1HNAA

Crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
217
structure length
217
Chain Sequence
PMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVFGNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTATHIONE S-TRANSFERASE
publication title Crystal structure of human class mu glutathione transferase GSTM2-2. Effects of lattice packing on conformational heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase(glutathione)
total genus 71
structure length 217
sequence length 217
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1993-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00043 GST_C Glutathione S-transferase, C-terminal domain
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 1hnaA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 1hnaA01
5DQYA 1THOA 3W8SA 1SJIA 4JBBA 2C0DA 4F0CA 3KP8A 3BCKA 5D9XA 4KSMA 1O73A 3U5RE 1Y25A 2EIRA 5AISA 3IHQA 3I69A 3UVTA 3KD0A 2VO4A 3G7IA 3LG6A 3J7Yb 4CW9A 1KTEA 3J7Yk 5DVBA 4J2FA 1GTUA 5E59A 2LRNA 4ISDA 2FLSA 5B6NA 3Q18A 1T3BA 1FOVA 3A2XA 3FR6A 5FWGA 4KDYA 2P5RA 2YZUA 3HD5A 2I1UA 4N30A 1R26A 1ILOA 4LL4B 2BTOT 4QQ7A 4XS1A 3DRNA 1TRSA 4NWYA 3DKSA 3UBKA 4ZXGA 3GH6A 2WULA 2LNSA 3E0UA 7GSSA 1JLWA 5IMDA 1GTBA 3SBCA 3D6IA 5D73A 5H5RA 1LJRA 2OE1A 3F4TA 4KE3A 1NHYA 1Z6MA 3D4MA 4F0BA 4OMVA 3P8WA 2C3QA 4GSNA 2F51A 5ECHB 3IPZA 1JZRA 2H6ZA 4L0UA 2ZUPA 3KMOA 1GUKA 2EIQA 5INYA 2HSHA 1GSQA 4F82A 2GSRA 1SK1A 3TRPA 1HNCA 4MPFA 3L78A 4AJ6A 3CSIA 3Q19A 3WYWA 1EV9A 2YV9A 4POMA 5ELAA 4D73B 4RI7A 4MF5A 2OBIA 2YP6A 2WB9A 6GSTA 3PPUA 1DSBA 2GSTA 2PU9C 5EVOA 4Q5NA 4PTSA 1U3IA 3L9SA 2OE0A 2RM6A 3P2AA 2RLIA 1M9AA 6GSXA 3ZIVA 2V6KA 2NPBA 5C00A 4KF9A 4MJAA 1A8YA 2K8VA 3DWVA 1B9XC 2HSYA 2UZ8A 3RDWA 4NAXA 2HSNB 1U87A 1XW9A 3VI5A 4GSSA 3H79A 2F8FA 2H0HA 3HA9A 2GLRA 1OC9B 2FNOA 2PVQA 2VL9A 5JCWA 2FD3A 2HZEB 1T00A 3O3TA 3D22A 3NZNA 3ZITA 4QL9A 3E9JB 2GZZA 4K0NA 5JWRB 5IMAA 4D73A 3C1RA 5DAKB 1GL8A 4KCEA 1OYJA 3GHAA 2N5AA 1TXXA 2H66A 1WRYA 4HUAA 2VCZA 2VD1A 4KCAA 3Q74A 4H86A 3KM6A 4WKWA 1M99A 4I2TA 4HJ2A 2KP2A 2VL3A 4K7NA 3VWXA 2GQMA 2L4QA 3UBLA 1FW1A 1FAAA 5JCGA 1PX7A 3VWWA 3DMLA 5EY6A 4PUFC 5B8AA 4BVYB 1TRUA 2O7KA 1OC9A 4AGSA 3QMXA 2HZEA 4ML6A 1XWKA 2CQ9A 1EV4A 4G10A 1Z6NA 3ZLPA 4K7OA 2VD0A 3W6GA 2CX4A 3IK9A 2CVBA 5H5QA 4WF5A 3VURA 2YCDA 1EOGA 2C3NA 2C8UA 2EC4A 5DAKA 3LFLA 4I8BA 3IAM2 1SYXA 2ES7A 5GSSA 3A5WA 3FHKA 3QAVA 4JE1A 2DC5A 2QKEA 5G1KA 3GA4A 3HXSA 2K9FA 4FYBA 1GRXA 1S3AA 1USBA 3EYTA 3HYPA 2I81A 2V1MA 4X43A 5KN0A 4MA9A 1X9SB 1FVKA 2MZCA 3CXGA 4L8EA 2E2GA 2TIRA 2KLXA 4BVYA 1O8XA 1J9BA 3GX8A 3ZTLA 3I6AA 3QFAC 2H8LA 2YNXA 3LQ7A 2E0QA 2MMOA 4HU7A 4EDYA 5A4WA 4L0WA 4NV5A 4YQVA 3QR6A 4PX1A 2R4VA 2F9SA 5G5FA 4HOJA 2M72A 2XBQA 3SWLA 1OVNA 2HSMB 1AXDA 2OA7A 1V57A 1RW1A 22GSA 5CRWA 4GQFA 5F0GA 2H73A 1U6TA 3FYGA 3L9VA 3EMXA 1PL1A 1AQVA 3F4SA 2YWNA 1G6WA 1K0OA 2H72A 3C1SA 1FB6A 1Z9HA 4NXIA 5G5EA 4JRRA 4MP4A 1G7EA 1F3BA 2WJUA 2JSYA 2N5BA 1TRWA 1ZMAA 3LYPA 1UC7A 1LBKA 2C1YA 4ZL9A 4E8HA 3CTFA 3FZ9A 4ULXA 3K8NA 3HJOA 1EZKA 2V32A 3KH9A 5B7CA 2HSMA 2PWJA 2OE3A 4BL7B 2WDUA 4GCIA 4GSTA 4MABA 4IP1A 2IMDA 1BX9A 4JU5A 1UA5A 3M0FA 4TW5A 5GZZB 3TJJA 3IV4A 1JLVA 4MF7A 1M7TA 1EGRA 1ST9A 1YJ6A 4WETA 3UIWA 1THXA 4WEYA 5CRDA 3LXZA 4J57E 2RIIA 3IK7A 1M9BA 1SYRA 5J9BA 2GZYA 5J9CA 2MMAA 3C71A 5BMUA 1M2DA 3M1GA 1ERWA 3KH7A 2R37A 3LEFA 5GAPD 5IM9A 2K8SA 1HD2A 3RHBA 4ZB6A 3TKRA 1TI3A 2GDRA 4BL7A 3HZ8A 1HYUA 3H1NA 1SL0B 5CNWA 3LORA 4V2NA 5IMVA 2H1GA 2PMTA 4XHMA 1PMTA 2JSZA 2CVKA 1NM3A 3P7XA 3ZMKA 2CVDA 5HR1A 3GFKA 2PBJA 4FIWA 2CT6A 2VL2C 3ZYWA 2VCQA 4DSRA 3ERWA 5CP1A 1FO5A 1V58A 3ZFBA 1EEJA 1X5EA 3ZZXA 1WIKA 4IVFA 2X99A 2AV4A 3CMIA 4Q5QA 3APQA 4XCSA 4TR0A 3HY2A 4HI7A 3FR3A 1F37A 1A0RP 1XVWA 4V2MA 1MEKA 4XS4B 1AIUA 1V2AA 2A4VA 1XWAA 1GNWA 3FW2A 3C7MA 4KX4A 1M2AA 1XWBA 1XXUA 3TGZA 4G0KA 2MMZA 4X0XA 1TK0B 2XPEA 4QL7A 1FB0A 3BBYA 4CDOA 4I5QA 2KHPA 1QXHA 1OAZA 1ERTA 5G30A 3GKNA 5ABRA 2O8VB 2HRKB 4G19A 3HDCA 3APSA 3FR9A 4IGJA 4O7HA 4HJMA 4TKYA 3EINA 4YAVA 3I43A 2ALBA 4MK3A 3GKXA 2XHFA 4XS4A 5ID2B 2YZHA 2DJJA 1PGTA 3ME8A 4ZILA 2CA8A 2R6KA 4ECJA 5HR0A 1FVJA 3MDKA 1PRXA 4HEA2 3KJYA 4PXOA 3F6FA 2LRCA 4KGIA 4KSOA 3ZREA 3HKRA 4YQMA 3VFIA 4F9ZA 2B7JA 1MDJA 2IN3A 1OKDA 1Y6EA 2HRKA 2MMNA 2GQLA 2O87A 1R7HA 3L9UA 4O32A 1XZOA 2IMEA 3HJPA 1G7OA 2VOCA 1ZL9A 4K9ZA 4PQ1A 2B5XA 3EU4A 4MLYA 2H75A 1EP8A 4V1Ag 1WP0A 4MH2A 5ID2A 4FH8A 5EPFA 2QGVA 18GSA 1QK8A 3R2QA 2LUSA 2CAQA 2JZTA 3HVSA 3D5JA 3DIEA 5A4VA 1XWCA 3W8JA 2B7KA 5DDLA 3VI7A 5JWOB 2H30A 2RM5A 2ON7A 1I5GA 5CRHA 3TOTA 5CO3A 1MTCA 5HFKA 1TRVA 3QFBC 3F6DA 3KCMA 5LD0A 3HHVA 5IO2A 2O89A 3PINA 2TRCP 4Q5RA 3WT1A 3GTUB 2NBSA 6GSSA 3UOMA 3D0ZA 4XIHA 2H1AA 1PX6A 2K18A 4LLRA 4YH2A 19GSA 2DJ3A 2REMA 1N2AA 3TKSA 2AAWA 4LL1B 4JR6A 3IBHA 1JFUA 4WR4A 4MJCA 4G0IA 5ECQB 3ED3A 2F8AA 3UAPA 1YQ1A 1QGVA 2H1DA 5J5NA 2L57A 5ECOB 3CTGA 3M3MA 3L4NA 2LKUA 3TRXA 2IMFA 3UJ1A 1YF0A 1GNEA 4XS6A 5CAXA 3CYNA 1GLQA 2L5OA 1SD9A 1H4OA 5DJMA 3FRCA 3RAZA 1KBNA 1TKDB 3GTUA 5AIXA 3RBTA 5J4UA 4DEJA 2YN1A 1Z7PA 3EWLA 2IFQB 3H4KA 4JZQA 3BOAA 4BVXB 3AY8A 3GUSA 1DUGA 1EWXA 3HCZA 3LWAA 1W89A 1T7PB 3OR5A 3QAGA 3GL3A 2I4AA 3KXOA 1K0AA 1Z7RA 2WGRA 5CYYA 5D9VA 1OE7A 1GH2A 3C8EA 1UVZA 5F07A 2GVPA 4PNFA 3FZ5A 2LQOA 1YEXA 2I3YA 5C04A 4TRXA 5B8BA 2GQKA 3I9V2 2FA8A 4WBJA 2VM2A 3DVXA 2LJAA 1TK5B 4OFTA 1YKAA 2EIOA 5G31A 2RUEA 3VWVA 4P3YB 1GULA 2IFQA 4IQ1A 4BVXA 1FG4A 5IMFA 5G1LA 1T4ZA 1ZCPA 5CRGA 1TI1A 2B1KA 3C73A 1ACVA 1SU9A 1QMVA 2TRXA 4HDEA 2HXKA 1TK8B 5EL8A 4IN0A 4O5RA 3F63A 3TJKA 2FWEA 4DSSB 3TKPA 2H0GA 1WOUA 4KNDA 4KB3A 4OD7A 4IW9A 4HZ2A 5IOWA 1F6MC 1A24A 5HR3A 2MBSA 4GRFA 1YZXA 2I9HA 1J08A 2IWTA 4ML1A 2NVLA 10GSA 1IYIA 3DYRA 1K3OA 2V2GA 2AYTA 3D4TA 2GSSA 2L5LA 2DIZA 2HLSA 4ID0A 2XC2A 1M2BA 3GX0A 4TR4A 1ZGNA 1GSEA 3F4RA 3ZVJA 3GL5A 1Z5YE 2HQTA 2P0GA 3CSJA 2QSIA 4GXZA 5KN1A 1UN2A 4EKZA 2QC7A 2V41A 3GKKA 1SKWB 3TUEA 3TJGA 4MDCA 3LYKA 1S3CA 4FQUA 1TJDA 1F2EA 2D2ZA 2C4JA 4DSSA 4IBPA 4FYUA 2LQQA 3UVHA 5DQSA 3UL3A 4I97A 4EF0A 4NMUA 5AN1A 3KTLA 1VGLA 3RHCA 1B4QA 5DALB 3UARA 3H93A 1TU7A 1WE0A 1R4WA 3S9FA 1JHBA 1A23A 1NW2A 2JZSA 2R5GA 2H71A 4G9HA 4TOPA 4AF2A 5L71A 4MZWA 1XCCA 2H01A 1XFLA 4IELA 4NV2A 3APOA 4ZB9A 2NTOA 1O8WA 1G6YA 3GURA 3ZMLA 5AGYA 3KGKA 2L6DA 4WR5A 2C3TA 4GF0A 4K0GA 4GTUA 4TR1B 4ECCA 3MAKA 5HR2A 1SK0A 2HNLA 2N5FA 4KA0A 5A5KA 2H1BA 5IO0A 1BG5A 3EC3A 4AJ8A 3P90A 1K0MA 1GTIA 4EC0A 4OO4A 3IXRA 3F3QA 5DALA 2KP1A 1AC1A 3WGXA 2LTKA 1C72A 4I6XA 4XRDA 4MZCA 5F06A 4POBA 2X8CA 3EU3A 2GT6A 2PVOC 3WGEA 5E4WA 2GS3A 3LXTA 5LNKe 4ZB8A 2Z9SA 3EE2A 2PERA 2FWFA 4KH7A 3IA1A 2GSQA 4G2EA 1VF1A 2IMKA 4EDZA 1ERUA 3FZAA 2DLXA 4ECIA 2HRNA 1KNGA 4YQUA 2YWMA 4IS0A 2R3XA 1XIYA 2VCXA 1OC8A 2PUKC 1QUWA 3ZVJD 1V40A 1SKRB 4MZBA 1GSUA 5F8BA 3WGDA 4HQZA 2FWHA 4KAEA 1VRSD 1IYHA 1WMJA 2MYGA 1RK4A 4RQXA 13GSA 1XOAA 1VF4A 1OKTA 2P31A 3FKFA 5H5SA 5COHA 1K0CA 1MDKA 3TOUA 2VIMA 5IQYA 4WXTA 4CHSA 3DGQA 3IR4A 1B9YC 1E2YA 1MD4A 2DJ2A 4DSQA 1F3AA 3M8NA 9GSSA 4KDUA 2H74A 2M46A 2VCVA 5ECIB 2BJXA 1ABAA 3GH9A 4MMMA 5IPHA 2JU5A 1XVQA 5JCUA 1ERVA 2JL4A 1X9MB 4ECBA 2NDOA 2X8GA 2M80A 3V1WA 4KW6A 2VLTA 4KUNA 2AB6A 3GSTA 1WPIA 4OCEA 4MJEA 5J3RA 3GV1A 2WZ9A 6GSWA 3KZQA 2PN8A 1U88A 3VK9A 1EEMA 12GSA 3NIVA 2FY6A 2IJYA 2VAFA 5J41A 2OADA 1BYEA 2CV4A 4PNGA 4K8MA 2B6MA 5F05A 8GSSA 4JEDA 2LSTA 2HRAA 1X5DA 4X1UA 3JCML 3ISOA 2LEGA 3QAWA 1K0NA 5DJLA 1EOHA 1SL2B 1VF3A 3LJRA 3HVXA 5B6MA 1QFNA 3R3EA 3ZIJA 1YY7A 4HQSA 1QQ2A 3IC4A 2IL3A 4IJ3A 1AW9A 4ZL8A 2YWOA 3IDVA 1ML6A 2VLVA 4IHUA 3U6VA 5GSTA 1SKSB 2ON5A 3KEBA 2H76A 5ECLB 2VLUA 4WBRD 3VPQA 3G7YA 2VUPA 2C80A 3A2WA 4L5OA 2DJ0A 3M9KA 4USSA 3QPMA 2L4CA 1TW9A 3ZRDA 1EGOA 1I9DA 4ZIJA 2HYXA 1PKWA 5JWQB 1H75A 5IOXA 1DE1A 3ZL5A 1T4YA 4OO5A 3EURA 4ILFA 4EL1A 4RI6A 3D21A 4EE0A 1OE8A 1Q98A 2LJRA 2OJLA 2X64A 4HS1A 1V9WA 1CQHA 4ACSA 2YOIA 1SENA 5HQPA 2E7PA 4LMWA 4Q5FA 2OBKA 4OWYA 4BA7A 3WD6A 1R5PA 3N5OA 1AQWA 1BQ7A 3F8UA 5ECMB 2RUFA 3IE3A 14GSA 3EMPA 2C0FA 2YJ7A 1PD21 1M0UA 3MSZA 4ZBAA 3QOUA 5A4UA 1B4PA 2IMIA 1SD8A 2C0EA 4NHZA 3CRTA 6GSYA 1DE2A 5ECKB 4POKA 2VM1A 4WF4A 2XPDA 4KDXA 1HNAA 17GSA 2KOKA 1WJKA 4OFNA 4MF6A 4GQCA 1GTAA 2AHEA 5HFIA 2CX3A 1OC3A 4EUYA 2KUCA 2AUVA 2HI7A 5ECSA 4ZBDA 3F9UA 4AJ7A 4TN8A 2WS2A 1Q4JA 1GLPA 4PGTA 1PKZA 1X9WB 2B3SA 3MNGA 1AQXA 2V6OA 4TXOB 3RPNA 1TU8A 4IQAA 4LA1A 3G9BA 2LV3A 1NSWA 6GSUA 1CQGA 1GSDA 3KIJA 2F3MA 1NHOA 1PQNA 5ELGA 3F0IA 4OFMA 2OACA 5IMCA 3A3TA 5GAND 4K1FA 2OKAA 11GSA 1ZZYA 1GUMA 3VLNA 1O85A 2HZFA 1XW5A 4MPGA 3TKSC 1WWJA 2VCWA 1E6BA 1K3LA 4RQRA 1A0FA 1XBSA 3BD2A 1W4VA 1XOBA 3M9JA 1GWCA 6GSVA 1Z3EA 3GYKA 2A2RA 2GTUA 1S3DA 3PR8A 4IJIA 4G0LA 3TCOA 1T1VA 3CSHA 1SJZA 2GT5A 1GSFA 1XWGA 2WRTA 5LCZA 4TXOA 1K0DA 5DCGA 3UEMA 2H6XA 2DSAA 5IIZA 4J56E 3IAS2 1U3AA 3DD3A 2XBIA 3US3A 1MDIA 3TB2A 5ECRB 2DIYA 4EVMA 2AJQB 2YJHA 3GKMA 4IP6A 5DCHA 3NOFA 5ECPB 4YAPA 2C0GA 1G0TA 1ZYQB 2DMLA 2E2MA 3GNJA 1J0FA 2CZ2A 3IC8A 3CBUA 1T8EB 1HQOA 1K3YA 2FWGA 1YKCA 3FEUA 1XW6A 2ZNMA 5FT3A 5ECNB 3E3EA 3ME7A 2DMMA 2G2QA 4V1Ap 4K6XA 1PA3A 2G0FA 1XPVA 2H19A 4BWQA 4N0VA 4N0ZA 5HFGA 1O81A 4GLTA 1ON4A 3O6TA 2HFDA 1V98A 4PQIA 2IPAA 2MBTA 2FGXA 3L0HA 4TXVA 2YWIA 1RQMA 2H0IA 4NPBA 2LJKA 3QD9A 1A2JA 2VL2A 4L5LA 4GWRA 3BCIA 4XTSA 2L6CA 2O85A 2CAIA 1PN9A 4N10A 2L59A 2YPMA 3KTBA 3O76A 2PPTA 4POLA 3IRAA 1A2LA 1A2MA 2FHEA 1KEBA 2H70A 2FCHA 2B1LA 2B5EA 2J9HA 3Q6OA 2DJKA 4V2LA 2WFCA 3TKSE 2K6VA 1TP9A 4PQHA 5KN3A 3HZ4A 1LU4A 1TOFA 5DBQA 4JR4A 2LRTA 3WT2A 5FHIA 3FK8A 4IKHA 1GSSA 3LSZA 1GUHA 3RPPA 3UMAA 3GIXA 1N8JA 5AIVA 2JZRA 4XRAA 4TR3A 1AUCA 4LMVA 1SJ6A 2X8HA 2YV7A 3PGTA 4F03A 4E8EA 1B8XA 1URMA 2PGTA 3LGCA 3G7JA 2IIYA 4K7IA 3VPTA 4BPYA 3GRXA 2HRFA 4NHWA 5KN2A 1JZWA 1F9MA 2A2SA 5IMZA 5D9TA 1BAYA 1JZOA 4HZ4A 1O6JA 4BWSA 4ZL7A 5D96A 4TR1A 4MJBA 1BJXA 3TRQA 3FZ4A 1VF2A 4RUVA 1YEPA 1A8LA 4EXJA 1X5CA 2HE3A 1GSYA 16GSA 3GN3A 20GSA 3ERGA 3QDNA 3BJ5A 5KEJA 3TJFA 1DBYA 1TTZA 4DVCA 2LS5A 2BMXA 1PL2A 4O92A 2J23A 4Z7XA 3FY7A 3GSSA 2R2JA 5G2ZA 3ERFA 1O7UA 4ZBBA 3DEXA 2YANA 1BEDA 1AAZA 1YDKA 4HU9A 2VCTA 2GGTA 5ENUA 5IPGA 5CREA 1FHEA 3MWHA 3GMFA 4F2IA 4MCUA 1GP1A 2LNTA 3CRUA 2ZCTA 1K0BA 1EP7A 3QCPA 2B5YA 4PUAA 4FYCA 5D8IA 1B48A 4EO3A 5D9WA 2WCIA 4K2DA 2FUG2 2JADA 1SL1B 1MD3A 3A2VA 5D93A 4PURA 1X0RA 2P5QA 2CZ3A 1JZDA 4MH3A 2FA4A 3HVVA 4FO5A 3TDGA 4I2UA 3DXBA 2DJ1A 3ZFLA 3IOSA 1HNBA 2DBCA 2GZPA 3DVWA 2H6YA 1PSQA 3H8QA 3F3RA 3VWUA 3HJMA 1YF1A 3KMNA 4N11A 3EVIA 3PH9A 3N9JA 3TKQA 1TDIA 4OCFA 2JACA 1R5AA 3KP9A 2HT9A 1SK2A 1ZYEA 4TVEA 1ZOFA 3TJBA
chains in the Genus database with same CATH superfamily
5DQYA 1THOA 3W8SA 1SJIA 4JBBA 2C0DA 4F0CA 3KP8A 3BCKA 5D9XA 4KSMA 1O73A 3U5RE 1Y25A 2EIRA 5AISA 3IHQA 3I69A 4HSCX 3UVTA 3KD0A 2VO4A 3G7IA 3LG6A 3J7Yb 4CW9A 1KTEA 3J7Yk 5DVBA 4J2FA 1GTUA 5A34B 5E59A 2LRNA 4ISDA 2FLSA 5B6NA 3Q18A 1T3BA 1FOVA 4E68A 3A2XA 1SVOA 3FR6A 5FWGA 4KDYA 2P5RA 2YZUA 3HD5A 2I1UA 4N30A 1R26A 1ILOA 4LL4B 2BTOT 4QQ7A 4XS1A 3DRNA 1TRSA 4NWYA 3DKSA 3UBKA 4ZXGA 3GH6A 2WULA 2LNSA 3E0UA 7GSSA 1JLWA 5IMDA 1GTBA 3SBCA 2O36A 5D73A 3D6IA 5H5RA 1LJRA 2OE1A 1ZYPA 3F4TA 4KE3A 1NHYA 1Z6MA 3D4MA 4F0BA 4OMVA 3P8WA 2C3QA 4GSNA 2F51A 5ECHB 3IPZA 1JZRA 5A34A 2H6ZA 2ZUPA 4L0UA 3KMOA 1GUKA 2EIQA 5INYA 5A1NB 2HSHA 1GSQA 1BF5A 4F82A 2GSRA 1SK1A 3TRPA 1HNCA 4MPFA 3L78A 4AJ6A 3CSIA 3Q19A 3WYWA 1EV9A 2YV9A 4POMA 5ELAA 4D73B 4RI7A 4N3ZA 4MF5A 2OBIA 2YP6A 2EFDA 2WB9A 6GSTA 3PPUA 1DSBA 5KOWA 2GSTA 2PU9C 5EVOA 4Q5NA 4PTSA 1U3IA 3L9SA 2OE0A 2RM6A 3P2AA 2RLIA 1M9AA 6GSXA 3ZIVA 2V6KA 2NPBA 2WZSA 2VKZG 5C00A 4KF9A 4MJAA 4YKFA 1A8YA 2K8VA 3DWVA 1B9XC 2HSYA 2UZ8A 3RDWA 4NAXA 3TU3B 2HSNB 1U87A 1XW9A 3VI5A 1Y1UA 4GSSA 3H79A 2F8FA 2H0HA 3HA9A 4K2XA 5BRTA 2GLRA 1OC9B 5A1NA 2FNOA 2PVQA 2VL9A 5JCWA 2FD3A 2HZEB 1T00A 3O3TA 3D22A 3NZNA 3ZITA 4QL9A 3E9JB 2GZZA 4K0NA 5JWRB 5IMAA 4D73A 3C1RA 5DAKB 1GL8A 4KCEA 1OYJA 3GHAA 2N5AA 4BIKA 1TXXA 2H66A 1WRYA 4HUAA 2VCZA 2VD1A 4KCAA 3Q74A 4H86A 3KM6A 1PFOA 1M99A 4WKWA 4I2TA 4HJ2A 4PI2C 2KP2A 1BG1A 2VL3A 4K7NA 3VWXA 2GQMA 2L4QA 3UBLA 1FW1A 1FAAA 5JCGA 2HSNA 1PX7A 3VWWA 3DMLA 5EY6A 4PUFC 5B8AA 4BVYB 1TRUA 2O7KA 1OC9A 4AGSA 3QMXA 2HZEA 4ML6A 1XWKA 2CQ9A 1EV4A 4G10A 1Z6NA 3ZLPA 4K7OA 2VD0A 3W6GA 2CX4A 3IK9A 2CVBA 5H5QA 4WF5A 3VURA 2YCDA 1EOGA 2C3NA 2C8UA 3CWGA 2EC4A 5DAKA 3LFLA 4I8BA 3IAM2 1SYXA 2ES7A 5GSSA 3A5WA 3FHKA 3QAVA 4JE1A 2DC5A 2QKEA 5G1KA 3GA4A 3HXSA 2K9FA 4FYBA 1GRXA 1S3AA 1USBA 3EYTA 3HYPA 2I81A 2V1MA 4X43A 5KN0A 4MA9A 1X9SB 1FVKA 2MZCA 3CXGA 4L8EA 2E2GA 3HMJG 2TIRA 2KLXA 4BVYA 1O8XA 1J9BA 3GX8A 3ZTLA 3I6AA 3QFAC 2H8LA 2YNXA 3LQ7A 1S3RA 2E0QA 2MMOA 4HU7A 4EDYA 5A4WA 4L0WA 4NV5A 4YQVA 3QR6A 4PX1A 2R4VA 2F9SA 5G5FA 4HOJA 2M72A 2XBQA 3SWLA 1OVNA 2HSMB 1AXDA 2OA7A 1V57A 4CY6A 1RW1A 22GSA 5CRWA 4GQFA 5F0GA 2H73A 1U6TA 4MNNA 3FYGA 4QMKA 3L9VA 3EMXA 4FXYP 1PL1A 4GDFA 1AQVA 3F4SA 2YWNA 1G6WA 1K0OA 2H72A 3C1SA 1FB6A 1Z9HA 1ZYNA 4NXIA 5G5EA 4JRRA 4MP4A 1G7EA 1F3BA 2WJUA 2JSYA 2N5BA 1TRWA 1ZMAA 3CQFA 3LYPA 1UC7A 1LBKA 4G01A 2C1YA 5BMUB 4ZL9A 4E8HA 3CTFA 3FZ9A 4ULXA 3K8NA 3HJOA 1EZKA 2V32A 3KH9A 5B7CA 2HSMA 2PWJA 2OE3A 4BL7B 1YVLA 2WDUA 4GCIA 4GSTA 4MABA 4IP1A 2IMDA 1BX9A 4JU5A 1UA5A 3M0FA 4TW5A 5GZZB 3TJJA 3IV4A 1JLVA 4MF7A 1M7TA 1EGRA 1ST9A 1YJ6A 4WETA 3UIWA 1THXA 4WEYA 5CRDA 3LXZA 4J57E 2X49A 2RIIA 3IK7A 2R0GA 1M9BA 1SYRA 5J9BA 2GZYA 5J9CA 2MMAA 3C71A 2UV8G 5BMUA 1M2DA 3M1GA 1ERWA 3KH7A 2R37A 3LEFA 5GAPD 5IM9A 2K8SA 1HD2A 3RHBA 4ZB6A 3TKRA 1TI3A 2GDRA 4BL7A 3HZ8A 1HYUA 3H1NA 1SL0B 5CNWA 3LORA 4V2NA 5IMVA 2H1GA 2PMTA 4XHMA 1PMTA 2JSZA 2CVKA 1NM3A 3P7XA 3ZMKA 2CVDA 5HR1A 3GFKA 2PBJA 4FIWA 2CT6A 2O3EA 2VL2C 3ZYWA 2VCQA 4DSRA 3ERWA 5CP1A 1FO5A 1V58A 3ZFBA 1EEJA 3RFRC 1X5EA 3LW9A 3ZZXA 1WIKA 4IVFA 2X99A 2AV4A 3CMIA 4Q5QA 3APQA 4XCSA 4TR0A 3HY2A 4HI7A 3FR3A 1F37A 1A0RP 1XVWA 4V2MA 1MEKA 4XS4B 1AIUA 5KOXA 1V2AA 2A4VA 1XWAA 1GNWA 3FW2A 3C7MA 4KX4A 1M2AA 1XWBA 1XXUA 3TGZA 4G0KA 2MMZA 4X0XA 1TK0B 2XPEA 4QL7A 1FB0A 3BBYA 2WW0A 4CDOA 4I5QA 2KHPA 1QXHA 1OAZA 4AKHA 1ERTA 5G30A 3GKNA 5ABRA 2O8VB 2HRKB 4G19A 3HDCA 3APSA 3FR9A 3MIXA 4IGJA 4O7HA 4HJMA 4TKYA 3EINA 4O5UA 4YAVA 3I43A 2ALBA 4MK3A 3GKXA 2XHFA 4XS4A 5ID2B 2YZHA 2DJJA 1PGTA 3ME8A 4ZILA 2CA8A 2R6KA 4ECJA 5HR0A 2A4HA 1FVJA 3MDKA 1PRXA 4HEA2 3KJYA 4Z2UA 4PXOA 3F6FA 2LRCA 4KGIA 4KSOA 3ZREA 3HKRA 4YQMA 3VFIA 4F9ZA 2B7JA 2EFCA 1MDJA 2IN3A 2OT3A 1OKDA 1Y6EA 2WW2A 2HRKA 2H1LA 2MMNA 2GQLA 2O87A 1R7HA 3L9UA 4O32A 1XZOA 2IMEA 3HJPA 1G7OA 2VOCA 1ZL9A 4K9ZA 4PQ1A 2B5XA 3EU4A 4MLYA 2H75A 1EP8A 4V1Ag 1WP0A 4MH2A 5ID2A 4FH8A 5EPFA 2QGVA 18GSA 1QK8A 2EFEA 3R2QA 2LUSA 2CAQA 2JZTA 4CY8A 3HVSA 3D5JA 3DIEA 5A4VA 1XWCA 3W8JA 2B7KA 5DDLA 3VI7A 5JWOB 2H30A 2RM5A 2ON7A 1I5GA 5CRHA 2EFHA 3TOTA 5CO3A 1MTCA 5HFKA 1TRVA 3QFBC 3F6DA 3KCMA 5LD0A 1SVMA 3HHVA 5IO2A 2O89A 3PINA 2TRCP 4Q5RA 3WT1A 3GTUB 2NBSA 6GSSA 3UOMA 3D0ZA 4XIHA 2H1AA 1PX6A 2K18A 4LLRA 4YH2A 19GSA 2DJ3A 2REMA 1N2AA 3TKSA 2AAWA 4LL1B 4JR6A 3IBHA 1JFUA 4WR4A 4MJCA 4G0IA 5ECQB 3ED3A 4PI0C 2F8AA 3UAPA 1YQ1A 1QGVA 2H1DA 5J5NA 2L57A 5ECOB 3CTGA 3M3MA 3L4NA 5J40A 2LKUA 3TRXA 2IMFA 3UJ1A 1YF0A 1GNEA 4XS6A 5CAXA 3CYNA 1GLQA 2L5OA 1SD9A 1H4OA 5DJMA 3FRCA 3RAZA 1KBNA 1TKDB 3GTUA 5AIXA 3RBTA 5J4UA 4DEJA 2YN1A 1Z7PA 3EWLA 2IFQB 3H4KA 4JZQA 3BOAA 4X4JA 4BVXB 3AY8A 3GUSA 1DUGA 1EWXA 3HCZA 3LWAA 1W89A 1T7PB 2WW3A 3OR5A 3QAGA 3GL3A 2I4AA 3KXOA 1K0AA 1Z7RA 2WGRA 5CYYA 5D9VA 3FMWA 1OE7A 1GH2A 3C8EA 1UVZA 5F07A 2GVPA 4PNFA 3FZ5A 2LQOA 1YEXA 2I3YA 5C04A 4TRXA 5B8BA 2GQKA 3I9V2 2FA8A 4WBJA 2VM2A 3DVXA 2LJAA 1TK5B 4OFTA 1YKAA 2EIOA 5G31A 2RUEA 2A2PA 3VWVA 4EIPA 4P3YB 1GULA 1SVLA 2IFQA 4IQ1A 4BVXA 4O5QA 1FG4A 5IMFA 5G1LA 1T4ZA 1ZCPA 5CRGA 1TI1A 2B1KA 3C73A 1ACVA 1SU9A 1QMVA 2TRXA 4HDEA 2HXKA 1TK8B 5EL8A 4IN0A 4O5RA 3F63A 3TJKA 2FWEA 4DSSB 3TKPA 2H0GA 1WOUA 4KNDA 4KB3A 4OD7A 4IW9A 4HZ2A 5IOWA 1F6MC 1A24A 5HR3A 2MBSA 3IHGA 4GRFA 1YZXA 2I9HA 1J08A 2IWTA 4ML1A 2NVLA 10GSA 1IYIA 3DYRA 1K3OA 2V2GA 2AYTA 3D4TA 2GSSA 2L5LA 2DIZA 2HLSA 4ID0A 2WVXB 2XC2A 1M2BA 3GX0A 4TR4A 1ZGNA 1GSEA 3F4RA 3ZVJA 3GL5A 1Z5YE 2R0CA 2HQTA 2P0GA 3CSJA 2QSIA 4GXZA 5KN1A 1UN2A 4EKZA 2QC7A 2V41A 3GKKA 1SKWB 3TUEA 3TJGA 4MDCA 3LYKA 1S3CA 4FQUA 1TJDA 1F2EA 2D2ZA 2C4JA 4DSSA 4IBPA 4FYUA 2LQQA 3UVHA 5DQSA 3UL3A 4I97A 4EF0A 4NMUA 5AN1A 3KTLA 1VGLA 3RHCA 1B4QA 5DALB 3UARA 3H93A 1TU7A 1WE0A 1R4WA 3S9FA 1JHBA 1A23A 1NW2A 2JZSA 1S4BP 5J4YA 2R5GA 2H71A 4G9HA 2WVXA 4TOPA 4AF2A 5L71A 4MZWA 1XCCA 2H01A 1XFLA 4IELA 4NV2A 3APOA 4ZB9A 2NTOA 1O8WA 1G6YA 3GURA 3ZMLA 5AGYA 3KGKA 2L6DA 4WR5A 2C3TA 4GF0A 4K0GA 4GTUA 4TR1B 4ECCA 3MAKA 5HR2A 1M3JA 1SK0A 2HNLA 2N5FA 4KA0A 5A5KA 2H1BA 5IO0A 1BG5A 3EC3A 5J4VA 4AJ8A 3P90A 1K0MA 1GTIA 4EC0A 4OO4A 4A5PA 3IXRA 3F3QA 5DALA 2KP1A 1AC1A 3WGXA 2LTKA 1C72A 4I6XA 4XRDA 4MZCA 5F06A 4POBA 2X8CA 3EU3A 2GT6A 2PVOC 3WGEA 5E4WA 2GS3A 1XG8A 3LXTA 5LNKe 4ZB8A 2Z9SA 3EE2A 4K5RA 2PERA 2FWFA 4KH7A 3IA1A 2GSQA 4G2EA 1VF1A 2WW1A 2IMKA 4EDZA 1ERUA 3FZAA 2DLXA 4ECIA 2HRNA 1KNGA 4YQUA 2YWMA 4IS0A 2R3XA 1XIYA 2VCXA 1OC8A 2PUKC 1QUWA 4W66A 3ZVJD 1V40A 1SKRB 4MZBA 1GSUA 5F8BA 3WGDA 4HQZA 2FWHA 4KAEA 1VRSD 1IYHA 1WMJA 2MYGA 1RK4A 4RQXA 1M3IA 13GSA 1XOAA 4YKGA 1VF4A 1OKTA 2P31A 3FKFA 5H5SA 5COHA 1K0CA 1MDKA 3TOUA 2VIMA 5IQYA 4WXTA 4CHSA 3DGQA 3IR4A 2R0PA 3A5IA 1B9YC 1E2YA 1MD4A 2DJ2A 4DSQA 1F3AA 3M8NA 9GSSA 4KDUA 2H74A 2M46A 2VCVA 4Z2TA 5J47A 2WVZA 5ECIB 2BJXA 1ABAA 3GH9A 4MMMA 5IPHA 2JU5A 1XVQA 5JCUA 1ERVA 2JL4A 1X9MB 4K5SA 4ECBA 2NDOA 2X8GA 2M80A 1TXUA 3V1WA 4KW6A 2VLTA 4KUNA 2AB6A 3GSTA 1WPIA 4OCEA 4MJEA 5J3RA 3GV1A 2WZ9A 6GSWA 3KZQA 2PN8A 1U88A 3VK9A 1EEMA 12GSA 3NIVA 2FY6A 2IJYA 2VAFA 4Z2RA 5J41A 2OADA 1BYEA 2CV4A 4PNGA 4K8MA 2B6MA 5F05A 8GSSA 4JEDA 2LSTA 2HRAA 1X5DA 4X1UA 3JCML 1N25A 3ISOA 2LEGA 3QAWA 1K0NA 5DJLA 1EOHA 1SL2B 1VF3A 3LJRA 3HVXA 5B6MA 1QFNA 3R3EA 3ZIJA 1YY7A 4HQSA 1QQ2A 3IC4A 2IL3A 4IJ3A 1AW9A 4AKIA 4ZL8A 2YWOA 3IDVA 1ML6A 2VLVA 4IHUA 3U6VA 5GSTA 1SKSB 2ON5A 3KEBA 2H76A 5ECLB 2VLUA 4WBRD 3VPQA 3G7YA 2VUPA 2C80A 3A2WA 4L5OA 2DJ0A 3M9KA 4USSA 3QPMA 2L4CA 1TW9A 3ZRDA 1EGOA 1I9DA 4ZIJA 2HYXA 1PKWA 5JWQB 1H75A 1PN0A 5IOXA 1DE1A 3ZL5A 1T4YA 4OO5A 3EURA 4ILFA 4EL1A 4RI6A 3D21A 4EE0A 1OE8A 1Q98A 2LJRA 2OJLA 2X64A 4HS1A 1V9WA 1CQHA 4ACSA 2YOIA 1SENA 5HQPA 2O5VA 2E7PA 4LMWA 4Q5FA 2OBKA 4OWYA 4BA7A 3WD6A 4AKGA 1R5PA 3N5OA 3RGBC 1AQWA 1BQ7A 3F8UA 5ECMB 2RUFA 3IE3A 14GSA 3EMPA 2C0FA 2YJ7A 1PD21 1M0UA 3MSZA 4ZBAA 3QOUA 5A4UA 1B4PA 2IMIA 1SD8A 2C0EA 4NHZA 3CRTA 6GSYA 1DE2A 5ECKB 4POKA 2VM1A 4WF4A 2XPDA 4KDXA 1HNAA 17GSA 2KOKA 1WJKA 4OFNA 4MF6A 4GQCA 1GTAA 2AHEA 5HFIA 2CX3A 1OC3A 2QA2A 4EUYA 2KUCA 2AUVA 2HI7A 5ECSA 4ZBDA 4AI6A 3F9UA 4AJ7A 4TN8A 2WS2A 1Q4JA 1GLPA 4PGTA 1PKZA 1X9WB 5A5HB 2B3SA 3MNGA 1AQXA 2V6OA 4TXOB 3RPNA 1TU8A 4IQAA 4LA1A 3G9BA 2LV3A 1NSWA 6GSUA 1CQGA 1GSDA 4AKXB 3KIJA 2F3MA 1NHOA 1PQNA 5ELGA 3F0IA 4OFMA 2OACA 5IMCA 3A3TA 5GAND 4K1FA 2OKAA 11GSA 1ZZYA 1GUMA 3VLNA 1O85A 2HZFA 1XW5A 4MPGA 3TKSC 1WWJA 2VCWA 1E6BA 1K3LA 4RQRA 1A0FA 1XBSA 3BD2A 1W4VA 1XOBA 3M9JA 1GWCA 6GSVA 1Z3EA 3GYKA 5A5HA 2A2RA 2GTUA 1S3DA 3PR8A 4IJIA 4G0LA 3TCOA 1T1VA 2WVYA 3CSHA 1SJZA 2GT5A 1GSFA 1XWGA 2WRTA 5LCZA 4TXOA 1K0DA 5DCGA 3UEMA 2H6XA 2DSAA 5IIZA 4J56E 3IAS2 1U3AA 3DD3A 2XBIA 3US3A 1MDIA 3TB2A 5ECRB 2DIYA 4PHZC 4EVMA 2YJHA 2AJQB 3GKMA 4IP6A 5DCHA 3NOFA 5ECPB 4YAPA 2C0GA 1G0TA 1ZYQB 2DMLA 2E2MA 3GNJA 1J0FA 2CZ2A 3IC8A 3CBUA 1T8EB 1HQOA 1K3YA 2FWGA 1YKCA 2QA1A 3FEUA 1XW6A 2ZNMA 5FT3A 5ECNB 3E3EA 3ME7A 2DMMA 2G2QA 4V1Ap 4K6XA 1PA3A 2G0FA 1XPVA 2H19A 4BWQA 4N0VA 4N0ZA 5HFGA 1YEWC 1O81A 4GLTA 1ON4A 3O6TA 4ICYA 2HFDA 1V98A 4PQIA 3EPTA 1FOHA 2IPAA 2MBTA 2FGXA 3L0HA 4TXVA 2YWIA 1RQMA 2H0IA 4NPBA 2LJKA 3QD9A 1A2JA 2VL2A 4L5LA 4GWRA 2DKIA 3BCIA 4XTSA 2L6CA 2O85A 2CAIA 1PN9A 4N10A 2L59A 2YPMA 3KTBA 3O76A 2PPTA 4POLA 3IRAA 1A2LA 1A2MA 2FHEA 4ZB7A 1KEBA 2H70A 2FCHA 2B1LA 2B5EA 2J9HA 3Q6OA 2DJKA 4V2LA 2WFCA 3TKSE 2K6VA 1TP9A 4PQHA 5KN3A 3HZ4A 1LU4A 1TOFA 5DBQA 4JR4A 2LRTA 3WT2A 5FHIA 3FK8A 4IKHA 1GSSA 3LSZA 3HVNA 1GUHA 1I1IP 3RPPA 3UMAA 3GIXA 1N8JA 5AIVA 2JZRA 4XRAA 4TR3A 1AUCA 4LMVA 1SJ6A 2X8HA 2YV7A 3PGTA 4F03A 4E8EA 1B8XA 1URMA 2PGTA 3LGCA 3G7JA 2IIYA 4K7IA 3VPTA 4BPYA 3GRXA 2HRFA 4NHWA 5KN2A 1JZWA 1F9MA 2A2SA 5IMZA 5D9TA 1BAYA 1JZOA 4HZ4A 1O6JA 4BWSA 4ZL7A 5D96A 4TR1A 4MJBA 1BJXA 3TRQA 3FZ4A 1VF2A 4RUVA 1YEPA 1A8LA 4EXJA 1X5CA 2HE3A 1GSYA 3CHXC 16GSA 3GN3A 20GSA 3ERGA 3QDNA 3BJ5A 4EIQA 5KEJA 3TJFA 1DBYA 1TTZA 4DVCA 2LS5A 2BMXA 1PL2A 4O92A 2J23A 3MYDA 4Z7XA 3FY7A 3GSSA 2R2JA 5G2ZA 3ERFA 1O7UA 4ZBBA 3DEXA 2YANA 1BEDA 1AAZA 1YDKA 4HU9A 2VCTA 2GGTA 5ENUA 5IPGA 5CREA 1FHEA 3MWHA 3GMFA 4F2IA 4MCUA 1GP1A 2LNTA 3CRUA 2ZCTA 1K0BA 1EP7A 3QCPA 2B5YA 4PUAA 4FYCA 5D8IA 1B48A 4EO3A 5D9WA 2WCIA 4K2DA 2FUG2 2JADA 1SL1B 1MD3A 3A2VA 5D93A 4PURA 1X0RA 2P5QA 2CZ3A 1JZDA 4MH3A 2FA4A 3HVVA 4FO5A 3TDGA 4I2UA 3DXBA 2DJ1A 3ZFLA 3IOSA 1HNBA 2DBCA 2GZPA 3DVWA 2H6YA 1PSQA 3H8QA 3F3RA 3VWUA 2X4AA 3HJMA 1YF1A 3KMNA 4N11A 3EVIA 3PH9A 3N9JA 3TKQA 1TDIA 4OCFA 2JACA 2DKHA 1R5AA 3KP9A 2HT9A 1SK2A 1ZYEA 4TVEA 1ZOFA 3TJBA
chains in the Genus database with same CATH topology
5DQYA 1THOA 3W8SA 1SJIA 4JBBA 2C0DA 4F0CA 3KP8A 3BCKA 5D9XA 4KSMA 1O73A 3U5RE 1Y25A 2EIRA 5AISA 3IHQA 3I69A 3UVTA 3KD0A 2VO4A 3G7IA 3LG6A 3J7Yb 4CW9A 1KTEA 3J7Yk 5DVBA 4J2FA 1GTUA 5A34B 5E59A 2LRNA 4ISDA 2FLSA 5B6NA 3Q18A 1T3BA 1FOVA 4E68A 3A2XA 1SVOA 3FR6A 5FWGA 4KDYA 2P5RA 2YZUA 3HD5A 2I1UA 4N30A 1R26A 1ILOA 4LL4B 2BTOT 4QQ7A 4XS1A 3DRNA 1TRSA 4NWYA 3DKSA 3UBKA 4ZXGA 3GH6A 2WULA 2LNSA 3E0UA 7GSSA 1JLWA 5IMDA 1GTBA 3SBCA 3D6IA 5D73A 5H5RA 1LJRA 2OE1A 1ZYPA 3F4TA 4KE3A 1NHYA 1Z6MA 3D4MA 4F0BA 4OMVA 3P8WA 2C3QA 4GSNA 2F51A 5ECHB 3IPZA 1JZRA 5A34A 2H6ZA 2ZUPA 4L0UA 3KMOA 1GUKA 2EIQA 5INYA 5A1NB 2HSHA 1GSQA 1BF5A 4F82A 2GSRA 1SK1A 3TRPA 1HNCA 4MPFA 3L78A 4AJ6A 3CSIA 3Q19A 3WYWA 1EV9A 2YV9A 4POMA 5ELAA 4D73B 4RI7A 4N3ZA 4MF5A 2OBIA 2YP6A 2EFDA 2WB9A 6GSTA 3PPUA 1DSBA 5KOWA 2GSTA 2PU9C 5EVOA 4Q5NA 4PTSA 1U3IA 3L9SA 2OE0A 2RM6A 3P2AA 2RLIA 1M9AA 6GSXA 3ZIVA 2V6KA 2NPBA 2VKZG 5C00A 4KF9A 4MJAA 4YKFA 1A8YA 2K8VA 3DWVA 1B9XC 2HSYA 2UZ8A 3RDWA 4NAXA 3TU3B 2HSNB 1U87A 1XW9A 3VI5A 1Y1UA 4GSSA 3H79A 2F8FA 2H0HA 3HA9A 4K2XA 5BRTA 2GLRA 1OC9B 5A1NA 2FNOA 2PVQA 2VL9A 5JCWA 2FD3A 2HZEB 1T00A 3O3TA 3D22A 3NZNA 3ZITA 4QL9A 3E9JB 2GZZA 4K0NA 5JWRB 5IMAA 4D73A 3C1RA 5DAKB 1GL8A 4KCEA 1OYJA 3GHAA 2N5AA 1TXXA 2H66A 1WRYA 4HUAA 2VCZA 2VD1A 4KCAA 3Q74A 4H86A 3KM6A 4WKWA 1M99A 4I2TA 4HJ2A 2KP2A 1BG1A 2VL3A 4K7NA 3VWXA 2GQMA 2L4QA 3UBLA 1FW1A 1FAAA 5JCGA 2HSNA 1PX7A 3VWWA 3DMLA 5EY6A 4PUFC 5B8AA 4BVYB 1TRUA 2O7KA 1OC9A 4AGSA 3QMXA 2HZEA 4ML6A 1XWKA 2CQ9A 1EV4A 4G10A 1Z6NA 3ZLPA 4K7OA 2VD0A 3W6GA 2CX4A 3IK9A 2CVBA 5H5QA 4WF5A 3VURA 2YCDA 1EOGA 2C3NA 2C8UA 3CWGA 2EC4A 5DAKA 3LFLA 4I8BA 3IAM2 1SYXA 2ES7A 5GSSA 3A5WA 3FHKA 3QAVA 4JE1A 2DC5A 2QKEA 5G1KA 3GA4A 3HXSA 2K9FA 4FYBA 1GRXA 1S3AA 1USBA 3EYTA 3HYPA 2I81A 2V1MA 4X43A 5KN0A 4MA9A 1X9SB 1FVKA 2MZCA 3CXGA 4L8EA 2E2GA 3HMJG 2TIRA 2KLXA 4BVYA 1O8XA 1J9BA 3GX8A 3ZTLA 3I6AA 3QFAC 2H8LA 2YNXA 3LQ7A 2E0QA 2MMOA 4HU7A 4EDYA 5A4WA 4L0WA 4NV5A 4YQVA 3QR6A 4PX1A 2R4VA 2F9SA 5G5FA 4HOJA 2M72A 2XBQA 3SWLA 1OVNA 2HSMB 1AXDA 2OA7A 1V57A 4CY6A 1RW1A 22GSA 5CRWA 4GQFA 5F0GA 2H73A 1U6TA 4MNNA 3FYGA 4QMKA 3L9VA 3EMXA 1PL1A 4GDFA 1AQVA 3F4SA 2YWNA 1G6WA 1K0OA 2H72A 3C1SA 1FB6A 1Z9HA 1ZYNA 4NXIA 5G5EA 4JRRA 4MP4A 1G7EA 1F3BA 2WJUA 2JSYA 2N5BA 1TRWA 1ZMAA 3LYPA 1UC7A 1LBKA 4G01A 2C1YA 5BMUB 4ZL9A 4E8HA 3CTFA 3FZ9A 4ULXA 3K8NA 3HJOA 1EZKA 2V32A 3KH9A 5B7CA 2HSMA 2PWJA 2OE3A 4BL7B 1YVLA 2WDUA 4GCIA 4GSTA 4MABA 4IP1A 2IMDA 1BX9A 4JU5A 1UA5A 3M0FA 4TW5A 5GZZB 3TJJA 3IV4A 1JLVA 4MF7A 1M7TA 1EGRA 1ST9A 1YJ6A 4WETA 3UIWA 1THXA 4WEYA 5CRDA 3LXZA 4J57E 2X49A 2RIIA 3IK7A 2R0GA 1M9BA 1SYRA 5J9BA 2GZYA 5J9CA 2MMAA 3C71A 2UV8G 5BMUA 1M2DA 3M1GA 1ERWA 3KH7A 2R37A 3LEFA 5GAPD 5IM9A 2K8SA 1HD2A 3RHBA 4ZB6A 3TKRA 1TI3A 2GDRA 4BL7A 3HZ8A 1HYUA 3H1NA 1SL0B 5CNWA 3LORA 4V2NA 5IMVA 2H1GA 2PMTA 4XHMA 1PMTA 2JSZA 2CVKA 1NM3A 3P7XA 3ZMKA 2CVDA 5HR1A 3GFKA 2PBJA 4FIWA 2CT6A 2VL2C 3ZYWA 2VCQA 4DSRA 3ERWA 5CP1A 1FO5A 1V58A 3ZFBA 1EEJA 1X5EA 3LW9A 3ZZXA 1WIKA 4IVFA 2X99A 2AV4A 3CMIA 4Q5QA 3APQA 4XCSA 4TR0A 3HY2A 4HI7A 3FR3A 1F37A 1A0RP 1XVWA 4V2MA 1MEKA 4XS4B 1AIUA 5KOXA 1V2AA 2A4VA 1XWAA 1GNWA 3FW2A 3C7MA 4KX4A 1M2AA 1XWBA 1XXUA 3TGZA 4G0KA 2MMZA 4X0XA 1TK0B 2XPEA 4QL7A 1FB0A 3BBYA 4CDOA 4I5QA 2KHPA 1QXHA 1OAZA 4AKHA 1ERTA 5G30A 3GKNA 5ABRA 2O8VB 2HRKB 4G19A 3HDCA 3APSA 3FR9A 3MIXA 4IGJA 4O7HA 4HJMA 4TKYA 3EINA 4O5UA 4YAVA 3I43A 2ALBA 4MK3A 3GKXA 2XHFA 4XS4A 5ID2B 2YZHA 2DJJA 1PGTA 3ME8A 4ZILA 2CA8A 2R6KA 4ECJA 5HR0A 2A4HA 1FVJA 3MDKA 1PRXA 4HEA2 3KJYA 4Z2UA 4PXOA 3F6FA 2LRCA 4KGIA 4KSOA 3ZREA 3HKRA 4YQMA 3VFIA 4F9ZA 2B7JA 2EFCA 1MDJA 2IN3A 2OT3A 1OKDA 1Y6EA 2HRKA 2H1LA 2MMNA 2GQLA 2O87A 1R7HA 3L9UA 4O32A 1XZOA 2IMEA 3HJPA 1G7OA 2VOCA 1ZL9A 4K9ZA 4PQ1A 2B5XA 3EU4A 4MLYA 2H75A 1EP8A 4V1Ag 1WP0A 4MH2A 5ID2A 4FH8A 5EPFA 2QGVA 18GSA 1QK8A 2EFEA 3R2QA 2LUSA 2CAQA 2JZTA 4CY8A 3HVSA 3D5JA 3DIEA 5A4VA 1XWCA 3W8JA 2B7KA 5DDLA 3VI7A 5JWOB 2H30A 2RM5A 2ON7A 1I5GA 5CRHA 2EFHA 3TOTA 5CO3A 1MTCA 5HFKA 1TRVA 3QFBC 3F6DA 3KCMA 5LD0A 1SVMA 3HHVA 5IO2A 2O89A 3PINA 2TRCP 4Q5RA 3WT1A 3GTUB 2NBSA 6GSSA 3UOMA 3D0ZA 4XIHA 2H1AA 1PX6A 2K18A 4LLRA 4YH2A 19GSA 2DJ3A 2REMA 1N2AA 3TKSA 2AAWA 4LL1B 4JR6A 3IBHA 1JFUA 4WR4A 4MJCA 4G0IA 5ECQB 3ED3A 2F8AA 3UAPA 1YQ1A 1QGVA 2H1DA 5J5NA 2L57A 5ECOB 3CTGA 3M3MA 3L4NA 5J40A 2LKUA 3TRXA 2IMFA 3UJ1A 1YF0A 1GNEA 4XS6A 5CAXA 3CYNA 1GLQA 2L5OA 1SD9A 1H4OA 5DJMA 3FRCA 3RAZA 1KBNA 1TKDB 3GTUA 5AIXA 3RBTA 5J4UA 4DEJA 2YN1A 1Z7PA 3EWLA 2IFQB 3H4KA 4JZQA 3BOAA 4X4JA 4BVXB 3AY8A 3GUSA 1DUGA 1EWXA 3HCZA 3LWAA 1W89A 1T7PB 3OR5A 3QAGA 3GL3A 2I4AA 3KXOA 1K0AA 1Z7RA 2WGRA 5CYYA 5D9VA 3FMWA 1OE7A 1GH2A 3C8EA 1UVZA 5F07A 2GVPA 4PNFA 3FZ5A 2LQOA 1YEXA 2I3YA 5C04A 4TRXA 5B8BA 2GQKA 3I9V2 2FA8A 4WBJA 2VM2A 3DVXA 2LJAA 1TK5B 4OFTA 1YKAA 2EIOA 5G31A 2RUEA 2A2PA 3VWVA 4EIPA 4P3YB 1GULA 1SVLA 2IFQA 4IQ1A 4BVXA 4O5QA 1FG4A 5IMFA 5G1LA 1T4ZA 1ZCPA 5CRGA 1TI1A 2B1KA 3C73A 1ACVA 1SU9A 1QMVA 2TRXA 4HDEA 2HXKA 1TK8B 5EL8A 4IN0A 4O5RA 3F63A 3TJKA 2FWEA 4DSSB 3TKPA 2H0GA 1WOUA 4KNDA 4KB3A 4OD7A 4IW9A 4HZ2A 5IOWA 1F6MC 1A24A 5HR3A 2MBSA 3IHGA 4GRFA 1YZXA 2I9HA 1J08A 2IWTA 4ML1A 2NVLA 10GSA 1IYIA 3DYRA 1K3OA 2V2GA 2AYTA 3D4TA 2GSSA 2L5LA 2DIZA 2HLSA 4ID0A 2XC2A 1M2BA 3GX0A 4TR4A 1ZGNA 1GSEA 3F4RA 3ZVJA 3GL5A 1Z5YE 2R0CA 2HQTA 2P0GA 3CSJA 2QSIA 4GXZA 5KN1A 1UN2A 4EKZA 2QC7A 2V41A 3GKKA 1SKWB 3TUEA 3TJGA 4MDCA 3LYKA 1S3CA 4FQUA 1TJDA 1F2EA 2D2ZA 2C4JA 4DSSA 4IBPA 4FYUA 2LQQA 3UVHA 5DQSA 3UL3A 4I97A 4EF0A 4NMUA 5AN1A 3KTLA 1VGLA 3RHCA 1B4QA 5DALB 3UARA 3H93A 1TU7A 1WE0A 1R4WA 3S9FA 1JHBA 1A23A 1NW2A 2JZSA 5J4YA 2R5GA 2H71A 4G9HA 4TOPA 4AF2A 5L71A 4MZWA 1XCCA 2H01A 1XFLA 4IELA 4NV2A 3APOA 4ZB9A 2NTOA 1O8WA 1G6YA 3GURA 3ZMLA 5AGYA 3KGKA 2L6DA 4WR5A 2C3TA 4GF0A 4K0GA 4GTUA 4TR1B 4ECCA 3MAKA 5HR2A 1SK0A 2HNLA 2N5FA 4KA0A 5A5KA 2H1BA 5IO0A 1BG5A 3EC3A 5J4VA 4AJ8A 3P90A 1K0MA 1GTIA 4EC0A 4OO4A 4A5PA 3IXRA 3F3QA 5DALA 2KP1A 1AC1A 3WGXA 2LTKA 1C72A 4I6XA 4XRDA 4MZCA 5F06A 4POBA 2X8CA 3EU3A 2GT6A 2PVOC 3WGEA 5E4WA 2GS3A 3LXTA 5LNKe 4ZB8A 2Z9SA 3EE2A 4K5RA 2PERA 2FWFA 4KH7A 3IA1A 2GSQA 4G2EA 1VF1A 2IMKA 4EDZA 1ERUA 3FZAA 2DLXA 4ECIA 2HRNA 1KNGA 4YQUA 2YWMA 4IS0A 2R3XA 1XIYA 2VCXA 1OC8A 2PUKC 1QUWA 4W66A 3ZVJD 1V40A 1SKRB 4MZBA 1GSUA 5F8BA 3WGDA 4HQZA 2FWHA 4KAEA 1VRSD 1IYHA 1WMJA 2MYGA 1RK4A 4RQXA 13GSA 1XOAA 4YKGA 1VF4A 1OKTA 2P31A 3FKFA 5H5SA 5COHA 1K0CA 1MDKA 3TOUA 2VIMA 5IQYA 4WXTA 4CHSA 3DGQA 3IR4A 2R0PA 3A5IA 1B9YC 1E2YA 1MD4A 2DJ2A 4DSQA 1F3AA 3M8NA 9GSSA 4KDUA 2H74A 2M46A 2VCVA 4Z2TA 5J47A 5ECIB 2BJXA 1ABAA 3GH9A 4MMMA 5IPHA 2JU5A 1XVQA 5JCUA 1ERVA 2JL4A 1X9MB 4K5SA 4ECBA 2NDOA 2X8GA 2M80A 1TXUA 3V1WA 4KW6A 2VLTA 4KUNA 2AB6A 3GSTA 1WPIA 4OCEA 4MJEA 5J3RA 3GV1A 2WZ9A 6GSWA 3KZQA 2PN8A 1U88A 3VK9A 1EEMA 12GSA 3NIVA 2FY6A 2IJYA 2VAFA 4Z2RA 5J41A 2OADA 1BYEA 2CV4A 4PNGA 4K8MA 2B6MA 5F05A 8GSSA 4JEDA 2LSTA 2HRAA 1X5DA 4X1UA 3JCML 1N25A 3ISOA 2LEGA 3QAWA 1K0NA 5DJLA 1EOHA 1SL2B 1VF3A 3LJRA 3HVXA 5B6MA 1QFNA 3R3EA 3ZIJA 1YY7A 4HQSA 1QQ2A 3IC4A 2IL3A 4IJ3A 1AW9A 4AKIA 4ZL8A 2YWOA 3IDVA 1ML6A 2VLVA 4IHUA 3U6VA 5GSTA 1SKSB 2ON5A 3KEBA 2H76A 5ECLB 2VLUA 4WBRD 3VPQA 3G7YA 2VUPA 2C80A 3A2WA 4L5OA 2DJ0A 3M9KA 4USSA 3QPMA 2L4CA 1TW9A 3ZRDA 1EGOA 1I9DA 4ZIJA 2HYXA 1PKWA 5JWQB 1H75A 1PN0A 5IOXA 1DE1A 3ZL5A 1T4YA 4OO5A 3EURA 4ILFA 4EL1A 4RI6A 3D21A 4EE0A 1OE8A 1Q98A 2LJRA 2OJLA 2X64A 4HS1A 1V9WA 1CQHA 4ACSA 2YOIA 1SENA 5HQPA 2O5VA 2E7PA 4LMWA 4Q5FA 2OBKA 4OWYA 4BA7A 3WD6A 4AKGA 1R5PA 3N5OA 1AQWA 1BQ7A 3F8UA 5ECMB 2RUFA 3IE3A 14GSA 3EMPA 2C0FA 2YJ7A 1PD21 1M0UA 3MSZA 4ZBAA 3QOUA 5A4UA 1B4PA 2IMIA 1SD8A 2C0EA 4NHZA 3CRTA 6GSYA 1DE2A 5ECKB 4POKA 2VM1A 4WF4A 2XPDA 4KDXA 1HNAA 17GSA 2KOKA 1WJKA 4OFNA 4MF6A 4GQCA 1GTAA 2AHEA 5HFIA 2CX3A 1OC3A 2QA2A 4EUYA 2KUCA 2AUVA 2HI7A 5ECSA 4ZBDA 4AI6A 3F9UA 4AJ7A 4TN8A 2WS2A 1Q4JA 1GLPA 4PGTA 1PKZA 1X9WB 5A5HB 2B3SA 3MNGA 1AQXA 2V6OA 4TXOB 3RPNA 1TU8A 4IQAA 4LA1A 3G9BA 2LV3A 1NSWA 6GSUA 1CQGA 1GSDA 4AKXB 3KIJA 2F3MA 1NHOA 1PQNA 5ELGA 3F0IA 4OFMA 2OACA 5IMCA 3A3TA 5GAND 4K1FA 2OKAA 11GSA 1ZZYA 1GUMA 3VLNA 1O85A 2HZFA 1XW5A 4MPGA 3TKSC 1WWJA 2VCWA 1E6BA 1K3LA 4RQRA 1A0FA 1XBSA 3BD2A 1W4VA 1XOBA 3M9JA 1GWCA 6GSVA 1Z3EA 3GYKA 5A5HA 2A2RA 2GTUA 1S3DA 3PR8A 4IJIA 4G0LA 3TCOA 1T1VA 3CSHA 1SJZA 2GT5A 1GSFA 1XWGA 2WRTA 5LCZA 4TXOA 1K0DA 5DCGA 3UEMA 2H6XA 2DSAA 5IIZA 4J56E 3IAS2 1U3AA 3DD3A 2XBIA 3US3A 1MDIA 3TB2A 5ECRB 2DIYA 4EVMA 2AJQB 2YJHA 3GKMA 4IP6A 5DCHA 3NOFA 5ECPB 4YAPA 2C0GA 1G0TA 1ZYQB 2DMLA 2E2MA 3GNJA 1J0FA 2CZ2A 3IC8A 3CBUA 1T8EB 1HQOA 1K3YA 2FWGA 1YKCA 2QA1A 3FEUA 1XW6A 2ZNMA 5FT3A 5ECNB 3E3EA 3ME7A 2DMMA 2G2QA 4V1Ap 4K6XA 1PA3A 2G0FA 1XPVA 2H19A 4BWQA 4N0VA 4N0ZA 5HFGA 1O81A 4GLTA 1ON4A 3O6TA 4ICYA 2HFDA 1V98A 4PQIA 3EPTA 1FOHA 2IPAA 2MBTA 2FGXA 3L0HA 4TXVA 2YWIA 1RQMA 2H0IA 4NPBA 2LJKA 3QD9A 1A2JA 2VL2A 4L5LA 4GWRA 2DKIA 3BCIA 4XTSA 2L6CA 2O85A 2CAIA 1PN9A 4N10A 2L59A 2YPMA 3KTBA 3O76A 2PPTA 4POLA 3IRAA 1A2LA 1A2MA 2FHEA 4ZB7A 1KEBA 2H70A 2FCHA 2B1LA 2B5EA 2J9HA 3Q6OA 2DJKA 4V2LA 2WFCA 3TKSE 2K6VA 1TP9A 4PQHA 5KN3A 3HZ4A 1LU4A 1TOFA 5DBQA 4JR4A 2LRTA 3WT2A 5FHIA 3FK8A 4IKHA 1GSSA 3LSZA 1GUHA 3RPPA 3UMAA 3GIXA 1N8JA 5AIVA 2JZRA 4XRAA 4TR3A 1AUCA 4LMVA 1SJ6A 2X8HA 2YV7A 3PGTA 4F03A 4E8EA 1B8XA 1URMA 2PGTA 3LGCA 3G7JA 2IIYA 4K7IA 3VPTA 4BPYA 3GRXA 2HRFA 4NHWA 5KN2A 1JZWA 1F9MA 2A2SA 5IMZA 5D9TA 1BAYA 1JZOA 4HZ4A 1O6JA 4BWSA 4ZL7A 5D96A 4TR1A 4MJBA 1BJXA 3TRQA 3FZ4A 1VF2A 4RUVA 1YEPA 1A8LA 4EXJA 1X5CA 2HE3A 1GSYA 16GSA 3GN3A 20GSA 3ERGA 3QDNA 3BJ5A 4EIQA 5KEJA 3TJFA 1DBYA 1TTZA 4DVCA 2LS5A 2BMXA 1PL2A 4O92A 2J23A 3MYDA 4Z7XA 3FY7A 3GSSA 2R2JA 5G2ZA 3ERFA 1O7UA 4ZBBA 3DEXA 2YANA 1BEDA 1AAZA 1YDKA 4HU9A 2VCTA 2GGTA 5ENUA 5IPGA 5CREA 1FHEA 3MWHA 3GMFA 4F2IA 4MCUA 1GP1A 2LNTA 3CRUA 2ZCTA 1K0BA 1EP7A 3QCPA 2B5YA 4PUAA 4FYCA 5D8IA 1B48A 4EO3A 5D9WA 2WCIA 4K2DA 2FUG2 2JADA 1SL1B 1MD3A 3A2VA 5D93A 4PURA 1X0RA 2P5QA 2CZ3A 1JZDA 4MH3A 2FA4A 3HVVA 4FO5A 3TDGA 4I2UA 3DXBA 2DJ1A 3ZFLA 3IOSA 1HNBA 2DBCA 2GZPA 3DVWA 2H6YA 1PSQA 3H8QA 3F3RA 3VWUA 2X4AA 3HJMA 1YF1A 3KMNA 4N11A 3EVIA 3PH9A 3N9JA 3TKQA 1TDIA 4OCFA 2JACA 2DKHA 1R5AA 3KP9A 2HT9A 1SK2A 1ZYEA 4TVEA 1ZOFA 3TJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DQY A;  1THO A;  3W8S A;  1SJI A;  4JBB A;  2C0D A;  4F0C A;  3KP8 A;  3BCK A;  5D9X A;  4KSM A;  1O73 A;  3U5R E;  1Y25 A;  2EIR A;  5AIS A;  3IHQ A;  3I69 A;  3UVT A;  3KD0 A;  2VO4 A;  3G7I A;  3LG6 A;  3J7Y b;  4CW9 A;  1KTE A;  3J7Y k;  5DVB A;  4J2F A;  1GTU A;  5E59 A;  2LRN A;  4ISD A;  2FLS A;  5B6N A;  3Q18 A;  1T3B A;  1FOV A;  3A2X A;  3FR6 A;  5FWG A;  4KDY A;  2P5R A;  2YZU A;  3HD5 A;  2I1U A;  4N30 A;  1R26 A;  1ILO A;  4LL4 B;  2BTO T;  4QQ7 A;  4XS1 A;  3DRN A;  1TRS A;  4NWY A;  3DKS A;  3UBK A;  4ZXG A;  3GH6 A;  2WUL A;  2LNS A;  3E0U A;  7GSS A;  1JLW A;  5IMD A;  1GTB A;  3SBC A;  3D6I A;  5D73 A;  5H5R A;  1LJR A;  2OE1 A;  3F4T A;  4KE3 A;  1NHY A;  1Z6M A;  3D4M A;  4F0B A;  4OMV A;  3P8W A;  2C3Q A;  4GSN A;  2F51 A;  5ECH B;  3IPZ A;  1JZR A;  2H6Z A;  4L0U A;  2ZUP A;  3KMO A;  1GUK A;  2EIQ A;  5INY A;  2HSH A;  1GSQ A;  4F82 A;  2GSR A;  1SK1 A;  3TRP A;  1HNC A;  4MPF A;  3L78 A;  4AJ6 A;  3CSI A;  3Q19 A;  3WYW A;  1EV9 A;  2YV9 A;  4POM A;  5ELA A;  4D73 B;  4RI7 A;  4MF5 A;  2OBI A;  2YP6 A;  2WB9 A;  6GST A;  3PPU A;  1DSB A;  2GST A;  2PU9 C;  5EVO A;  4Q5N A;  4PTS A;  1U3I A;  3L9S A;  2OE0 A;  2RM6 A;  3P2A A;  2RLI A;  1M9A A;  6GSX A;  3ZIV A;  2V6K A;  2NPB A;  5C00 A;  4KF9 A;  4MJA A;  1A8Y A;  2K8V A;  3DWV A;  1B9X C;  2HSY A;  2UZ8 A;  3RDW A;  4NAX A;  2HSN B;  1U87 A;  1XW9 A;  3VI5 A;  4GSS A;  3H79 A;  2F8F A;  2H0H A;  3HA9 A;  2GLR A;  1OC9 B;  2FNO A;  2PVQ A;  2VL9 A;  5JCW A;  2FD3 A;  2HZE B;  1T00 A;  3O3T A;  3D22 A;  3NZN A;  3ZIT A;  4QL9 A;  3E9J B;  2GZZ A;  4K0N A;  5JWR B;  5IMA A;  4D73 A;  3C1R A;  5DAK B;  1GL8 A;  4KCE A;  1OYJ A;  3GHA A;  2N5A A;  1TXX A;  2H66 A;  1WRY A;  4HUA A;  2VCZ A;  2VD1 A;  4KCA A;  3Q74 A;  4H86 A;  3KM6 A;  4WKW A;  1M99 A;  4I2T A;  4HJ2 A;  2KP2 A;  2VL3 A;  4K7N A;  3VWX A;  2GQM A;  2L4Q A;  3UBL A;  1FW1 A;  1FAA A;  5JCG A;  1PX7 A;  3VWW A;  3DML A;  5EY6 A;  4PUF C;  5B8A A;  4BVY B;  1TRU A;  2O7K A;  1OC9 A;  4AGS A;  3QMX A;  2HZE A;  4ML6 A;  1XWK A;  2CQ9 A;  1EV4 A;  4G10 A;  1Z6N A;  3ZLP A;  4K7O A;  2VD0 A;  3W6G A;  2CX4 A;  3IK9 A;  2CVB A;  5H5Q A;  4WF5 A;  3VUR A;  2YCD A;  1EOG A;  2C3N A;  2C8U A;  2EC4 A;  5DAK A;  3LFL A;  4I8B A;  3IAM 2;  1SYX A;  2ES7 A;  5GSS A;  3A5W A;  3FHK A;  3QAV A;  4JE1 A;  2DC5 A;  2QKE A;  5G1K A;  3GA4 A;  3HXS A;  2K9F A;  4FYB A;  1GRX A;  1S3A A;  1USB A;  3EYT A;  3HYP A;  2I81 A;  2V1M A;  4X43 A;  5KN0 A;  4MA9 A;  1X9S B;  1FVK A;  2MZC A;  3CXG A;  4L8E A;  2E2G A;  2TIR A;  2KLX A;  4BVY A;  1O8X A;  1J9B A;  3GX8 A;  3ZTL A;  3I6A A;  3QFA C;  2H8L A;  2YNX A;  3LQ7 A;  2E0Q A;  2MMO A;  4HU7 A;  4EDY A;  5A4W A;  4L0W A;  4NV5 A;  4YQV A;  3QR6 A;  4PX1 A;  2R4V A;  2F9S A;  5G5F A;  4HOJ A;  2M72 A;  2XBQ A;  3SWL A;  1OVN A;  2HSM B;  1AXD A;  2OA7 A;  1V57 A;  1RW1 A;  22GS A;  5CRW A;  4GQF A;  5F0G A;  2H73 A;  1U6T A;  3FYG A;  3L9V A;  3EMX A;  1PL1 A;  1AQV A;  3F4S A;  2YWN A;  1G6W A;  1K0O A;  2H72 A;  3C1S A;  1FB6 A;  1Z9H A;  4NXI A;  5G5E A;  4JRR A;  4MP4 A;  1G7E A;  1F3B A;  2WJU A;  2JSY A;  2N5B A;  1TRW A;  1ZMA A;  3LYP A;  1UC7 A;  1LBK A;  2C1Y A;  4ZL9 A;  4E8H A;  3CTF A;  3FZ9 A;  4ULX A;  3K8N A;  3HJO A;  1EZK A;  2V32 A;  3KH9 A;  5B7C A;  2HSM A;  2PWJ A;  2OE3 A;  4BL7 B;  2WDU A;  4GCI A;  4GST A;  4MAB A;  4IP1 A;  2IMD A;  1BX9 A;  4JU5 A;  1UA5 A;  3M0F A;  4TW5 A;  5GZZ B;  3TJJ A;  3IV4 A;  1JLV A;  4MF7 A;  1M7T A;  1EGR A;  1ST9 A;  1YJ6 A;  4WET A;  3UIW A;  1THX A;  4WEY A;  5CRD A;  3LXZ A;  4J57 E;  2RII A;  3IK7 A;  1M9B A;  1SYR A;  5J9B A;  2GZY A;  5J9C A;  2MMA A;  3C71 A;  5BMU A;  1M2D A;  3M1G A;  1ERW A;  3KH7 A;  2R37 A;  3LEF A;  5GAP D;  5IM9 A;  2K8S A;  1HD2 A;  3RHB A;  4ZB6 A;  3TKR A;  1TI3 A;  2GDR A;  4BL7 A;  3HZ8 A;  1HYU A;  3H1N A;  1SL0 B;  5CNW A;  3LOR A;  4V2N A;  5IMV A;  2H1G A;  2PMT A;  4XHM A;  1PMT A;  2JSZ A;  2CVK A;  1NM3 A;  3P7X A;  3ZMK A;  2CVD A;  5HR1 A;  3GFK A;  2PBJ A;  4FIW A;  2CT6 A;  2VL2 C;  3ZYW A;  2VCQ A;  4DSR A;  3ERW A;  5CP1 A;  1FO5 A;  1V58 A;  3ZFB A;  1EEJ A;  1X5E A;  3ZZX A;  1WIK A;  4IVF A;  2X99 A;  2AV4 A;  3CMI A;  4Q5Q A;  3APQ A;  4XCS A;  4TR0 A;  3HY2 A;  4HI7 A;  3FR3 A;  1F37 A;  1A0R P;  1XVW A;  4V2M A;  1MEK A;  4XS4 B;  1AIU A;  1V2A A;  2A4V A;  1XWA A;  1GNW A;  3FW2 A;  3C7M A;  4KX4 A;  1M2A A;  1XWB A;  1XXU A;  3TGZ A;  4G0K A;  2MMZ A;  4X0X A;  1TK0 B;  2XPE A;  4QL7 A;  1FB0 A;  3BBY A;  4CDO A;  4I5Q A;  2KHP A;  1QXH A;  1OAZ A;  1ERT A;  5G30 A;  3GKN A;  5ABR A;  2O8V B;  2HRK B;  4G19 A;  3HDC A;  3APS A;  3FR9 A;  4IGJ A;  4O7H A;  4HJM A;  4TKY A;  3EIN A;  4YAV A;  3I43 A;  2ALB A;  4MK3 A;  3GKX A;  2XHF A;  4XS4 A;  5ID2 B;  2YZH A;  2DJJ A;  1PGT A;  3ME8 A;  4ZIL A;  2CA8 A;  2R6K A;  4ECJ A;  5HR0 A;  1FVJ A;  3MDK A;  1PRX A;  4HEA 2;  3KJY A;  4PXO A;  3F6F A;  2LRC A;  4KGI A;  4KSO A;  3ZRE A;  3HKR A;  4YQM A;  3VFI A;  4F9Z A;  2B7J A;  1MDJ A;  2IN3 A;  1OKD A;  1Y6E A;  2HRK A;  2MMN A;  2GQL A;  2O87 A;  1R7H A;  3L9U A;  4O32 A;  1XZO A;  2IME A;  3HJP A;  1G7O A;  2VOC A;  1ZL9 A;  4K9Z A;  4PQ1 A;  2B5X A;  3EU4 A;  4MLY A;  2H75 A;  1EP8 A;  4V1A g;  1WP0 A;  4MH2 A;  5ID2 A;  4FH8 A;  5EPF A;  2QGV A;  18GS A;  1QK8 A;  3R2Q A;  2LUS A;  2CAQ A;  2JZT A;  3HVS A;  3D5J A;  3DIE A;  5A4V A;  1XWC A;  3W8J A;  2B7K A;  5DDL A;  3VI7 A;  5JWO B;  2H30 A;  2RM5 A;  2ON7 A;  1I5G A;  5CRH A;  3TOT A;  5CO3 A;  1MTC A;  5HFK A;  1TRV A;  3QFB C;  3F6D A;  3KCM A;  5LD0 A;  3HHV A;  5IO2 A;  2O89 A;  3PIN A;  2TRC P;  4Q5R A;  3WT1 A;  3GTU B;  2NBS A;  6GSS A;  3UOM A;  3D0Z A;  4XIH A;  2H1A A;  1PX6 A;  2K18 A;  4LLR A;  4YH2 A;  19GS A;  2DJ3 A;  2REM A;  1N2A A;  3TKS A;  2AAW A;  4LL1 B;  4JR6 A;  3IBH A;  1JFU A;  4WR4 A;  4MJC A;  4G0I A;  5ECQ B;  3ED3 A;  2F8A A;  3UAP A;  1YQ1 A;  1QGV A;  2H1D A;  5J5N A;  2L57 A;  5ECO B;  3CTG A;  3M3M A;  3L4N A;  2LKU A;  3TRX A;  2IMF A;  3UJ1 A;  1YF0 A;  1GNE A;  4XS6 A;  5CAX A;  3CYN A;  1GLQ A;  2L5O A;  1SD9 A;  1H4O A;  5DJM A;  3FRC A;  3RAZ A;  1KBN A;  1TKD B;  3GTU A;  5AIX A;  3RBT A;  5J4U A;  4DEJ A;  2YN1 A;  1Z7P A;  3EWL A;  2IFQ B;  3H4K A;  4JZQ A;  3BOA A;  4BVX B;  3AY8 A;  3GUS A;  1DUG A;  1EWX A;  3HCZ A;  3LWA A;  1W89 A;  1T7P B;  3OR5 A;  3QAG A;  3GL3 A;  2I4A A;  3KXO A;  1K0A A;  1Z7R A;  2WGR A;  5CYY A;  5D9V A;  1OE7 A;  1GH2 A;  3C8E A;  1UVZ A;  5F07 A;  2GVP A;  4PNF A;  3FZ5 A;  2LQO A;  1YEX A;  2I3Y A;  5C04 A;  4TRX A;  5B8B A;  2GQK A;  3I9V 2;  2FA8 A;  4WBJ A;  2VM2 A;  3DVX A;  2LJA A;  1TK5 B;  4OFT A;  1YKA A;  2EIO A;  5G31 A;  2RUE A;  3VWV A;  4P3Y B;  1GUL A;  2IFQ A;  4IQ1 A;  4BVX A;  1FG4 A;  5IMF A;  5G1L A;  1T4Z A;  1ZCP A;  5CRG A;  1TI1 A;  2B1K A;  3C73 A;  1ACV A;  1SU9 A;  1QMV A;  2TRX A;  4HDE A;  2HXK A;  1TK8 B;  5EL8 A;  4IN0 A;  4O5R A;  3F63 A;  3TJK A;  2FWE A;  4DSS B;  3TKP A;  2H0G A;  1WOU A;  4KND A;  4KB3 A;  4OD7 A;  4IW9 A;  4HZ2 A;  5IOW A;  1F6M C;  1A24 A;  5HR3 A;  2MBS A;  4GRF A;  1YZX A;  2I9H A;  1J08 A;  2IWT A;  4ML1 A;  2NVL A;  10GS A;  1IYI A;  3DYR A;  1K3O A;  2V2G A;  2AYT A;  3D4T A;  2GSS A;  2L5L A;  2DIZ A;  2HLS A;  4ID0 A;  2XC2 A;  1M2B A;  3GX0 A;  4TR4 A;  1ZGN A;  1GSE A;  3F4R A;  3ZVJ A;  3GL5 A;  1Z5Y E;  2HQT A;  2P0G A;  3CSJ A;  2QSI A;  4GXZ A;  5KN1 A;  1UN2 A;  4EKZ A;  2QC7 A;  2V41 A;  3GKK A;  1SKW B;  3TUE A;  3TJG A;  4MDC A;  3LYK A;  1S3C A;  4FQU A;  1TJD A;  1F2E A;  2D2Z A;  2C4J A;  4DSS A;  4IBP A;  4FYU A;  2LQQ A;  3UVH A;  5DQS A;  3UL3 A;  4I97 A;  4EF0 A;  4NMU A;  5AN1 A;  3KTL A;  1VGL A;  3RHC A;  1B4Q A;  5DAL B;  3UAR A;  3H93 A;  1TU7 A;  1WE0 A;  1R4W A;  3S9F A;  1JHB A;  1A23 A;  1NW2 A;  2JZS A;  2R5G A;  2H71 A;  4G9H A;  4TOP A;  4AF2 A;  5L71 A;  4MZW A;  1XCC A;  2H01 A;  1XFL A;  4IEL A;  4NV2 A;  3APO A;  4ZB9 A;  2NTO A;  1O8W A;  1G6Y A;  3GUR A;  3ZML A;  5AGY A;  3KGK A;  2L6D A;  4WR5 A;  2C3T A;  4GF0 A;  4K0G A;  4GTU A;  4TR1 B;  4ECC A;  3MAK A;  5HR2 A;  1SK0 A;  2HNL A;  2N5F A;  4KA0 A;  5A5K A;  2H1B A;  5IO0 A;  1BG5 A;  3EC3 A;  4AJ8 A;  3P90 A;  1K0M A;  1GTI A;  4EC0 A;  4OO4 A;  3IXR A;  3F3Q A;  5DAL A;  2KP1 A;  1AC1 A;  3WGX A;  2LTK A;  1C72 A;  4I6X A;  4XRD A;  4MZC A;  5F06 A;  4POB A;  2X8C A;  3EU3 A;  2GT6 A;  2PVO C;  3WGE A;  5E4W A;  2GS3 A;  3LXT A;  5LNK e;  4ZB8 A;  2Z9S A;  3EE2 A;  2PER A;  2FWF A;  4KH7 A;  3IA1 A;  2GSQ A;  4G2E A;  1VF1 A;  2IMK A;  4EDZ A;  1ERU A;  3FZA A;  2DLX A;  4ECI A;  2HRN A;  1KNG A;  4YQU A;  2YWM A;  4IS0 A;  2R3X A;  1XIY A;  2VCX A;  1OC8 A;  2PUK C;  1QUW A;  3ZVJ D;  1V40 A;  1SKR B;  4MZB A;  1GSU A;  5F8B A;  3WGD A;  4HQZ A;  2FWH A;  4KAE A;  1VRS D;  1IYH A;  1WMJ A;  2MYG A;  1RK4 A;  4RQX A;  13GS A;  1XOA A;  1VF4 A;  1OKT A;  2P31 A;  3FKF A;  5H5S A;  5COH A;  1K0C A;  1MDK A;  3TOU A;  2VIM A;  5IQY A;  4WXT A;  4CHS A;  3DGQ A;  3IR4 A;  1B9Y C;  1E2Y A;  1MD4 A;  2DJ2 A;  4DSQ A;  1F3A A;  3M8N A;  9GSS A;  4KDU A;  2H74 A;  2M46 A;  2VCV A;  5ECI B;  2BJX A;  1ABA A;  3GH9 A;  4MMM A;  5IPH A;  2JU5 A;  1XVQ A;  5JCU A;  1ERV A;  2JL4 A;  1X9M B;  4ECB A;  2NDO A;  2X8G A;  2M80 A;  3V1W A;  4KW6 A;  2VLT A;  4KUN A;  2AB6 A;  3GST A;  1WPI A;  4OCE A;  4MJE A;  5J3R A;  3GV1 A;  2WZ9 A;  6GSW A;  3KZQ A;  2PN8 A;  1U88 A;  3VK9 A;  1EEM A;  12GS A;  3NIV A;  2FY6 A;  2IJY A;  2VAF A;  5J41 A;  2OAD A;  1BYE A;  2CV4 A;  4PNG A;  4K8M A;  2B6M A;  5F05 A;  8GSS A;  4JED A;  2LST A;  2HRA A;  1X5D A;  4X1U A;  3JCM L;  3ISO A;  2LEG A;  3QAW A;  1K0N A;  5DJL A;  1EOH A;  1SL2 B;  1VF3 A;  3LJR A;  3HVX A;  5B6M A;  1QFN A;  3R3E A;  3ZIJ A;  1YY7 A;  4HQS A;  1QQ2 A;  3IC4 A;  2IL3 A;  4IJ3 A;  1AW9 A;  4ZL8 A;  2YWO A;  3IDV A;  1ML6 A;  2VLV A;  4IHU A;  3U6V A;  5GST A;  1SKS B;  2ON5 A;  3KEB A;  2H76 A;  5ECL B;  2VLU A;  4WBR D;  3VPQ A;  3G7Y A;  2VUP A;  2C80 A;  3A2W A;  4L5O A;  2DJ0 A;  3M9K A;  4USS A;  3QPM A;  2L4C A;  1TW9 A;  3ZRD A;  1EGO A;  1I9D A;  4ZIJ A;  2HYX A;  1PKW A;  5JWQ B;  1H75 A;  5IOX A;  1DE1 A;  3ZL5 A;  1T4Y A;  4OO5 A;  3EUR A;  4ILF A;  4EL1 A;  4RI6 A;  3D21 A;  4EE0 A;  1OE8 A;  1Q98 A;  2LJR A;  2OJL A;  2X64 A;  4HS1 A;  1V9W A;  1CQH A;  4ACS A;  2YOI A;  1SEN A;  5HQP A;  2E7P A;  4LMW A;  4Q5F A;  2OBK A;  4OWY A;  4BA7 A;  3WD6 A;  1R5P A;  3N5O A;  1AQW A;  1BQ7 A;  3F8U A;  5ECM B;  2RUF A;  3IE3 A;  14GS A;  3EMP A;  2C0F A;  2YJ7 A;  1PD2 1;  1M0U A;  3MSZ A;  4ZBA A;  3QOU A;  5A4U A;  1B4P A;  2IMI A;  1SD8 A;  2C0E A;  4NHZ A;  3CRT A;  6GSY A;  1DE2 A;  5ECK B;  4POK A;  2VM1 A;  4WF4 A;  2XPD A;  4KDX A;  1HNA A;  17GS A;  2KOK A;  1WJK A;  4OFN A;  4MF6 A;  4GQC A;  1GTA A;  2AHE A;  5HFI A;  2CX3 A;  1OC3 A;  4EUY A;  2KUC A;  2AUV A;  2HI7 A;  5ECS A;  4ZBD A;  3F9U A;  4AJ7 A;  4TN8 A;  2WS2 A;  1Q4J A;  1GLP A;  4PGT A;  1PKZ A;  1X9W B;  2B3S A;  3MNG A;  1AQX A;  2V6O A;  4TXO B;  3RPN A;  1TU8 A;  4IQA A;  4LA1 A;  3G9B A;  2LV3 A;  1NSW A;  6GSU A;  1CQG A;  1GSD A;  3KIJ A;  2F3M A;  1NHO A;  1PQN A;  5ELG A;  3F0I A;  4OFM A;  2OAC A;  5IMC A;  3A3T A;  5GAN D;  4K1F A;  2OKA A;  11GS A;  1ZZY A;  1GUM A;  3VLN A;  1O85 A;  2HZF A;  1XW5 A;  4MPG A;  3TKS C;  1WWJ A;  2VCW A;  1E6B A;  1K3L A;  4RQR A;  1A0F A;  1XBS A;  3BD2 A;  1W4V A;  1XOB A;  3M9J A;  1GWC A;  6GSV A;  1Z3E A;  3GYK A;  2A2R A;  2GTU A;  1S3D A;  3PR8 A;  4IJI A;  4G0L A;  3TCO A;  1T1V A;  3CSH A;  1SJZ A;  2GT5 A;  1GSF A;  1XWG A;  2WRT A;  5LCZ A;  4TXO A;  1K0D A;  5DCG A;  3UEM A;  2H6X A;  2DSA A;  5IIZ A;  4J56 E;  3IAS 2;  1U3A A;  3DD3 A;  2XBI A;  3US3 A;  1MDI A;  3TB2 A;  5ECR B;  2DIY A;  4EVM A;  2AJQ B;  2YJH A;  3GKM A;  4IP6 A;  5DCH A;  3NOF A;  5ECP B;  4YAP A;  2C0G A;  1G0T A;  1ZYQ B;  2DML A;  2E2M A;  3GNJ A;  1J0F A;  2CZ2 A;  3IC8 A;  3CBU A;  1T8E B;  1HQO A;  1K3Y A;  2FWG A;  1YKC A;  3FEU A;  1XW6 A;  2ZNM A;  5FT3 A;  5ECN B;  3E3E A;  3ME7 A;  2DMM A;  2G2Q A;  4V1A p;  4K6X A;  1PA3 A;  2G0F A;  1XPV A;  2H19 A;  4BWQ A;  4N0V A;  4N0Z A;  5HFG A;  1O81 A;  4GLT A;  1ON4 A;  3O6T A;  2HFD A;  1V98 A;  4PQI A;  2IPA A;  2MBT A;  2FGX A;  3L0H A;  4TXV A;  2YWI A;  1RQM A;  2H0I A;  4NPB A;  2LJK A;  3QD9 A;  1A2J A;  2VL2 A;  4L5L A;  4GWR A;  3BCI A;  4XTS A;  2L6C A;  2O85 A;  2CAI A;  1PN9 A;  4N10 A;  2L59 A;  2YPM A;  3KTB A;  3O76 A;  2PPT A;  4POL A;  3IRA A;  1A2L A;  1A2M A;  2FHE A;  1KEB A;  2H70 A;  2FCH A;  2B1L A;  2B5E A;  2J9H A;  3Q6O A;  2DJK A;  4V2L A;  2WFC A;  3TKS E;  2K6V A;  1TP9 A;  4PQH A;  5KN3 A;  3HZ4 A;  1LU4 A;  1TOF A;  5DBQ A;  4JR4 A;  2LRT A;  3WT2 A;  5FHI A;  3FK8 A;  4IKH A;  1GSS A;  3LSZ A;  1GUH A;  3RPP A;  3UMA A;  3GIX A;  1N8J A;  5AIV A;  2JZR A;  4XRA A;  4TR3 A;  1AUC A;  4LMV A;  1SJ6 A;  2X8H A;  2YV7 A;  3PGT A;  4F03 A;  4E8E A;  1B8X A;  1URM A;  2PGT A;  3LGC A;  3G7J A;  2IIY A;  4K7I A;  3VPT A;  4BPY A;  3GRX A;  2HRF A;  4NHW A;  5KN2 A;  1JZW A;  1F9M A;  2A2S A;  5IMZ A;  5D9T A;  1BAY A;  1JZO A;  4HZ4 A;  1O6J A;  4BWS A;  4ZL7 A;  5D96 A;  4TR1 A;  4MJB A;  1BJX A;  3TRQ A;  3FZ4 A;  1VF2 A;  4RUV A;  1YEP A;  1A8L A;  4EXJ A;  1X5C A;  2HE3 A;  1GSY A;  16GS A;  3GN3 A;  20GS A;  3ERG A;  3QDN A;  3BJ5 A;  5KEJ A;  3TJF A;  1DBY A;  1TTZ A;  4DVC A;  2LS5 A;  2BMX A;  1PL2 A;  4O92 A;  2J23 A;  4Z7X A;  3FY7 A;  3GSS A;  2R2J A;  5G2Z A;  3ERF A;  1O7U A;  4ZBB A;  3DEX A;  2YAN A;  1BED A;  1AAZ A;  1YDK A;  4HU9 A;  2VCT A;  2GGT A;  5ENU A;  5IPG A;  5CRE A;  1FHE A;  3MWH A;  3GMF A;  4F2I A;  4MCU A;  1GP1 A;  2LNT A;  3CRU A;  2ZCT A;  1K0B A;  1EP7 A;  3QCP A;  2B5Y A;  4PUA A;  4FYC A;  5D8I A;  1B48 A;  4EO3 A;  5D9W A;  2WCI A;  4K2D A;  2FUG 2;  2JAD A;  1SL1 B;  1MD3 A;  3A2V A;  5D93 A;  4PUR A;  1X0R A;  2P5Q A;  2CZ3 A;  1JZD A;  4MH3 A;  2FA4 A;  3HVV A;  4FO5 A;  3TDG A;  4I2U A;  3DXB A;  2DJ1 A;  3ZFL A;  3IOS A;  1HNB A;  2DBC A;  2GZP A;  3DVW A;  2H6Y A;  1PSQ A;  3H8Q A;  3F3R A;  3VWU A;  3HJM A;  1YF1 A;  3KMN A;  4N11 A;  3EVI A;  3PH9 A;  3N9J A;  3TKQ A;  1TDI A;  4OCF A;  2JAC A;  1R5A A;  3KP9 A;  2HT9 A;  1SK2 A;  1ZYE A;  4TVE A;  1ZOF A;  3TJB A; 
#chains in the Genus database with same CATH topology
 5DQY A;  1THO A;  3W8S A;  1SJI A;  4JBB A;  2C0D A;  4F0C A;  3KP8 A;  3BCK A;  5D9X A;  4KSM A;  1O73 A;  3U5R E;  1Y25 A;  2EIR A;  5AIS A;  3IHQ A;  3I69 A;  4HSC X;  3UVT A;  3KD0 A;  2VO4 A;  3G7I A;  3LG6 A;  3J7Y b;  4CW9 A;  1KTE A;  3J7Y k;  5DVB A;  4J2F A;  1GTU A;  5A34 B;  5E59 A;  2LRN A;  4ISD A;  2FLS A;  5B6N A;  3Q18 A;  1T3B A;  1FOV A;  4E68 A;  3A2X A;  1SVO A;  3FR6 A;  5FWG A;  4KDY A;  2P5R A;  2YZU A;  3HD5 A;  2I1U A;  4N30 A;  1R26 A;  1ILO A;  4LL4 B;  2BTO T;  4QQ7 A;  4XS1 A;  3DRN A;  1TRS A;  4NWY A;  3DKS A;  3UBK A;  4ZXG A;  3GH6 A;  2WUL A;  2LNS A;  3E0U A;  7GSS A;  1JLW A;  5IMD A;  1GTB A;  3SBC A;  2O36 A;  5D73 A;  3D6I A;  5H5R A;  1LJR A;  2OE1 A;  1ZYP A;  3F4T A;  4KE3 A;  1NHY A;  1Z6M A;  3D4M A;  4F0B A;  4OMV A;  3P8W A;  2C3Q A;  4GSN A;  2F51 A;  5ECH B;  3IPZ A;  1JZR A;  5A34 A;  2H6Z A;  2ZUP A;  4L0U A;  3KMO A;  1GUK A;  2EIQ A;  5INY A;  5A1N B;  2HSH A;  1GSQ A;  1BF5 A;  4F82 A;  2GSR A;  1SK1 A;  3TRP A;  1HNC A;  4MPF A;  3L78 A;  4AJ6 A;  3CSI A;  3Q19 A;  3WYW A;  1EV9 A;  2YV9 A;  4POM A;  5ELA A;  4D73 B;  4RI7 A;  4N3Z A;  4MF5 A;  2OBI A;  2YP6 A;  2EFD A;  2WB9 A;  6GST A;  3PPU A;  1DSB A;  5KOW A;  2GST A;  2PU9 C;  5EVO A;  4Q5N A;  4PTS A;  1U3I A;  3L9S A;  2OE0 A;  2RM6 A;  3P2A A;  2RLI A;  1M9A A;  6GSX A;  3ZIV A;  2V6K A;  2NPB A;  2WZS A;  2VKZ G;  5C00 A;  4KF9 A;  4MJA A;  4YKF A;  1A8Y A;  2K8V A;  3DWV A;  1B9X C;  2HSY A;  2UZ8 A;  3RDW A;  4NAX A;  3TU3 B;  2HSN B;  1U87 A;  1XW9 A;  3VI5 A;  1Y1U A;  4GSS A;  3H79 A;  2F8F A;  2H0H A;  3HA9 A;  4K2X A;  5BRT A;  2GLR A;  1OC9 B;  5A1N A;  2FNO A;  2PVQ A;  2VL9 A;  5JCW A;  2FD3 A;  2HZE B;  1T00 A;  3O3T A;  3D22 A;  3NZN A;  3ZIT A;  4QL9 A;  3E9J B;  2GZZ A;  4K0N A;  5JWR B;  5IMA A;  4D73 A;  3C1R A;  5DAK B;  1GL8 A;  4KCE A;  1OYJ A;  3GHA A;  2N5A A;  4BIK A;  1TXX A;  2H66 A;  1WRY A;  4HUA A;  2VCZ A;  2VD1 A;  4KCA A;  3Q74 A;  4H86 A;  3KM6 A;  1PFO A;  1M99 A;  4WKW A;  4I2T A;  4HJ2 A;  4PI2 C;  2KP2 A;  1BG1 A;  2VL3 A;  4K7N A;  3VWX A;  2GQM A;  2L4Q A;  3UBL A;  1FW1 A;  1FAA A;  5JCG A;  2HSN A;  1PX7 A;  3VWW A;  3DML A;  5EY6 A;  4PUF C;  5B8A A;  4BVY B;  1TRU A;  2O7K A;  1OC9 A;  4AGS A;  3QMX A;  2HZE A;  4ML6 A;  1XWK A;  2CQ9 A;  1EV4 A;  4G10 A;  1Z6N A;  3ZLP A;  4K7O A;  2VD0 A;  3W6G A;  2CX4 A;  3IK9 A;  2CVB A;  5H5Q A;  4WF5 A;  3VUR A;  2YCD A;  1EOG A;  2C3N A;  2C8U A;  3CWG A;  2EC4 A;  5DAK A;  3LFL A;  4I8B A;  3IAM 2;  1SYX A;  2ES7 A;  5GSS A;  3A5W A;  3FHK A;  3QAV A;  4JE1 A;  2DC5 A;  2QKE A;  5G1K A;  3GA4 A;  3HXS A;  2K9F A;  4FYB A;  1GRX A;  1S3A A;  1USB A;  3EYT A;  3HYP A;  2I81 A;  2V1M A;  4X43 A;  5KN0 A;  4MA9 A;  1X9S B;  1FVK A;  2MZC A;  3CXG A;  4L8E A;  2E2G A;  3HMJ G;  2TIR A;  2KLX A;  4BVY A;  1O8X A;  1J9B A;  3GX8 A;  3ZTL A;  3I6A A;  3QFA C;  2H8L A;  2YNX A;  3LQ7 A;  1S3R A;  2E0Q A;  2MMO A;  4HU7 A;  4EDY A;  5A4W A;  4L0W A;  4NV5 A;  4YQV A;  3QR6 A;  4PX1 A;  2R4V A;  2F9S A;  5G5F A;  4HOJ A;  2M72 A;  2XBQ A;  3SWL A;  1OVN A;  2HSM B;  1AXD A;  2OA7 A;  1V57 A;  4CY6 A;  1RW1 A;  22GS A;  5CRW A;  4GQF A;  5F0G A;  2H73 A;  1U6T A;  4MNN A;  3FYG A;  4QMK A;  3L9V A;  3EMX A;  4FXY P;  1PL1 A;  4GDF A;  1AQV A;  3F4S A;  2YWN A;  1G6W A;  1K0O A;  2H72 A;  3C1S A;  1FB6 A;  1Z9H A;  1ZYN A;  4NXI A;  5G5E A;  4JRR A;  4MP4 A;  1G7E A;  1F3B A;  2WJU A;  2JSY A;  2N5B A;  1TRW A;  1ZMA A;  3CQF A;  3LYP A;  1UC7 A;  1LBK A;  4G01 A;  2C1Y A;  5BMU B;  4ZL9 A;  4E8H A;  3CTF A;  3FZ9 A;  4ULX A;  3K8N A;  3HJO A;  1EZK A;  2V32 A;  3KH9 A;  5B7C A;  2HSM A;  2PWJ A;  2OE3 A;  4BL7 B;  1YVL A;  2WDU A;  4GCI A;  4GST A;  4MAB A;  4IP1 A;  2IMD A;  1BX9 A;  4JU5 A;  1UA5 A;  3M0F A;  4TW5 A;  5GZZ B;  3TJJ A;  3IV4 A;  1JLV A;  4MF7 A;  1M7T A;  1EGR A;  1ST9 A;  1YJ6 A;  4WET A;  3UIW A;  1THX A;  4WEY A;  5CRD A;  3LXZ A;  4J57 E;  2X49 A;  2RII A;  3IK7 A;  2R0G A;  1M9B A;  1SYR A;  5J9B A;  2GZY A;  5J9C A;  2MMA A;  3C71 A;  2UV8 G;  5BMU A;  1M2D A;  3M1G A;  1ERW A;  3KH7 A;  2R37 A;  3LEF A;  5GAP D;  5IM9 A;  2K8S A;  1HD2 A;  3RHB A;  4ZB6 A;  3TKR A;  1TI3 A;  2GDR A;  4BL7 A;  3HZ8 A;  1HYU A;  3H1N A;  1SL0 B;  5CNW A;  3LOR A;  4V2N A;  5IMV A;  2H1G A;  2PMT A;  4XHM A;  1PMT A;  2JSZ A;  2CVK A;  1NM3 A;  3P7X A;  3ZMK A;  2CVD A;  5HR1 A;  3GFK A;  2PBJ A;  4FIW A;  2CT6 A;  2O3E A;  2VL2 C;  3ZYW A;  2VCQ A;  4DSR A;  3ERW A;  5CP1 A;  1FO5 A;  1V58 A;  3ZFB A;  1EEJ A;  3RFR C;  1X5E A;  3LW9 A;  3ZZX A;  1WIK A;  4IVF A;  2X99 A;  2AV4 A;  3CMI A;  4Q5Q A;  3APQ A;  4XCS A;  4TR0 A;  3HY2 A;  4HI7 A;  3FR3 A;  1F37 A;  1A0R P;  1XVW A;  4V2M A;  1MEK A;  4XS4 B;  1AIU A;  5KOX A;  1V2A A;  2A4V A;  1XWA A;  1GNW A;  3FW2 A;  3C7M A;  4KX4 A;  1M2A A;  1XWB A;  1XXU A;  3TGZ A;  4G0K A;  2MMZ A;  4X0X A;  1TK0 B;  2XPE A;  4QL7 A;  1FB0 A;  3BBY A;  2WW0 A;  4CDO A;  4I5Q A;  2KHP A;  1QXH A;  1OAZ A;  4AKH A;  1ERT A;  5G30 A;  3GKN A;  5ABR A;  2O8V B;  2HRK B;  4G19 A;  3HDC A;  3APS A;  3FR9 A;  3MIX A;  4IGJ A;  4O7H A;  4HJM A;  4TKY A;  3EIN A;  4O5U A;  4YAV A;  3I43 A;  2ALB A;  4MK3 A;  3GKX A;  2XHF A;  4XS4 A;  5ID2 B;  2YZH A;  2DJJ A;  1PGT A;  3ME8 A;  4ZIL A;  2CA8 A;  2R6K A;  4ECJ A;  5HR0 A;  2A4H A;  1FVJ A;  3MDK A;  1PRX A;  4HEA 2;  3KJY A;  4Z2U A;  4PXO A;  3F6F A;  2LRC A;  4KGI A;  4KSO A;  3ZRE A;  3HKR A;  4YQM A;  3VFI A;  4F9Z A;  2B7J A;  2EFC A;  1MDJ A;  2IN3 A;  2OT3 A;  1OKD A;  1Y6E A;  2WW2 A;  2HRK A;  2H1L A;  2MMN A;  2GQL A;  2O87 A;  1R7H A;  3L9U A;  4O32 A;  1XZO A;  2IME A;  3HJP A;  1G7O A;  2VOC A;  1ZL9 A;  4K9Z A;  4PQ1 A;  2B5X A;  3EU4 A;  4MLY A;  2H75 A;  1EP8 A;  4V1A g;  1WP0 A;  4MH2 A;  5ID2 A;  4FH8 A;  5EPF A;  2QGV A;  18GS A;  1QK8 A;  2EFE A;  3R2Q A;  2LUS A;  2CAQ A;  2JZT A;  4CY8 A;  3HVS A;  3D5J A;  3DIE A;  5A4V A;  1XWC A;  3W8J A;  2B7K A;  5DDL A;  3VI7 A;  5JWO B;  2H30 A;  2RM5 A;  2ON7 A;  1I5G A;  5CRH A;  2EFH A;  3TOT A;  5CO3 A;  1MTC A;  5HFK A;  1TRV A;  3QFB C;  3F6D A;  3KCM A;  5LD0 A;  1SVM A;  3HHV A;  5IO2 A;  2O89 A;  3PIN A;  2TRC P;  4Q5R A;  3WT1 A;  3GTU B;  2NBS A;  6GSS A;  3UOM A;  3D0Z A;  4XIH A;  2H1A A;  1PX6 A;  2K18 A;  4LLR A;  4YH2 A;  19GS A;  2DJ3 A;  2REM A;  1N2A A;  3TKS A;  2AAW A;  4LL1 B;  4JR6 A;  3IBH A;  1JFU A;  4WR4 A;  4MJC A;  4G0I A;  5ECQ B;  3ED3 A;  4PI0 C;  2F8A A;  3UAP A;  1YQ1 A;  1QGV A;  2H1D A;  5J5N A;  2L57 A;  5ECO B;  3CTG A;  3M3M A;  3L4N A;  5J40 A;  2LKU A;  3TRX A;  2IMF A;  3UJ1 A;  1YF0 A;  1GNE A;  4XS6 A;  5CAX A;  3CYN A;  1GLQ A;  2L5O A;  1SD9 A;  1H4O A;  5DJM A;  3FRC A;  3RAZ A;  1KBN A;  1TKD B;  3GTU A;  5AIX A;  3RBT A;  5J4U A;  4DEJ A;  2YN1 A;  1Z7P A;  3EWL A;  2IFQ B;  3H4K A;  4JZQ A;  3BOA A;  4X4J A;  4BVX B;  3AY8 A;  3GUS A;  1DUG A;  1EWX A;  3HCZ A;  3LWA A;  1W89 A;  1T7P B;  2WW3 A;  3OR5 A;  3QAG A;  3GL3 A;  2I4A A;  3KXO A;  1K0A A;  1Z7R A;  2WGR A;  5CYY A;  5D9V A;  3FMW A;  1OE7 A;  1GH2 A;  3C8E A;  1UVZ A;  5F07 A;  2GVP A;  4PNF A;  3FZ5 A;  2LQO A;  1YEX A;  2I3Y A;  5C04 A;  4TRX A;  5B8B A;  2GQK A;  3I9V 2;  2FA8 A;  4WBJ A;  2VM2 A;  3DVX A;  2LJA A;  1TK5 B;  4OFT A;  1YKA A;  2EIO A;  5G31 A;  2RUE A;  2A2P A;  3VWV A;  4EIP A;  4P3Y B;  1GUL A;  1SVL A;  2IFQ A;  4IQ1 A;  4BVX A;  4O5Q A;  1FG4 A;  5IMF A;  5G1L A;  1T4Z A;  1ZCP A;  5CRG A;  1TI1 A;  2B1K A;  3C73 A;  1ACV A;  1SU9 A;  1QMV A;  2TRX A;  4HDE A;  2HXK A;  1TK8 B;  5EL8 A;  4IN0 A;  4O5R A;  3F63 A;  3TJK A;  2FWE A;  4DSS B;  3TKP A;  2H0G A;  1WOU A;  4KND A;  4KB3 A;  4OD7 A;  4IW9 A;  4HZ2 A;  5IOW A;  1F6M C;  1A24 A;  5HR3 A;  2MBS A;  3IHG A;  4GRF A;  1YZX A;  2I9H A;  1J08 A;  2IWT A;  4ML1 A;  2NVL A;  10GS A;  1IYI A;  3DYR A;  1K3O A;  2V2G A;  2AYT A;  3D4T A;  2GSS A;  2L5L A;  2DIZ A;  2HLS A;  4ID0 A;  2WVX B;  2XC2 A;  1M2B A;  3GX0 A;  4TR4 A;  1ZGN A;  1GSE A;  3F4R A;  3ZVJ A;  3GL5 A;  1Z5Y E;  2R0C A;  2HQT A;  2P0G A;  3CSJ A;  2QSI A;  4GXZ A;  5KN1 A;  1UN2 A;  4EKZ A;  2QC7 A;  2V41 A;  3GKK A;  1SKW B;  3TUE A;  3TJG A;  4MDC A;  3LYK A;  1S3C A;  4FQU A;  1TJD A;  1F2E A;  2D2Z A;  2C4J A;  4DSS A;  4IBP A;  4FYU A;  2LQQ A;  3UVH A;  5DQS A;  3UL3 A;  4I97 A;  4EF0 A;  4NMU A;  5AN1 A;  3KTL A;  1VGL A;  3RHC A;  1B4Q A;  5DAL B;  3UAR A;  3H93 A;  1TU7 A;  1WE0 A;  1R4W A;  3S9F A;  1JHB A;  1A23 A;  1NW2 A;  2JZS A;  1S4B P;  5J4Y A;  2R5G A;  2H71 A;  4G9H A;  2WVX A;  4TOP A;  4AF2 A;  5L71 A;  4MZW A;  1XCC A;  2H01 A;  1XFL A;  4IEL A;  4NV2 A;  3APO A;  4ZB9 A;  2NTO A;  1O8W A;  1G6Y A;  3GUR A;  3ZML A;  5AGY A;  3KGK A;  2L6D A;  4WR5 A;  2C3T A;  4GF0 A;  4K0G A;  4GTU A;  4TR1 B;  4ECC A;  3MAK A;  5HR2 A;  1M3J A;  1SK0 A;  2HNL A;  2N5F A;  4KA0 A;  5A5K A;  2H1B A;  5IO0 A;  1BG5 A;  3EC3 A;  5J4V A;  4AJ8 A;  3P90 A;  1K0M A;  1GTI A;  4EC0 A;  4OO4 A;  4A5P A;  3IXR A;  3F3Q A;  5DAL A;  2KP1 A;  1AC1 A;  3WGX A;  2LTK A;  1C72 A;  4I6X A;  4XRD A;  4MZC A;  5F06 A;  4POB A;  2X8C A;  3EU3 A;  2GT6 A;  2PVO C;  3WGE A;  5E4W A;  2GS3 A;  1XG8 A;  3LXT A;  5LNK e;  4ZB8 A;  2Z9S A;  3EE2 A;  4K5R A;  2PER A;  2FWF A;  4KH7 A;  3IA1 A;  2GSQ A;  4G2E A;  1VF1 A;  2WW1 A;  2IMK A;  4EDZ A;  1ERU A;  3FZA A;  2DLX A;  4ECI A;  2HRN A;  1KNG A;  4YQU A;  2YWM A;  4IS0 A;  2R3X A;  1XIY A;  2VCX A;  1OC8 A;  2PUK C;  1QUW A;  4W66 A;  3ZVJ D;  1V40 A;  1SKR B;  4MZB A;  1GSU A;  5F8B A;  3WGD A;  4HQZ A;  2FWH A;  4KAE A;  1VRS D;  1IYH A;  1WMJ A;  2MYG A;  1RK4 A;  4RQX A;  1M3I A;  13GS A;  1XOA A;  4YKG A;  1VF4 A;  1OKT A;  2P31 A;  3FKF A;  5H5S A;  5COH A;  1K0C A;  1MDK A;  3TOU A;  2VIM A;  5IQY A;  4WXT A;  4CHS A;  3DGQ A;  3IR4 A;  2R0P A;  3A5I A;  1B9Y C;  1E2Y A;  1MD4 A;  2DJ2 A;  4DSQ A;  1F3A A;  3M8N A;  9GSS A;  4KDU A;  2H74 A;  2M46 A;  2VCV A;  4Z2T A;  5J47 A;  2WVZ A;  5ECI B;  2BJX A;  1ABA A;  3GH9 A;  4MMM A;  5IPH A;  2JU5 A;  1XVQ A;  5JCU A;  1ERV A;  2JL4 A;  1X9M B;  4K5S A;  4ECB A;  2NDO A;  2X8G A;  2M80 A;  1TXU A;  3V1W A;  4KW6 A;  2VLT A;  4KUN A;  2AB6 A;  3GST A;  1WPI A;  4OCE A;  4MJE A;  5J3R A;  3GV1 A;  2WZ9 A;  6GSW A;  3KZQ A;  2PN8 A;  1U88 A;  3VK9 A;  1EEM A;  12GS A;  3NIV A;  2FY6 A;  2IJY A;  2VAF A;  4Z2R A;  5J41 A;  2OAD A;  1BYE A;  2CV4 A;  4PNG A;  4K8M A;  2B6M A;  5F05 A;  8GSS A;  4JED A;  2LST A;  2HRA A;  1X5D A;  4X1U A;  3JCM L;  1N25 A;  3ISO A;  2LEG A;  3QAW A;  1K0N A;  5DJL A;  1EOH A;  1SL2 B;  1VF3 A;  3LJR A;  3HVX A;  5B6M A;  1QFN A;  3R3E A;  3ZIJ A;  1YY7 A;  4HQS A;  1QQ2 A;  3IC4 A;  2IL3 A;  4IJ3 A;  1AW9 A;  4AKI A;  4ZL8 A;  2YWO A;  3IDV A;  1ML6 A;  2VLV A;  4IHU A;  3U6V A;  5GST A;  1SKS B;  2ON5 A;  3KEB A;  2H76 A;  5ECL B;  2VLU A;  4WBR D;  3VPQ A;  3G7Y A;  2VUP A;  2C80 A;  3A2W A;  4L5O A;  2DJ0 A;  3M9K A;  4USS A;  3QPM A;  2L4C A;  1TW9 A;  3ZRD A;  1EGO A;  1I9D A;  4ZIJ A;  2HYX A;  1PKW A;  5JWQ B;  1H75 A;  1PN0 A;  5IOX A;  1DE1 A;  3ZL5 A;  1T4Y A;  4OO5 A;  3EUR A;  4ILF A;  4EL1 A;  4RI6 A;  3D21 A;  4EE0 A;  1OE8 A;  1Q98 A;  2LJR A;  2OJL A;  2X64 A;  4HS1 A;  1V9W A;  1CQH A;  4ACS A;  2YOI A;  1SEN A;  5HQP A;  2O5V A;  2E7P A;  4LMW A;  4Q5F A;  2OBK A;  4OWY A;  4BA7 A;  3WD6 A;  4AKG A;  1R5P A;  3N5O A;  3RGB C;  1AQW A;  1BQ7 A;  3F8U A;  5ECM B;  2RUF A;  3IE3 A;  14GS A;  3EMP A;  2C0F A;  2YJ7 A;  1PD2 1;  1M0U A;  3MSZ A;  4ZBA A;  3QOU A;  5A4U A;  1B4P A;  2IMI A;  1SD8 A;  2C0E A;  4NHZ A;  3CRT A;  6GSY A;  1DE2 A;  5ECK B;  4POK A;  2VM1 A;  4WF4 A;  2XPD A;  4KDX A;  1HNA A;  17GS A;  2KOK A;  1WJK A;  4OFN A;  4MF6 A;  4GQC A;  1GTA A;  2AHE A;  5HFI A;  2CX3 A;  1OC3 A;  2QA2 A;  4EUY A;  2KUC A;  2AUV A;  2HI7 A;  5ECS A;  4ZBD A;  4AI6 A;  3F9U A;  4AJ7 A;  4TN8 A;  2WS2 A;  1Q4J A;  1GLP A;  4PGT A;  1PKZ A;  1X9W B;  5A5H B;  2B3S A;  3MNG A;  1AQX A;  2V6O A;  4TXO B;  3RPN A;  1TU8 A;  4IQA A;  4LA1 A;  3G9B A;  2LV3 A;  1NSW A;  6GSU A;  1CQG A;  1GSD A;  4AKX B;  3KIJ A;  2F3M A;  1NHO A;  1PQN A;  5ELG A;  3F0I A;  4OFM A;  2OAC A;  5IMC A;  3A3T A;  5GAN D;  4K1F A;  2OKA A;  11GS A;  1ZZY A;  1GUM A;  3VLN A;  1O85 A;  2HZF A;  1XW5 A;  4MPG A;  3TKS C;  1WWJ A;  2VCW A;  1E6B A;  1K3L A;  4RQR A;  1A0F A;  1XBS A;  3BD2 A;  1W4V A;  1XOB A;  3M9J A;  1GWC A;  6GSV A;  1Z3E A;  3GYK A;  5A5H A;  2A2R A;  2GTU A;  1S3D A;  3PR8 A;  4IJI A;  4G0L A;  3TCO A;  1T1V A;  2WVY A;  3CSH A;  1SJZ A;  2GT5 A;  1GSF A;  1XWG A;  2WRT A;  5LCZ A;  4TXO A;  1K0D A;  5DCG A;  3UEM A;  2H6X A;  2DSA A;  5IIZ A;  4J56 E;  3IAS 2;  1U3A A;  3DD3 A;  2XBI A;  3US3 A;  1MDI A;  3TB2 A;  5ECR B;  2DIY A;  4PHZ C;  4EVM A;  2YJH A;  2AJQ B;  3GKM A;  4IP6 A;  5DCH A;  3NOF A;  5ECP B;  4YAP A;  2C0G A;  1G0T A;  1ZYQ B;  2DML A;  2E2M A;  3GNJ A;  1J0F A;  2CZ2 A;  3IC8 A;  3CBU A;  1T8E B;  1HQO A;  1K3Y A;  2FWG A;  1YKC A;  2QA1 A;  3FEU A;  1XW6 A;  2ZNM A;  5FT3 A;  5ECN B;  3E3E A;  3ME7 A;  2DMM A;  2G2Q A;  4V1A p;  4K6X A;  1PA3 A;  2G0F A;  1XPV A;  2H19 A;  4BWQ A;  4N0V A;  4N0Z A;  5HFG A;  1YEW C;  1O81 A;  4GLT A;  1ON4 A;  3O6T A;  4ICY A;  2HFD A;  1V98 A;  4PQI A;  3EPT A;  1FOH A;  2IPA A;  2MBT A;  2FGX A;  3L0H A;  4TXV A;  2YWI A;  1RQM A;  2H0I A;  4NPB A;  2LJK A;  3QD9 A;  1A2J A;  2VL2 A;  4L5L A;  4GWR A;  2DKI A;  3BCI A;  4XTS A;  2L6C A;  2O85 A;  2CAI A;  1PN9 A;  4N10 A;  2L59 A;  2YPM A;  3KTB A;  3O76 A;  2PPT A;  4POL A;  3IRA A;  1A2L A;  1A2M A;  2FHE A;  4ZB7 A;  1KEB A;  2H70 A;  2FCH A;  2B1L A;  2B5E A;  2J9H A;  3Q6O A;  2DJK A;  4V2L A;  2WFC A;  3TKS E;  2K6V A;  1TP9 A;  4PQH A;  5KN3 A;  3HZ4 A;  1LU4 A;  1TOF A;  5DBQ A;  4JR4 A;  2LRT A;  3WT2 A;  5FHI A;  3FK8 A;  4IKH A;  1GSS A;  3LSZ A;  3HVN A;  1GUH A;  1I1I P;  3RPP A;  3UMA A;  3GIX A;  1N8J A;  5AIV A;  2JZR A;  4XRA A;  4TR3 A;  1AUC A;  4LMV A;  1SJ6 A;  2X8H A;  2YV7 A;  3PGT A;  4F03 A;  4E8E A;  1B8X A;  1URM A;  2PGT A;  3LGC A;  3G7J A;  2IIY A;  4K7I A;  3VPT A;  4BPY A;  3GRX A;  2HRF A;  4NHW A;  5KN2 A;  1JZW A;  1F9M A;  2A2S A;  5IMZ A;  5D9T A;  1BAY A;  1JZO A;  4HZ4 A;  1O6J A;  4BWS A;  4ZL7 A;  5D96 A;  4TR1 A;  4MJB A;  1BJX A;  3TRQ A;  3FZ4 A;  1VF2 A;  4RUV A;  1YEP A;  1A8L A;  4EXJ A;  1X5C A;  2HE3 A;  1GSY A;  3CHX C;  16GS A;  3GN3 A;  20GS A;  3ERG A;  3QDN A;  3BJ5 A;  4EIQ A;  5KEJ A;  3TJF A;  1DBY A;  1TTZ A;  4DVC A;  2LS5 A;  2BMX A;  1PL2 A;  4O92 A;  2J23 A;  3MYD A;  4Z7X A;  3FY7 A;  3GSS A;  2R2J A;  5G2Z A;  3ERF A;  1O7U A;  4ZBB A;  3DEX A;  2YAN A;  1BED A;  1AAZ A;  1YDK A;  4HU9 A;  2VCT A;  2GGT A;  5ENU A;  5IPG A;  5CRE A;  1FHE A;  3MWH A;  3GMF A;  4F2I A;  4MCU A;  1GP1 A;  2LNT A;  3CRU A;  2ZCT A;  1K0B A;  1EP7 A;  3QCP A;  2B5Y A;  4PUA A;  4FYC A;  5D8I A;  1B48 A;  4EO3 A;  5D9W A;  2WCI A;  4K2D A;  2FUG 2;  2JAD A;  1SL1 B;  1MD3 A;  3A2V A;  5D93 A;  4PUR A;  1X0R A;  2P5Q A;  2CZ3 A;  1JZD A;  4MH3 A;  2FA4 A;  3HVV A;  4FO5 A;  3TDG A;  4I2U A;  3DXB A;  2DJ1 A;  3ZFL A;  3IOS A;  1HNB A;  2DBC A;  2GZP A;  3DVW A;  2H6Y A;  1PSQ A;  3H8Q A;  3F3R A;  3VWU A;  2X4A A;  3HJM A;  1YF1 A;  3KMN A;  4N11 A;  3EVI A;  3PH9 A;  3N9J A;  3TKQ A;  1TDI A;  4OCF A;  2JAC A;  2DKH A;  1R5A A;  3KP9 A;  2HT9 A;  1SK2 A;  1ZYE A;  4TVE A;  1ZOF A;  3TJB A; 
#chains in the Genus database with same CATH homology
 5DQY A;  1THO A;  3W8S A;  1SJI A;  4JBB A;  2C0D A;  4F0C A;  3KP8 A;  3BCK A;  5D9X A;  4KSM A;  1O73 A;  3U5R E;  1Y25 A;  2EIR A;  5AIS A;  3IHQ A;  3I69 A;  3UVT A;  3KD0 A;  2VO4 A;  3G7I A;  3LG6 A;  3J7Y b;  4CW9 A;  1KTE A;  3J7Y k;  5DVB A;  4J2F A;  1GTU A;  5A34 B;  5E59 A;  2LRN A;  4ISD A;  2FLS A;  5B6N A;  3Q18 A;  1T3B A;  1FOV A;  4E68 A;  3A2X A;  1SVO A;  3FR6 A;  5FWG A;  4KDY A;  2P5R A;  2YZU A;  3HD5 A;  2I1U A;  4N30 A;  1R26 A;  1ILO A;  4LL4 B;  2BTO T;  4QQ7 A;  4XS1 A;  3DRN A;  1TRS A;  4NWY A;  3DKS A;  3UBK A;  4ZXG A;  3GH6 A;  2WUL A;  2LNS A;  3E0U A;  7GSS A;  1JLW A;  5IMD A;  1GTB A;  3SBC A;  3D6I A;  5D73 A;  5H5R A;  1LJR A;  2OE1 A;  1ZYP A;  3F4T A;  4KE3 A;  1NHY A;  1Z6M A;  3D4M A;  4F0B A;  4OMV A;  3P8W A;  2C3Q A;  4GSN A;  2F51 A;  5ECH B;  3IPZ A;  1JZR A;  5A34 A;  2H6Z A;  2ZUP A;  4L0U A;  3KMO A;  1GUK A;  2EIQ A;  5INY A;  5A1N B;  2HSH A;  1GSQ A;  1BF5 A;  4F82 A;  2GSR A;  1SK1 A;  3TRP A;  1HNC A;  4MPF A;  3L78 A;  4AJ6 A;  3CSI A;  3Q19 A;  3WYW A;  1EV9 A;  2YV9 A;  4POM A;  5ELA A;  4D73 B;  4RI7 A;  4N3Z A;  4MF5 A;  2OBI A;  2YP6 A;  2EFD A;  2WB9 A;  6GST A;  3PPU A;  1DSB A;  5KOW A;  2GST A;  2PU9 C;  5EVO A;  4Q5N A;  4PTS A;  1U3I A;  3L9S A;  2OE0 A;  2RM6 A;  3P2A A;  2RLI A;  1M9A A;  6GSX A;  3ZIV A;  2V6K A;  2NPB A;  2VKZ G;  5C00 A;  4KF9 A;  4MJA A;  4YKF A;  1A8Y A;  2K8V A;  3DWV A;  1B9X C;  2HSY A;  2UZ8 A;  3RDW A;  4NAX A;  3TU3 B;  2HSN B;  1U87 A;  1XW9 A;  3VI5 A;  1Y1U A;  4GSS A;  3H79 A;  2F8F A;  2H0H A;  3HA9 A;  4K2X A;  5BRT A;  2GLR A;  1OC9 B;  5A1N A;  2FNO A;  2PVQ A;  2VL9 A;  5JCW A;  2FD3 A;  2HZE B;  1T00 A;  3O3T A;  3D22 A;  3NZN A;  3ZIT A;  4QL9 A;  3E9J B;  2GZZ A;  4K0N A;  5JWR B;  5IMA A;  4D73 A;  3C1R A;  5DAK B;  1GL8 A;  4KCE A;  1OYJ A;  3GHA A;  2N5A A;  1TXX A;  2H66 A;  1WRY A;  4HUA A;  2VCZ A;  2VD1 A;  4KCA A;  3Q74 A;  4H86 A;  3KM6 A;  4WKW A;  1M99 A;  4I2T A;  4HJ2 A;  2KP2 A;  1BG1 A;  2VL3 A;  4K7N A;  3VWX A;  2GQM A;  2L4Q A;  3UBL A;  1FW1 A;  1FAA A;  5JCG A;  2HSN A;  1PX7 A;  3VWW A;  3DML A;  5EY6 A;  4PUF C;  5B8A A;  4BVY B;  1TRU A;  2O7K A;  1OC9 A;  4AGS A;  3QMX A;  2HZE A;  4ML6 A;  1XWK A;  2CQ9 A;  1EV4 A;  4G10 A;  1Z6N A;  3ZLP A;  4K7O A;  2VD0 A;  3W6G A;  2CX4 A;  3IK9 A;  2CVB A;  5H5Q A;  4WF5 A;  3VUR A;  2YCD A;  1EOG A;  2C3N A;  2C8U A;  3CWG A;  2EC4 A;  5DAK A;  3LFL A;  4I8B A;  3IAM 2;  1SYX A;  2ES7 A;  5GSS A;  3A5W A;  3FHK A;  3QAV A;  4JE1 A;  2DC5 A;  2QKE A;  5G1K A;  3GA4 A;  3HXS A;  2K9F A;  4FYB A;  1GRX A;  1S3A A;  1USB A;  3EYT A;  3HYP A;  2I81 A;  2V1M A;  4X43 A;  5KN0 A;  4MA9 A;  1X9S B;  1FVK A;  2MZC A;  3CXG A;  4L8E A;  2E2G A;  3HMJ G;  2TIR A;  2KLX A;  4BVY A;  1O8X A;  1J9B A;  3GX8 A;  3ZTL A;  3I6A A;  3QFA C;  2H8L A;  2YNX A;  3LQ7 A;  2E0Q A;  2MMO A;  4HU7 A;  4EDY A;  5A4W A;  4L0W A;  4NV5 A;  4YQV A;  3QR6 A;  4PX1 A;  2R4V A;  2F9S A;  5G5F A;  4HOJ A;  2M72 A;  2XBQ A;  3SWL A;  1OVN A;  2HSM B;  1AXD A;  2OA7 A;  1V57 A;  4CY6 A;  1RW1 A;  22GS A;  5CRW A;  4GQF A;  5F0G A;  2H73 A;  1U6T A;  4MNN A;  3FYG A;  4QMK A;  3L9V A;  3EMX A;  1PL1 A;  4GDF A;  1AQV A;  3F4S A;  2YWN A;  1G6W A;  1K0O A;  2H72 A;  3C1S A;  1FB6 A;  1Z9H A;  1ZYN A;  4NXI A;  5G5E A;  4JRR A;  4MP4 A;  1G7E A;  1F3B A;  2WJU A;  2JSY A;  2N5B A;  1TRW A;  1ZMA A;  3LYP A;  1UC7 A;  1LBK A;  4G01 A;  2C1Y A;  5BMU B;  4ZL9 A;  4E8H A;  3CTF A;  3FZ9 A;  4ULX A;  3K8N A;  3HJO A;  1EZK A;  2V32 A;  3KH9 A;  5B7C A;  2HSM A;  2PWJ A;  2OE3 A;  4BL7 B;  1YVL A;  2WDU A;  4GCI A;  4GST A;  4MAB A;  4IP1 A;  2IMD A;  1BX9 A;  4JU5 A;  1UA5 A;  3M0F A;  4TW5 A;  5GZZ B;  3TJJ A;  3IV4 A;  1JLV A;  4MF7 A;  1M7T A;  1EGR A;  1ST9 A;  1YJ6 A;  4WET A;  3UIW A;  1THX A;  4WEY A;  5CRD A;  3LXZ A;  4J57 E;  2X49 A;  2RII A;  3IK7 A;  2R0G A;  1M9B A;  1SYR A;  5J9B A;  2GZY A;  5J9C A;  2MMA A;  3C71 A;  2UV8 G;  5BMU A;  1M2D A;  3M1G A;  1ERW A;  3KH7 A;  2R37 A;  3LEF A;  5GAP D;  5IM9 A;  2K8S A;  1HD2 A;  3RHB A;  4ZB6 A;  3TKR A;  1TI3 A;  2GDR A;  4BL7 A;  3HZ8 A;  1HYU A;  3H1N A;  1SL0 B;  5CNW A;  3LOR A;  4V2N A;  5IMV A;  2H1G A;  2PMT A;  4XHM A;  1PMT A;  2JSZ A;  2CVK A;  1NM3 A;  3P7X A;  3ZMK A;  2CVD A;  5HR1 A;  3GFK A;  2PBJ A;  4FIW A;  2CT6 A;  2VL2 C;  3ZYW A;  2VCQ A;  4DSR A;  3ERW A;  5CP1 A;  1FO5 A;  1V58 A;  3ZFB A;  1EEJ A;  1X5E A;  3LW9 A;  3ZZX A;  1WIK A;  4IVF A;  2X99 A;  2AV4 A;  3CMI A;  4Q5Q A;  3APQ A;  4XCS A;  4TR0 A;  3HY2 A;  4HI7 A;  3FR3 A;  1F37 A;  1A0R P;  1XVW A;  4V2M A;  1MEK A;  4XS4 B;  1AIU A;  5KOX A;  1V2A A;  2A4V A;  1XWA A;  1GNW A;  3FW2 A;  3C7M A;  4KX4 A;  1M2A A;  1XWB A;  1XXU A;  3TGZ A;  4G0K A;  2MMZ A;  4X0X A;  1TK0 B;  2XPE A;  4QL7 A;  1FB0 A;  3BBY A;  4CDO A;  4I5Q A;  2KHP A;  1QXH A;  1OAZ A;  4AKH A;  1ERT A;  5G30 A;  3GKN A;  5ABR A;  2O8V B;  2HRK B;  4G19 A;  3HDC A;  3APS A;  3FR9 A;  3MIX A;  4IGJ A;  4O7H A;  4HJM A;  4TKY A;  3EIN A;  4O5U A;  4YAV A;  3I43 A;  2ALB A;  4MK3 A;  3GKX A;  2XHF A;  4XS4 A;  5ID2 B;  2YZH A;  2DJJ A;  1PGT A;  3ME8 A;  4ZIL A;  2CA8 A;  2R6K A;  4ECJ A;  5HR0 A;  2A4H A;  1FVJ A;  3MDK A;  1PRX A;  4HEA 2;  3KJY A;  4Z2U A;  4PXO A;  3F6F A;  2LRC A;  4KGI A;  4KSO A;  3ZRE A;  3HKR A;  4YQM A;  3VFI A;  4F9Z A;  2B7J A;  2EFC A;  1MDJ A;  2IN3 A;  2OT3 A;  1OKD A;  1Y6E A;  2HRK A;  2H1L A;  2MMN A;  2GQL A;  2O87 A;  1R7H A;  3L9U A;  4O32 A;  1XZO A;  2IME A;  3HJP A;  1G7O A;  2VOC A;  1ZL9 A;  4K9Z A;  4PQ1 A;  2B5X A;  3EU4 A;  4MLY A;  2H75 A;  1EP8 A;  4V1A g;  1WP0 A;  4MH2 A;  5ID2 A;  4FH8 A;  5EPF A;  2QGV A;  18GS A;  1QK8 A;  2EFE A;  3R2Q A;  2LUS A;  2CAQ A;  2JZT A;  4CY8 A;  3HVS A;  3D5J A;  3DIE A;  5A4V A;  1XWC A;  3W8J A;  2B7K A;  5DDL A;  3VI7 A;  5JWO B;  2H30 A;  2RM5 A;  2ON7 A;  1I5G A;  5CRH A;  2EFH A;  3TOT A;  5CO3 A;  1MTC A;  5HFK A;  1TRV A;  3QFB C;  3F6D A;  3KCM A;  5LD0 A;  1SVM A;  3HHV A;  5IO2 A;  2O89 A;  3PIN A;  2TRC P;  4Q5R A;  3WT1 A;  3GTU B;  2NBS A;  6GSS A;  3UOM A;  3D0Z A;  4XIH A;  2H1A A;  1PX6 A;  2K18 A;  4LLR A;  4YH2 A;  19GS A;  2DJ3 A;  2REM A;  1N2A A;  3TKS A;  2AAW A;  4LL1 B;  4JR6 A;  3IBH A;  1JFU A;  4WR4 A;  4MJC A;  4G0I A;  5ECQ B;  3ED3 A;  2F8A A;  3UAP A;  1YQ1 A;  1QGV A;  2H1D A;  5J5N A;  2L57 A;  5ECO B;  3CTG A;  3M3M A;  3L4N A;  5J40 A;  2LKU A;  3TRX A;  2IMF A;  3UJ1 A;  1YF0 A;  1GNE A;  4XS6 A;  5CAX A;  3CYN A;  1GLQ A;  2L5O A;  1SD9 A;  1H4O A;  5DJM A;  3FRC A;  3RAZ A;  1KBN A;  1TKD B;  3GTU A;  5AIX A;  3RBT A;  5J4U A;  4DEJ A;  2YN1 A;  1Z7P A;  3EWL A;  2IFQ B;  3H4K A;  4JZQ A;  3BOA A;  4X4J A;  4BVX B;  3AY8 A;  3GUS A;  1DUG A;  1EWX A;  3HCZ A;  3LWA A;  1W89 A;  1T7P B;  3OR5 A;  3QAG A;  3GL3 A;  2I4A A;  3KXO A;  1K0A A;  1Z7R A;  2WGR A;  5CYY A;  5D9V A;  3FMW A;  1OE7 A;  1GH2 A;  3C8E A;  1UVZ A;  5F07 A;  2GVP A;  4PNF A;  3FZ5 A;  2LQO A;  1YEX A;  2I3Y A;  5C04 A;  4TRX A;  5B8B A;  2GQK A;  3I9V 2;  2FA8 A;  4WBJ A;  2VM2 A;  3DVX A;  2LJA A;  1TK5 B;  4OFT A;  1YKA A;  2EIO A;  5G31 A;  2RUE A;  2A2P A;  3VWV A;  4EIP A;  4P3Y B;  1GUL A;  1SVL A;  2IFQ A;  4IQ1 A;  4BVX A;  4O5Q A;  1FG4 A;  5IMF A;  5G1L A;  1T4Z A;  1ZCP A;  5CRG A;  1TI1 A;  2B1K A;  3C73 A;  1ACV A;  1SU9 A;  1QMV A;  2TRX A;  4HDE A;  2HXK A;  1TK8 B;  5EL8 A;  4IN0 A;  4O5R A;  3F63 A;  3TJK A;  2FWE A;  4DSS B;  3TKP A;  2H0G A;  1WOU A;  4KND A;  4KB3 A;  4OD7 A;  4IW9 A;  4HZ2 A;  5IOW A;  1F6M C;  1A24 A;  5HR3 A;  2MBS A;  3IHG A;  4GRF A;  1YZX A;  2I9H A;  1J08 A;  2IWT A;  4ML1 A;  2NVL A;  10GS A;  1IYI A;  3DYR A;  1K3O A;  2V2G A;  2AYT A;  3D4T A;  2GSS A;  2L5L A;  2DIZ A;  2HLS A;  4ID0 A;  2XC2 A;  1M2B A;  3GX0 A;  4TR4 A;  1ZGN A;  1GSE A;  3F4R A;  3ZVJ A;  3GL5 A;  1Z5Y E;  2R0C A;  2HQT A;  2P0G A;  3CSJ A;  2QSI A;  4GXZ A;  5KN1 A;  1UN2 A;  4EKZ A;  2QC7 A;  2V41 A;  3GKK A;  1SKW B;  3TUE A;  3TJG A;  4MDC A;  3LYK A;  1S3C A;  4FQU A;  1TJD A;  1F2E A;  2D2Z A;  2C4J A;  4DSS A;  4IBP A;  4FYU A;  2LQQ A;  3UVH A;  5DQS A;  3UL3 A;  4I97 A;  4EF0 A;  4NMU A;  5AN1 A;  3KTL A;  1VGL A;  3RHC A;  1B4Q A;  5DAL B;  3UAR A;  3H93 A;  1TU7 A;  1WE0 A;  1R4W A;  3S9F A;  1JHB A;  1A23 A;  1NW2 A;  2JZS A;  5J4Y A;  2R5G A;  2H71 A;  4G9H A;  4TOP A;  4AF2 A;  5L71 A;  4MZW A;  1XCC A;  2H01 A;  1XFL A;  4IEL A;  4NV2 A;  3APO A;  4ZB9 A;  2NTO A;  1O8W A;  1G6Y A;  3GUR A;  3ZML A;  5AGY A;  3KGK A;  2L6D A;  4WR5 A;  2C3T A;  4GF0 A;  4K0G A;  4GTU A;  4TR1 B;  4ECC A;  3MAK A;  5HR2 A;  1SK0 A;  2HNL A;  2N5F A;  4KA0 A;  5A5K A;  2H1B A;  5IO0 A;  1BG5 A;  3EC3 A;  5J4V A;  4AJ8 A;  3P90 A;  1K0M A;  1GTI A;  4EC0 A;  4OO4 A;  4A5P A;  3IXR A;  3F3Q A;  5DAL A;  2KP1 A;  1AC1 A;  3WGX A;  2LTK A;  1C72 A;  4I6X A;  4XRD A;  4MZC A;  5F06 A;  4POB A;  2X8C A;  3EU3 A;  2GT6 A;  2PVO C;  3WGE A;  5E4W A;  2GS3 A;  3LXT A;  5LNK e;  4ZB8 A;  2Z9S A;  3EE2 A;  4K5R A;  2PER A;  2FWF A;  4KH7 A;  3IA1 A;  2GSQ A;  4G2E A;  1VF1 A;  2IMK A;  4EDZ A;  1ERU A;  3FZA A;  2DLX A;  4ECI A;  2HRN A;  1KNG A;  4YQU A;  2YWM A;  4IS0 A;  2R3X A;  1XIY A;  2VCX A;  1OC8 A;  2PUK C;  1QUW A;  4W66 A;  3ZVJ D;  1V40 A;  1SKR B;  4MZB A;  1GSU A;  5F8B A;  3WGD A;  4HQZ A;  2FWH A;  4KAE A;  1VRS D;  1IYH A;  1WMJ A;  2MYG A;  1RK4 A;  4RQX A;  13GS A;  1XOA A;  4YKG A;  1VF4 A;  1OKT A;  2P31 A;  3FKF A;  5H5S A;  5COH A;  1K0C A;  1MDK A;  3TOU A;  2VIM A;  5IQY A;  4WXT A;  4CHS A;  3DGQ A;  3IR4 A;  2R0P A;  3A5I A;  1B9Y C;  1E2Y A;  1MD4 A;  2DJ2 A;  4DSQ A;  1F3A A;  3M8N A;  9GSS A;  4KDU A;  2H74 A;  2M46 A;  2VCV A;  4Z2T A;  5J47 A;  5ECI B;  2BJX A;  1ABA A;  3GH9 A;  4MMM A;  5IPH A;  2JU5 A;  1XVQ A;  5JCU A;  1ERV A;  2JL4 A;  1X9M B;  4K5S A;  4ECB A;  2NDO A;  2X8G A;  2M80 A;  1TXU A;  3V1W A;  4KW6 A;  2VLT A;  4KUN A;  2AB6 A;  3GST A;  1WPI A;  4OCE A;  4MJE A;  5J3R A;  3GV1 A;  2WZ9 A;  6GSW A;  3KZQ A;  2PN8 A;  1U88 A;  3VK9 A;  1EEM A;  12GS A;  3NIV A;  2FY6 A;  2IJY A;  2VAF A;  4Z2R A;  5J41 A;  2OAD A;  1BYE A;  2CV4 A;  4PNG A;  4K8M A;  2B6M A;  5F05 A;  8GSS A;  4JED A;  2LST A;  2HRA A;  1X5D A;  4X1U A;  3JCM L;  1N25 A;  3ISO A;  2LEG A;  3QAW A;  1K0N A;  5DJL A;  1EOH A;  1SL2 B;  1VF3 A;  3LJR A;  3HVX A;  5B6M A;  1QFN A;  3R3E A;  3ZIJ A;  1YY7 A;  4HQS A;  1QQ2 A;  3IC4 A;  2IL3 A;  4IJ3 A;  1AW9 A;  4AKI A;  4ZL8 A;  2YWO A;  3IDV A;  1ML6 A;  2VLV A;  4IHU A;  3U6V A;  5GST A;  1SKS B;  2ON5 A;  3KEB A;  2H76 A;  5ECL B;  2VLU A;  4WBR D;  3VPQ A;  3G7Y A;  2VUP A;  2C80 A;  3A2W A;  4L5O A;  2DJ0 A;  3M9K A;  4USS A;  3QPM A;  2L4C A;  1TW9 A;  3ZRD A;  1EGO A;  1I9D A;  4ZIJ A;  2HYX A;  1PKW A;  5JWQ B;  1H75 A;  1PN0 A;  5IOX A;  1DE1 A;  3ZL5 A;  1T4Y A;  4OO5 A;  3EUR A;  4ILF A;  4EL1 A;  4RI6 A;  3D21 A;  4EE0 A;  1OE8 A;  1Q98 A;  2LJR A;  2OJL A;  2X64 A;  4HS1 A;  1V9W A;  1CQH A;  4ACS A;  2YOI A;  1SEN A;  5HQP A;  2O5V A;  2E7P A;  4LMW A;  4Q5F A;  2OBK A;  4OWY A;  4BA7 A;  3WD6 A;  4AKG A;  1R5P A;  3N5O A;  1AQW A;  1BQ7 A;  3F8U A;  5ECM B;  2RUF A;  3IE3 A;  14GS A;  3EMP A;  2C0F A;  2YJ7 A;  1PD2 1;  1M0U A;  3MSZ A;  4ZBA A;  3QOU A;  5A4U A;  1B4P A;  2IMI A;  1SD8 A;  2C0E A;  4NHZ A;  3CRT A;  6GSY A;  1DE2 A;  5ECK B;  4POK A;  2VM1 A;  4WF4 A;  2XPD A;  4KDX A;  1HNA A;  17GS A;  2KOK A;  1WJK A;  4OFN A;  4MF6 A;  4GQC A;  1GTA A;  2AHE A;  5HFI A;  2CX3 A;  1OC3 A;  2QA2 A;  4EUY A;  2KUC A;  2AUV A;  2HI7 A;  5ECS A;  4ZBD A;  4AI6 A;  3F9U A;  4AJ7 A;  4TN8 A;  2WS2 A;  1Q4J A;  1GLP A;  4PGT A;  1PKZ A;  1X9W B;  5A5H B;  2B3S A;  3MNG A;  1AQX A;  2V6O A;  4TXO B;  3RPN A;  1TU8 A;  4IQA A;  4LA1 A;  3G9B A;  2LV3 A;  1NSW A;  6GSU A;  1CQG A;  1GSD A;  4AKX B;  3KIJ A;  2F3M A;  1NHO A;  1PQN A;  5ELG A;  3F0I A;  4OFM A;  2OAC A;  5IMC A;  3A3T A;  5GAN D;  4K1F A;  2OKA A;  11GS A;  1ZZY A;  1GUM A;  3VLN A;  1O85 A;  2HZF A;  1XW5 A;  4MPG A;  3TKS C;  1WWJ A;  2VCW A;  1E6B A;  1K3L A;  4RQR A;  1A0F A;  1XBS A;  3BD2 A;  1W4V A;  1XOB A;  3M9J A;  1GWC A;  6GSV A;  1Z3E A;  3GYK A;  5A5H A;  2A2R A;  2GTU A;  1S3D A;  3PR8 A;  4IJI A;  4G0L A;  3TCO A;  1T1V A;  3CSH A;  1SJZ A;  2GT5 A;  1GSF A;  1XWG A;  2WRT A;  5LCZ A;  4TXO A;  1K0D A;  5DCG A;  3UEM A;  2H6X A;  2DSA A;  5IIZ A;  4J56 E;  3IAS 2;  1U3A A;  3DD3 A;  2XBI A;  3US3 A;  1MDI A;  3TB2 A;  5ECR B;  2DIY A;  4EVM A;  2AJQ B;  2YJH A;  3GKM A;  4IP6 A;  5DCH A;  3NOF A;  5ECP B;  4YAP A;  2C0G A;  1G0T A;  1ZYQ B;  2DML A;  2E2M A;  3GNJ A;  1J0F A;  2CZ2 A;  3IC8 A;  3CBU A;  1T8E B;  1HQO A;  1K3Y A;  2FWG A;  1YKC A;  2QA1 A;  3FEU A;  1XW6 A;  2ZNM A;  5FT3 A;  5ECN B;  3E3E A;  3ME7 A;  2DMM A;  2G2Q A;  4V1A p;  4K6X A;  1PA3 A;  2G0F A;  1XPV A;  2H19 A;  4BWQ A;  4N0V A;  4N0Z A;  5HFG A;  1O81 A;  4GLT A;  1ON4 A;  3O6T A;  4ICY A;  2HFD A;  1V98 A;  4PQI A;  3EPT A;  1FOH A;  2IPA A;  2MBT A;  2FGX A;  3L0H A;  4TXV A;  2YWI A;  1RQM A;  2H0I A;  4NPB A;  2LJK A;  3QD9 A;  1A2J A;  2VL2 A;  4L5L A;  4GWR A;  2DKI A;  3BCI A;  4XTS A;  2L6C A;  2O85 A;  2CAI A;  1PN9 A;  4N10 A;  2L59 A;  2YPM A;  3KTB A;  3O76 A;  2PPT A;  4POL A;  3IRA A;  1A2L A;  1A2M A;  2FHE A;  4ZB7 A;  1KEB A;  2H70 A;  2FCH A;  2B1L A;  2B5E A;  2J9H A;  3Q6O A;  2DJK A;  4V2L A;  2WFC A;  3TKS E;  2K6V A;  1TP9 A;  4PQH A;  5KN3 A;  3HZ4 A;  1LU4 A;  1TOF A;  5DBQ A;  4JR4 A;  2LRT A;  3WT2 A;  5FHI A;  3FK8 A;  4IKH A;  1GSS A;  3LSZ A;  1GUH A;  3RPP A;  3UMA A;  3GIX A;  1N8J A;  5AIV A;  2JZR A;  4XRA A;  4TR3 A;  1AUC A;  4LMV A;  1SJ6 A;  2X8H A;  2YV7 A;  3PGT A;  4F03 A;  4E8E A;  1B8X A;  1URM A;  2PGT A;  3LGC A;  3G7J A;  2IIY A;  4K7I A;  3VPT A;  4BPY A;  3GRX A;  2HRF A;  4NHW A;  5KN2 A;  1JZW A;  1F9M A;  2A2S A;  5IMZ A;  5D9T A;  1BAY A;  1JZO A;  4HZ4 A;  1O6J A;  4BWS A;  4ZL7 A;  5D96 A;  4TR1 A;  4MJB A;  1BJX A;  3TRQ A;  3FZ4 A;  1VF2 A;  4RUV A;  1YEP A;  1A8L A;  4EXJ A;  1X5C A;  2HE3 A;  1GSY A;  16GS A;  3GN3 A;  20GS A;  3ERG A;  3QDN A;  3BJ5 A;  4EIQ A;  5KEJ A;  3TJF A;  1DBY A;  1TTZ A;  4DVC A;  2LS5 A;  2BMX A;  1PL2 A;  4O92 A;  2J23 A;  3MYD A;  4Z7X A;  3FY7 A;  3GSS A;  2R2J A;  5G2Z A;  3ERF A;  1O7U A;  4ZBB A;  3DEX A;  2YAN A;  1BED A;  1AAZ A;  1YDK A;  4HU9 A;  2VCT A;  2GGT A;  5ENU A;  5IPG A;  5CRE A;  1FHE A;  3MWH A;  3GMF A;  4F2I A;  4MCU A;  1GP1 A;  2LNT A;  3CRU A;  2ZCT A;  1K0B A;  1EP7 A;  3QCP A;  2B5Y A;  4PUA A;  4FYC A;  5D8I A;  1B48 A;  4EO3 A;  5D9W A;  2WCI A;  4K2D A;  2FUG 2;  2JAD A;  1SL1 B;  1MD3 A;  3A2V A;  5D93 A;  4PUR A;  1X0R A;  2P5Q A;  2CZ3 A;  1JZD A;  4MH3 A;  2FA4 A;  3HVV A;  4FO5 A;  3TDG A;  4I2U A;  3DXB A;  2DJ1 A;  3ZFL A;  3IOS A;  1HNB A;  2DBC A;  2GZP A;  3DVW A;  2H6Y A;  1PSQ A;  3H8Q A;  3F3R A;  3VWU A;  2X4A A;  3HJM A;  1YF1 A;  3KMN A;  4N11 A;  3EVI A;  3PH9 A;  3N9J A;  3TKQ A;  1TDI A;  4OCF A;  2JAC A;  2DKH A;  1R5A A;  3KP9 A;  2HT9 A;  1SK2 A;  1ZYE A;  4TVE A;  1ZOF A;  3TJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...