P P;  3MMB B;  2CQC A;  1CJV B;  1RK8 A;  4UUX A;  3BS9 A;  1M1K T;  1QM9 A;  2AYE A;  1VK3 A;  1U1M A;  2H4Y B;  5DGA A;  4JI1 J;  2HFZ A;  2AYG A;  5KG3 A;  3BGR B;  5CD4 H;  3UFC X;  2HQ3 A;  2ZKU A;  4U8V A;  1C0U A;  3TVZ A;  1PCA A;  3I55 S;  5C24 A;  4QYZ J;  1SXL A;  5T41 A;  1T11 A;  3DOM A;  5ETR A;  2DHH A;  3TUI C;  1WKJ A;  2MPU A;  2MLX A;  3FBF A;  2VQE F;  1VQK S;  4ZVG A;  4CT9 A;  2Q66 A;  3KOA A;  1ICE B;  2VL1 A;  4B9S A;  4PPD A;  3G4S S;  1QDU B;  3CTR A;  4KAI A;  1MWQ A;  2VBX A;  2YPY A;  1S0V A;  4NLG A;  1W26 A;  3PYE A;  2F7V A;  5IT4 A;  2R9L A;  4P9S A;  1NKB A;  1LV5 A;  3IM9 A;  2M0G B;  3SCI E;  3FZ2 A;  1FFS B;  3NXZ A;  4KBI A;  4P52 A;  1I51 B;  4NLV A;  4MKV A;  4JI0 F;  4NAS A;  4N56 A;  2F63 A;  4H4O A;  3E2E A;  2PFD A;  3VHQ A;  3PAC A;  5CHC B;  3OR1 A;  1N34 J;  4NCG B;  3KLG A;  1HBN A;  3AQP A;  1GT8 A;  1RBL A;  2DNO A;  2KT5 A;  2JRS A;  3H20 A;  4W98 A;  4C48 A;  2AJF E;  2PMH A;  5I3Q A;  2WCX A;  3CD0 A;  5K9F A;  2AJ4 A;  3GFY A;  1RJJ A;  1IKW B;  1UVL A;  3LQV A;  1UW9 A;  4P73 A;  3TX0 A;  4DV2 J;  4IG3 A;  1R0A B;  4Q5V A;  2UUB F;  4ZPT R;  2W8L A;  1ZS6 A;  3MED B;  1FJE B;  2HAI A;  1UWB A;  2B5J A;  2PMZ D;  3T1Y J;  2BZ2 A;  1REV A;  2JH3 A;  4RW9 B;  2WSF C;  2E9R X;  3M2V B;  3A13 A;  2WVC A;  4IOC Q;  2ZH8 A;  1BQM B;  1JLQ B;  2ILZ A;  5K14 B;  1Q8L A;  2ZM6 F;  1DUR A;  3GII A;  2VUG A;  3MTJ A;  2JX2 A;  3C19 A;  1N5S A;  1RSC A;  3M9M B;  3MPY A;  1Q78 A;  1HBO B;  3K5O A;  2O67 A;  1KRP A;  4DFK A;  5D15 A;  2BKO A;  1U6F A;  2ZNZ A;  2F9D A;  2V2K A;  4FS1 A;  2BQ3 A;  1S0N A;  4KR0 B;  4OYW A;  1D9A A;  4QWB A;  4TQR A;  4DS4 A;  5AE2 A;  4NOH A;  1ACM B;  2BXJ A;  3DCA A;  3UN5 A;  1P9Y A;  4ZIV A;  4K4T A;  1VQ9 S;  2XI3 A;  4C2M A;  5HBM B;  3HMJ G;  1S0M A;  4W92 B;  3M8Q A;  2WON B;  2IHR 1;  4KGV B;  2VA2 A;  1J5O B;  4Y3C A;  4Q8F A;  2XC9 A;  2CQD A;  3MOJ B;  2CYY A;  1N48 A;  1NJY A;  1R8P A;  4FYV B;  3SMZ A;  2F1F A;  4EBE A;  2Z2Y B;  1KQS R;  4PG5 A;  3RBD A;  3I0R B;  2QYG A;  2V8G A;  4U7U D;  2HHX A;  2BA9 A;  1HL6 A;  2O5D A;  5KFC A;  1DRZ A;  4B9M A;  4LF9 J;  1RAF B;  5IQ6 A;  5HLF B;  1XNR J;  2JFD A;  4FNI A;  5DGB A;  2HNZ B;  5ETT A;  2HBY B;  3W8G A;  5FLX Y;  3C16 B;  4WXO A;  3B8H A;  2NR0 A;  1C1C B;  1FK9 A;  2E5H A;  4R0J A;  2C2K B;  5H9E K;  1DQ8 A;  3V4M A;  4N5S A;  2YH1 A;  3BGR A;  5D0G A;  3R7N B;  5BYS A;  4OHX A;  2MZQ A;  1IUJ A;  5A0Y B;  4ID8 A;  3I9Z A;  1U2C A;  3S6E A;  1D8Y A;  2U1A A;  2DIT A;  1C0T A;  3B78 A;  3GSD A;  4FDF A;  4Q2L A;  1TAQ A;  1CG2 A;  2WBM A;  3RBX A;  4YHH J;  1FKA F;  4I67 A;  4R8U A;  2FHO B;  5B0G A;  2PT0 A;  3KLI B;  4ZJL A;  3EZ5 A;  5KFU A;  3GJQ B;  3MMA A;  2FZK B;  4KKO A;  3UNY A;  3VAI A;  3TI0 A;  3C46 A;  2B4P A;  2MQN A;  3KUH A;  4ETX A;  1SL0 A;  4PKD B;  2LDY A;  1VLY A;  2V67 A;  2IRU A;  2GIF A;  4X66 J;  3TRG A;  1TVR B;  5E3C A;  4X2B A;  2V0N A;  4ZVF A;  1H3D A;  3LPY A;  1JNR B;  2DR5 A;  1KFD A;  4J9K A;  2AF6 A;  2B9E A;  3BKT A;  5LXY A;  2A6M A;  3OFE A;  4RBT A;  3UE2 A;  4DPW A;  4X64 J;  2BQR A;  1KLN A;  2ACM A;  4JYA J;  2OHD A;  1LWC A;  4FP9 A;  2C2E A;  1TL1 B;  5C5J A;  2HHQ A;  3IWL A;  2DT9 A;  1EP4 A;  4KRW A;  9RUB A;  2RS2 A;  1YJR A;  1QTN B;  1Q86 T;  4I1T A;  4IRC A;  1SH3 A;  1Q8B A;  4LVO P;  1NKC A;  4CT8 A;  1LW2 B;  3SQG A;  3MD3 A;  3UI3 A;  5F0U A;  1YG0 A;  4DR7 F;  4O23 A;  3G71 S;  1JMT A;  2HFS A;  1U45 A;  1FA0 A;  1CJK A;  3DDK A;  4DQS A;  3L9Z A;  2D3U A;  1N6Q B;  1NO8 A;  3NL0 A;  4OYZ A;  4M5D A;  3DRP B;  4L3N A;  4OZ5 A;  5D78 A;  2I6W A;  4CLS A;  3GIM A;  3IBW A;  2GIR A;  1GXU A;  4HDG A;  3I82 A;  4TYB A;  1FXD A;  2W2N P;  1U7L A;  2BMB A;  2FY8 A;  1WKK A;  3K89 A;  1VHI A;  2L48 A;  3H59 A;  4LSL B;  1ZZN A;  4LSL A;  1EB0 A;  3PEJ A;  4K4S A;  3IR6 B;  3LPE A;  2JEI A;  1R6Y A;  2CNO B;  3AH6 A;  1K44 A;  4ED6 A;  1MRO B;  3DDN A;  4J9Q A;  4G3I A;  3EDR B;  1GTH A;  4YR2 A;  1AFI A;  3VF0 B;  2AP6 A;  4DXL A;  1XJW B;  1JLG B;  1OPZ A;  3UO0 A;  5E3A A;  2LEP A;  4NCB A;  1YRT A;  3DMJ A;  2ACY A;  4HH0 A;  2BJ3 A;  2KYZ A;  1RIS A;  2DGT A;  1KVK A;  4KH0 B;  4NLO A;  1V3R A;  3IR7 B;  3L7U A;  4F4K A;  4H4M B;  3Q83 A;  3C6U B;  2G0C A;  2QTW A;  1EP4 B;  3EVW A;  1FT8 A;  3E01 B;  4DN9 A;  4OX9 J;  1VLO A;  1HWU A;  4E2F B;  4WZQ A;  2M8H A;  4RZR A;  4OYX A;  4PRF A;  4OMF G;  1VFJ A;  2QV6 A;  5J1E B;  1SCJ B;  3VGV A;  1S6Q A;  2VG7 A;  5D4O A;  1VMB A;  3H2L A;  2DEJ A;  3CED A;  3WZ0 A;  3W2V B;  1HW8 A;  4ZDN A;  4CLW A;  4CO0 A;  4Q43 A;  4DF4 A;  3QIP A;  3OR2 A;  2MKJ A;  4OI6 A;  1TL3 A;  1PO6 A;  1JLF A;  1S1X B;  1Q5V A;  2DNN A;  2ZEJ A;  3MOZ A;  4DL0 C;  3CCJ S;  1RHR B;  1Q0N A;  1UFW A;  3I6P A;  3RTV A;  4L74 A;  4WKR A;  4R8U B;  1YVF A;  2JEF A;  4OZ0 A;  4LRC A;  5GAG I;  2AV5 A;  3VR1 A;  4RW6 B;  2F9J A;  4C8K A;  2ZBI A;  2W7P A;  3ULH A;  3I0R A;  3NGU A;  3QGG A;  3DM2 B;  4OLP A;  2AYB A;  1ZM3 A;  3MCO A;  3FUY A;  1ZYQ A;  4K5S A;  5IC6 B;  3OTC A;  2OD4 A;  4WK1 A;  3ZC4 A;  1H7X A;  2X3G A;  2YX1 A;  2PD1 A;  4URQ U;  4ES2 A;  5AE1 A;  4YR0 A;  5ETL A;  4HTI A;  3EWG A;  5F9N A;  3MUT P;  2UUA F;  4JI4 J;  4U67 Q;  2ZC4 A;  2IY5 B;  4YY3 J;  3TVK A;  1YKW A;  1B0V A;  1UL3 A;  2YWW A;  4DSJ A;  1PIL A;  4WCE Q;  2VJU A;  4F2R A;  2AW0 A;  1LW0 B;  1R7I A;  1RBO B;  3DC2 A;  4ZKA A;  1UJ6 A;  2CAD A;  2AEF A;  1JLC A;  2VQF F;  2CQ2 A;  1FX4 A;  2GCF A;  3C15 A;  4RUH A;  5GMK a;  2B43 A;  4TVA B;  1TKD A;  2MZ1 A;  5LT5 A;  1SJ1 A;  3QO9 A;  1U48 A;  4JI7 F;  4N8O A;  2FIU A;  2DNR A;  2P9E A;  4P71 A;  2CPY A;  4QOT A;  2HBR B;  2J6U A;  2ATC B;  2YBV A;  2C22 A;  4RX6 A;  3MR6 A;  1VBK A;  2D9P A;  2YY3 A;  1FTR A;  1YIJ S;  4CLT A;  3CCS S;  2NSB A;  3ENW A;  4I56 A;  4ICL B;  1WG4 A;  3TJ9 A;  2NXC A;  5LOQ A;  3RB3 A;  4ANE A;  4JI3 J;  2OSR A;  4UQG A;  2W4P A;  1QUP A;  2OO4 A;  2RQM A;  3OXL A;  4FYW B;  3KTQ A;  4RPF A;  2X7I A;  1NDL A;  1U6Z A;  5LJ3 Y;  5JVH Q;  2YWE A;  1V3Z A;  4UF4 A;  1FD2 A;  2XMK A;  4ZP6 A;  1OQ6 A;  2RSQ A;  4TLQ A;  3JSM B;  1WTF A;  2BEF A;  2EC0 A;  3HVA A;  4NLT A;  1WJ9 A;  4C8N A;  1VQ7 S;  4ZPA A;  3RG6 A;  2XB2 D;  2IM0 A;  4DR5 F;  4XAK A;  4F4Y A;  3MEE B;  1X31 C;  3QFH A;  2J0Q D;  1T9Y A;  1Y0H A;  2CJ9 A;  4LRE A;  4U8Y A;  1RTD A;  3GYX B;  4Y0F A;  1N32 J;  5D8H B;  5KG0 A;  2DGV A;  1HQ2 A;  3NGK A;  4ZIW A;  3KLH B;  1NJZ A;  1RE1 B;  1RI7 A;  4PG7 A;  4DUY J;  5HLF A;  4OHW A;  3TUZ C;  4NZ0 A;  4DCJ B;  5B0B A;  4F50 A;  1WTB A;  1HW9 A;  1HBM B;  1S9E A;  2C2M B;  2DHS A;  2W25 A;  1F9H A;  1FD8 A;  4M5K A;  4C97 A;  5M2P A;  4B3M J;  2ZJR Q;  4DV5 J;  3PV8 A;  1IBL F;  4ELV A;  1M5K C;  3OJU A;  1NK0 A;  2MJN A;  3ISN C;  5B0F A;  4E0D A;  2GC8 A;  5HAO A;  3M2U A;  3OHB A;  2VFS A;  1JX4 A;  2KZM A;  4AND A;  3PYF A;  1SJ4 P;  3TZY A;  4IR9 A;  4DR6 J;  4KHP J;  1S1T A;  4ZCI A;  2HZV A;  3B4M A;  4Y2C A;  4F04 B;  1DBD A;  1SPB P;  1W7W A;  3M6X A;  4EK2 A;  4IRD A;  4BCA A;  1FX2 A;  3MF5 A;  5AJ3 J;  5KFY A;  1HR0 J;  1SC3 B;  2Z0G A;  2GHW A;  3MUV P;  4JI2 J;  1FI4 A;  3QRQ A;  3E01 A;  2ZE2 B;  3CMQ A;  1IKX A;  3D7S B;  4DPT A;  5JJB A;  2WW8 A;  1WEY A;  1RLD A;  2BVZ A;  4IDK A;  2YQ3 A;  4M63 A;  1XEZ A;  2FB0 A;  4KC5 A;  3UDV A;  2HG4 A;  3IC1 A;  1RA6 A;  4PQA A;  2DVI A;  3OFG A;  4RO0 A;  5I3U B;  1MNE A;  4CQ1 A;  4R5P B;  2ZOF A;  1S1V B;  1SUQ B;  2NPI A;  3WX8 A;  4CDI A;  2MQQ A;  5L1K A;  2HND A;  2CZV C;  2YKA A;  4O3S A;  2RQK A;  4ENO A;  3FC9 A;  3D0H E;  4OV6 A;  1AUS L;  2W9A A;  4L3K A;  4DV1 F;  1N56 A;  1H6K X;  2D3O 1;  2GVD A;  2HLT A;  1KR4 A;  3C14 A;  2P2C B;  3GG1 A;  2GQQ A;  4XDD A;  4ZVE A;  5EWF A;  1RU1 A;  3J7Z 5;  2WOM A;  2VOO A;  4RUA A;  5A8R A;  4DR1 F;  1MSW D;  1S97 A;  1FEH A;  3O8W A;  2XGQ A;  2HS0 A;  3O3L A;  5KOX A;  1SJF A;  4N76 A;  2EEY A;  4DV0 F;  4FF3 A;  1A6L A;  2DR7 A;  5CZV A;  1U2F A;  2H54 B;  1YZ6 A;  1MML A;  2VU5 A;  2IVM A;  3F44 A;  2A2D A;  6FDR A;  4PXC A;  2FVP A;  5DLF A;  3P6Y C;  2LYV A;  3A8K A;  2CPF A;  4DQP A;  2IC3 A;  3R2C J;  2E9T A;  1XMQ J;  3CCM S;  2AZ1 A;  2FPH X;  2KI2 A;  3BKU A;  4O4G B;  3SQG B;  5GME A;  5ITH A;  2ROE A;  2UUA J;  3N79 A;  1FRL A;  1YI2 S;  1HI8 A;  1FDN A;  1HNW J;  2MHE A;  1TL4 A;  1SC6 A;  2QE5 A;  2PDA A;  2DRB A;  4LFB F;  5B0C A;  4J9N A;  4XTT A;  5EGY A;  2KN4 A;  4C0H A;  3ETM A;  2Q79 A;  2ZD1 B;  2VPW B;  2UU9 F;  1BD6 A;  3ZZP A;  3PW4 A;  2DIU A;  2B9Y A;  3NEK A;  4TNO A;  1ZM9 A;  1FXR A;  2CJQ A;  4ZP7 A;  1P6T A;  3PW5 A;  2KT3 A;  1XNQ F;  2YKN A;  4A8Q A;  1IR1 A;  2EG2 A;  4KFB B;  4JV0 A;  5DQI A;  1ARO P;  4R5P A;  1HHQ A;  3MM9 B;  3EGV A;  2I8E A;  3LWM A;  1Y11 A;  4RUB A;  1RTI A;  2DGX A;  4RUC A;  2V6A A;  2RD5 C;  1RB0 A;  3R5C A;  3AB4 B;  5KG7 A;  4DSI A;  3RRK A;  4I2Q A;  1YBU A;  2WAQ D;  2XMW A;  5ETK A;  3ELH A;  2FVR A;  2A2C A;  5KFK A;  2YQ1 A;  1T9X A;  1RWO B;  2E5I A;  3OJS A;  2R8G A;  2ZBP A;  2R7V A;  3C6U A;  5EHH A;  2CDR B;  1P27 B;  4WKY A;  3B82 A;  3EXC X;  5LXR A;  1S1U B;  5IT0 A;  2KO1 A;  5D4N A;  3ZZ0 A;  1S4F A;  1KSP A;  1KVJ A;  5LSR A;  1BQX A;  2C1E B;  3MUM P;  3QO9 B;  4X62 F;  2MTL A;  4ECW A;  4BLG A;  5HQM A;  3R27 A;  2GIQ A;  4DBQ A;  3MMA B;  2J0S D;  2R7R A;  2GVZ B;  2QA4 S;  3AXK A;  1XMO F;  1SKS A;  2VG6 B;  3DLK A;  3NP5 A;  4FYY B;  4I2P A;  4Q45 A;  1NDP A;  1AYE A;  1KTQ A;  1R43 A;  4ECV A;  3OUY B;  3HT0 A;  5LMN J;  3CGI A;  4RW8 A;  3MPW A;  3V6D A;  1IVZ A;  4DN0 A;  4J9V A;  4WFX A;  4I0W A;  1UVI A;  4WWS A;  1NBE B;  3JSR A;  3M6W A;  2MQL A;  4ZCM A;  1OSD A;  2F65 A;  4P7T A;  1WUU A;  1VOM A;  2AZ3 A;  3N01 A;  5HBM A;  4NA3 A;  3HSZ A;  3FFI B;  4OZL A;  2RDD A;  3AQO A;  4J5O A;  3DM2 A;  4HT7 A;  1R31 A;  4WE1 B;  5CYQ A;  3UVJ B;  4EO8 A;  3TZW A;  4DV6 F;  1EQM A;  2HZA A;  1VRU A;  4DHV A;  5IFM A;  4MAK A;  3CJK A;  1UVM A;  5KOW A;  2IRY A;  1C1B A;  1VR6 A;  1WC6 A;  5CD4 A;  1GNK A;  2XHW A;  3DLG A;  3PHE A;  4M5J A;  4LQ3 A;  4G6V B;  3DXS X;  1QE1 A;  1PJ7 A;  2Y8Y A;  3R9L A;  2A18 A;  4GMK A;  1TL3 B;  4USU A;  4X4P A;  4QWA A;  1TEL A;  2W9B A;  4PXB A;  1FDA A;  1FKP A;  3HHL B;  5L46 A;  5KFR A;  3G82 A;  2IRX A;  1U02 A;  3PYD A;  1RT1 A;  4HLB A;  4WP8 A;  2ZH6 A;  1U24 A;  1RWP B;  1IKV A;  3I32 A;  3CC4 S;  1TKX A;  2H9Z A;  1F3V A;  2CJY B;  4DQQ A;  1U2R A;  4JYA F;  2M3D A;  2YKM A;  2ZIT A;  2Y1J A;  1X5S A;  3CJR A;  2VON A;  2B5J B;  4DR1 J;  4LJM A;  1TL5 A;  3UNG C;  3H4D A;  3LTO A;  4RU2 A;  3L09 A;  3JQM A;  4ZLP A;  3J80 U;  1VBZ A;  2R3V A;  1X5T A;  3CO9 A;  5KFD A;  2ZJP Q;  3BQ1 A;  3CUL A;  4GVB B;  2G1H A;  3TZZ A;  2DRA A;  4S0M A;  4E98 A;  5FDL B;  1X5P A;  2OIH A;  3P96 A;  3GFZ A;  2VKR A;  2OJ3 A;  3KHG A;  1EET A;  1KLM A;  1JKH B;  1I5O B;  2H4W B;  2YNI B;  2C3O A;  1M5P C;  4NCG A;  3KLG B;  1OPI A;  1YJ9 S;  5F8J A;  4C9D A;  3ETO A;  2VG6 A;  3DLK B;  1UVN A;  3DOM B;  2CKW A;  4LFB J;  3PNI A;  3CCT A;  3SEO A;  3DRP A;  1VQ4 S;  1QD1 A;  4P2F A;  2XG8 A;  3NGR A;  1T05 A;  2D7S A;  1N6Q A;  1S10 A;  5KFH A;  1LNQ A;  3PCO B;  4NXM F;  2V2Z A;  2HGN A;  1BGX T;  2JZ5 A;  5T14 A;  4B9N A;  4OI3 A;  3MCN A;  5KFZ A;  2ZWP A;  4QR0 A;  5IT9 Y;  4UY8 5;  1XNQ J;  2M2B A;  1QY7 A;  2VKZ G;  3W63 A;  2Y9H A;  1Y7P A;  2R7S A;  3FEX B;  3UDE A;  2GHV C;  2FLO A;  3LAL A;  4DF8 A;  4LF6 J;  2GGP A;  3PM9 A;  2W4D A;  3G6Y A;  2YKO A;  3DDI A;  4K5R A;  1S9F A;  1W2B R;  3JTP A;  4FN5 A;  2ZDP A;  4LF1 A;  3F41 A;  1N5Q A;  1XIQ A;  3MAQ A;  4HH1 A;  2XZD B;  4CTA A;  2HVE A;  2QLW A;  3M1V B;  1NZ8 A;  1U0S A;  5GAH I;  4WK3 A;  5KT2 A;  2FLN A;  2KH9 A;  3PW2 A;  1S76 D;  2WSE C;  1B7F A;  2DNG A;  2OPQ A;  4M5N A;  4ID5 B;  2RIL A;  1DTQ B;  2Y8W A;  1FHT A;  3I87 A;  2ZDO A;  3M32 B;  5A6P A;  3T5L A;  2JDJ A;  3CXC R;  2RHS B;  3G6V A;  4M5H A;  4TYA A;  2G1D A;  2AIR B;  4X62 J;  3FQK A;  2W01 A;  2V34 A;  3FVY A;  1NSP A;  3F0N A;  1NK4 A;  2B7C B;  2HWH A;  2MKK A;  3KUG A;  1FRH A;  1VRQ C;  2BJ1 A;  1MN9 A;  2PE8 A;  2G13 A;  2CQ0 A;  4W90 B;  2XI2 A;  1LQ9 A;  3P45 B;  4KKO B;  3IG1 B;  3MEC A;  3S1T A;  1MWY A;  1T9W A;  2XHC A;  4USI A;  5CA5 A;  1IBM J;  2HGL A;  1PGZ A;  4KJI A;  3S7R A;  1JJ2 R;  4OI0 A;  1DY3 A;  3M9N B;  4LFC F;  4J90 A;  3X1L B;  1RT5 B;  3R5D A;  1AZS B;  4AUK A;  4CLF A;  2PGC A;  2DB1 A;  1RHK B;  1BQN A;  4ANC A;  1U47 A;  3WBZ A;  2PA8 D;  1C0U B;  1RWX B;  3GR1 A;  1FFW B;  4DR4 F;  1HWJ A;  2EW9 A;  2V4J A;  1PSD A;  4MFB A;  3KNA A;  4LIR A;  3AJ2 A;  4DI6 A;  1DAX A;  3NAI A;  1D0E A;  2NYI A;  2ZH2 A;  3CJS A;  4AXJ A;  2HPU A;  3EPG A;  1X9W A;  1F5B A;  1ZBT A;  4MKA A;  3BSA A;  5AT1 B;  3EUN A;  1AXQ A;  4HTJ A;  3BJY A;  5IM0 B;  4DQI A;  1HNW F;  3SDE B;  4C3K A;  4QPX A;  4ZLJ A;  2V8H A;  5EWE A;  3OL6 A;  3ZNU A;  3OV7 A;  2B3T B;  4EMD A;  3CUN A;  2COL A;  4DSL A;  1V6H A;  3KMQ A;  3AY0 A;  4ZVU B;  2VV5 A;  2AT1 B;  2G2Z A;  3CE8 A;  4NLW A;  5SUH A;  3QLH A;  2X3D A;  1M5H A;  2DXD A;  3DRX A;  4X4N A;  3I4P A;  5K8P A;  2QMU B;  1FNX H;  1WC4 A;  2D74 B;  3JB9 k;  5FLX U;  2KM8 B;  3MPU B;  4YR3 A;  4O3O A;  4ZVP B;  1YRU A;  4OI2 A;  4EU0 A;  1HI0 P;  1QSL A;  1B99 A;  4J91 A;  2XYG B;  1PAE X;  2YPZ A;  2UXB J;  1JJC B;  2VFT A;  2ZD1 A;  1WF0 A;  2BE2 B;  3BKF A;  2K8G A;  5BYR A;  3GYG A;  4FKY A;  3J7Y I;  4DL5 A;  1JK9 B;  3OR1 B;  5IOL A;  4YEA A;  3BGO P;  3OSP A;  3FJ2 A;  4H4O B;  1TUW A;  2H5I B;  3FCW A;  4MJK A;  4O4G A;  4TN2 A;  1HFE L;  3TO8 A;  2QFI A;  5H9E J;  1Q8K A;  1Z1Z A;  3DYA B;  3PRD A;  3S8S A;  1YDL A;  2M70 A;  4DV5 F;  4NXN F;  3OT9 A;  3D3B J;  1HNZ J;  5C2C A;  4V19 X;  5CYM B;  2CFX A;  1RWM B;  2Z57 B;  3UR3 C;  3M05 A;  4X65 J;  3GP9 A;  4CCH A;  1UFK A;  1VQ6 S;  4MMO A;  2Z4P A;  2QMW A;  2GA7 A;  2EC2 A;  2D1C A;  4ZCL A;  1YRX A;  2ZUA A;  1KD1 T;  1HYS B;  1JLA B;  3QT7 A;  1J5E J;  4HDH A;  3OFF A;  1TZ0 A;  4RWX A;  4KE5 A;  2RKI A;  2H51 B;  3L4B C;  3V6J A;  1SL1 A;  1VQN S;  4KPY A;  2E9Z A;  2ZOM A;  5D77 A;  3MM6 A;  2KXN B;  3EIC A;  1EAR A;  3EM1 A;  4QCL A;  2DXE A;  1KHV A;  5HJY A;  3FMW A;  3OTD A;  3DOL A;  1SUQ A;  2UXD J;  3T5K A;  1L3U A;  2DH7 A;  1S79 A;  4CZC A;  4KPC A;  2XYP B;  2HVD A;  3H4B A;  3NCQ A;  1OYD A;  2I5J B;  3Q86 A;  4J9L A;  3PX4 A;  4M5I A;  3R8Y A;  2HMI A;  4HHH A;  1N5T A;  5KT7 A;  4KGK A;  3SV3 A;  2MY8 A;  2HHV A;  5KT3 A;  4NRT A;  4NE9 C;  1ZTT A;  1LWE A;  2NXJ A;  1TFW A;  2AEM A;  1EZZ B;  3KFW X;  3NMA A;  2P6S A;  2QT7 A;  3QAU A;  3QT8 A;  1CEZ A;  3HHE A;  2J9D A;  2DPI A;  4NZ7 A;  1LEO A;  3THP A;  3DLL Q;  3SCK E;  3RR7 A;  4FF4 A;  3ZO7 A;  1H2U X;  3ILJ A;  1RT4 B;  4AL5 A;  2Q43 A;  3UR0 A;  5KG6 A;  3A8I A;  5L9N A;  3CCU S;  3AT1 B;  1G7C B;  3RB0 A;  2JVO A;  5D3G B;  4UOH A;  1CVJ A;  2WB1 D;  4U7C A;  5B0E A;  3UDL A;  3OTO F;  1OSC A;  3HJF A;  1K0T A;  3DRS A;  2HNY B;  1NHK L;  2HZC A;  1AZS A;  5M2R A;  4F7V A;  3H8Y A;  4LFA F;  1YIT S;  3O2I A;  1EQ0 A;  1U0H B;  3W8P A;  1N36 J;  4QIF A;  3H25 A;  3IS9 B;  1C2P A;  3T5J A;  1WI8 A;  2DNK A;  2OKQ A;  4BC7 A;  2GO9 A;  3BDE A;  3RB4 A;  3EZO A;  4U9R A;  5J2N A;  2QLB B;  2Y3Y A;  1LW2 A;  1FE4 A;  1QAY A;  1RTJ B;  2NPF A;  4ZN1 A;  2C2Z B;  1CJV A;  1K8A T;  5EX0 A;  1KNZ A;  1RWK B;  1NPR A;  2YKM B;  4L75 A;  5DRK A;  3PIP Q;  2H48 B;  2LU2 A;  2ZBQ A;  2O1P A;  2V63 A;  3KDN A;  3PFO A;  4I4B A;  2C42 A;  4K59 A;  4DPO A;  3HZE A;  4PWW A;  1HNI B;  1KKH A;  4WP9 A;  5EWG A;  1VC0 A;  5K8O A;  4OX9 F;  1NH7 A;  5K20 B;  2GQ2 A;  3HX9 A;  3GQC A;  2IVF B;  4RW7 B;  2ZKT A;  2B8Q A;  3CD5 A;  3D5M A;  4U95 A;  4ZIT A;  3PKM A;  3M32 A;  4HVZ A;  4TU7 A;  2B0G A;  3MPV A;  4F8R A;  4IFY A;  3A3P B;  4F67 A;  4ED5 A;  2HWT A;  2PEB A;  1UFL A;  2GJF A;  4NA2 A;  2KVI A;  4ZLL A;  5J2Q B;  3RAQ A;  1Z4U A;  4AQY J;  3PO5 A;  1G2E A;  4EFA C;  3Q8Y A;  1NDK A;  3D0G E;  3MMC B;  1QE1 B;  3W5Z A;  4CTA B;  1RLC L;  1FRK A;  2QLX A;  4F26 A;  3ISZ A;  4M1K A;  1T7P A;  1TK8 A;  4LSZ B;  3M6V A;  2UUC J;  1DTT B;  3D67 A;  2KG0 A;  1WOO A;  3ZZZ A;  1PKU A;  1RT5 A;  4ECX A;  2QFJ A;  1KFS A;  4KGX B;  1T3O A;  2EFN A;  4OI4 A;  3PR5 B;  1S9G B;  2XLK A;  1U4B A;  4K4U A;  3I5A A;  3VAM A;  2QSF A;  3C66 A;  1R0C B;  4QWC A;  2J76 E;  2DNM A;  1VIS A;  4DV4 F;  2EWH A;  2CQG A;  2XSJ A;  2UZA A;  3DHW C;  4B3S J;  2VPZ B;  2V4Q A;  2C2N A;  3SBM A;  1X4G A;  1NHU A;  1NH8 A;  2G0J A;  1VQO S;  5EX3 A;  1RBA A;  2V9W A;  1U8S A;  4LBH A;  3UCG A;  3Q8R B;  3BBF A;  5KFQ A;  1VQL S;  4P75 A;  3G6X A;  4CM2 A;  3VZI A;  4YY3 F;  3T3F A;  5D0E A;  2FYX A;  3ZTP A;  1IM6 A;  1NHV A;  3R5J B;  1NK6 A;  3A12 A;  2DO0 A;  1WKL A;  2K1R B;  3HI9 A;  3KNG A;  3LP2 A;  5JMN A;  2WON A;  2IM1 A;  1F2H A;  4DR3 F;  1G6B A;  1BE4 A;  2ZZN A;  3MZI A;  4CM0 A;  4Q0B B;  1SKW A;  2B4O A;  4NEY A;  2IDE A;  2BW2 A;  5L1I A;  2E1R A;  3KJQ B;  4Z37 A;  5I3U A;  3FBB A;  2ZOG A;  3KLF B;  3CMA S;  4USW A;  4LUB A;  1QSY A;  2KT2 A;  3CW2 C;  3VAF A;  2ZBC A;  1F5C A;  5U47 A;  3U27 A;  1EHW A;  3QMQ A;  3BR9 A;  2EPI A;  3IRW P;  1CBK A;  1C4A A;  2MMY A;  2V5H G;  4C6A A;  4DV7 F;  3VGS A;  3U1N A;  5A2Q U;  4H4M A;  3MDF A;  3K8V A;  3JSB A;  3F56 A;  3HJV A;  3A3N B;  4RW9 A;  4GVL A;  4OX6 A;  1VI7 A;  2KJV A;  1Y5L B;  7FD1 A;  2G0I A;  1VCT A;  4WJB A;  4J9O A;  3VCD A;  1KS2 A;  1YJ7 A;  3D6T B;  5ETO A;  3D3C J;  5LMU F;  3LAK A;  1VK8 A;  3FBC A;  4A8F A;  2I1R A;  2QGF B;  4OX7 A;  4OJG A;  2EVZ A;  2O3D A;  1Q8I A;  1TTH B;  3VGU A;  3B54 A;  4AE5 A;  3HVW A;  3HP6 A;  3N6M A;  4DCP B;  3RU0 A;  5BR8 J;  1GMV A;  2EFG A;  4EZ6 A;  2LEA A;  3PRV A;  2Y1R I;  2OP5 A;  4UOC A;  4HHJ A;  2IJR A;  5DQG A;  3KG4 A;  4PQU A;  5FDL A;  4FYD A;  2QMX A;  2EFO A;  3NOG A;  4GVB A;  1NUE A;  3M6U A;  4TY8 B;  4QWE A;  1RAI B;  1FWK A;  2ZHA A;  4U7U K;  4PWD B;  3FK4 A;  3W2W A;  1DLO A;  1HLW A;  3VAH A;  3HCX A;  4BDP A;  2AJ1 A;  2PEH A;  1RT7 A;  1U1K A;  5FJ4 A;  2GMH A;  5G0R B;  1BLU A;  2QEX S;  2CRL A;  3DI6 B;  1VHF A;  4GO5 X;  4F4Z A;  3HFK A;  1RHU B;  1T94 A;  5F8G A;  2ADB A;  1NK8 A;  5F41 A;  2AU0 A;  3OPK A;  3MR2 A;  2FVQ A;  2BAN B;  5KFA A;  2HS3 A;  3R5B A;  4C8M A;  1F1B B;  1B0P A;  3IGN A;  4PWU A;  2YXL A;  3AOA A;  3KLV A;  4J9M A;  4JOU A;  1KTV A;  3G2X A;  2OH2 A;  3G87 A;  1I1G A;  4LF6 F;  4WII A;  3QBC A;  3DFE A;  5L1L A;  1T95 A;  1A9N B;  1C4C A;  3G8Q A;  1ZM4 A;  2AJ2 A;  4JI5 F;  3GIL A;  1CJU B;  1FES A;  3R5G A;  5J1N A;  2IM3 A;  1UWB B;  4DSF A;  1RYR A;  4RW4 A;  1JNZ B;  1REG X;  1TMM A;  1VJW A;  2CPD A;  3QSI A;  3NRB A;  4YHH F;  3X3U A;  1SJQ A;  3K7R A;  3Q8P B;  4LF7 J;  1YZ7 A;  3IAM 9;  4CH1 A;  4JI8 J;  4M95 A;  1QLN A;  3HKW A;  2FVS A;  5C25 A;  3LGN A;  3R7B B;  2I0X A;  2V69 A;  2VC0 A;  2VG5 A;  3ENQ A;  5JXS A;  4UZB A;  3UWT A;  1LFW A;  4PR6 A;  3NLC A;  3I9V 9;  4N47 A;  1FNM A;  4CIO A;  4J9R A;  3ILL A;  4P2M A;  1TMJ A;  2HRU A;  1KQK A;  1RAG B;  1SIW B;  2MZJ A;  2NQP A;  1HBU A;  2CWK A;  5GAE U;  2B8P A;  1RA7 A;  1HNV B;  3QID A;  3G96 A;  2ZBR A;  2B9X A;  2N7Y A;  2E5G A;  4EZ9 A;  3RBZ A;  3W66 A;  3BYR A;  3CJ0 A;  3IWX A;  1RWN B;  2F3J A;  2FJE B;  1YJT A;  2OTL S;  1PC5 A;  2VPY B;  4CO1 A;  4U96 A;  2CQB A;  1CLF A;  4Y00 A;  4LMZ A;  1P1T A;  2LQJ A;  4L76 A;  1SV5 B;  3BGU A;  1L5U A;  2R7X A;  1AW0 A;  3CJT A;  1TV6 B;  2QA4 G;  2FGO A;  2GVZ A;  5CCL A;  3T1H F;  3DU5 A;  1H98 A;  4G1P A;  1M5O C;  2UXC F;  2AX0 A;  1XR7 A;  2F8M A;  1RTH A;  2MYF A;  3H42 A;  1NB2 A;  2FGC A;  2QN6 B;  3OLA A;  4EBC A;  3ZZR A;  4B9U A;  4LSN B;  2ROG A;  3EE3 A;  5D0R A;  4A46 A;  2XWY A;  4WFZ A;  1X4C A;  2FVC A;  3O5T B;  5CZX A;  4LF5 F;  1DFD A;  1FRM A;  2ABY A;  2FC9 A;  4WXW A;  4A8X A;  4NLR A;  1S4E A;  2CAJ A;  1N33 J;  2J9E A;  1FVS A;  1RAE B;  2E7X A;  3M8P B;  1Y00 A;  4KQZ A;  3QRP A;  2IM2 A;  1WC0 A;  4DUZ F;  4K4V A;  5DO2 A;  4HR2 A;  5C42 A;  4P72 A;  4ICL A;  3MR7 A;  1A0O B;  1F3F A;  2GVD B;  4QU7 A;  3TAQ A;  3LUY A;  1X8D A;  1B7Y B;  1RUS A;  3MMC A;  5HMY A;  2HMI B;  3QZ7 A;  3BO3 A;  4JV5 F;  4G1I A;  2BUN A;  2CJA A;  3W7B A;  2HBZ B;  1FTC A;  4NL5 A;  2BM0 A;  5EN1 A;  3TZX A;  2JEG A;  2XS2 A;  2DH9 A;  3M8R A;  3QAT A;  3KHR A;  1KQG B;  3KKF A;  4UOF A;  2JLG A;  1VQP S;  1UJ5 A;  3ET6 B;  2MEW A;  5SZT A;  3DOK B;  3QQC D;  2IDL A;  3E3X A;  2VAS A;  3GB0 A;  2VFV A;  3NAH A;  2DNQ A;  1HQE A;  3ONQ A;  3V2U C;  1GMU A;  3LP1 B;  2BR0 A;  2K3I A;  2OD6 A;  4NLU A;  1ZET A;  2RQC A;  2RH3 A;  4D3G A;  4F02 A;  1SIZ A;  3MAH A;  4P10 A;  4KYZ A;  4K50 A;  2GO8 A;  3JXO A;  1Y3J A;  4NML A;  3T6B A;  4QU6 A;  1IKY B;  4ECS A;  4DS5 A;  2KFZ A;  4FS2 A;  1WD6 A;  2RUS A;  4C11 A;  1M1H A;  1HWK A;  2HHP A;  4NYZ A;  4USM A;  2B6A B;  2VZ9 A;  3N5B A;  4C8Z A;  3AOD A;  4HI1 A;  1FE0 A;  1EET B;  3TAN A;  5KFI A;  1IR2 A;  1OWX A;  2PO4 A;  2H65 B;  2XMU A;  1GMW D;  3MEG A;  4CH7 A;  4G1Q A;  2MZS A;  3OVS A;  2LKZ A;  4GKJ J;  1KEK A;  1GMW A;  2VDI A;  3CIM A;  2MKY A;  1UW4 A;  3P5B P;  3CPW R;  4UUW A;  1NJW A;  4JB8 B;  4ZHR A;  3PKY A;  3MM5 B;  4A8S A;  5DG7 A;  1SBR A;  4IDK B;  2HBQ B;  2ZH3 A;  4ECU A;  1UA0 A;  3MXH P;  2UUW A;  5IQQ A;  1RKJ A;  2YNG B;  2ZHO A;  4PXD A;  4DV2 F;  5IV3 A;  3FDS A;  2HHT A;  4LF7 F;  3TJA A;  3KLI A;  3CB4 A;  3EMT A;  2XMA A;  4DPY A;  5E33 A;  5HI7 A;  1WWH A;  4OJH A;  5A76 A;  2RML A;  1TKZ A;  4QW8 A;  4X4S A;  2CG4 A;  2H5J B;  2YNH B;  1T03 B;  3VAJ A;  1H7W A;  1S1T B;  2PA3 A;  5IC4 B;  1VYA A;  2HQC A;  1RAH B;  2NXU A;  4C0B A;  5DG9 A;  2VIH A;  4HYK A;  2RE1 A;  4RWW A;  2EK6 A;  3H7H B;  3CDA A;  1F9E B;  5CAA A;  1Z2L A;  4YFU A;  3J7Y U;  1ROF A;  2IAJ A;  4UTG A;  3SSQ A;  3FQL A;  1WHX A;  2LXI A;  2K1R A;  4I6W A;  3CC2 S;  2XWX A;  3HUL A;  1HBM A;  1ULR A;  5F3Z A;  3EGW B;  4NLS A;  2ZH7 A;  1SC4 B;  4ER8 A;  4DQR A;  1KLM B;  2SXL A;  1WHW A;  2KG1 A;  1C1B B;  3C6T A;  4NI2 B;  4WTY A;  1K1S A;  1N34 F;  4L73 A;  3M2R A;  3MM7 A;  1HD1 A;  1OS5 A;  5MAO A;  2IMO A;  1Q53 A;  1KHW A;  2VDH A;  4M94 A;  1CJK B;  1PJ6 A;  5J2P B;  1N5V A;  1UWA A;  4ZPW R;  2FDN A;  3F73 A;  4OYM A;  4QW9 A;  2VIC A;  5KFL A;  1KN6 A;  1X4D A;  2DGO A;  3AD8 C;  5HL7 Q;  3LW5 C;  3OL8 A;  3VZH A;  3DLE B;  3EYZ A;  2BJD A;  4ELT A;  5A6W A;  5CYJ A;  4QYZ K;  1KON A;  4KHP F;  2VD3 A;  4B9L A;  9ATC B;  5DDR C;  4O3R A;  1R8H A;  4N77 A;  4LF5 J;  1AFJ A;  2KYX A;  3TQ1 A;  4RR5 A;  4HEA 9;  3SCJ E;  5L8R C;  1WOP A; 
#chains in the Genus database with same CATH homology
 1HHQ A;  3EM1 A;  2DXE A;  3FBB A;  3ZTO A;  3DDI A;  4WBF A;  3EVM A;  4KPC A;  4HR2 A;  2HVD A;  1EHW A;  1F3F A;  1XIQ A;  2HVE A;  3Q8V A;  3ELH A;  3Q86 A;  1UCN A;  3PJ9 A;  3JS9 A;  4C6A A;  4ANE A;  1NCL A;  3VGS A;  1NDL A;  1S57 A;  3Q8U A;  4UOF A;  2BEF A;  4F36 A;  4O0N A;  1LEO A;  3Q89 A;  1BHN A;  1NSP A;  3ENA A;  3FBC A;  3ZTR A;  4F4A A;  1MN9 A;  1WKJ A;  3VGU A;  1NDP A;  3B54 A;  3EVO A;  3FBF A;  3DKD A;  4UOH A;  2NCK L;  3FCV A;  3PRV A;  3GPA A;  1HIY A;  1S5Z A;  1NUE A;  3NGT A;  4FKX A;  1NHK L;  1WKK A;  2AZ3 A;  1HLW A;  2BX6 A;  3B6B A;  4ANC A;  1K44 A;  1KDN A;  3FKB A;  4AND A;  3ZTQ A;  4W98 A;  1NLK L;  3ZTS A;  1JXV A;  1S59 A;  1NSK L;  1W7W A;  3BBC A;  4DI6 A;  4EK2 A;  3R9L A;  3G2X A;  3MPD A;  3L7U A;  1ZS6 A;  3BH7 B;  3Q83 A;  2HUR A;  4UOG A;  3EVW A;  2B8Q A;  1MN7 A;  5CAB A;  3EMT A;  3VVT A;  4DUT A;  3VGV A;  3VVU A;  3WX8 A;  4ENO A;  2DXD A;  3FC9 A;  3Q8Y A;  1NDK A;  1VYA A;  2DY9 A;  5CAA A;  1B99 A;  1PAE X;  1PKU A;  3NGS A;  1BUX A;  2CWK A;  2B8P A;  1F6T A;  4FKY A;  4S0M A;  5BXI A;  5IOL A;  2VU5 A;  3NGU A;  3FCW A;  4CP5 A;  2DXF A;  3VGT A;  1U8W A;  1NSQ A;  2AZ1 A;  4DZ6 A;  1XQI A;  1NDC A;  3BBF A;  3BBB A;  1B4S A;  3GP9 A;  3NGR A;  3ZTP A;  3BH6 B;  3FBE A;  3ETM A;  1NB2 A;  5C7P A;  2ZUA A;  1WKL A;  2DYA A;  3EJM A;  1NPK A;  3EE3 A;  1BE4 A;  1LWX A;  3EIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...