1HMRA

1.4 angstroms structural studies on human muscle fatty acid binding protein: binding interactions with three saturated and unsaturated c18 fatty acids
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
131
structure length
131
Chain Sequence
b'VDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUSCLE FATTY ACID BINDING PROTEIN
publication title Structural studies on human muscle fatty acid binding protein at 1.4 A resolution: binding interactions with three C18 fatty acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lipid binding protein
total genus 32
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 1994-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 1hmrA00
4XMEA 4HPCA 3STMX 3P6CA 1JV4A 3QKGA 3FA9A 3F9DA 3C78X 5H9AA 4QGWA 3P6EA 3TGBA 5EDBA 4M6SA 4A1HA 5HCEC 3FA8A 4DQ4A 2L9CA 4ORSA 1OPBA 4ARHA 5HZ6A 4NYRA 1TW4A 3TGCA 1TOWA 1QY2A 5DPQA 2X46A 5EEDA 1QABE 2ACPX 3CWKA 3FEPA 3C76X 3S26A 1KZXA 3ZUIA 3D95A 4YDAA 4YCEA 3STKA 4XMFA 1ZNGA 1TXLA 2RCQA 3FR5A 4ORUA 5D48A 1MVGA 3NR3A 4ZHDA 1BSYA 1E5PA 2RA6A 2MM3A 4XMCA 4EXZA 4ZH9A 1I4UA 1ML7A 1FELA 5KICA 4QYPA 2WSJA 1EPBA 1SXWA 4IB9A 2WUTA 3RSWA 1A2DA 1DFVA 4TLJA 4ZHGA 1JYDA 2CZTA 3P6DA 2R73A 4OMWA 1JJXA 1IKJA 2F73A 1QY1A 1U17A 1LKEA 1CRBA 1RBPA 3KFIA 5EEEA 3FMZA 4HPDA 4ALOA 2JU7A 4EDEA 1SY0A 5HBSA 5HA0A 2LFOA 1BBPA 2G7BA 4KIIA 5H9LA 1ERXA 1CBIA 1AVGI 1HN2A 1LNMA 5L8IA 4AZMA 1G74A 1YP6A 1DC9A 1HMRA 5CE4A 4GNWA 4OS0A 5BVTA 5LJKA 2NNDA 4OS3A 1DV9A 1BM5A 1QFTA 2W2FA 2LBVA 5DG4A 4I3BA 5EPQA 1MX7A 1LICA 3WJFA 2L67A 2AT3X 4ALBA 3P6HA 2A2GA 5HZ5A 1OBPA 1TOUA 3L4RA 5H8TA 5KIDA 3D96A 2FT9A 3F8AA 3KQ0A 3KFGA 4ZH6A 3APUA 4D6AA 4N7DA 1QG5A 3O22A 3VG3A 3WVMA 5LJBA 4YDBA 4TQ2A 1BLRA 3WJCA 1KGLA 3FW4A 1N0SA 2FRSA 3PH6A 1CBSA 1DZKA 2R56A 3BY0A 4K19A 4LKTA 1ZNEA 2R74A 2HZQA 1OEKA 1LIDA 3FEKA 2A13A 5EDCA 3ZQ3A 3FA7A 2GTFX 3EM0A 2OVEA 5F7GA 2WR6A 1PMPA 2QOSC 5FAZA 3TF6A 2EU7X 2IFBA 5D47A 3K3LA 1BSOA 2AKQA 3WXQA 2P8GA 2CM4A 3JSQA 1G7NA 4IMOA 4NNSA 2O62A 4I9SA 5LKFA 3DTQA 3WJDA 3CR6A 3UEVA 1NGLA 1JJJA 4IB8A 1KT5A 1A3YA 2G79A 2X45A 3UEUA 4ZJ0A 3WJGA 3U0DA 4EFGA 2QO4A 1ICMA 2AT0X 5HAEA 1E00A 1ADLA 4LKPA 4XMHA 3B2IA 3CBSA 1Z24A 4NLIA 5D45A 4RUNA 4YMYA 3PECA 1ZNKA 1LIFA 4GETA 2HMBA 1H91A 1O1UA 2LBAA 3VG4A 4ZFXA 5HZ8A 3U03A 4QGXA 3FIQA 5IO7A 3OJYC 2HNXA 1GXAA 1HBPA 1LIBA 4QAEA 1EXSA 1EUOA 2WEWA 4ZR2A 1ALBA 1TVQA 5HWZA 4IBAA 4A8ZA 2CBSA 1QQSA 1P6PA 3NQ9A 4YKOA 3BRNA 1X71A 1X8OA 2ACOA 4GE1A 1HMTA 3IFBA 2OZQA 4HPAA 1I05A 4YH0A 2FR2A 3BX8A 3CBCA 1HMSA 1X8NA 2CM9A 1E06A 4HFOA 2AT8X 2RQ0A 2KTDA 2MO5A 3NX2A 1L6MA 5F6BA 3HWDA 1KQWA 1BEBA 1R0UA 4XMGA 5BVQA 3WJEA 2BLGA 3HWFA 5LJCA 2XKLA 5H9NA 4CK4A 3BU9A 1OBQA 4NP1A 3VG2A 1KT6A 1VYFA 3NQ3A 1JBHA 1GX8A 4Y0SA 1B56A 4AYHA 3VG6A 1SA8A 3FW5A 1IFCA 1CBQA 4IB7A 4LZVA 4AZOA 1ZNLA 4A1YA 3FR2A 4YFRA 4OMXA 4N7CA 2ASNX 2W2AA 2W2BA 1KT3A 3BSZE 4ZCBA 1OBUA 4GKCA 1O8VA 3WBGA 4BOEA 4IB6A 4NNTA 2QO6A 2MJIA 3KZAA 2HLVA 3BS2A 4QZTA 1QWDA 1XKIA 3B2JA 3Q6LA 5FENA 1PM1X 3C77X 2OFRX 3NADA 2Q2PA 1SXYA 1EQDA 3AKMA 4WFVA 1S44A 1ZNDA 4Y0QA 3EMMA 2A0AA 2WQ9A 1VYGA 5HTDA 3FELA 1LPJA 5EZ2A 3U9PC 1UZ2X 3FLLA 2AT5X 1EW3A 1ACDA 2NP1A 3RZYA 4YBPA 3MBTA 1B8EA 4AZNA 4UU2A 5KHPA 2KT4B 2E4JA 1SXXA 2JU8A 2NNEA 5HZQA 2A2UA 4AW8A 3EBKA 1I04A 1OEEA 1T0VA 5F1EA 3UEXA 3KFFA 3VG7A 4ORXA 3IA8A 4I3DA 2AL0X 1FENA 1IKEA 1YP7A 3HWGA 4MVIA 5K06A 4UU3A 1FTPA 2JOZA 2PY1A 1ZRYA 4I3CA 1FDQA 3JS1A 4AZRA 2JU3A 2NNQA 4AZQA 4MVLA 1LIEA 3D97A 2POAA 1D3SA 4BVMA 2AH7X 1NP4A 1BSQA 4DQ3A 3EBWA 1LFOA 1ERBA 5C0NA 4M7MA 1B0OA 1AB0A 1SY2A 1SY3A 3AKNA 1E02A 3G7XA 5IO6A 1X89A 1D2UA 2FR3A 3WJBA 1EIIA 4R0BA 1YWAA 2OVAA 4GRJA 1ICNA 4QYNA 4YBUA 1B4MA 4YKMA 1KQXA 1QFVA 2G78A 3BDRA 1T68X 1GGLA 1QY0A 1A18A 2QO5A 1FE3A 2HYSA 3PP6A 1RLBE 3B2KA 5HTEA 2ALLX 4ORWA 1EPAA 5L8OA 1ZNHA 2WWPA 3NP1A 5HZ9A 2QM9A 3B2HA 1MDCA 2FWVA 4QZUA 4TKJA 3VG5A 3O19A 2CBRA 1VPRA 5BVSA 3TZSA 2HZRA 2Q9SA 1KZWA 4ZGUA 5HCDC 4LZUA 5LKEA 4GH7A 2DM5A 4ZHCA 1JYJA 5LJEA 2Q39A 4ORRA 2L5PA 4BQUA 4ES7A 5HA1A 1GKAA 4IMNA 5B29A 5LJHA 1HQPA 3MVFA 1IIUA 1SXUA 1U0XA 1KT4A 3KFHA 5H9KA 4ORYA 1A57A 2OVDA 3ELXA 4YGGA 4D6BA 1S7DA 1EALA 1AQBA 3PEDA 2JN3A 1S2PA 5IO5A 4IAXA 2LB6A 4A60A 3CQRA 3HK1A 4XMDA 2GJ5A 1PEEA 5JR8A 1X8PA 4EEJA 3PH5A 2Q4NA 3BX7A 4HPBA 1YWCA 2CZUA 2FS7A 1JZUA 3DSZA 4ODDA 4Y0PA 3NPOA 1KT7A 1G85A 1LF7A 4I9RA 1BRPA 2WEXA 1PBOA 1SY1A 2Q2MA 3CMPA 1G5WA 3ELZA 1YWDA 3P6FA 1OEJA 2K62A 2L68A 1X8UA 2FTBA 3PPTA 1EIOA 1IFBA 3I17A 4AZPA 1CBRA 1BWYA 1BJ7A 3SAOA 4GNYA 3APXA 5LJDA 1MX8A 4YFPA 1I06A 2WQAE 5F6ZA 1DZMA 4WBKA 3T1DA 3BLGA 4MVKA 2N93A 1YIVA 5B27A 3P6GA 4RUUA 1FEMA 1GT3A 5HCCC 4TJZA 4NYQA 5F58A 1U18A 4YGHA 1BRQA 5AQ6A 1GM6A 1YUPA 3TGAA 1KXOA 3NX1A 1GX9A 4YGZA 3FENA 3B2LA 1DZPA 5D8JA 3GAQA 4YFQA 2RD7C 3FR4A 1GKAB 2AT6X 4ZHHA 2K23A 1GT4A 1CJ5A 2AMMX 3CQNA 4Y0RA 2XSTA 3APVA 4O9SA 2FS6A 4OS8A 1HBQA 2LKKA 4TKHA 3I0AA 2OFMX 3BU1A 4TNNA 1DF3A 1YWBA 4TKBA 3HWEA 4IAWA 1AELA 3UEWA 4ZHFA 4PSQA 2YG2A 2GC9A 1X8QA 2FLJA 3APWA 2A3FX 4WFUA 3STNA 1T8VA 4NLJA 2RCTA 1DZJA 5D4AA 4QGVA 5L8NA 3FA6A 3O2YA 1UREA 5FFHA 1XCAA 1KOIA 3ZUOA 2ANSA 3EYCA 4YCHA 1MUPA 1GT1A 1IW2A 1GT5A 1O1VA 5LJGA 1NP1A 1OPAA
chains in the Genus database with same CATH superfamily
2BS6A 3RE5A 4XMEA 4HPCA 3STMX 2RTGB 2WPUA 2MHDA 3P6CA 1JV4A 3QKGA 3FA9A 4QQ1A 3F9DA 4CDFA 3C78X 5H9AA 1KL5A 1NQMA 1JMZA 2IZCB 4QGWA 3P6EA 4ZHHA 5EDBA 4M6SA 4A1HA 3TGBA 5HCEC 1VWIB 3FA8A 4DQ4A 2L9CA 2I5VO 3FDCA 4ORSA 1OPBA 4ARHA 5HZ6A 4NYRA 1TW4A 3TGCA 1TOWA 1QY2A 2X8SA 1JMXA 2BT9A 2X46A 4NW4A 1QABE 1W4TA 2ACPX 3CWKA 5DPQA 3FEPA 4NV7A 5EEDA 4CPHA 3C76X 1MEPA 3S26A 1KZXA 3ZUIA 3D95A 4YDAA 4YCEA 2RTCB 3STKA 5IRWA 4XMFA 1ZNGA 1SRFA 1TXLA 2C1QA 2RCQA 3FR5A 4ORUA 5D48A 5AJBA 1MVGA 2RTIB 3NR3A 4ID2A 4ZHDA 1BSYA 1SWPA 5FQ7E 4CV7A 1E5PA 2IZIA 2RA6A 4INNA 2MM3A 4BX5A 1HXZA 1K3BA 3RDUA 4XMCA 4CPIA 4EXZA 4ZH9A 1I4UA 1ML7A 1FELA 5KICA 4QYPA 3VU1A 1VWDB 2WSJA 1EPBA 1SXWA 4U8UM 4IB9A 2WUTA 3RSWA 2OL7A 1A2DA 1DFVA 4TLJA 2OYBO 4CDDA 3RKGA 4ZHGA 1JYDA 3ZZVA 2CZTA 3P6DA 2R73A 4OMWA 1JJXA 1IKJA 2F73A 1QY1A 1U17A 1LKEA 1CRBA 1RBPA 1N43A 3KFIA 5EEEA 3FMZA 2Y32A 4HPDA 2JU7A 4ALOA 4COTA 2BHVA 4EDEA 1SY0A 4MVEA 5HBSA 1OSPO 1SWJA 5HA0A 3WZQA 5BYPA 2LFOA 1BBPA 2G7BA 4KIIA 5H9LA 1ERXA 1CBIA 1Y0GA 4ZGFA 2MF6A 4KCAA 3ZW1A 5JD2A 1AVGI 1HN2A 1LNMA 5L8IA 4AZMA 1W6FA 1G74A 4BX7A 1MM9A 4Y5DA 5IRUA 1YP6A 1DC9A 1HMRA 2UZ2A 3NBXX 5CE4A 4GNWA 4OS0A 5BVTA 5LJKA 3ZW0B 5IRAA 2NNDA 1Y52X 4OS3A 1DV9A 1BM5A 1QFTA 2W2FA 1VWNB 2VFCA 2LBVA 5DG4A 3T2XA 4I3BA 5EPQA 4B55A 1MX7A 1VWBB 1LICA 3WJFA 2L67A 2AT3X 4ALBA 3WZNA 2G8CO 1SWUA 4IRWA 4WHIA 4U9CA 2IZKA 3P6HA 4GU8A 2A2GA 1VWEB 5HZ5A 1OBPA 1I9HA 1FJ1E 1TOUA 2GTLM 3L4RA 5H8TA 5KIDA 3D96A 1SWEA 2FT9A 3F8AA 3KQ0A 5CHKA 3KFGA 4ZH6A 3APUA 4KH8A 4N7DA 1QG5A 3O22A 4O4OA 3SOTA 3JQOA 3VG3A 3WVMA 5LJBA 1WUBA 4YDBA 4TQ2A 1BLRA 3WJCA 1KGLA 3FW4A 3MM0A 1N0SA 2FRSA 4O3ZA 4CPHB 3PH6A 1HY2A 4DNEA 2OY7A 1CBSA 1DZKA 2R56A 3BY0A 4K19A 1SWSA 4LKTA 1ZNEA 2R74A 2HZQA 1OEKA 1RSUB 1LIDA 1SWGA 3FEKA 3FIDA 5B10O 4CPEA 2A13A 5EDCA 3ZQ3A 3FA7A 2IZEB 2GTFX 1VWOB 2OVEA 2ZSCA 2WR6A 1PMPA 2QOSC 2RTAA 2X8TA 3EM0A 5FAZA 3TF6A 4FBRA 2EU7X 2IFBA 4O49A 5D47A 3T6LA 3K3LA 5L3YA 4BX5B 1BSOA 1HXLA 2LA7A 2AKQA 3RDXA 3WXQA 2P8GA 4BBOA 2CM4A 1WBIA 1RXJA 1STPA 3D4RA 2QMIA 1SLEB 1SRJA 3EW2A 2RTPB 1PTSA 3JSQA 1G7NA 4IMOA 4NNSA 4MISA 2O62A 4I9SA 5LKFA 3DTQA 3WJDA 3CR6A 1KL3A 3UEVA 1NGLA 4FBVA 1JJJA 1NDJA 2OF9A 1KT5A 2RTMA 4IB8A 1A3YA 1RXHA 2G79A 5B5FA 1GX3A 2X45A 1N9YA 3UEUA 4CDCA 4ZJ0A 3WJGA 3U0DA 4EFGA 1AVDA 2QO4A 1ICMA 2AT0X 3ZW1B 5HAEA 1E00A 1ADLA 1VWRB 2PI3O 4LKPA 4XMHA 1VWLB 2RTLA 3B2IA 1Z24A 3CBSA 4NLIA 4BX7B 5D45A 4RUNA 4BCSA 4C5PA 3PECA 4EEJA 4YMYA 1ZNKA 3SLOA 1LIFA 4GETA 2RTOB 2HMBA 1N9MA 1H91A 4NV8A 1O1UA 2LBAA 3VG4A 4Z2OA 1VWKB 4ZFXA 5HZ8A 3U03A 4O3WA 4QGXA 3FIQA 5IO7A 3OJYC 2HNXA 1GXAA 1HBPA 1LIBA 2RTEB 1EXSA 3LHNA 4OKAA 1EUOA 2WEWA 4FQBB 4QAEA 2CAMA 4ZR2A 1ALBA 1TVQA 1SRHA 1N7YA 5HWZA 4IBAA 4A8ZA 2CBSA 1QQSA 1P6PA 3NQ9A 4YKOA 3BRNA 1X71A 1X8OA 2ACOA 3AEHA 4GE1A 1HMTA 3P02A 3IFBA 2OZQA 4HPAA 1I05A 4YH0A 2FR2A 3BX8A 3CBCA 2FKGA 1HMSA 1X8NA 2CM9A 1E06A 3VE1A 4HFOA 2AT8X 2RQ0A 2KTDA 2MO5A 3NX2A 3RE6A 2DJFA 1L6MA 5F6BA 3HWDA 1KQWA 1BEBA 1R0UA 2IZAA 2JW1A 3N91A 3OBLA 4XMGA 4GZVA 1PBYA 5BVQA 1UYNX 3WJEA 1SRIA 1Y9TA 2BLGA 3HWFA 3RDOA 5LJCA 2XKLA 1SWBA 5H9NA 2Z4HA 4CK4A 3BU9A 3HTYA 1OBQA 4Z2PA 4NP1A 3VG2A 3HOEA 1KT6A 1VYFA 4MEEA 3NQ3A 1JBHA 1GX8A 4Y0SA 4BX6A 1B56A 2OL6O 4AYHA 3VG6A 2RTJA 1SA8A 3FW5A 1IFCA 1CBQA 4IB7A 4LZVA 4AZOA 1SLGB 1I78A 1ZNLA 4A1YA 3FR2A 4YFRA 4OMXA 4N7CA 2ASNX 2BSZA 2W2AA 2W2BA 1KT3A 3BSZE 4ZCBA 3P24A 1OBUA 4GKCA 1O8VA 2JGSA 2OF8A 3WBGA 4BOEA 4IB6A 4NNTA 2QO6A 2MJIA 3KZAA 2HLVA 3BS2A 4QZTA 1QWDA 1XKIA 3B2JA 3PQSA 3MX7A 3Q6LA 5FENA 4D6AA 1PM1X 3C77X 2OFRX 3SZIA 4HWMA 3NADA 2Q2PA 1MOYA 1NP1A 1SXYA 1SWRA 1RSTB 1EQDA 2RTQB 2FHLA 1S44A 1ZNDA 3AKMA 4WFVA 4Y0QA 1SMPI 3EMMA 4EKVA 1SWDA 2A0AA 3S5XA 2WQ9A 1STSB 1VYGA 5HTDA 3FELA 1LPJA 5EZ2A 3U9PC 3OD9A 1UZ2X 3FLLA 2AT5X 2RTDB 1Y53X 1EW3A 2I5ZO 3NQKA 1ACDA 4GUZA 2X34A 4QNIA 2NP1A 5K68A 5CSEA 3RZYA 4YBPA 3MBTA 1B8EA 1VWGB 4UU2A 4AZNA 5KHPA 2KT4B 2E4JA 2HKDA 3RDSA 1SXXA 2JU8A 2NNEA 5HZQA 2A2UA 4AW8A 3EBKA 1I04A 1OEEA 1T0VA 5F1EA 3UEXA 1SWAA 3KFFA 3RDMA 3PQUA 4OELA 2X32A 1SWNA 3VG7A 3GE2A 4ORXA 2AF5A 3IA8A 3WZPA 4I3DA 5AEOA 3VHHA 2AL0X 1EI5A 1FENA 1IKEA 1YP7A 3HWGA 1SWQA 4Z6JA 4ON1A 5K67A 4MVIA 5K06A 4UU3A 1FTPA 2JOZA 2PY1A 1ZRYA 4I3CA 1FDQA 3JS1A 1SREA 2JU3A 2NNQA 4AZRA 4O3YA 4GGRA 4AZQA 4MVLA 2ZAIA 4YVBA 1LIEA 3D97A 3WOVA 2POAA 1D3SA 4BVMA 2AH7X 4BX6B 2Z4IA 3AUMO 4Z2VA 1NP4A 1BSQA 4DQ3A 2UYWA 3SZHA 3EBWA 3VPJE 1VWCB 1LFOA 1ERBA 2KD2A 5C0NA 4M7MA 1B0OA 1AB0A 1SY2A 2RN4A 4I95A 1SY3A 2VDFA 1W5RA 3AKNA 2X4MA 4BJ8A 1E02A 3G7XA 5IO6A 1SLFB 1X89A 1VWPB 1NBXA 1D2UA 3OE3A 4FGIB 2FR3A 3WJBA 1EIIA 1LCZA 4R0BA 1YWAA 2OVAA 4GRJA 1ICNA 1JIWI 4QYNA 4YBUA 1B4MA 4YKMA 2A5CA 1KQXA 1SRGA 1QFVA 4U46A 2BS5A 3VGWA 2G78A 5B11O 3BDRA 1T68X 1GGLA 1QY0A 1A18A 2QO5A 1FE3A 2HYSA 3T6FA 3PP6A 1RLBE 1SWLA 1VYOA 2ALLX 2IZFB 2MWHA 3B2KA 4ORWA 1EPAA 4KC8A 5HTEA 5L8OA 4CDEA 1ZNHA 2WWPA 3NP1A 5HZ9A 4GDAA 2QM9A 3RY1A 2OFAA 3B2HA 1MDCA 3HOLA 5CYBA 2FWVA 4QZUA 4TKJA 4GJSA 3VG5A 1RAVA 2CBRA 3O19A 1LCVA 1VPRA 1VWFB 3E3CA 3MG5A 4IABA 5BVSA 3TZSA 2HZRA 2OY8A 2Q9SA 2OVSA 2A5BA 1SWKA 4JNJA 1KZWA 1N4JA 3LTWA 4ZGUA 2G5LA 3S60A 5HCDC 4LZUA 5LKEA 2RTBB 4GH7A 2DM5A 2BC3A 4ZHCA 1JYJA 2C1SA 4GK9A 4L3RA 5LJEA 2AVIA 3X00A 4JGLA 2Q39A 4O4SA 3ZWEA 2RTRB 4FBOA 4ORRA 1NQNA 3ZI8A 2L5PA 5F7GA 3VHIA 4BQUA 2OY1O 2X56A 2ZAGA 1IJ8A 4ES7A 5HA1A 1GKAA 4IMNA 5B29A 5LJHA 4L1NA 3VHMA 3PDFA 1HQPA 2C4IA 3MVFA 4MIRA 4U8UO 5B2AO 2QCBA 5FQ6E 1IIUA 2IZGB 4CPFA 1SXUA 1U0XA 1KT4A 3KFHA 5H9KA 4ORYA 1A57A 2OVDA 3ELXA 4YGGA 4D6BA 1S7DA 1EALA 1AQBA 1UYOX 3PEDA 2JN3A 3WYPA 1S2PA 2Y3EA 5IO5A 4IAXA 2FGSA 3D9WA 1SWCA 5FQ8E 3ZW2A 2LB6A 2OY5O 4A60A 3CQRA 3HK1A 4XMDA 2GJ5A 4PJ2A 1PEEA 3SZJA 5JR8A 1X8PA 2YMSA 3PH5A 2Q4NA 2IZLB 3F6ZB 3BX7A 4GD9A 4HPBA 4QRLA 1VWJB 1KL4A 1AVEA 4U8UN 2KW1A 1YWCA 2CZUA 2FS7A 1JZUA 2FKJA 3DSZA 1NC9A 4ODDA 4Y0PA 3NPOA 4JHQA 1KT7A 1G85A 1LF7A 4I9RA 2RTKA 1BRPA 2WEXA 1PBOA 1SY1A 4JO6A 1RXKA 2Q2MA 3CMPA 1G5WA 3ELZA 1YWDA 2IZHB 3KVNA 1OEJA 3P6FA 3WYQA 2K62A 3WZOA 5AJCA 1K24A 1LDOA 2L68A 1X8UA 1SWFA 2FTBA 3PPTA 2FHNX 4O4XA 1EIOA 1IFBA 1LELA 3I17A 4AZPA 1CBRA 2GTLO 4U3QA 1BJ7A 3SAOA 4GNYA 3APXA 5IXGA 3EC5A 1BWYA 5LJDA 3VE2A 2RTFB 1MX8A 4YFPA 1SWHA 1I06A 2WQAE 4GGTA 5F6ZA 1DZMA 4OEMA 4WBKA 2JMBA 3BLGA 4MVKA 3T1DA 4Z27A 4O4UA 2N93A 3Q34A 1YIVA 1VWHB 5B27A 2GH7A 4I60A 3P6GA 2IZJA 4GGZA 4RUUA 1VWAB 1FEMA 1GT3A 5HCCC 4ML7B 1JJUA 4TJZA 4Y59A 4NYQA 5F58A 1VWQB 1U18A 1Y9LA 4YGHA 1BRQA 5AQ6A 2QOMA 2VFBA 3RBYA 1GM6A 1YUPA 3TGAA 1KXOA 3NX1A 1KFFA 2GTLN 1GX9A 4EQAC 2IZBA 4YGZA 3FENA 2RTHB 3B2LA 1DZPA 4GDZA 5D8JA 4Z28A 4CSBA 3GAQA 1JQPA 2OL8O 2F01A 2KTSA 4YFQA 2RD7C 3FR4A 4LQZA 1GKAB 2AT6X 2Y3FA 2K23A 1GT4A 5F2BA 1HQQA 1STRB 1DF8A 2AMMX 3CQNA 3LV4A 4Y0RA 2XSTA 3PK2A 1CJ5A 3HPEA 3UAQA 3APVA 3CKFA 1LCWA 2X55A 2A8GA 4O9SA 3CKGA 2FS6A 5B5GA 3V8UA 2X8FA 4OS8A 1HBQA 2LKKA 3SLTA 4TKHA 3I0AA 1Y55X 2OFMX 3BU1A 4TNNA 1DF3A 1LDQA 1YWBA 4TKBA 3HWEA 4IAWA 1AELA 3UEWA 4KT5A 4ZHFA 4PSQA 1VWMB 2GC9A 1X8QA 2YG2A 2FLJA 1SWTA 3APWA 2A3FX 4WFUA 3STNA 5B3MO 1T8VA 4NLJA 3H3IA 2RCTA 3QQ2A 3S5VA 1DZJA 5D4AA 1MK5A 3RWXA 3SLJA 3FYFA 4QGVA 5L8NA 4DCBA 4GJVA 3FA6A 3O2YA 4I6SA 2RTNB 1UREA 3RDQA 4KC7A 2M4LA 5FFHA 4BGFA 2DJGA 1LUQA 1XCAA 2F09A 1KOIA 2IZDB 2ANSA 3EYCA 4YCHA 3ZUOA 3ZW0A 1MUPA 1E2TA 1GT1A 3RY2A 3T2WA 1IW2A 4O3XB 1GT5A 1O1VA 5LJGA 2OFBA 1SLDB 1SWOA 1OPAA 3EW1A
chains in the Genus database with same CATH topology
2BS6A 4XMEA 4HPCA 3STMX 2MHDA 3P6CA 1JV4A 3QKGA 3FA9A 4QQ1A 3F9DA 3C78X 5H9AA 4QGWA 3P6EA 3TGBA 5EDBA 4M6SA 4A1HA 5HCEC 3FA8A 4DQ4A 2L9CA 4ORSA 1OPBA 4ARHA 5HZ6A 4NYRA 1TW4A 3TGCA 1TOWA 1QY2A 2X8SA 4NW4A 2BT9A 2X46A 5DPQA 1QABE 2ACPX 5EEDA 3CWKA 3FEPA 3C76X 3S26A 1KZXA 3ZUIA 3D95A 4YDAA 4YCEA 3STKA 4XMFA 1ZNGA 1TXLA 2RCQA 3FR5A 4ORUA 5D48A 5AJBA 1MVGA 3NR3A 4ID2A 4ZHDA 1BSYA 4CV7A 5FQ7E 1E5PA 2RA6A 4INNA 2MM3A 4XMCA 4EXZA 4ZH9A 1I4UA 1ML7A 1FELA 5KICA 4QYPA 3VU1A 2WSJA 1EPBA 1SXWA 4U8UM 4IB9A 2WUTA 3RSWA 1A2DA 1DFVA 4TLJA 3RKGA 4ZHGA 1JYDA 3ZZVA 2CZTA 3P6DA 2R73A 4OMWA 1JJXA 1IKJA 2F73A 1QY1A 1U17A 1LKEA 1CRBA 1RBPA 3KFIA 5EEEA 3FMZA 4HPDA 4ALOA 2JU7A 4COTA 2BHVA 4EDEA 1SY0A 4MVEA 5HBSA 5BYPA 5HA0A 2LFOA 1BBPA 2G7BA 4KIIA 5H9LA 1ERXA 1CBIA 4ZGFA 4KCAA 3ZW1A 1AVGI 1HN2A 1LNMA 5L8IA 4AZMA 1G74A 1YP6A 1DC9A 1HMRA 3NBXX 5CE4A 4GNWA 4OS0A 5BVTA 5LJKA 3ZW0B 2NNDA 4OS3A 1DV9A 1BM5A 1QFTA 2W2FA 2LBVA 5DG4A 4I3BA 5EPQA 1MX7A 1LICA 3WJFA 2L67A 2AT3X 4ALBA 4WHIA 4U9CA 3P6HA 4GU8A 2A2GA 5HZ5A 1OBPA 2GTLM 1TOUA 3L4RA 5H8TA 5KIDA 3D96A 2FT9A 3F8AA 3KQ0A 3KFGA 4ZH6A 3APUA 4KH8A 4N7DA 1QG5A 3O22A 4O4OA 3SOTA 3JQOA 3VG3A 3WVMA 5LJBA 4YDBA 4TQ2A 1BLRA 3WJCA 1KGLA 3FW4A 1N0SA 2FRSA 4O3ZA 3PH6A 1CBSA 1DZKA 2R56A 3BY0A 4K19A 4LKTA 1ZNEA 2R74A 2HZQA 1OEKA 1LIDA 3FEKA 2A13A 5EDCA 3ZQ3A 3FA7A 2GTFX 3EM0A 2OVEA 5F7GA 2WR6A 1PMPA 2QOSC 2X8TA 5FAZA 3TF6A 4FBRA 2EU7X 2IFBA 4O49A 5D47A 3K3LA 1BSOA 2LA7A 2AKQA 3WXQA 2P8GA 2CM4A 3JSQA 3D4RA 2QMIA 1G7NA 4IMOA 4NNSA 4MISA 2O62A 4I9SA 5LKFA 3DTQA 3WJDA 3CR6A 3UEVA 1NGLA 4FBVA 1JJJA 4IB8A 1KT5A 1A3YA 2G79A 2X45A 3UEUA 4ZJ0A 3WJGA 3U0DA 4EFGA 2QO4A 1ICMA 2AT0X 3ZW1B 5HAEA 1E00A 1ADLA 4LKPA 4XMHA 3B2IA 3CBSA 1Z24A 4NLIA 5D45A 4RUNA 4YMYA 3PECA 1ZNKA 1LIFA 4GETA 2HMBA 1H91A 1O1UA 2LBAA 3VG4A 4ZFXA 5HZ8A 3U03A 4O3WA 4QGXA 3FIQA 5IO7A 3OJYC 2HNXA 1GXAA 1HBPA 1LIBA 3LHNA 1EXSA 4QAEA 1EUOA 2WEWA 4FQBB 4ZR2A 1ALBA 1TVQA 5HWZA 4IBAA 4A8ZA 2CBSA 1QQSA 1P6PA 3NQ9A 4YKOA 3BRNA 1X71A 1X8OA 2ACOA 4GE1A 1HMTA 3P02A 3IFBA 2OZQA 4HPAA 1I05A 4YH0A 2FR2A 3BX8A 3CBCA 1HMSA 1X8NA 2CM9A 1E06A 3VE1A 4HFOA 2AT8X 2RQ0A 2KTDA 2MO5A 3NX2A 1L6MA 5F6BA 3HWDA 1KQWA 1BEBA 1R0UA 2JW1A 3N91A 3OBLA 4XMGA 4GZVA 5BVQA 3WJEA 1Y9TA 2BLGA 3HWFA 5LJCA 2XKLA 5H9NA 2Z4HA 4CK4A 3BU9A 3HTYA 1OBQA 4NP1A 3VG2A 3HOEA 1KT6A 1VYFA 3NQ3A 1JBHA 1GX8A 4Y0SA 1B56A 4AYHA 3VG6A 1SA8A 3FW5A 1IFCA 1CBQA 4IB7A 4LZVA 4AZOA 1ZNLA 4A1YA 3FR2A 4YFRA 4OMXA 4N7CA 2ASNX 2W2AA 2W2BA 1KT3A 3BSZE 4ZCBA 3P24A 1OBUA 4GKCA 1O8VA 3WBGA 4BOEA 4IB6A 4NNTA 2QO6A 2MJIA 3KZAA 2HLVA 3BS2A 4QZTA 1QWDA 1XKIA 3B2JA 3PQSA 3MX7A 3Q6LA 5FENA 4D6AA 1PM1X 3C77X 2OFRX 4HWMA 3NADA 2Q2PA 1SXYA 1EQDA 3AKMA 4WFVA 1S44A 1ZNDA 4Y0QA 1SMPI 3EMMA 2A0AA 3S5XA 2WQ9A 1VYGA 5HTDA 3FELA 1LPJA 5EZ2A 3U9PC 3OD9A 1UZ2X 3FLLA 2AT5X 1EW3A 3NQKA 4QNIA 1ACDA 2NP1A 3RZYA 4YBPA 3MBTA 1B8EA 4AZNA 4UU2A 5KHPA 2KT4B 2E4JA 1SXXA 2JU8A 2NNEA 5HZQA 2A2UA 4AW8A 3EBKA 1I04A 1OEEA 1T0VA 5F1EA 3UEXA 3KFFA 3PQUA 3VG7A 3GE2A 4ORXA 5AEOA 3IA8A 4I3DA 2AL0X 1EI5A 1FENA 1IKEA 1YP7A 3HWGA 4ON1A 4MVIA 5K06A 4UU3A 1FTPA 2JOZA 2PY1A 1ZRYA 4I3CA 1FDQA 3JS1A 4AZRA 2JU3A 2NNQA 4O3YA 4AZQA 4MVLA 2ZAIA 1LIEA 3D97A 3WOVA 2POAA 1D3SA 4BVMA 2AH7X 2Z4IA 1NP4A 1BSQA 4DQ3A 3EBWA 3VPJE 1LFOA 1ERBA 2KD2A 5C0NA 4M7MA 1B0OA 1AB0A 1SY2A 2RN4A 4I95A 1SY3A 3AKNA 1E02A 3G7XA 5IO6A 1X89A 3OE3A 1D2UA 4FGIB 2FR3A 3WJBA 1EIIA 4R0BA 1YWAA 2OVAA 4GRJA 1ICNA 1JIWI 4QYNA 4YBUA 1B4MA 4YKMA 1KQXA 1QFVA 2BS5A 2G78A 3BDRA 1T68X 1GGLA 1QY0A 1A18A 2QO5A 1FE3A 2HYSA 3PP6A 1RLBE 3B2KA 5HTEA 2ALLX 2MWHA 4ORWA 1EPAA 4KC8A 5L8OA 1ZNHA 2WWPA 3NP1A 5HZ9A 2QM9A 3B2HA 1MDCA 3HOLA 5CYBA 2FWVA 4QZUA 4TKJA 3VG5A 3O19A 2CBRA 1VPRA 3E3CA 4IABA 5BVSA 3TZSA 2HZRA 2Q9SA 2OVSA 1KZWA 4ZGUA 3S60A 5HCDC 4LZUA 5LKEA 4GH7A 2DM5A 4ZHCA 1JYJA 4GK9A 4L3RA 5LJEA 4JGLA 2Q39A 4O4SA 3ZWEA 4FBOA 4ORRA 3ZI8A 2L5PA 4BQUA 2ZAGA 4ES7A 5HA1A 1GKAA 4IMNA 5B29A 5LJHA 4L1NA 1HQPA 3MVFA 4MIRA 4U8UO 5FQ6E 1IIUA 1SXUA 1U0XA 1KT4A 3KFHA 5H9KA 4ORYA 1A57A 2OVDA 3ELXA 4YGGA 4D6BA 1S7DA 1EALA 1AQBA 3PEDA 2JN3A 1S2PA 5IO5A 4IAXA 5FQ8E 3ZW2A 2LB6A 4A60A 3CQRA 3HK1A 4XMDA 2GJ5A 4PJ2A 1PEEA 5JR8A 1X8PA 2YMSA 3PH5A 2Q4NA 3F6ZB 4EEJA 3BX7A 4HPBA 4QRLA 4U8UN 2KW1A 1YWCA 2CZUA 2FS7A 1JZUA 3DSZA 4ODDA 4Y0PA 3NPOA 1KT7A 1G85A 1LF7A 4I9RA 1BRPA 2WEXA 1PBOA 1SY1A 2Q2MA 3CMPA 1G5WA 3ELZA 1YWDA 3P6FA 1OEJA 2K62A 5AJCA 2L68A 1X8UA 2FTBA 3PPTA 4O4XA 1EIOA 1IFBA 3I17A 4AZPA 1CBRA 2GTLO 4U3QA 1BJ7A 3SAOA 4GNYA 3APXA 1BWYA 5LJDA 3VE2A 1MX8A 4YFPA 1I06A 2WQAE 5F6ZA 1DZMA 4WBKA 2JMBA 3BLGA 4MVKA 3T1DA 4O4UA 2N93A 1YIVA 5B27A 3P6GA 4RUUA 1FEMA 1GT3A 5HCCC 4ML7B 4TJZA 4NYQA 5F58A 1U18A 1Y9LA 4YGHA 1BRQA 5AQ6A 3RBYA 1GM6A 1YUPA 3TGAA 1KXOA 3NX1A 2GTLN 1GX9A 4EQAC 4YGZA 3FENA 3B2LA 1DZPA 4GDZA 5D8JA 4CSBA 3GAQA 4YFQA 2KTSA 2RD7C 3FR4A 4LQZA 1GKAB 2AT6X 4ZHHA 2K23A 1GT4A 1CJ5A 2AMMX 3CQNA 3LV4A 4Y0RA 2XSTA 3UAQA 3APVA 4O9SA 3V8UA 2FS6A 2X8FA 4OS8A 1HBQA 2LKKA 4TKHA 3I0AA 2OFMX 3BU1A 4TNNA 1DF3A 1YWBA 4TKBA 3HWEA 4IAWA 1AELA 3UEWA 4KT5A 4ZHFA 4PSQA 2YG2A 2GC9A 1X8QA 2FLJA 3APWA 2A3FX 4WFUA 3STNA 1T8VA 4NLJA 3H3IA 2RCTA 3S5VA 1DZJA 5D4AA 3RWXA 3FYFA 4QGVA 5L8NA 3FA6A 3O2YA 4I6SA 1UREA 4KC7A 2M4LA 5FFHA 1XCAA 2F09A 1KOIA 3ZUOA 2ANSA 3EYCA 4YCHA 3ZW0A 1MUPA 1GT1A 1IW2A 4O3XB 1GT5A 1O1VA 5LJGA 1NP1A 1OPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XME A;  4HPC A;  3STM X;  3P6C A;  1JV4 A;  3QKG A;  3FA9 A;  3F9D A;  3C78 X;  5H9A A;  4QGW A;  3P6E A;  3TGB A;  5EDB A;  4M6S A;  4A1H A;  5HCE C;  3FA8 A;  4DQ4 A;  2L9C A;  4ORS A;  1OPB A;  4ARH A;  5HZ6 A;  4NYR A;  1TW4 A;  3TGC A;  1TOW A;  1QY2 A;  5DPQ A;  2X46 A;  5EED A;  1QAB E;  2ACP X;  3CWK A;  3FEP A;  3C76 X;  3S26 A;  1KZX A;  3ZUI A;  3D95 A;  4YDA A;  4YCE A;  3STK A;  4XMF A;  1ZNG A;  1TXL A;  2RCQ A;  3FR5 A;  4ORU A;  5D48 A;  1MVG A;  3NR3 A;  4ZHD A;  1BSY A;  1E5P A;  2RA6 A;  2MM3 A;  4XMC A;  4EXZ A;  4ZH9 A;  1I4U A;  1ML7 A;  1FEL A;  5KIC A;  4QYP A;  2WSJ A;  1EPB A;  1SXW A;  4IB9 A;  2WUT A;  3RSW A;  1A2D A;  1DFV A;  4TLJ A;  4ZHG A;  1JYD A;  2CZT A;  3P6D A;  2R73 A;  4OMW A;  1JJX A;  1IKJ A;  2F73 A;  1QY1 A;  1U17 A;  1LKE A;  1CRB A;  1RBP A;  3KFI A;  5EEE A;  3FMZ A;  4HPD A;  4ALO A;  2JU7 A;  4EDE A;  1SY0 A;  5HBS A;  5HA0 A;  2LFO A;  1BBP A;  2G7B A;  4KII A;  5H9L A;  1ERX A;  1CBI A;  1AVG I;  1HN2 A;  1LNM A;  5L8I A;  4AZM A;  1G74 A;  1YP6 A;  1DC9 A;  1HMR A;  5CE4 A;  4GNW A;  4OS0 A;  5BVT A;  5LJK A;  2NND A;  4OS3 A;  1DV9 A;  1BM5 A;  1QFT A;  2W2F A;  2LBV A;  5DG4 A;  4I3B A;  5EPQ A;  1MX7 A;  1LIC A;  3WJF A;  2L67 A;  2AT3 X;  4ALB A;  3P6H A;  2A2G A;  5HZ5 A;  1OBP A;  1TOU A;  3L4R A;  5H8T A;  5KID A;  3D96 A;  2FT9 A;  3F8A A;  3KQ0 A;  3KFG A;  4ZH6 A;  3APU A;  4D6A A;  4N7D A;  1QG5 A;  3O22 A;  3VG3 A;  3WVM A;  5LJB A;  4YDB A;  4TQ2 A;  1BLR A;  3WJC A;  1KGL A;  3FW4 A;  1N0S A;  2FRS A;  3PH6 A;  1CBS A;  1DZK A;  2R56 A;  3BY0 A;  4K19 A;  4LKT A;  1ZNE A;  2R74 A;  2HZQ A;  1OEK A;  1LID A;  3FEK A;  2A13 A;  5EDC A;  3ZQ3 A;  3FA7 A;  2GTF X;  3EM0 A;  2OVE A;  5F7G A;  2WR6 A;  1PMP A;  2QOS C;  5FAZ A;  3TF6 A;  2EU7 X;  2IFB A;  5D47 A;  3K3L A;  1BSO A;  2AKQ A;  3WXQ A;  2P8G A;  2CM4 A;  3JSQ A;  1G7N A;  4IMO A;  4NNS A;  2O62 A;  4I9S A;  5LKF A;  3DTQ A;  3WJD A;  3CR6 A;  3UEV A;  1NGL A;  1JJJ A;  4IB8 A;  1KT5 A;  1A3Y A;  2G79 A;  2X45 A;  3UEU A;  4ZJ0 A;  3WJG A;  3U0D A;  4EFG A;  2QO4 A;  1ICM A;  2AT0 X;  5HAE A;  1E00 A;  1ADL A;  4LKP A;  4XMH A;  3B2I A;  3CBS A;  1Z24 A;  4NLI A;  5D45 A;  4RUN A;  4YMY A;  3PEC A;  1ZNK A;  1LIF A;  4GET A;  2HMB A;  1H91 A;  1O1U A;  2LBA A;  3VG4 A;  4ZFX A;  5HZ8 A;  3U03 A;  4QGX A;  3FIQ A;  5IO7 A;  3OJY C;  2HNX A;  1GXA A;  1HBP A;  1LIB A;  4QAE A;  1EXS A;  1EUO A;  2WEW A;  4ZR2 A;  1ALB A;  1TVQ A;  5HWZ A;  4IBA A;  4A8Z A;  2CBS A;  1QQS A;  1P6P A;  3NQ9 A;  4YKO A;  3BRN A;  1X71 A;  1X8O A;  2ACO A;  4GE1 A;  1HMT A;  3IFB A;  2OZQ A;  4HPA A;  1I05 A;  4YH0 A;  2FR2 A;  3BX8 A;  3CBC A;  1HMS A;  1X8N A;  2CM9 A;  1E06 A;  4HFO A;  2AT8 X;  2RQ0 A;  2KTD A;  2MO5 A;  3NX2 A;  1L6M A;  5F6B A;  3HWD A;  1KQW A;  1BEB A;  1R0U A;  4XMG A;  5BVQ A;  3WJE A;  2BLG A;  3HWF A;  5LJC A;  2XKL A;  5H9N A;  4CK4 A;  3BU9 A;  1OBQ A;  4NP1 A;  3VG2 A;  1KT6 A;  1VYF A;  3NQ3 A;  1JBH A;  1GX8 A;  4Y0S A;  1B56 A;  4AYH A;  3VG6 A;  1SA8 A;  3FW5 A;  1IFC A;  1CBQ A;  4IB7 A;  4LZV A;  4AZO A;  1ZNL A;  4A1Y A;  3FR2 A;  4YFR A;  4OMX A;  4N7C A;  2ASN X;  2W2A A;  2W2B A;  1KT3 A;  3BSZ E;  4ZCB A;  1OBU A;  4GKC A;  1O8V A;  3WBG A;  4BOE A;  4IB6 A;  4NNT A;  2QO6 A;  2MJI A;  3KZA A;  2HLV A;  3BS2 A;  4QZT A;  1QWD A;  1XKI A;  3B2J A;  3Q6L A;  5FEN A;  1PM1 X;  3C77 X;  2OFR X;  3NAD A;  2Q2P A;  1SXY A;  1EQD A;  3AKM A;  4WFV A;  1S44 A;  1ZND A;  4Y0Q A;  3EMM A;  2A0A A;  2WQ9 A;  1VYG A;  5HTD A;  3FEL A;  1LPJ A;  5EZ2 A;  3U9P C;  1UZ2 X;  3FLL A;  2AT5 X;  1EW3 A;  1ACD A;  2NP1 A;  3RZY A;  4YBP A;  3MBT A;  1B8E A;  4AZN A;  4UU2 A;  5KHP A;  2KT4 B;  2E4J A;  1SXX A;  2JU8 A;  2NNE A;  5HZQ A;  2A2U A;  4AW8 A;  3EBK A;  1I04 A;  1OEE A;  1T0V A;  5F1E A;  3UEX A;  3KFF A;  3VG7 A;  4ORX A;  3IA8 A;  4I3D A;  2AL0 X;  1FEN A;  1IKE A;  1YP7 A;  3HWG A;  4MVI A;  5K06 A;  4UU3 A;  1FTP A;  2JOZ A;  2PY1 A;  1ZRY A;  4I3C A;  1FDQ A;  3JS1 A;  4AZR A;  2JU3 A;  2NNQ A;  4AZQ A;  4MVL A;  1LIE A;  3D97 A;  2POA A;  1D3S A;  4BVM A;  2AH7 X;  1NP4 A;  1BSQ A;  4DQ3 A;  3EBW A;  1LFO A;  1ERB A;  5C0N A;  4M7M A;  1B0O A;  1AB0 A;  1SY2 A;  1SY3 A;  3AKN A;  1E02 A;  3G7X A;  5IO6 A;  1X89 A;  1D2U A;  2FR3 A;  3WJB A;  1EII A;  4R0B A;  1YWA A;  2OVA A;  4GRJ A;  1ICN A;  4QYN A;  4YBU A;  1B4M A;  4YKM A;  1KQX A;  1QFV A;  2G78 A;  3BDR A;  1T68 X;  1GGL A;  1QY0 A;  1A18 A;  2QO5 A;  1FE3 A;  2HYS A;  3PP6 A;  1RLB E;  3B2K A;  5HTE A;  2ALL X;  4ORW A;  1EPA A;  5L8O A;  1ZNH A;  2WWP A;  3NP1 A;  5HZ9 A;  2QM9 A;  3B2H A;  1MDC A;  2FWV A;  4QZU A;  4TKJ A;  3VG5 A;  3O19 A;  2CBR A;  1VPR A;  5BVS A;  3TZS A;  2HZR A;  2Q9S A;  1KZW A;  4ZGU A;  5HCD C;  4LZU A;  5LKE A;  4GH7 A;  2DM5 A;  4ZHC A;  1JYJ A;  5LJE A;  2Q39 A;  4ORR A;  2L5P A;  4BQU A;  4ES7 A;  5HA1 A;  1GKA A;  4IMN A;  5B29 A;  5LJH A;  1HQP A;  3MVF A;  1IIU A;  1SXU A;  1U0X A;  1KT4 A;  3KFH A;  5H9K A;  4ORY A;  1A57 A;  2OVD A;  3ELX A;  4YGG A;  4D6B A;  1S7D A;  1EAL A;  1AQB A;  3PED A;  2JN3 A;  1S2P A;  5IO5 A;  4IAX A;  2LB6 A;  4A60 A;  3CQR A;  3HK1 A;  4XMD A;  2GJ5 A;  1PEE A;  5JR8 A;  1X8P A;  4EEJ A;  3PH5 A;  2Q4N A;  3BX7 A;  4HPB A;  1YWC A;  2CZU A;  2FS7 A;  1JZU A;  3DSZ A;  4ODD A;  4Y0P A;  3NPO A;  1KT7 A;  1G85 A;  1LF7 A;  4I9R A;  1BRP A;  2WEX A;  1PBO A;  1SY1 A;  2Q2M A;  3CMP A;  1G5W A;  3ELZ A;  1YWD A;  3P6F A;  1OEJ A;  2K62 A;  2L68 A;  1X8U A;  2FTB A;  3PPT A;  1EIO A;  1IFB A;  3I17 A;  4AZP A;  1CBR A;  1BWY A;  1BJ7 A;  3SAO A;  4GNY A;  3APX A;  5LJD A;  1MX8 A;  4YFP A;  1I06 A;  2WQA E;  5F6Z A;  1DZM A;  4WBK A;  3T1D A;  3BLG A;  4MVK A;  2N93 A;  1YIV A;  5B27 A;  3P6G A;  4RUU A;  1FEM A;  1GT3 A;  5HCC C;  4TJZ A;  4NYQ A;  5F58 A;  1U18 A;  4YGH A;  1BRQ A;  5AQ6 A;  1GM6 A;  1YUP A;  3TGA A;  1KXO A;  3NX1 A;  1GX9 A;  4YGZ A;  3FEN A;  3B2L A;  1DZP A;  5D8J A;  3GAQ A;  4YFQ A;  2RD7 C;  3FR4 A;  1GKA B;  2AT6 X;  4ZHH A;  2K23 A;  1GT4 A;  1CJ5 A;  2AMM X;  3CQN A;  4Y0R A;  2XST A;  3APV A;  4O9S A;  2FS6 A;  4OS8 A;  1HBQ A;  2LKK A;  4TKH A;  3I0A A;  2OFM X;  3BU1 A;  4TNN A;  1DF3 A;  1YWB A;  4TKB A;  3HWE A;  4IAW A;  1AEL A;  3UEW A;  4ZHF A;  4PSQ A;  2YG2 A;  2GC9 A;  1X8Q A;  2FLJ A;  3APW A;  2A3F X;  4WFU A;  3STN A;  1T8V A;  4NLJ A;  2RCT A;  1DZJ A;  5D4A A;  4QGV A;  5L8N A;  3FA6 A;  3O2Y A;  1URE A;  5FFH A;  1XCA A;  1KOI A;  3ZUO A;  2ANS A;  3EYC A;  4YCH A;  1MUP A;  1GT1 A;  1IW2 A;  1GT5 A;  1O1V A;  5LJG A;  1NP1 A;  1OPA A; 
#chains in the Genus database with same CATH topology
 2BS6 A;  3RE5 A;  4XME A;  4HPC A;  3STM X;  2RTG B;  2WPU A;  2MHD A;  3P6C A;  1JV4 A;  3QKG A;  3FA9 A;  4QQ1 A;  3F9D A;  4CDF A;  3C78 X;  5H9A A;  1KL5 A;  1NQM A;  1JMZ A;  2IZC B;  4QGW A;  3P6E A;  4ZHH A;  5EDB A;  4M6S A;  4A1H A;  3TGB A;  5HCE C;  1VWI B;  3FA8 A;  4DQ4 A;  2L9C A;  2I5V O;  3FDC A;  4ORS A;  1OPB A;  4ARH A;  5HZ6 A;  4NYR A;  1TW4 A;  3TGC A;  1TOW A;  1QY2 A;  2X8S A;  1JMX A;  2BT9 A;  2X46 A;  4NW4 A;  1QAB E;  1W4T A;  2ACP X;  3CWK A;  5DPQ A;  3FEP A;  4NV7 A;  5EED A;  4CPH A;  3C76 X;  1MEP A;  3S26 A;  1KZX A;  3ZUI A;  3D95 A;  4YDA A;  4YCE A;  2RTC B;  3STK A;  5IRW A;  4XMF A;  1ZNG A;  1SRF A;  1TXL A;  2C1Q A;  2RCQ A;  3FR5 A;  4ORU A;  5D48 A;  5AJB A;  1MVG A;  2RTI B;  3NR3 A;  4ID2 A;  4ZHD A;  1BSY A;  1SWP A;  5FQ7 E;  4CV7 A;  1E5P A;  2IZI A;  2RA6 A;  4INN A;  2MM3 A;  4BX5 A;  1HXZ A;  1K3B A;  3RDU A;  4XMC A;  4CPI A;  4EXZ A;  4ZH9 A;  1I4U A;  1ML7 A;  1FEL A;  5KIC A;  4QYP A;  3VU1 A;  1VWD B;  2WSJ A;  1EPB A;  1SXW A;  4U8U M;  4IB9 A;  2WUT A;  3RSW A;  2OL7 A;  1A2D A;  1DFV A;  4TLJ A;  2OYB O;  4CDD A;  3RKG A;  4ZHG A;  1JYD A;  3ZZV A;  2CZT A;  3P6D A;  2R73 A;  4OMW A;  1JJX A;  1IKJ A;  2F73 A;  1QY1 A;  1U17 A;  1LKE A;  1CRB A;  1RBP A;  1N43 A;  3KFI A;  5EEE A;  3FMZ A;  2Y32 A;  4HPD A;  2JU7 A;  4ALO A;  4COT A;  2BHV A;  4EDE A;  1SY0 A;  4MVE A;  5HBS A;  1OSP O;  1SWJ A;  5HA0 A;  3WZQ A;  5BYP A;  2LFO A;  1BBP A;  2G7B A;  4KII A;  5H9L A;  1ERX A;  1CBI A;  1Y0G A;  4ZGF A;  2MF6 A;  4KCA A;  3ZW1 A;  5JD2 A;  1AVG I;  1HN2 A;  1LNM A;  5L8I A;  4AZM A;  1W6F A;  1G74 A;  4BX7 A;  1MM9 A;  4Y5D A;  5IRU A;  1YP6 A;  1DC9 A;  1HMR A;  2UZ2 A;  3NBX X;  5CE4 A;  4GNW A;  4OS0 A;  5BVT A;  5LJK A;  3ZW0 B;  5IRA A;  2NND A;  1Y52 X;  4OS3 A;  1DV9 A;  1BM5 A;  1QFT A;  2W2F A;  1VWN B;  2VFC A;  2LBV A;  5DG4 A;  3T2X A;  4I3B A;  5EPQ A;  4B55 A;  1MX7 A;  1VWB B;  1LIC A;  3WJF A;  2L67 A;  2AT3 X;  4ALB A;  3WZN A;  2G8C O;  1SWU A;  4IRW A;  4WHI A;  4U9C A;  2IZK A;  3P6H A;  4GU8 A;  2A2G A;  1VWE B;  5HZ5 A;  1OBP A;  1I9H A;  1FJ1 E;  1TOU A;  2GTL M;  3L4R A;  5H8T A;  5KID A;  3D96 A;  1SWE A;  2FT9 A;  3F8A A;  3KQ0 A;  5CHK A;  3KFG A;  4ZH6 A;  3APU A;  4KH8 A;  4N7D A;  1QG5 A;  3O22 A;  4O4O A;  3SOT A;  3JQO A;  3VG3 A;  3WVM A;  5LJB A;  1WUB A;  4YDB A;  4TQ2 A;  1BLR A;  3WJC A;  1KGL A;  3FW4 A;  3MM0 A;  1N0S A;  2FRS A;  4O3Z A;  4CPH B;  3PH6 A;  1HY2 A;  4DNE A;  2OY7 A;  1CBS A;  1DZK A;  2R56 A;  3BY0 A;  4K19 A;  1SWS A;  4LKT A;  1ZNE A;  2R74 A;  2HZQ A;  1OEK A;  1RSU B;  1LID A;  1SWG A;  3FEK A;  3FID A;  5B10 O;  4CPE A;  2A13 A;  5EDC A;  3ZQ3 A;  3FA7 A;  2IZE B;  2GTF X;  1VWO B;  2OVE A;  2ZSC A;  2WR6 A;  1PMP A;  2QOS C;  2RTA A;  2X8T A;  3EM0 A;  5FAZ A;  3TF6 A;  4FBR A;  2EU7 X;  2IFB A;  4O49 A;  5D47 A;  3T6L A;  3K3L A;  5L3Y A;  4BX5 B;  1BSO A;  1HXL A;  2LA7 A;  2AKQ A;  3RDX A;  3WXQ A;  2P8G A;  4BBO A;  2CM4 A;  1WBI A;  1RXJ A;  1STP A;  3D4R A;  2QMI A;  1SLE B;  1SRJ A;  3EW2 A;  2RTP B;  1PTS A;  3JSQ A;  1G7N A;  4IMO A;  4NNS A;  4MIS A;  2O62 A;  4I9S A;  5LKF A;  3DTQ A;  3WJD A;  3CR6 A;  1KL3 A;  3UEV A;  1NGL A;  4FBV A;  1JJJ A;  1NDJ A;  2OF9 A;  1KT5 A;  2RTM A;  4IB8 A;  1A3Y A;  1RXH A;  2G79 A;  5B5F A;  1GX3 A;  2X45 A;  1N9Y A;  3UEU A;  4CDC A;  4ZJ0 A;  3WJG A;  3U0D A;  4EFG A;  1AVD A;  2QO4 A;  1ICM A;  2AT0 X;  3ZW1 B;  5HAE A;  1E00 A;  1ADL A;  1VWR B;  2PI3 O;  4LKP A;  4XMH A;  1VWL B;  2RTL A;  3B2I A;  1Z24 A;  3CBS A;  4NLI A;  4BX7 B;  5D45 A;  4RUN A;  4BCS A;  4C5P A;  3PEC A;  4EEJ A;  4YMY A;  1ZNK A;  3SLO A;  1LIF A;  4GET A;  2RTO B;  2HMB A;  1N9M A;  1H91 A;  4NV8 A;  1O1U A;  2LBA A;  3VG4 A;  4Z2O A;  1VWK B;  4ZFX A;  5HZ8 A;  3U03 A;  4O3W A;  4QGX A;  3FIQ A;  5IO7 A;  3OJY C;  2HNX A;  1GXA A;  1HBP A;  1LIB A;  2RTE B;  1EXS A;  3LHN A;  4OKA A;  1EUO A;  2WEW A;  4FQB B;  4QAE A;  2CAM A;  4ZR2 A;  1ALB A;  1TVQ A;  1SRH A;  1N7Y A;  5HWZ A;  4IBA A;  4A8Z A;  2CBS A;  1QQS A;  1P6P A;  3NQ9 A;  4YKO A;  3BRN A;  1X71 A;  1X8O A;  2ACO A;  3AEH A;  4GE1 A;  1HMT A;  3P02 A;  3IFB A;  2OZQ A;  4HPA A;  1I05 A;  4YH0 A;  2FR2 A;  3BX8 A;  3CBC A;  2FKG A;  1HMS A;  1X8N A;  2CM9 A;  1E06 A;  3VE1 A;  4HFO A;  2AT8 X;  2RQ0 A;  2KTD A;  2MO5 A;  3NX2 A;  3RE6 A;  2DJF A;  1L6M A;  5F6B A;  3HWD A;  1KQW A;  1BEB A;  1R0U A;  2IZA A;  2JW1 A;  3N91 A;  3OBL A;  4XMG A;  4GZV A;  1PBY A;  5BVQ A;  1UYN X;  3WJE A;  1SRI A;  1Y9T A;  2BLG A;  3HWF A;  3RDO A;  5LJC A;  2XKL A;  1SWB A;  5H9N A;  2Z4H A;  4CK4 A;  3BU9 A;  3HTY A;  1OBQ A;  4Z2P A;  4NP1 A;  3VG2 A;  3HOE A;  1KT6 A;  1VYF A;  4MEE A;  3NQ3 A;  1JBH A;  1GX8 A;  4Y0S A;  4BX6 A;  1B56 A;  2OL6 O;  4AYH A;  3VG6 A;  2RTJ A;  1SA8 A;  3FW5 A;  1IFC A;  1CBQ A;  4IB7 A;  4LZV A;  4AZO A;  1SLG B;  1I78 A;  1ZNL A;  4A1Y A;  3FR2 A;  4YFR A;  4OMX A;  4N7C A;  2ASN X;  2BSZ A;  2W2A A;  2W2B A;  1KT3 A;  3BSZ E;  4ZCB A;  3P24 A;  1OBU A;  4GKC A;  1O8V A;  2JGS A;  2OF8 A;  3WBG A;  4BOE A;  4IB6 A;  4NNT A;  2QO6 A;  2MJI A;  3KZA A;  2HLV A;  3BS2 A;  4QZT A;  1QWD A;  1XKI A;  3B2J A;  3PQS A;  3MX7 A;  3Q6L A;  5FEN A;  4D6A A;  1PM1 X;  3C77 X;  2OFR X;  3SZI A;  4HWM A;  3NAD A;  2Q2P A;  1MOY A;  1NP1 A;  1SXY A;  1SWR A;  1RST B;  1EQD A;  2RTQ B;  2FHL A;  1S44 A;  1ZND A;  3AKM A;  4WFV A;  4Y0Q A;  1SMP I;  3EMM A;  4EKV A;  1SWD A;  2A0A A;  3S5X A;  2WQ9 A;  1STS B;  1VYG A;  5HTD A;  3FEL A;  1LPJ A;  5EZ2 A;  3U9P C;  3OD9 A;  1UZ2 X;  3FLL A;  2AT5 X;  2RTD B;  1Y53 X;  1EW3 A;  2I5Z O;  3NQK A;  1ACD A;  4GUZ A;  2X34 A;  4QNI A;  2NP1 A;  5K68 A;  5CSE A;  3RZY A;  4YBP A;  3MBT A;  1B8E A;  1VWG B;  4UU2 A;  4AZN A;  5KHP A;  2KT4 B;  2E4J A;  2HKD A;  3RDS A;  1SXX A;  2JU8 A;  2NNE A;  5HZQ A;  2A2U A;  4AW8 A;  3EBK A;  1I04 A;  1OEE A;  1T0V A;  5F1E A;  3UEX A;  1SWA A;  3KFF A;  3RDM A;  3PQU A;  4OEL A;  2X32 A;  1SWN A;  3VG7 A;  3GE2 A;  4ORX A;  2AF5 A;  3IA8 A;  3WZP A;  4I3D A;  5AEO A;  3VHH A;  2AL0 X;  1EI5 A;  1FEN A;  1IKE A;  1YP7 A;  3HWG A;  1SWQ A;  4Z6J A;  4ON1 A;  5K67 A;  4MVI A;  5K06 A;  4UU3 A;  1FTP A;  2JOZ A;  2PY1 A;  1ZRY A;  4I3C A;  1FDQ A;  3JS1 A;  1SRE A;  2JU3 A;  2NNQ A;  4AZR A;  4O3Y A;  4GGR A;  4AZQ A;  4MVL A;  2ZAI A;  4YVB A;  1LIE A;  3D97 A;  3WOV A;  2POA A;  1D3S A;  4BVM A;  2AH7 X;  4BX6 B;  2Z4I A;  3AUM O;  4Z2V A;  1NP4 A;  1BSQ A;  4DQ3 A;  2UYW A;  3SZH A;  3EBW A;  3VPJ E;  1VWC B;  1LFO A;  1ERB A;  2KD2 A;  5C0N A;  4M7M A;  1B0O A;  1AB0 A;  1SY2 A;  2RN4 A;  4I95 A;  1SY3 A;  2VDF A;  1W5R A;  3AKN A;  2X4M A;  4BJ8 A;  1E02 A;  3G7X A;  5IO6 A;  1SLF B;  1X89 A;  1VWP B;  1NBX A;  1D2U A;  3OE3 A;  4FGI B;  2FR3 A;  3WJB A;  1EII A;  1LCZ A;  4R0B A;  1YWA A;  2OVA A;  4GRJ A;  1ICN A;  1JIW I;  4QYN A;  4YBU A;  1B4M A;  4YKM A;  2A5C A;  1KQX A;  1SRG A;  1QFV A;  4U46 A;  2BS5 A;  3VGW A;  2G78 A;  5B11 O;  3BDR A;  1T68 X;  1GGL A;  1QY0 A;  1A18 A;  2QO5 A;  1FE3 A;  2HYS A;  3T6F A;  3PP6 A;  1RLB E;  1SWL A;  1VYO A;  2ALL X;  2IZF B;  2MWH A;  3B2K A;  4ORW A;  1EPA A;  4KC8 A;  5HTE A;  5L8O A;  4CDE A;  1ZNH A;  2WWP A;  3NP1 A;  5HZ9 A;  4GDA A;  2QM9 A;  3RY1 A;  2OFA A;  3B2H A;  1MDC A;  3HOL A;  5CYB A;  2FWV A;  4QZU A;  4TKJ A;  4GJS A;  3VG5 A;  1RAV A;  2CBR A;  3O19 A;  1LCV A;  1VPR A;  1VWF B;  3E3C A;  3MG5 A;  4IAB A;  5BVS A;  3TZS A;  2HZR A;  2OY8 A;  2Q9S A;  2OVS A;  2A5B A;  1SWK A;  4JNJ A;  1KZW A;  1N4J A;  3LTW A;  4ZGU A;  2G5L A;  3S60 A;  5HCD C;  4LZU A;  5LKE A;  2RTB B;  4GH7 A;  2DM5 A;  2BC3 A;  4ZHC A;  1JYJ A;  2C1S A;  4GK9 A;  4L3R A;  5LJE A;  2AVI A;  3X00 A;  4JGL A;  2Q39 A;  4O4S A;  3ZWE A;  2RTR B;  4FBO A;  4ORR A;  1NQN A;  3ZI8 A;  2L5P A;  5F7G A;  3VHI A;  4BQU A;  2OY1 O;  2X56 A;  2ZAG A;  1IJ8 A;  4ES7 A;  5HA1 A;  1GKA A;  4IMN A;  5B29 A;  5LJH A;  4L1N A;  3VHM A;  3PDF A;  1HQP A;  2C4I A;  3MVF A;  4MIR A;  4U8U O;  5B2A O;  2QCB A;  5FQ6 E;  1IIU A;  2IZG B;  4CPF A;  1SXU A;  1U0X A;  1KT4 A;  3KFH A;  5H9K A;  4ORY A;  1A57 A;  2OVD A;  3ELX A;  4YGG A;  4D6B A;  1S7D A;  1EAL A;  1AQB A;  1UYO X;  3PED A;  2JN3 A;  3WYP A;  1S2P A;  2Y3E A;  5IO5 A;  4IAX A;  2FGS A;  3D9W A;  1SWC A;  5FQ8 E;  3ZW2 A;  2LB6 A;  2OY5 O;  4A60 A;  3CQR A;  3HK1 A;  4XMD A;  2GJ5 A;  4PJ2 A;  1PEE A;  3SZJ A;  5JR8 A;  1X8P A;  2YMS A;  3PH5 A;  2Q4N A;  2IZL B;  3F6Z B;  3BX7 A;  4GD9 A;  4HPB A;  4QRL A;  1VWJ B;  1KL4 A;  1AVE A;  4U8U N;  2KW1 A;  1YWC A;  2CZU A;  2FS7 A;  1JZU A;  2FKJ A;  3DSZ A;  1NC9 A;  4ODD A;  4Y0P A;  3NPO A;  4JHQ A;  1KT7 A;  1G85 A;  1LF7 A;  4I9R A;  2RTK A;  1BRP A;  2WEX A;  1PBO A;  1SY1 A;  4JO6 A;  1RXK A;  2Q2M A;  3CMP A;  1G5W A;  3ELZ A;  1YWD A;  2IZH B;  3KVN A;  1OEJ A;  3P6F A;  3WYQ A;  2K62 A;  3WZO A;  5AJC A;  1K24 A;  1LDO A;  2L68 A;  1X8U A;  1SWF A;  2FTB A;  3PPT A;  2FHN X;  4O4X A;  1EIO A;  1IFB A;  1LEL A;  3I17 A;  4AZP A;  1CBR A;  2GTL O;  4U3Q A;  1BJ7 A;  3SAO A;  4GNY A;  3APX A;  5IXG A;  3EC5 A;  1BWY A;  5LJD A;  3VE2 A;  2RTF B;  1MX8 A;  4YFP A;  1SWH A;  1I06 A;  2WQA E;  4GGT A;  5F6Z A;  1DZM A;  4OEM A;  4WBK A;  2JMB A;  3BLG A;  4MVK A;  3T1D A;  4Z27 A;  4O4U A;  2N93 A;  3Q34 A;  1YIV A;  1VWH B;  5B27 A;  2GH7 A;  4I60 A;  3P6G A;  2IZJ A;  4GGZ A;  4RUU A;  1VWA B;  1FEM A;  1GT3 A;  5HCC C;  4ML7 B;  1JJU A;  4TJZ A;  4Y59 A;  4NYQ A;  5F58 A;  1VWQ B;  1U18 A;  1Y9L A;  4YGH A;  1BRQ A;  5AQ6 A;  2QOM A;  2VFB A;  3RBY A;  1GM6 A;  1YUP A;  3TGA A;  1KXO A;  3NX1 A;  1KFF A;  2GTL N;  1GX9 A;  4EQA C;  2IZB A;  4YGZ A;  3FEN A;  2RTH B;  3B2L A;  1DZP A;  4GDZ A;  5D8J A;  4Z28 A;  4CSB A;  3GAQ A;  1JQP A;  2OL8 O;  2F01 A;  2KTS A;  4YFQ A;  2RD7 C;  3FR4 A;  4LQZ A;  1GKA B;  2AT6 X;  2Y3F A;  2K23 A;  1GT4 A;  5F2B A;  1HQQ A;  1STR B;  1DF8 A;  2AMM X;  3CQN A;  3LV4 A;  4Y0R A;  2XST A;  3PK2 A;  1CJ5 A;  3HPE A;  3UAQ A;  3APV A;  3CKF A;  1LCW A;  2X55 A;  2A8G A;  4O9S A;  3CKG A;  2FS6 A;  5B5G A;  3V8U A;  2X8F A;  4OS8 A;  1HBQ A;  2LKK A;  3SLT A;  4TKH A;  3I0A A;  1Y55 X;  2OFM X;  3BU1 A;  4TNN A;  1DF3 A;  1LDQ A;  1YWB A;  4TKB A;  3HWE A;  4IAW A;  1AEL A;  3UEW A;  4KT5 A;  4ZHF A;  4PSQ A;  1VWM B;  2GC9 A;  1X8Q A;  2YG2 A;  2FLJ A;  1SWT A;  3APW A;  2A3F X;  4WFU A;  3STN A;  5B3M O;  1T8V A;  4NLJ A;  3H3I A;  2RCT A;  3QQ2 A;  3S5V A;  1DZJ A;  5D4A A;  1MK5 A;  3RWX A;  3SLJ A;  3FYF A;  4QGV A;  5L8N A;  4DCB A;  4GJV A;  3FA6 A;  3O2Y A;  4I6S A;  2RTN B;  1URE A;  3RDQ A;  4KC7 A;  2M4L A;  5FFH A;  4BGF A;  2DJG A;  1LUQ A;  1XCA A;  2F09 A;  1KOI A;  2IZD B;  2ANS A;  3EYC A;  4YCH A;  3ZUO A;  3ZW0 A;  1MUP A;  1E2T A;  1GT1 A;  3RY2 A;  3T2W A;  1IW2 A;  4O3X B;  1GT5 A;  1O1V A;  5LJG A;  2OFB A;  1SLD B;  1SWO A;  1OPA A;  3EW1 A; 
#chains in the Genus database with same CATH homology
 2BS6 A;  4XME A;  4HPC A;  3STM X;  2MHD A;  3P6C A;  1JV4 A;  3QKG A;  3FA9 A;  4QQ1 A;  3F9D A;  3C78 X;  5H9A A;  4QGW A;  3P6E A;  3TGB A;  5EDB A;  4M6S A;  4A1H A;  5HCE C;  3FA8 A;  4DQ4 A;  2L9C A;  4ORS A;  1OPB A;  4ARH A;  5HZ6 A;  4NYR A;  1TW4 A;  3TGC A;  1TOW A;  1QY2 A;  2X8S A;  4NW4 A;  2BT9 A;  2X46 A;  5DPQ A;  1QAB E;  2ACP X;  5EED A;  3CWK A;  3FEP A;  3C76 X;  3S26 A;  1KZX A;  3ZUI A;  3D95 A;  4YDA A;  4YCE A;  3STK A;  4XMF A;  1ZNG A;  1TXL A;  2RCQ A;  3FR5 A;  4ORU A;  5D48 A;  5AJB A;  1MVG A;  3NR3 A;  4ID2 A;  4ZHD A;  1BSY A;  4CV7 A;  5FQ7 E;  1E5P A;  2RA6 A;  4INN A;  2MM3 A;  4XMC A;  4EXZ A;  4ZH9 A;  1I4U A;  1ML7 A;  1FEL A;  5KIC A;  4QYP A;  3VU1 A;  2WSJ A;  1EPB A;  1SXW A;  4U8U M;  4IB9 A;  2WUT A;  3RSW A;  1A2D A;  1DFV A;  4TLJ A;  3RKG A;  4ZHG A;  1JYD A;  3ZZV A;  2CZT A;  3P6D A;  2R73 A;  4OMW A;  1JJX A;  1IKJ A;  2F73 A;  1QY1 A;  1U17 A;  1LKE A;  1CRB A;  1RBP A;  3KFI A;  5EEE A;  3FMZ A;  4HPD A;  4ALO A;  2JU7 A;  4COT A;  2BHV A;  4EDE A;  1SY0 A;  4MVE A;  5HBS A;  5BYP A;  5HA0 A;  2LFO A;  1BBP A;  2G7B A;  4KII A;  5H9L A;  1ERX A;  1CBI A;  4ZGF A;  4KCA A;  3ZW1 A;  1AVG I;  1HN2 A;  1LNM A;  5L8I A;  4AZM A;  1G74 A;  1YP6 A;  1DC9 A;  1HMR A;  3NBX X;  5CE4 A;  4GNW A;  4OS0 A;  5BVT A;  5LJK A;  3ZW0 B;  2NND A;  4OS3 A;  1DV9 A;  1BM5 A;  1QFT A;  2W2F A;  2LBV A;  5DG4 A;  4I3B A;  5EPQ A;  1MX7 A;  1LIC A;  3WJF A;  2L67 A;  2AT3 X;  4ALB A;  4WHI A;  4U9C A;  3P6H A;  4GU8 A;  2A2G A;  5HZ5 A;  1OBP A;  2GTL M;  1TOU A;  3L4R A;  5H8T A;  5KID A;  3D96 A;  2FT9 A;  3F8A A;  3KQ0 A;  3KFG A;  4ZH6 A;  3APU A;  4KH8 A;  4N7D A;  1QG5 A;  3O22 A;  4O4O A;  3SOT A;  3JQO A;  3VG3 A;  3WVM A;  5LJB A;  4YDB A;  4TQ2 A;  1BLR A;  3WJC A;  1KGL A;  3FW4 A;  1N0S A;  2FRS A;  4O3Z A;  3PH6 A;  1CBS A;  1DZK A;  2R56 A;  3BY0 A;  4K19 A;  4LKT A;  1ZNE A;  2R74 A;  2HZQ A;  1OEK A;  1LID A;  3FEK A;  2A13 A;  5EDC A;  3ZQ3 A;  3FA7 A;  2GTF X;  3EM0 A;  2OVE A;  5F7G A;  2WR6 A;  1PMP A;  2QOS C;  2X8T A;  5FAZ A;  3TF6 A;  4FBR A;  2EU7 X;  2IFB A;  4O49 A;  5D47 A;  3K3L A;  1BSO A;  2LA7 A;  2AKQ A;  3WXQ A;  2P8G A;  2CM4 A;  3JSQ A;  3D4R A;  2QMI A;  1G7N A;  4IMO A;  4NNS A;  4MIS A;  2O62 A;  4I9S A;  5LKF A;  3DTQ A;  3WJD A;  3CR6 A;  3UEV A;  1NGL A;  4FBV A;  1JJJ A;  4IB8 A;  1KT5 A;  1A3Y A;  2G79 A;  2X45 A;  3UEU A;  4ZJ0 A;  3WJG A;  3U0D A;  4EFG A;  2QO4 A;  1ICM A;  2AT0 X;  3ZW1 B;  5HAE A;  1E00 A;  1ADL A;  4LKP A;  4XMH A;  3B2I A;  3CBS A;  1Z24 A;  4NLI A;  5D45 A;  4RUN A;  4YMY A;  3PEC A;  1ZNK A;  1LIF A;  4GET A;  2HMB A;  1H91 A;  1O1U A;  2LBA A;  3VG4 A;  4ZFX A;  5HZ8 A;  3U03 A;  4O3W A;  4QGX A;  3FIQ A;  5IO7 A;  3OJY C;  2HNX A;  1GXA A;  1HBP A;  1LIB A;  3LHN A;  1EXS A;  4QAE A;  1EUO A;  2WEW A;  4FQB B;  4ZR2 A;  1ALB A;  1TVQ A;  5HWZ A;  4IBA A;  4A8Z A;  2CBS A;  1QQS A;  1P6P A;  3NQ9 A;  4YKO A;  3BRN A;  1X71 A;  1X8O A;  2ACO A;  4GE1 A;  1HMT A;  3P02 A;  3IFB A;  2OZQ A;  4HPA A;  1I05 A;  4YH0 A;  2FR2 A;  3BX8 A;  3CBC A;  1HMS A;  1X8N A;  2CM9 A;  1E06 A;  3VE1 A;  4HFO A;  2AT8 X;  2RQ0 A;  2KTD A;  2MO5 A;  3NX2 A;  1L6M A;  5F6B A;  3HWD A;  1KQW A;  1BEB A;  1R0U A;  2JW1 A;  3N91 A;  3OBL A;  4XMG A;  4GZV A;  5BVQ A;  3WJE A;  1Y9T A;  2BLG A;  3HWF A;  5LJC A;  2XKL A;  5H9N A;  2Z4H A;  4CK4 A;  3BU9 A;  3HTY A;  1OBQ A;  4NP1 A;  3VG2 A;  3HOE A;  1KT6 A;  1VYF A;  3NQ3 A;  1JBH A;  1GX8 A;  4Y0S A;  1B56 A;  4AYH A;  3VG6 A;  1SA8 A;  3FW5 A;  1IFC A;  1CBQ A;  4IB7 A;  4LZV A;  4AZO A;  1ZNL A;  4A1Y A;  3FR2 A;  4YFR A;  4OMX A;  4N7C A;  2ASN X;  2W2A A;  2W2B A;  1KT3 A;  3BSZ E;  4ZCB A;  3P24 A;  1OBU A;  4GKC A;  1O8V A;  3WBG A;  4BOE A;  4IB6 A;  4NNT A;  2QO6 A;  2MJI A;  3KZA A;  2HLV A;  3BS2 A;  4QZT A;  1QWD A;  1XKI A;  3B2J A;  3PQS A;  3MX7 A;  3Q6L A;  5FEN A;  4D6A A;  1PM1 X;  3C77 X;  2OFR X;  4HWM A;  3NAD A;  2Q2P A;  1SXY A;  1EQD A;  3AKM A;  4WFV A;  1S44 A;  1ZND A;  4Y0Q A;  1SMP I;  3EMM A;  2A0A A;  3S5X A;  2WQ9 A;  1VYG A;  5HTD A;  3FEL A;  1LPJ A;  5EZ2 A;  3U9P C;  3OD9 A;  1UZ2 X;  3FLL A;  2AT5 X;  1EW3 A;  3NQK A;  4QNI A;  1ACD A;  2NP1 A;  3RZY A;  4YBP A;  3MBT A;  1B8E A;  4AZN A;  4UU2 A;  5KHP A;  2KT4 B;  2E4J A;  1SXX A;  2JU8 A;  2NNE A;  5HZQ A;  2A2U A;  4AW8 A;  3EBK A;  1I04 A;  1OEE A;  1T0V A;  5F1E A;  3UEX A;  3KFF A;  3PQU A;  3VG7 A;  3GE2 A;  4ORX A;  5AEO A;  3IA8 A;  4I3D A;  2AL0 X;  1EI5 A;  1FEN A;  1IKE A;  1YP7 A;  3HWG A;  4ON1 A;  4MVI A;  5K06 A;  4UU3 A;  1FTP A;  2JOZ A;  2PY1 A;  1ZRY A;  4I3C A;  1FDQ A;  3JS1 A;  4AZR A;  2JU3 A;  2NNQ A;  4O3Y A;  4AZQ A;  4MVL A;  2ZAI A;  1LIE A;  3D97 A;  3WOV A;  2POA A;  1D3S A;  4BVM A;  2AH7 X;  2Z4I A;  1NP4 A;  1BSQ A;  4DQ3 A;  3EBW A;  3VPJ E;  1LFO A;  1ERB A;  2KD2 A;  5C0N A;  4M7M A;  1B0O A;  1AB0 A;  1SY2 A;  2RN4 A;  4I95 A;  1SY3 A;  3AKN A;  1E02 A;  3G7X A;  5IO6 A;  1X89 A;  3OE3 A;  1D2U A;  4FGI B;  2FR3 A;  3WJB A;  1EII A;  4R0B A;  1YWA A;  2OVA A;  4GRJ A;  1ICN A;  1JIW I;  4QYN A;  4YBU A;  1B4M A;  4YKM A;  1KQX A;  1QFV A;  2BS5 A;  2G78 A;  3BDR A;  1T68 X;  1GGL A;  1QY0 A;  1A18 A;  2QO5 A;  1FE3 A;  2HYS A;  3PP6 A;  1RLB E;  3B2K A;  5HTE A;  2ALL X;  2MWH A;  4ORW A;  1EPA A;  4KC8 A;  5L8O A;  1ZNH A;  2WWP A;  3NP1 A;  5HZ9 A;  2QM9 A;  3B2H A;  1MDC A;  3HOL A;  5CYB A;  2FWV A;  4QZU A;  4TKJ A;  3VG5 A;  3O19 A;  2CBR A;  1VPR A;  3E3C A;  4IAB A;  5BVS A;  3TZS A;  2HZR A;  2Q9S A;  2OVS A;  1KZW A;  4ZGU A;  3S60 A;  5HCD C;  4LZU A;  5LKE A;  4GH7 A;  2DM5 A;  4ZHC A;  1JYJ A;  4GK9 A;  4L3R A;  5LJE A;  4JGL A;  2Q39 A;  4O4S A;  3ZWE A;  4FBO A;  4ORR A;  3ZI8 A;  2L5P A;  4BQU A;  2ZAG A;  4ES7 A;  5HA1 A;  1GKA A;  4IMN A;  5B29 A;  5LJH A;  4L1N A;  1HQP A;  3MVF A;  4MIR A;  4U8U O;  5FQ6 E;  1IIU A;  1SXU A;  1U0X A;  1KT4 A;  3KFH A;  5H9K A;  4ORY A;  1A57 A;  2OVD A;  3ELX A;  4YGG A;  4D6B A;  1S7D A;  1EAL A;  1AQB A;  3PED A;  2JN3 A;  1S2P A;  5IO5 A;  4IAX A;  5FQ8 E;  3ZW2 A;  2LB6 A;  4A60 A;  3CQR A;  3HK1 A;  4XMD A;  2GJ5 A;  4PJ2 A;  1PEE A;  5JR8 A;  1X8P A;  2YMS A;  3PH5 A;  2Q4N A;  3F6Z B;  4EEJ A;  3BX7 A;  4HPB A;  4QRL A;  4U8U N;  2KW1 A;  1YWC A;  2CZU A;  2FS7 A;  1JZU A;  3DSZ A;  4ODD A;  4Y0P A;  3NPO A;  1KT7 A;  1G85 A;  1LF7 A;  4I9R A;  1BRP A;  2WEX A;  1PBO A;  1SY1 A;  2Q2M A;  3CMP A;  1G5W A;  3ELZ A;  1YWD A;  3P6F A;  1OEJ A;  2K62 A;  5AJC A;  2L68 A;  1X8U A;  2FTB A;  3PPT A;  4O4X A;  1EIO A;  1IFB A;  3I17 A;  4AZP A;  1CBR A;  2GTL O;  4U3Q A;  1BJ7 A;  3SAO A;  4GNY A;  3APX A;  1BWY A;  5LJD A;  3VE2 A;  1MX8 A;  4YFP A;  1I06 A;  2WQA E;  5F6Z A;  1DZM A;  4WBK A;  2JMB A;  3BLG A;  4MVK A;  3T1D A;  4O4U A;  2N93 A;  1YIV A;  5B27 A;  3P6G A;  4RUU A;  1FEM A;  1GT3 A;  5HCC C;  4ML7 B;  4TJZ A;  4NYQ A;  5F58 A;  1U18 A;  1Y9L A;  4YGH A;  1BRQ A;  5AQ6 A;  3RBY A;  1GM6 A;  1YUP A;  3TGA A;  1KXO A;  3NX1 A;  2GTL N;  1GX9 A;  4EQA C;  4YGZ A;  3FEN A;  3B2L A;  1DZP A;  4GDZ A;  5D8J A;  4CSB A;  3GAQ A;  4YFQ A;  2KTS A;  2RD7 C;  3FR4 A;  4LQZ A;  1GKA B;  2AT6 X;  4ZHH A;  2K23 A;  1GT4 A;  1CJ5 A;  2AMM X;  3CQN A;  3LV4 A;  4Y0R A;  2XST A;  3UAQ A;  3APV A;  4O9S A;  3V8U A;  2FS6 A;  2X8F A;  4OS8 A;  1HBQ A;  2LKK A;  4TKH A;  3I0A A;  2OFM X;  3BU1 A;  4TNN A;  1DF3 A;  1YWB A;  4TKB A;  3HWE A;  4IAW A;  1AEL A;  3UEW A;  4KT5 A;  4ZHF A;  4PSQ A;  2YG2 A;  2GC9 A;  1X8Q A;  2FLJ A;  3APW A;  2A3F X;  4WFU A;  3STN A;  1T8V A;  4NLJ A;  3H3I A;  2RCT A;  3S5V A;  1DZJ A;  5D4A A;  3RWX A;  3FYF A;  4QGV A;  5L8N A;  3FA6 A;  3O2Y A;  4I6S A;  1URE A;  4KC7 A;  2M4L A;  5FFH A;  1XCA A;  2F09 A;  1KOI A;  3ZUO A;  2ANS A;  3EYC A;  4YCH A;  3ZW0 A;  1MUP A;  1GT1 A;  1IW2 A;  4O3X B;  1GT5 A;  1O1V A;  5LJG A;  1NP1 A;  1OPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...