1HNEE

Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-angstroms resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEDGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords HUMAN LEUCOCYTE ELASTASE
total genus 39
structure length 218
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 1989-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hneE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hneE02
3VGCC 1GJ8B 4KTCA 5EXMA 1WBGB 4FUHA 5C67A 1SGDE 1BT7A 1CO7E 1P2OA 1P9UA 2QCYA 6ESTA 7GCHF 2HLCA 5FX6A 1EZQA 3SBKA 2M5TA 1GI8B 3KL6A 1PYTC 1TPOA 1C2HA 1HRTH 1NC6A 2QIQA 2ZHWH 2ZDVH 4VGCB 1T8MA 2ZA5A 1W0YH 4YZUA 3UPEA 1TA6A 1LQDB 4Y10E 2OQ5A 1TX8A 2PSXA 2CV3A 1TGBA 3BTFE 1YYY1 1KLTA 2BQ6B 1NFXA 2OXSA 1XUHA 3GICB 1NT1A 1UO6A 1BCUH 4DURA 2ZIQH 4MPXA 1NN6A 5EQRA 1GBKA 2I6QA 4X1RU 1INCA 4ZXYH 4KKDA 4ABEA 1AGJA 1SOTA 4ABIA 5EOKA 2EI7A 4SGBE 1V2ST 2Z9KA 4I8HA 4A1XA 3K9XB 1V2KT 2XW9A 4QT8C 1ACBE 3A8DA 2WUBA 3P70B 2TBSA 2QA9E 1ZMLA 2VNTA 1FLEE 1O5BB 3RU4D 4Y71A 5AF9H 4JYVH 4X6NA 1O34A 3GISB 1C2MA 1IQLA 3ZZDA 3ZVEA 1AFQB 1HDTH 4IN1A 4KGAA 3RXGA 2A4QA 3QWCH 4SGAE 2SGDE 1UTQA 5AFYH 4I31A 1GI6A 1XXFA 1FJSA 1C1WH 4RKOB 5IYTA 1Z1JA 2H9HA 3U8TH 4LXBH 3M3SA 4ISOA 1C1RA 1O2HA 3LPRA 1P02A 2PKAA 3MYWA 1KXEA 1GBJA 4NSYA 3WY8A 2ZWLH 2C8ZB 2W26A 3ZVCA 4BOHA 1SQOA 2ZU1A 3I78A 1KY9A 1RTKA 4RKJB 2FXRA 3ODFA 2Q6DA 2W7SA 7KMEH 1AQ7A 3EE0B 5A09A 1SGTA 1GMHG 1HYLA 1J16A 2UUYA 3LH3A 1AU8A 2A4RA 2OBQA 1SSXA 4KELA 3E6PH 5JBBS 2G52A 1QBVH 4AFUA 3ZVDA 2G8TA 1F0UA 3BEUA 3V7TA 4O3UA 1MTNB 1IQGA 1EZSC 3U8OH 4DCDA 2ZCLP 2G4UA 4Z0KA 4BXWA 4GHQA 4CHAC 2J92A 1AN1E 2HVXA 4Q7XA 1P57B 3R0FA 4H4FA 5DP9A 3SUDA 4KP0A 5LPFA 2XCFA 2OC1A 2P8OB 2F9BH 2GZ7A 2ASUB 1TNIA 2EI8A 5LGOA 1VGCB 1UCYK 1BTPA 1TB6H 4I8LA 5HM9A 1XXDA 3GY3A 1O3KA 1PYTD 4ZROA 2BLWA 5TCAA 3S7KB 3E3TA 1C5YB 1OSSA 3A81A 1FN8A 2FPZA 2HNTE 1GBMA 1HAYB 2FYQA 2PKSB 1P2KA 1HAHH 2D8WA 1G30B 1CT4E 1LVMA 1GG6C 4LK4A 4IC6A 2Z3CA 5GIBA 4DJZB 1AKSB 1A2CH 1C5PA 2Q1JA 3LC5A 4DY7B 1V3XA 1ZHMA 2AIQA 1ELFA 4UD9H 2BXTH 4WXIA 3LIWA 4O97A 1G2MA 2C4FH 5FBEA 1UTPA 2WPKS 1WOFA 3MOCA 5EGMA 1BTYA 1CQQA 1MKXK 1C5NH 3TU7H 2RDLA 4Y8YA 1O2IA 2OC0A 1E36B 1SLUB 3GY6A 5EXNA 1ZHRA 4O3TA 1SQAA 2HPQH 2BY5X 3M7TA 1GBLA 1FY1A 2AEIH 3TJVA 2Z3EA 2A4OA 1JIRA 2TRMA 3PMBB 1TX7A 2FX4A 1GJCB 2CF8H 2VWOA 3M3TA 5PTPA 1LPKB 1JOUB 4JZDH 2F91A 1ZMJA 4J2YB 1EKBB 3G01A 1VZQH 4Q7ZA 1LQEA 2G5VA 4YO9A 1C1PA 1GL1A 4RN6A 2FI3E 1BQYA 1ELCA 1WU1A 2V3HH 3NXPA 4NA9H 4DIIH 3MHWU 1WQVH 3H7TA 1YCPK 1ETSH 1O2ZA 1AZ8A 3LU9B 4MNXA 1C1QA 3TH2H 5E0GA 3A7XA 4X1PU 1CBWC 1K1JA 4D9RA 1SLXB 2Y82A 3M5NA 1MUEB 1O32A 1P04A 1BZXE 4CRBA 1T8OA 2ZCHP 1WTHD 2A5IA 1CGJE 4KTUA 1TOMH 3TIUA 2Z9LA 2A45B 1O2GH 1AVGH 2FOMB 5TCCA 2BD7A 2BVSH 2WYGA 1P06A 4K69A 3BTEE 2ZTZA 4E06H 1BTXA 2ZCKP 3LKWA 2ZFFH 3MTYA 5ETXA 3SW2B 1OWDA 3FANA 2JETB 3VB5A 1XUIA 1V2OT 4WH6A 1SG8B 1SGYE 1D9IA 1FY3A 1W12U 3QN7A 4UDWH 2A2XH 3ZZCA 3MU1A 1NTPA 3AVZA 4ZKRU 1HXEH 4GVUA 4UONA 1XUJA 3TGKE 4NZLA 3M5MA 4GUXA 4NA7A 1T4VH 4X1QU 3TJOA 2J95A 2ZQ2A 4NWKA 1O3AA 1GHBF 4NIXA 4U01A 1LHDH 1UCYE 1Y3VA 2VGCC 2ZO3H 2EEKA 2OBOA 3ZZ3A 1P2IA 1O3OA 1O30A 3E1XB 1CHOG 1DWCH 1YPHC 4J1YA 4DIHH 3SZNA 3D65E 3BF6H 1NPMA 3PROA 4CR5A 1DANH 2BD9A 1EPTC 1OWJA 1P03A 4NWLA 4D76A 1ANEA 1THSH 3SV9A 2GCHG 5F8XA 3BTWE 5DP3A 2VVUA 3GCTG 1UK3A 5EW2H 1O3IA 2LPRA 1F0RA 1ID5H 2Q6FA 1IQHA 8KME2 1QL9A 2ZHDA 1UTLM 2CHAC 2YOLA 3O8RA 1D3PB 2P3TB 1W7XH 4U30A 2B7DH 4Y0ZE 1DSTA 1HGTH 1EZXC 1XM1A 1QCPA 2A7HA 5L6NH 4ZMAH 1HBTH 2F9NA 1XKAC 1KLJH 2ANWA 1P3EA 1A1RA 1TNHA 1JXPA 1GGDB 2JH6D 3PLPA 4UEHH 3ZV8A 1SPJA 1BMMH 1AKSA 2G5NA 1AFQC 3BTQE 3PO1B 3KQCA 2FTMA 4GCHG 2F9PA 1A3BH 5JPMH 5EW1H 1O5DH 1ZPZA 1MD7A 1NRSH 1WSSH 2GZ8A 2GMTB 2ZI2H 3LDXH 1VITG 1QNJA 1K28D 2ILNA 8GCHF 2IOTA 5C5OA 4ZAEA 1HAXB 1NO9H 1TIOA 6GCHG 4XDEA 3GCOA 1OOKB 2BX3A 1S6FA 2XBYA 3SJ8A 3ITIA 2PUXB 2XC4A 5ESTE 1F92A 4DG4A 1C2FA 1ZRKA 1SMFE 2SNWA 1XVMA 1JRSA 4ISNA 3E91A 4CRDA 3VEQB 1W0ZU 3SJIA 2FWWA 3B8JA 1MBQA 1ABJH 1HIAA 1QL7A 1YLCA 2ZHEH 4A1TA 3RXQA 1ZJDA 2WPJS 3PTNA 1TGNA 1O2KA 3OY6U 1QR3E 2RA0A 3E0NB 3Q76A 2FOAA 2QYIA 4D7FA 1LKBA 4K8YA 1N6XA 3A7YA 3VB3A 4ISLA 3OU0A 1AY6H 2Y5GA 2ULLA 4ZH8A 4CH8B 3N7OA 4KTSA 5C3NA 4A1VA 1YC0A 1MTUA 3D23A 1UMAH 1ZMNA 1K1LA 2FOHA 1B0FA 4M7GA 1RS0A 2ZEBA 3A80A 1SOZA 1GHAF 1V2LT 3BG4B 3DA9B 4JK6A 2FLBH 4ABDA 1O2NA 1ESAA 1LMWB 5JYIA 1BOQA 3SUEA 6CHAC 5C2ZA 5DPAA 1L2EA 3PV4A 3URDA 1GVZA 2IPHA 1KXDA 1P8VC 4DW2U 4ZUHA 5LPRA 3RXSA 5IDKA 1MZAA 5A8ZA 1P01A 1MAYA 3ZZ9A 2SGEE 3S69A 3AW1A 2F9OA 4YT7H 4TWWA 1C2GA 1L1JA 2QF3A 4E05H 1SLWB 5G4BA 4Y0YE 2R9PA 3BTGE 1BRCE 1O3FA 3OTJE 3SHAH 1FY5A 2OCVB 1SGIB 4WMDA 1BDAA 1SGFG 3RMMH 3C1KA 3HK6B 3RXEA 1PQ7A 2PGBB 2J38A 2C8XB 3DFJA 3LGWA 2Y80A 3Q3XA 2FM2A 5C1UA 3PYHA 1F5KU 1ESBA 1XVOA 3PWCA 1TBQH 1BJVA 1C5TA 1O3BA 2CMYA 1CA8B 3OYPA 2XNIA 2AYWA 3DFLA 4ABJA 2BM2A 2P8OC 4AFQA 4HTCH 1MCVA 4XSKU 4A92A 1MTNC 2FS9A 4FUDA 2PUQH 3U98H 1UHBB 3RXFA 1J17T 4AYYB 1PFXC 2BDGA 2BY6X 4GSOA 1O3EA 4K3JA 4OS1A 2RCEA 1V2PT 1G2LA 7ESTE 3KQDA 4FUEA 1EJAA 5JBAS 3T2NA 3VPKA 2C90B 2Y6TA 3TK9A 2BY7X 3TNSA 2ZC9H 2B0FA 2PLXA 2ZGCA 2QY0B 1LHCH 2BDBA 1K22H 1GHYH 2YNBA 1FAKH 1RIWB 5GPIB 4K2YA 3ATLA 3V3MA 1DWDH 3F9HA 4OS6A 1C9TA 2SGQE 3LT3A 3L3TA 5C1YA 1TRNA 1OP8A 2BMGB 1MH0A 1MKWH 1W8BH 4AX9H 3STJA 1QJ6B 2PSYA 1E0FD 2UUJB 4MNWA 5DK1A 4FVBA 3UNRA 1EAIA 1K1NA 1OWIA 1ZTLA 1FZZA 3ZZ5A 1VITF 4BNRA 1QJ7B 5EXLA 3BIUH 1V2WT 2LNCA 1TNKA 3Q77A 1PPZA 5DG6A 1RTLA 3RU4T 1MKWK 4U32A 3ATWA 3TLOA 3ZVBA 4MPUA 2VVCA 1IQIA 5T6FA 1TE0A 1ZPCA 2G51A 1NROH 2HNTC 1JRTA 1DSUA 1LHFH 3SGQE 1CGHA 1DPOA 3B23B 1TRYA 2NWNA 1TGTA 3MH7A 2FOGA 3MWIU 1O3MA 2GT8A 1GVKB 1PPBH 2GP9B 1GBHA 3QGJA 5L2ZH 1TYNA 1DLEA 1KTTB 1DS2E 1A3EH 3CP7A 2O8UA 4OS5A 2DE9A 1FONA 5HXFA 1GHZA 4D8NA 3PM3A 1AI8H 1FUJA 1GMCG 3LGTA 1BB0B 1VCQA 1HCGA 1UTOA 1VR1H 2CN0H 2VH6A 4LOYH 4FVDA 1C2EA 2GCHF 2R3UA 2OTVA 1QHRB 1HAZB 3LGYA 4CH2B 4MNYA 3RXPA 4DOQA 1CA0C 1C5LH 4XFQA 1DE7H 2XYAA 5C1XA 2HPPH 4FUIA 1C5OH 4BTIB 3FP8E 3HPTB 3QDZB 5A0AE 3O8BA 1X7AC 3SQHE 1D6RA 3L6PA 1H9HE 4MPWA 3E8LA 1SGFA 2TIOA 4HFPB 1G3CA 4B74A 2YNAA 2J9NA 1GI3A 1YF4A 2OC8A 2BD4A 1ANCA 3MNBA 3IITA 1J14A 2FYRA 1O3GA 1SGPE 1AFEH 1O3JA 1YPEH 3A89A 1F0SA 1UVTH 1FMGA 1DOJA 3STIA 1T4UH 1C1MA 1O3PB 2AERH 1O3CA 1EJNA 1V2UT 1T31A 1BBRE 1C2LA 2ZU2A 1MCTA 1SGCA 2ZKSA 2V35A 4TY6A 1ZRBA 4BAHB 5F03A 1Y3UA 2FOBA 1P10A 1SHHB 2C93B 4NG9H 4UFEH 1AO5A 3P8FA 1ETRH 3M7UA 2UUKB 1NFUA 3M3VA 1C5XB 1SB1H 2W7UA 2GD4B 3GY2A 1MMJN 3TITA 5B6OA 2UWOA 2ZDKA 1O0DH 4CBNA 4X8VH 3BG8A 1NM6A 3PLKA 4I8JA 2R0KA 1K1PA 1TRMA 3P95A 4INHA 3MH6A 2HRVA 1H8IH 3T5FH 2GKVE 3SN8A 1HXFH 4I7YH 5FBIA 5BPEA 1TNJA 4ZHAA 1BRBE 1FPCH 1LHGH 2ZDLA 1ELTA 4NCYA 4A7IB 1RTFB 4FUJA 3OSYA 1HAVA 3UNSA 1TMTH 1L1GA 2BYAX 1GI4A 3QZQA 3BG4C 1TMBH 2FP7B 4MPVA 2ODYB 2UUFB 3ESTA 3TH3H 3NK8A 1LPGB 1YGCH 1NRQH 1NRPH 2ODQA 3SGAE 1KXAA 5DP4A 5E0JA 3M5OA 1BJUA 1TNLA 1GDNA 5DGJA 1GDUA 5LH8A 3ZZ4A 2QXHA 2QF0A 1H1BA 1S6HA 2ZU4A 2TPIZ 4Y7BA 2BDYA 1EX3A 1KTSB 1EB2A 1OYTH 1N1LA 4K1SA 3MO3A 2VU8E 1VJ9U 1GG6B 1G3EA 3A7VA 4FUBA 2BDAA 1ZHPA 2FLRH 2A4GA 2HALA 3P92A 4IBLH 4K1TA 4BAMB 1S85A 2VIWA 3T26A 4Z6AH 2ODPA 3AAVA 1P11E 3GYLB 2EC9H 4NA8A 2PTNA 3TH4H 1IQEA 3EYDA 3NCLA 4ABHA 3RUOA 3BTTE 2O8MA 1H9IE 3OX7U 2ZFPH 1Z71A 2QN5T 1Q3XA 1W11U 3RXCA 3SJOA 1AMHA 3ODDA 2A31A 1RFNA 1OWKA 4FUFA 2PR3A 3C27B 3SQEE 3GY5A 5DO4H 2GT7A 1G3DA 1O38A 1GJ5H 5FPYA 2NU0E 2ZPRA 2AH4X 2PHBA 1SL3A 3T28A 4ZKOU 1NS3A 3T27A 2VIPA 3VB7A 1L4DA 2A7JA 1J9CH 2DUCA 3RXAA 3JZ1B 1SI5H 1JBUH 2B8OH 1GJDB 2A7CA 3TNTA 1MQ6A 3U8RH 3E0PB 1Z6JH 1Q31A 1A61H 1HAIH 1A0JA 2CHAB 4D7GA 3MI4A 9ESTA 2BVXH 3VB4A 2QXGA 1RD3B 2R2WU 3SGBE 3GY4A 1O2MA 2ESTE 1ETTH 1G3BA 2H5DA 1HNEE 1Z7KA 5DKMA 4ISIH 1IQMA 1F5RA 2BD3A 6GCHF 1FV9A 1Y3XA 3SU4A 2SFAA 2RA3A 1CT2E 2ANYA 1P12E 2Z9JA 3KQEA 1ESTA 2C8WB 3MFJA 3W95A 1P3CA 5L2YH 1PQ8A 2QAAA 1O3NA 1S5SA 5K0HA 1A5HA 3UOUA 4Y79A 2Q6GA 2FTLE 1F0TA 1LKAA 3H7OA 1RXPA 1QFKH 1HJ9A 2BOKA 3RM0H 2QXIA 4CR9A 1O37A 1QURH 3AASA 3TGJE 5JB8S 4OGXA 5A2MH 2TGAA 5DJ7A 4B75A 5CMXH 2Y5HA 1BITA 4IGDA 1ORFA 1GJ7B 1MTWA 1V2NT 5EU8A 1RRKA 1FIZA 2XRCA 3MH5A 2VJ1A 1QRXA 5C5NA 1YCPH 5GDSH 1YP9A 1K21H 3I77A 1O5AB 4GAWA 3GCTF 1T8LA 3BIVH 1O2WA 4CRCA 4JYTA 4OS4A 1Y5UT 4WY3A 4AGKA 5HGGA 3SO3A 1AZZA 4AYVB 1HFDA 2P93A 3F9GA 1FIWA 3K65B 4Y76A 3UWJH 1QB6A 1HJAC 4FU8A 2NU1E 2R2MB 2ZTXA 1HAPH 3QTOH 2ZGJA 4CREA 4TWYA 4FU9A 1SBWA 2OUAA 5LPEA 4JMYA 1G9IE 5DP5A 1YPKH 1WQSA 1MD8A 5T3HA 4TPYA 3BEFB 2D1JA 2P59A 1EOLA 4CBOA 2IN2A 3LJOA 1F2SE 2AMQA 1D6WA 2J94A 1DUEA 1PPCE 2IJOB 1Y3WA 1CU1A 3QZRA 3PO1C 4X8SH 1D3DB 3RM2H 1KYNA 5HYOA 4X6OA 1WAYB 3TGIE 2BY9X 4NZQA 2VWMA 1HAVB 4WWYA 1LDTT 1SFIA 1DUAA 1FN6A 5SGAE 3UNQA 3MU4A 3SV6A 1GDQA 3E16B 3S9AA 1KSNA 1P09A 1THPB 4DVAU 2P3FH 1SC8U 1W7GH 1O5FH 3PWBA 1EB1H 1UHBA 1EASA 1MTVA 1AHTH 1TPPA 2FODA 1SGRE 2STAE 2OLGA 1U6QA 1OWHA 1OP2A 1OWEA 4BAOB 3DT0H 3F9FA 2ZF0H 4AG2A 4X2XA 1GBIA 1CBWB 2ZG0H 4X8TH 1EPTB 5T6GA 4HGCA 4WMFA 1BA8B 3NPSA 3UOPA 1HV7A 1TWXB 1ZGVA 3A8CA 3DUXH 2NU4E 3E90B 5EPNA 1JMOH 2J34A 1GBTA 4WXVA 2BD5A 2C8YB 4BTUB 2EA3A 4FUGA 2PKSC 2FZZA 3U69H 4AN7A 1EUFA 1ZYOA 4WMEA 4PROA 4ZKSU 1TQ7B 5F8ZA 4X6MA 2F83A 1GJBB 1C4V2 2ZFTA 3M61U 1C2DA 3R3GB 4Y11E 5HM2A 1OX1A 2FS8A 1RJXB 1P2NA 4NGAH 1TONA 6CHAB 1ELVA 1T32A 4IMQA 5E8EH 1GHAG 3EDXB 4CRFA 1C2JA 1J15A 3S9BA 1WV7H 1GVLA 4B71A 1Y8TA 1ZZZA 2PKAB 3KIDU 1BTZA 1O2PA 2BOHB 1ZOMA 1TBRH 3T25A 2A5AA 2WV5A 4WVPE 4MG3A 4Y6DA 3HGNA 1MZDA 4GLYA 2STBE 1H8DH 2H5CA 3KEEA 1LHEH 5GCHF 3SV7A 4X2WA 1EP6A 1DVAH 3SJ9A 4B73A 3QK1A 4A6LA 1C5VA 1F5LA 1C1NA 2WPMS 1ELGA 1TABE 2PFEA 3SI4H 3OY5U 3T62A 1TX6A 3GCHB 4BAKB 1LTOA 1PJPA 1IAUA 3SI3H 3LC3A 1RIWC 2O9QA 3F6UH 1QRWA 1C2IA 1C1UH 4AFZA 3GDUA 4K60A 4R8TB 5TJXA 1GCTC 3U9AH 1O36A 3ELAH 8LPRA 3SU0A 1ARBA 3UY9A 1K1MA 1V2VT 4K5ZA 1S0QA 2J4IA 1HLTH 1N8OB 1OXGA 1QB1A 2OQUA 3A84A 3MU0A 3TK5A 5K7RA 3BTDE 2XWBI 8GCHG 3RXUA 1QA0A 3HATH 3SNCA 4GHTA 2ZFQH 1ZSKA 3LGVA 2K1QA 4HI3A 1YCPM 2GGVB 5H4IB 3RP2A 3UQVA 4YESB 5AVDA 4I8GA 3RMLH 1XX9A 2BTCE 2GMTC 3UR9A 1YPHE 3MH4A 1ABIH 1GHXH 1LPZB 3PMAB 4NFFA 3PMHB 3A87A 1EAUA 4CHAB 1QTFA 2UWLA 2ANMH 1NRRH 1BTWA 3ZVGA 1XKBC 1A0LA 1HIAB 2FX6A 2BD2A 3HKJB 1NFWA 5FCKA 1GMDF 1NESE 2O8TA 1AD8H 1GI9B 2W3IA 1C5ZB 3ZZ7A 1O2SA 2BZ6H 3HK3B 2AS9A 4WJG2 4LZ4B 5GXPA 1WUNH 1L1NA 2PW8H 2XBWA 3QO6A 1FY4A 3QTVH 4YOJA 2GCTC 2SGFE 1LVBA 2XBVA 2H2ZA 2FDAA 3CENA 1PPFE 2GDDA 4U2WA 3Q3KA 3A86A 4I33A 1S81A 3SU3A 2AGIX 4MVNA 1ELAA 2WPHS 1O2QA 1O5EH 1LCYA 1MTSA 7GCHG 3LOXA 4CRGA 1FXYA 1P0SH 1GI5A 1FAXA 3VGCB 1DXWA 1GBCA 1UK4A 4X8UH 2R3YA 2ZU5A 3SJKA 2ZTYA 2ZQ1A 3SV8A 2F9UA 3RXMA 1OKXA 1JWTA 5JBTA 2W5EA 2GZ9A 2Z9GA 1W13U 3VXEH 2BHGA 1AVXA 4H6SB 4LZ1H 3A7ZA 1VJAU 2J2UA 5CE1A 1ZSJA 4AFSA 2PV9B 1BHXF 5J4QA 3SU5A 2FMJA 1C9PA 5FHTA 1OS8A 2V6NA 4IMZA 1GI0A 4YLUA 1C5RA 1S0RA 1MU6B 4TYDA 1SGQE 1TQ0B 2ZGHA 4ZHMU 1B7XB 3U1JB 4OS2A 1SR5C 1SGEE 3EA7A 1C5WB 1ZLRA 1GMDG 3SUFA 2BB4A 1XUGA 1EPTA 3MMGA 2XXLA 2CJIA 2VIDA 3KHVA 1PPGE 1T8NA 4Q2KA 3UREA 3T29A 5FPSA 5FX5A 1PPEE 1YPMH 5FCRA 3BEIB 4JK5A 3A8AA 5FPTA 4F49A 2RG3A 2HGTH 4JZIA 4XE4A 1SHYA 3O8CA 1V2RT 2TGPZ 4THNH 1C5QA 2O8WA 4TY7A 4JZEH 3RXBA 4UFDH 2BX4A 2D26C 2QC2A 2ZGBH 1KXBA 3L33A 2ZZUH 1O33A 4H6TA 1IOEA 1O2XA 5T6DA 4AGJA 4TPIZ 2AGEX 2ALVA 4IC5A 1SQTA 1BMNH 3P8GA 1DM4B 1NZQH 1E35B 1ELEE 3PMJA 1B0EA 2JH5D 1D3QB 2ZECA 2VWNA 1VCWA 3GYMA 1ZGIA 3BTKE 1NU7B 3ZZ6A 2H9TH 4NSVA 1G32B 1GHBG 1O3HA 3NKKA 3RXVA 1GBAA 1TBZH 5AFZH 2AMPA 2FI4E 1H9LB 1NY22 4IW4E 4AG1A 1M9UA 1YPJH 1BBRK 1AB9B 4X1NU 1YBWA 4CRAA 4OGYA 4RSPA 4Y8XA 3A85A 1V2JT 4ABFA 5JDUB 2FO9A 3DD2H 5FXLA 1ZSLA 1BHXB 3ZVAA 3FFGA 5L30H 1EAXA 1K1IA 3SORA 1ARCA 1BBRH 1GI7B 4WF8A 3ATKA 2A0QB 1C4U2 1DFPA 2UWPA 1TGCA 2AIPA 4MQAA 4MLFB 2BLQA 2FESH 2F3CE 5EQSA 1XUKA 1C4Y2 1MKXH 3LONA 5DP8A 1HAOH 1UVUH 2GX4A 4FU7A 3P8NA 3MU8A 4D9QA 4R0IA 3NWUA 1FY8E 2BQ7B 1HUTH 1A5IA 1GJAB 5ABWA 3RXKA 1PQAA 2BD8A 3M5LA 1O3LA 1S82A 5ESBA 2WV4A 2ZGXH 2GDEH 3RXDA 3P6ZB 3RXOA 1GMHF 3EA9A 4YLQH 4BAQB 3BN9A 6LPRA 4MNVA 1OPHB 1QRZA 2ZDAH 1ELBA 1DICA 3JZ2B 3P8OA 4MTBA 1HJAB 1CGIE 1OYQA 5A8XA 2OP9A 2WINI 2Z9IA 1JIMA 1G36A 3LGUA 3KNXA 5I25A 1GCTB 3BTME 2Z94A 1F7ZA 2R0LA 5A8YA 1GBFA 1HB0B 3ZZ8A 3K2UA 1E38B 1J8AA 1GPZA 1KLIH 1XMNB 3D49H 4ISHH 4AORA 2O8LA 4NIVA 2FEQH 2ZU3A 3GCHC 3MNCA 4B2CA 2Y81A 1IHTH 1O3DA 1G37A 1GI2A 5E0HA 1ZPBA 2KAIA 2GV6A 1GJ9B 2TGTA 1DXPA 3SNBA 1ZTKA 1C1OA 1O31A 2GV7A 3SU1A 5A0CA 2VVVA 4AB9A 1BIOA 3RC6A 3IWMA 1GGDC 4ABAA 4AB8A 3SU2A 3URCA 4ABGA 2G81E 2Y7ZA 4X1SU 2G00A 4B76A 2I6SA 2QGRA 1W3CA 4IN2A 5DP7A 3MO6A 3A88A 7LPRA 1AE8H 4INLA 1FQ3A 2GTBA 3NUMA 2ZDMA 3O8DA 1SFQB 4AZ2B 1YPGH 3PB1E 4IS5A 3UIRA 2P95A 1GI1A 3FP6E 1MQ5A 1QY6A 1TGSZ 2D2DA 3GDVA 3RDZA 4E7NA 1O2JA 3ZVFA 4JYUH 2HNTF 2KAIB 1BRUP 3BSQA 3FZZA 2OC7A 1MU8B 5J4SA 2P3UB 3FZDA 1CVWH 1EP5A 3QGNB 5EPYA 1A5GH 1AB9C 2ZDNA 3SU6A 2WYJA 1TAWA 4B2AA 4YM9A 2FI5E 2WPLS 3RLWH 3SNAA 1C5SA 1A0HB 2THFB 2ZFSA 4JZ1A 1AIXH 1MBMA 5GWZA 1K9OE 3SHCH 1O2UA 4FUCA 1BTUA 3AW0A 3IG6B 4B1TA 2VGCB 2PTCE 1HJ8A 1TFXA 5GJ4B 4I8KA 1D4PB 3RU4E 3SOSA 4ZHLU 1YKTA 2ZFRH 1UTNA 2AMDA 1TPSA 4A5TS 2GVFA 2EI6A 2VB0A 1C5UA 3F68H 4Y7AA 4JZFH 1Y5BT 3M37A 3K6YA 2ZHQH 2VH0A 1FI8A 2BXUH 1GHWH 4UFFH 1O2OA 2XC0A 2OINA 1DITH 4O03A 1ELDE 5F6MA 2VIVA 4Q7YA 1UVPA 4OS7A 3RMOH 1EXFA 4X2VA 1BTHH 4GCHF 9LPRA 3TK6A 3ENSB 3TJUA 1THRH 4NIYA 4YTAA 1W2KH 1KDQB 2ZNKH 1AE5A 1N6YA 2BQWB 1T7CA 3UUZA 1W14U 2ZPQA 4B2BA 3GCNA 2TGDA 3D62A 1TA2A 2C3SA 3W94A 3LGIA 4Q80A 4YOGA 4WH8A 4YOIA 2BY8X 2A2QH 1YM0A 1PQ5A 2F9VA 1QIXB 3GOVB 2H6MA 1K2I1 1LO6A 1B5GH 1O2TA 3GY7A 1KIGH 3VB6A 3QX5H 1YLDA 1SVPA 4Y8ZA 3F9EA 3BV9B 1Z8JB 1GBBA 1NU9A 3SNDA 1EQ9A 1SGNE 1O5GH 2BLVA 5AHGH 2BVRH 5A0BA 4XBCA 2VWLA 2XCNA 4DT7B 1UTJA 2V0BA 1A46H 4BANB 4K8BA 1V2QT 5JBCS 2G55A 3EAJA 3S7HB 1CHGA 1TPAE 1IQFA 2SGAA 3QLPH 1Y3YA 3MO9A 4MDSA 1YPLH 1Z8IB 3DHKH 1V6DA 1AUTC 1OP0A 2ALPA 4H42U 5E2OA 4XOJA 1C1VH 3EA8A 1GJ6A 3HGPA 1ZR0A 2FOEA 1O35A 2G4TA 4DGJA 1IQNA 5DP6A 1O2VA 1QQ4A 1O2LA 3UWIA 3LJJA 5GCHG 3SNEA 4K1EA 1EAWA 4XBDA 1VCPA 3EGKH 4UE7H 3EQ0H 4O9VA 2QV1A 3VXFH 1WCZA 3A7WA 1CSOE 1GBDA 2BZAA 5BRRE 1E37B 2B5TB 1IQKA 4VGCC 5HMAA 1O5CB 1FDPA 5E2PA 1GMCF 2CXVA 2WPIS 2PGQB 1XUFA 1V2TT 2ZPSA 5I46H 2ZHFH 2P94A 3KCGH 2WUCA 3RMNH 3P17H 3VFEA 2Z6BD 1P9SA 1K1OA 1VGCC 3ZV9A 1QB9A 2BDIA 1UVOA 3TVJB 1SLVB 1EATA 2V3OH 3A8BA 3B9FH 3PLBA 3M36A 1KXCA 1GHVH 1CHOF 1AVWA 3RXRA 3KN2A 1WYKA 1Z8RA 4X2YA 1QJ1B 3Q00A 5EG4A 1UCYH 3V12A 1S83A 2W3KA 3ZYDA 2OD3B 1Z6EA 2Z3DA 2XWAA 3KQBA 1QBOA 1DDJA 4BTTB 4ZXXH 3TPIZ 1C2KA 2PWXA 2XTTB 3Q3YA 4ESTE 3V13A 1ZTJA 1IHSH 5CHAC 3M35A 3FAOA 1O2RA 4UFGH 3SUGA 2DE8A 2JKHA 4X0WU 3U1IB 2ANKH 2BDCA 3I29A 1Y5AT 1GL0E 3GY8A 1DWBH 3NZIA 1N8OC 3GDSA 1P05A 8ESTE 1C1SA 4ZKNU 5JB9S 1GBEA 1FNIA 5C20A 3MNSA 3ZZBA 1HAGE 2VIOA 3RXIA 3AAUA 1MAXA 4AOQA 1QQUA 1L0ZA 3LH1A 3RLYH 3ZYEA 1FPHH 1TALA 3ATMA 3S9CA 2B9LA 4ABBA 3KGPA 3ZZAA 1DLKB 4INKA 1DY9A 4FXGH 1QGFA 3V0XA 3UR6A 1BUIA 2BDHA 1KDQA 2FOCA 2A1DB 4NFEA 1A7SA 1HPGA 3BTHE 2CF9H 3SV2H 3CS7A 1QBNA 1ANDA 1BMLA 1LVOA 2AFQB 1AUJA 1DWEH 1Z8GA 1AWFH 2JETC 1L4ZA 1NRNH 3FVFB 1UVSH 1CT0E 4JCNA 1TNGA 2FOFA 2VINA 4NIWA 2FIRH 1QL8A 3CS0A 1A4WH 4BXSA 1W10U 1P2MA 2AGGX 2VIQA 3ATIA 2XC5A 2BLOA 1P2QA 3UFAA 1TMUH 4HZHA 1O2YA 3PTBA 1QA7A 1Q2WA 1CE5A 2SNVA 1UTKA 1EZUC 5FAHA 1KXFA 1D3TB 1RGQA 1UJ1A 2P16A 1E34B 5EODA 3RXHA 2H9EH 3FP7E 4ASHA 3A7TA 1BMAA 3RC4A 4YT6H 2XBXA 2JH0D 1WTGH 1GCDA 1GJ4H 1V2MT 2Z7FE 1VITH 2HWLB 3RXJA 1ZJKA 3H5CB 2CGAA 2GCTB 1DY8A 1TLDA 3MU5A 3RXLA 1DT2A 3A83A 1DX5M 2HOBA 1GWAA 2NU3E 4X6PA 3MNXA 1Z1IA 3S0NA 4I32A 2A32A 3F1SB 4XBBA 2H1UA 1PPHE 4E7RG 5CHAB 3QUMP 1ANBA 2A5KA 1TOCB 2QXJA 1LVYA 3K6ZA 3UTUH 1H4WA 3KF2A 1UTMA 3RC5A 1C1TA 1C5MD 1P2JA 1BRAA 1O39A 1S84A 3HKIB 3M7QA 3TJNA 1EJMA 1IQJA 2NU2E 5F8TA 1EOJA 2Y7XA 5EQQA 3A82A 1Y59T 2ZP0H 1CA0B 1UK2A 4F4OC 4GPGA 3RXTA 1NFYA 1AWHB 2Y5FA 2SGPE 3UQOA
chains in the Genus database with same CATH superfamily
4M9FA 3VGCC 1GJ8B 4KTCA 5EXMA 1WBGB 4FUHA 5C67A 1SGDE 1BT7A 1CO7E 1P2OA 1P9UA 2QCYA 6ESTA 7GCHF 2HLCA 5FX6A 1EZQA 3SBKA 2M5TA 1GI8B 3KL6A 1PYTC 1TPOA 1C2HA 1HRTH 5T1VA 1NC6A 2QIQA 2ZHWH 2ZDVH 4VGCB 1T8MA 2ZA5A 1W0YH 4YZUA 3UPEA 1TA6A 1LQDB 4Y10E 2OQ5A 1TX8A 2PSXA 2CV3A 1TGBA 3BTFE 1YYY1 1KLTA 2BQ6B 1NFXA 2OXSA 1XUHA 3GICB 1NT1A 1UO6A 1BCUH 4DURA 2ZIQH 4MPXA 1NN6A 4I86A 5EQRA 1GBKA 2I6QA 4X1RU 1INCA 4ZXYH 4KKDA 4ABEA 1AGJA 1SOTA 4ABIA 5EOKA 2EI7A 4SGBE 1V2ST 2Z9KA 4I8HA 4A1XA 3K9XB 1V2KT 2XW9A 4QT8C 1ACBE 3A8DA 2WUBA 3P70B 2TBSA 2QA9E 1ZMLA 2VNTA 1FLEE 1O5BB 3RU4D 4ASUD 4Y71A 5AF9H 4JYVH 4X6NA 1O34A 3GISB 1C2MA 1IQLA 3ZZDA 3ZVEA 1AFQB 1HDTH 4IN1A 4KGAA 3RXGA 2A4QA 3QWCH 4SGAE 2SGDE 1UTQA 5AFYH 4I31A 1GI6A 1XXFA 4Q4LA 1FJSA 1C1WH 4RKOB 5IYTA 1Z1JA 2H9HA 3U8TH 4LXBH 3M3SA 3NRLA 4ISOA 1C1RA 1O2HA 3LPRA 1P02A 2PKAA 3MYWA 1KXEA 1GBJA 4NSYA 3WY8A 2ZWLH 2C8ZB 2W26A 3ZVCA 5FL7D 4BOHA 1SQOA 2ZU1A 3I78A 1KY9A 1RTKA 4RKJB 2FXRA 3ODFA 2Q6DA 2W7SA 7KMEH 1AQ7A 3EE0B 3WWFA 5A09A 1SGTA 1GMHG 1HYLA 1J16A 2UUYA 3LH3A 1AU8A 2A4RA 2OBQA 1SSXA 4KELA 3E6PH 5JBBS 2G52A 1QBVH 4AFUA 3ZVDA 2G8TA 1F0UA 3BEUA 3V7TA 4O3UA 1MTNB 2XNDD 4Q63A 1IQGA 2AHME 3WW7A 1EZSC 3U8OH 4DCDA 2ZCLP 2G4UA 4Z0KA 4BXWA 4GHQA 4CHAC 2J92A 1AN1E 2HVXA 4Q7XA 1P57B 3R0FA 4H4FA 3SZEA 5DP9A 3H09A 3SUDA 4KP0A 5LPFA 1SKYE 2XCFA 2OC1A 2P8OB 2F9BH 2GZ7A 5B6LA 2ASUB 1TNIA 2EI8A 5LGOA 1VGCB 1UCYK 1BTPA 1TB6H 4I8LA 5HM9A 4AC9A 1XXDA 5CHBA 3GY3A 1O3KA 1PYTD 4ZROA 2BLWA 5TCAA 3S7KB 3E3TA 1C5YB 1OSSA 3A81A 1FN8A 2FPZA 2HNTE 1GBMA 1HAYB 2FYQA 2PKSB 2GJGA 1P2KA 1HAHH 2D8WA 1G30B 1CT4E 1LVMA 1GG6C 4LK4A 4IC6A 2Z3CA 5GIBA 4DJZB 1AKSB 1A2CH 1C5PA 3KYGA 2Q1JA 3LC5A 4DY7B 1V3XA 1ZHMA 2AIQA 1ELFA 2RDEA 4UD9H 2BXTH 4WXIA 3LIWA 4O97A 1G2MA 2C4FH 5FBEA 1UTPA 2WPKS 1WOFA 3MQKC 2J97A 3MOCA 5EGMA 1BTYA 1CQQA 1MKXK 1C5NH 3TU7H 2RDLA 4Y8YA 1O2IA 2OC0A 1E36B 1SLUB 3GY6A 5EXNA 1ZHRA 4O3TA 1NBME 1SQAA 2HPQH 2BY5X 3M7TA 1GBLA 1FY1A 2AEIH 3TJVA 2Z3EA 2A4OA 1JIRA 2TRMA 3PMBB 1TX7A 2FX4A 1GJCB 2CF8H 2VWOA 3M3TA 5PTPA 1LPKB 1JOUB 4JZDH 2F91A 1ZMJA 4J2YB 1EKBB 3G01A 1VZQH 4Q7ZA 1LQEA 2G5VA 4YO9A 1C1PA 1GL1A 4RN6A 2FI3E 1BQYA 1ELCA 1WU1A 2V3HH 3NXPA 4NA9H 4DIIH 3MHWU 1WQVH 3H7TA 1YCPK 1ETSH 1O2ZA 1AZ8A 3LU9B 4MNXA 1C1QA 3TH2H 5E0GA 3A7XA 4X1PU 1CBWC 1K1JA 4D9RA 1SLXB 4HG6A 2Y82A 3M5NA 1MUEB 1O32A 1P04A 1BZXE 4CRBA 1T8OA 2ZCHP 1WTHD 2A5IA 1CGJE 4KTUA 1TOMH 3TIUA 2Z9LA 2A45B 1O2GH 1AVGH 2FOMB 5TCCA 2BD7A 2BVSH 3DSOA 2WYGA 1P06A 4K69A 3BTEE 2ZTZA 4E06H 1BTXA 2ZCKP 3OEED 3LKWA 2ZFFH 3CNRA 3MTYA 5ETXA 3SW2B 1OWDA 3FANA 2JETB 3VB5A 1XUIA 1V2OT 4WH6A 1SG8B 1SGYE 1D9IA 1FY3A 1W12U 3QN7A 2KCOA 4UDWH 2A2XH 3ZZCA 3MU1A 1NTPA 3AVZA 4ZKRU 1HXEH 4GVUA 3FN8A 4UONA 1XUJA 3TGKE 4NZLA 3M5MA 4GUXA 4NA7A 1T4VH 4X1QU 3TJOA 2J95A 2ZQ2A 4NWKA 1O3AA 1GHBF 4NIXA 4U01A 1LHDH 1UCYE 1Y3VA 2VGCC 1MABB 2ZO3H 2EEKA 2OBOA 2W6ID 3ZZ3A 1P2IA 1O3OA 1O30A 3E1XB 1CHOG 1DWCH 1YPHC 4J1YA 4DIHH 3SZNA 3D65E 5EJLA 3BF6H 1NPMA 3PROA 4CR5A 1DANH 2BD9A 1EPTC 1OWJA 1P03A 4NWLA 4D76A 1ANEA 1THSH 3SV9A 2GCHG 5F8XA 3BTWE 5DP3A 2VVUA 3GCTG 1UK3A 5EW2H 1O3IA 2LPRA 1F0RA 1ID5H 2Q6FA 1IQHA 4RT1A 8KME2 1QL9A 2ZHDA 1UTLM 2CHAC 2YOLA 3O8RA 1WDIA 1D3PB 2P3TB 1W7XH 4U30A 2B7DH 4Y0ZE 1DSTA 1HGTH 1EZXC 1XM1A 1QCPA 2A7HA 2J98A 5L6NH 4ZMAH 1HBTH 2RFKC 2F9NA 1XKAC 1KLJH 2ANWA 1P3EA 1A1RA 1TNHA 1JXPA 1GGDB 2JH6D 3PLPA 4UEHH 3ZV8A 1SPJA 1BMMH 1AKSA 2G5NA 4TSFD 1AFQC 3BTQE 3PO1B 3KQCA 2FTMA 4GCHG 2F9PA 1A3BH 5JPMH 5EW1H 1O5DH 1ZPZA 1MD7A 1NRSH 1WSSH 2GZ8A 2GMTB 2ZI2H 3LDXH 1VITG 1QNJA 1K28D 2ILNA 8GCHF 2IOTA 5C5OA 4ZAEA 1HAXB 1NO9H 1TIOA 6GCHG 4XDEA 3PV2A 3GCOA 1OOKB 2BX3A 1S6FA 2XBYA 3SJ8A 3ITIA 2PUXB 2XC4A 5ESTE 1F92A 4DG4A 3GS9A 1C2FA 1ZRKA 1SMFE 2SNWA 1XVMA 1JRSA 4ISNA 3E91A 3VG8A 4CRDA 3VEQB 1W0ZU 3SJIA 2FWWA 3B8JA 1MBQA 1ABJH 1HIAA 1QL7A 1YLCA 2ZHEH 4A1TA 3RXQA 1ZJDA 2WPJS 3PTNA 1TGNA 2LELA 2F43B 1O2KA 3OY6U 1QR3E 2RA0A 3E0NB 3Q76A 2FOAA 4XRNA 2QYIA 4D7FA 1LKBA 4K8YA 1N6XA 3A7YA 3VB3A 4ISLA 3OU0A 3OFND 1AY6H 3DSGA 2Y5GA 2ULLA 4ZH8A 4CH8B 3N7OA 4KTSA 5C3NA 4A1VA 1YC0A 1MTUA 3D23A 1UMAH 1ZMNA 1K1LA 2FOHA 1B0FA 4M7GA 1RS0A 2ZEBA 3A80A 1SOZA 1GHAF 3DSPA 1V2LT 3BG4B 3DA9B 4JK6A 2FLBH 4ABDA 1UW7A 1O2NA 1ESAA 1LMWB 5JYIA 1BOQA 3SUEA 6CHAC 5C2ZA 5DPAA 5GNDA 1L2EA 3PV4A 3URDA 1GVZA 2IPHA 1KXDA 4TT3D 1P8VC 4DW2U 4ZUHA 2M2AA 5LPRA 3RXSA 5IDKA 1MZAA 5A8ZA 1P01A 1MAYA 3ZZ9A 2SGEE 3EE7A 3S69A 3AW1A 2F9OA 4YT7H 3FOAA 4TWWA 1C2GA 1L1JA 2QF3A 4E05H 1SLWB 5G4BA 4Y0YE 2R9PA 3BTGE 5EJZA 1BRCE 1O3FA 3OTJE 3SHAH 1FY5A 2OCVB 1SGIB 4WMDA 1BDAA 1SGFG 2WV9A 3RMMH 3C1KA 3HK6B 3RXEA 1PQ7A 2PGBB 2J38A 2C8XB 3DFJA 3LGWA 2Y80A 3Q3XA 2FM2A 5C1UA 3PYHA 1F5KU 1ESBA 1XVOA 3PWCA 4FETA 1TBQH 1BJVA 1C5TA 1O3BA 2CMYA 1CA8B 3OYPA 2XNIA 2AYWA 3DFLA 4ABJA 2BM2A 2P8OC 4AFQA 4HTCH 1MCVA 4XSKU 4A92A 1MTNC 2FS9A 4FUDA 2PUQH 3U98H 1UHBB 2PP6A 3OAAD 3RXFA 1J17T 4AYYB 1PFXC 2BDGA 2BY6X 4GSOA 1O3EA 4K3JA 4OS1A 2RCEA 1V2PT 1G2LA 7ESTE 3KQDA 2KFWA 4FUEA 1EJAA 5JBAS 3T2NA 3VPKA 2C90B 2Y6TA 3TK9A 2BY7X 3TNSA 2ZC9H 2B0FA 5IK2D 2PLXA 2ZGCA 5HKKD 2QY0B 1LHCH 2BDBA 5KEDA 1K22H 1GHYH 2YNBA 1FAKH 1RIWB 5GPIB 4B6FA 4K2YA 3ATLA 3V3MA 1DWDH 3F9HA 4OS6A 1C9TA 2SGQE 5KECA 3LT3A 3L3TA 5C1YA 1TRNA 1OP8A 1BMFD 2BMGB 1MH0A 1MKWH 1SQRA 1W8BH 4AX9H 3STJA 1QJ6B 2PSYA 1E0FD 2UUJB 4MNWA 5DK1A 4FVBA 3UNRA 1EAIA 1K1NA 1OWIA 1ZTLA 1FZZA 3ZZ5A 1VITF 4BNRA 1QJ7B 5EXLA 3BIUH 1V2WT 2LNCA 1TNKA 3Q77A 1PPZA 5DG6A 1RTLA 3RU4T 1MKWK 4U32A 3ATWA 3TLOA 3ZVBA 4MPUA 2VVCA 1IQIA 5T6FA 1TE0A 1ZPCA 2G51A 1NROH 2HNTC 1JRTA 1DSUA 1LHFH 3SGQE 1CGHA 1DPOA 3B23B 1TRYA 2NWNA 1TGTA 3MH7A 2FOGA 3MWIU 1O3MA 2GT8A 3FKSD 1GVKB 1PPBH 2GP9B 1GBHA 3QGJA 5L2ZH 1H8HD 1TYNA 1DLEA 1KTTB 2JJ1D 1DS2E 1A3EH 3CP7A 2O8UA 4OS5A 2DE9A 1FONA 5HXFA 1GHZA 4D8NA 2V7QD 3PM3A 4ACBA 1AI8H 1FUJA 1GMCG 3LGTA 1BB0B 1VCQA 1HCGA 1UTOA 1VR1H 2CN0H 2VH6A 4LOYH 4FVDA 3AK5A 1C2EA 2GCHF 2R3UA 2OTVA 1QHRB 1HAZB 3LGYA 4CH2B 4MNYA 3RXPA 4DOQA 1CA0C 1C5LH 4XFQA 1DE7H 2XYAA 5C1XA 3PV5A 2HPPH 4FUIA 1C5OH 4BTIB 3FP8E 3HPTB 3QDZB 5A0AE 2F4LA 3O8BA 1X7AC 3SQHE 1D6RA 3L6PA 1H9HE 4MPWA 3E8LA 1SGFA 2TIOA 2JJ2D 4HFPB 3PRDA 1G3CA 4B74A 2YNAA 2J9NA 1GI3A 1YF4A 2OC8A 2BD4A 1ANCA 3MNBA 3IITA 1J14A 2FYRA 1O3GA 1SGPE 1AFEH 1O3JA 1YPEH 3A89A 1F0SA 1UVTH 1FMGA 1DOJA 3STIA 2KCAA 1T4UH 1C1MA 1O3PB 2AERH 1O3CA 1EJNA 1V2UT 5HIZA 1T31A 1BBRE 1C2LA 2ZU2A 1MCTA 1SGCA 2ZKSA 2V35A 4TY6A 1ZRBA 4BAHB 5F03A 1Y3UA 2FOBA 1P10A 2LP6A 1SHHB 2C93B 4NG9H 4UFEH 1AO5A 3P8FA 1ETRH 3M7UA 2UUKB 1NFUA 3M3VA 1C5XB 5CDFE 1SB1H 2JIZD 2W7UA 2GD4B 3GY2A 1MMJN 3TITA 5B6OA 2UWOA 2ZDKA 1O0DH 4CBNA 4X8VH 3BG8A 1NM6A 3PLKA 4I8JA 2R0KA 1K1PA 1TRMA 3P95A 4INHA 3MH6A 2HRVA 1H8IH 3T5FH 2GKVE 1YWUA 3SN8A 1HXFH 4I7YH 5FBIA 5BPEA 1TNJA 4ZHAA 1BRBE 4RI0A 1FPCH 1LHGH 2ZDLA 1ELTA 4NCYA 4A7IB 1RTFB 4FUJA 3OSYA 1HAVA 3UNSA 1TMTH 1L1GA 2BYAX 1GI4A 3QZQA 3BG4C 1TMBH 2FP7B 4MPVA 2ODYB 2UUFB 3ESTA 3TH3H 3NK8A 1LPGB 1YGCH 2KCPA 1NRQH 1NRPH 2ODQA 3SGAE 1KXAA 5DP4A 5E0JA 3M5OA 1BJUA 1TNLA 1GDNA 5DGJA 1GDUA 5LH8A 3ZZ4A 2QXHA 2QF0A 1H1BA 1S6HA 1W0JD 2ZU4A 2TPIZ 4Y7BA 2BDYA 1EX3A 4P00A 1KTSB 1EB2A 1OYTH 1N1LA 4K1SA 3MO3A 2VU8E 1VJ9U 1GG6B 1G3EA 3A7VA 4FUBA 2BDAA 1ZHPA 2FLRH 2A4GA 3F3BA 2HALA 3P92A 4IBLH 4K1TA 3ZIAD 4BAMB 1S85A 2VIWA 3T26A 4Z6AH 2ODPA 3AAVA 1P11E 3GYLB 2EC9H 4NA8A 2PTNA 3TH4H 1IQEA 3EYDA 3NCLA 4ABHA 3RUOA 3BTTE 2O8MA 1WXRA 1H9IE 3OX7U 2ZFPH 3F2GA 1Z71A 2QN5T 1Q3XA 1W11U 3RXCA 3SJOA 1AMHA 3ODDA 2A31A 1RFNA 1OWKA 4FUFA 2PR3A 3C27B 3SQEE 3GY5A 5DO4H 2GT7A 1G3DA 1O38A 1GJ5H 5FPYA 2NU0E 2ZPRA 5KGOA 2AH4X 2PHBA 1SL3A 2QF4A 3T28A 4ZKOU 2WZQA 1NS3A 3T27A 2VIPA 3VB7A 1L4DA 2A7JA 1J9CH 2DUCA 3RXAA 3JZ1B 1SI5H 1JBUH 2B8OH 4ACAA 1GJDB 2A7CA 3TNTA 1MQ6A 3U8RH 3E0PB 1Z6JH 1Q31A 1A61H 1HAIH 1A0JA 2CHAB 4D7GA 3MI4A 9ESTA 2BVXH 3VB4A 2QXGA 1RD3B 2R2WU 3SGBE 3GY4A 1O2MA 2ESTE 1ETTH 1G3BA 2H5DA 1EFRD 1HNEE 1Z7KA 5DKMA 4ISIH 1IQMA 1F5RA 2BD3A 6GCHF 1YLNA 1FV9A 1Y3XA 2HLDD 2SFAA 3SU4A 2RA3A 1CT2E 2ANYA 1P12E 2Z9JA 3KQEA 1ESTA 2C8WB 3MFJA 3W95A 1P3CA 5L2YH 1PQ8A 2QAAA 1O3NA 1S5SA 5K0HA 1A5HA 3UOUA 4Y79A 1VKYA 2Q6GA 2FTLE 1F0TA 1LKAA 1S6LA 3H7OA 1RXPA 1QFKH 1HJ9A 2BOKA 1FX0B 3RM0H 2QXIA 4CR9A 1O37A 1QURH 3AASA 3TGJE 5JB8S 4DT4A 4OGXA 5A2MH 5C94A 2TGAA 5DJ7A 4B75A 5CMXH 2Y5HA 1BITA 4IGDA 1ORFA 1GJ7B 1MTWA 1V2NT 5EU8A 1RRKA 1FIZA 2XRCA 3MH5A 2VJ1A 1QRXA 5C5NA 1YCPH 5GDSH 1YP9A 1K21H 3I77A 1O5AB 4GAWA 3GCTF 1T8LA 3BIVH 1O2WA 4CRCA 4JYTA 4OS4A 1Y5UT 4WY3A 4AGKA 2WHXA 5HGGA 3SO3A 1AZZA 4AYVB 1HFDA 2P93A 3F9GA 1FIWA 3K65B 4Y76A 3UWJH 1QB6A 1HJAC 4FU8A 2WSSD 2NU1E 2R2MB 4XD7D 2ZTXA 1HAPH 3QTOH 2ZGJA 4CREA 3N7DA 2CK3D 4FU9A 1SBWA 4TWYA 2OUAA 5LPEA 4JMYA 1G9IE 5DP5A 1YPKH 1WQSA 1MD8A 5T3HA 4TPYA 3BEFB 2D1JA 2P59A 1EOLA 4CBOA 2IN2A 3LJOA 1F2SE 2AMQA 1D6WA 2J94A 1DUEA 1PPCE 2IJOB 1Y3WA 1CU1A 2IPQX 3QZRA 3PO1C 4X8SH 1D3DB 2L74A 3RM2H 1KYNA 5HYOA 4X6OA 1WAYB 3TGIE 2BY9X 4NZQA 2VWMA 1HAVB 4WWYA 1LDTT 1SFIA 1DUAA 1FN6A 5SGAE 3UNQA 3MU4A 3SV6A 1GDQA 3E16B 3S9AA 1KSNA 1P09A 1THPB 4DVAU 2P3FH 1SC8U 1W7GH 1O5FH 3PWBA 1EB1H 1UHBA 1EASA 1MTVA 1AHTH 1TPPA 2FODA 1SGRE 2STAE 2OLGA 1U6QA 1OWHA 1OP2A 1OWEA 4BAOB 3DT0H 3F9FA 2ZF0H 4AG2A 4X2XA 3F2HA 1GBIA 1CBWB 2ZG0H 4X8TH 1EPTB 5T6GA 4HGCA 4WMFA 1BA8B 3NPSA 3UOPA 1HV7A 1TWXB 1ZGVA 3A8CA 3DUXH 2YMSD 2NU4E 3E90B 5EPNA 1JMOH 2J34A 1GBTA 4WXVA 2BD5A 2C8YB 4BTUB 2EA3A 4FUGA 2PKSC 2FZZA 3U69H 4AN7A 1EUFA 1ZYOA 4WMEA 4PROA 2K0QA 4ZKSU 1TQ7B 5F8ZA 4X6MA 2F83A 1GJBB 1OHHD 1C4V2 2ZFTA 3M61U 1C2DA 3R3GB 4Y11E 5HM2A 1OX1A 2FS8A 4OM9A 1RJXB 1P2NA 4NGAH 1K0HA 1TONA 6CHAB 3DCLA 1ELVA 1T32A 1NBMD 4IMQA 5E8EH 1GHAG 3EDXB 4CRFA 1C2JA 1J15A 3S9BA 1WV7H 1GVLA 4B71A 1Y8TA 1ZZZA 2PKAB 3KIDU 1BTZA 1O2PA 2BOHB 1ZOMA 1TBRH 3T25A 2A5AA 2WV5A 4WVPE 4MG3A 4Y6DA 3HGNA 4B6EA 1MZDA 4GLYA 2STBE 1H8DH 2H5CA 3KEEA 1LHEH 5GCHF 3SV7A 4X2WA 1EP6A 1DVAH 5EJ1A 3SJ9A 4B73A 3QK1A 4A6LA 1C5VA 4YXWD 1F5LA 1C1NA 2WPMS 1ELGA 1TABE 2PFEA 3SI4H 3OY5U 3T62A 1TX6A 3GCHB 4BAKB 1LTOA 1PJPA 1IAUA 3SI3H 3LC3A 1RIWC 2O9QA 3F6UH 1QRWA 1C2IA 1C1UH 3F2FA 4AFZA 2K8IA 3GDUA 4K60A 4R8TB 5TJXA 1GCTC 3U9AH 1O36A 3ELAH 8LPRA 3SU0A 1ARBA 3UY9A 1K1MA 1V2VT 4K5ZA 1S0QA 2J4IA 1HLTH 1N8OB 1OXGA 1QB1A 2OQUA 3A84A 3MU0A 3TK5A 2L6OA 5K7RA 3BTDE 2XWBI 8GCHG 3RXUA 1QA0A 3HATH 3SNCA 4GHTA 2ZFQH 1ZSKA 3LGVA 2K1QA 4HI3A 1YCPM 2GGVB 5H4IB 3RP2A 3UQVA 4YESB 5AVDA 4I8GA 3RMLH 1XX9A 2BTCE 2GMTC 3UR9A 1YPHE 3MH4A 1ABIH 1GHXH 1LPZB 3PMAB 4NFFA 3PMHB 3A87A 1EAUA 4CHAB 1QTFA 2UWLA 3UB0A 2ANMH 1NRRH 1BTWA 3ZVGA 1XKBC 2W6JD 1A0LA 1COWD 1HIAB 2FX6A 2BD2A 3HKJB 1NFWA 5FCKA 1GMDF 1NESE 2O8TA 1AD8H 1GI9B 2W3IA 1C5ZB 3ZZ7A 1O2SA 2BZ6H 3HK3B 2AS9A 4WJG2 4LZ4B 5GXPA 1WUNH 1L1NA 2PW8H 2XBWA 3QO6A 1FY4A 3QTVH 4YOJA 2GCTC 2SGFE 1LVBA 2XBVA 2H2ZA 2FDAA 3CENA 1PPFE 2GDDA 3PRBA 4U2WA 3Q3KA 3A86A 4I33A 1S81A 3SU3A 2AGIX 4MVNA 1ELAA 2XOKD 2WPHS 1O2QA 1O5EH 1LCYA 1MTSA 7GCHG 3LOXA 4P02A 4CRGA 1FXYA 1P0SH 1GI5A 1FAXA 3VGCB 1DXWA 1GBCA 1UK4A 4X8UH 2R3YA 5HIYA 2ZU5A 3SJKA 2ZTYA 2ZQ1A 3SV8A 2F9UA 3RXMA 1OKXA 1JWTA 5JBTA 2W5EA 2GZ9A 2Z9GA 1W13U 3F0PA 3VXEH 2BHGA 1AVXA 4H6SB 4LZ1H 3A7ZA 1VJAU 2J2UA 5CE1A 1ZSJA 4AFSA 2PV9B 1BHXF 5J4QA 3SU5A 2FMJA 1C9PA 5FHTA 1OS8A 2V6NA 4IMZA 2KZ4A 1GI0A 4YLUA 1C5RA 1S0RA 1MU6B 4TYDA 1SGQE 1TQ0B 2ZGHA 4ZHMU 1B7XB 3U1JB 4OS2A 1SR5C 1SGEE 2KM0A 3EA7A 1C5WB 1H8ED 1ZLRA 1GMDG 3SUFA 2BB4A 1XUGA 1EPTA 3FO8D 3MMGA 2XXLA 2CJIA 2VIDA 3KHVA 2QE7D 1PPGE 1T8NA 4Q2KA 3UREA 3T29A 5FPSA 5FX5A 1PPEE 1YPMH 5FCRA 3UAIC 3BEIB 4JK5A 3A8AA 5FPTA 4F49A 2RG3A 2HGTH 4JZIA 4XE4A 1SHYA 3O8CA 1V2RT 2TGPZ 4THNH 1C5QA 2O8WA 4TY7A 4JZEH 3RXBA 4UFDH 2BX4A 2D26C 2YMSC 2QC2A 2ZGBH 1KXBA 3L33A 2ZZUH 1O33A 4H6TA 1IOEA 3SYJA 1O2XA 5F53A 5T6DA 4TPIZ 4AGJA 2AGEX 2ALVA 4IC5A 1SQTA 1BMNH 3P8GA 1DM4B 1NZQH 1E35B 1ELEE 3PMJA 1B0EA 2JH5D 1D3QB 2ZECA 2VWNA 1VCWA 3GYMA 1ZGIA 3BTKE 1NU7B 3ZZ6A 1E1RD 2H9TH 4NSVA 1G32B 1GHBG 1O3HA 5DSFA 3NKKA 4F55A 3N99A 3RXVA 4Z1MD 1GBAA 1TBZH 5AFZH 2AMPA 2FI4E 1H9LB 1NY22 4IW4E 4AG1A 1M9UA 2J98B 1YPJH 1BBRK 1AB9B 4X1NU 1YBWA 4CRAA 4OGYA 4RSPA 4Y8XA 3A85A 1V2JT 4ABFA 5JDUB 2FO9A 3DD2H 5FXLA 1ZSLA 1BHXB 3ZVAA 3FFGA 5L30H 1EAXA 1K1IA 3SORA 1ARCA 1BBRH 1GI7B 4WF8A 2JDID 3ATKA 2A0QB 1C4U2 1DFPA 2UWPA 2WPDD 1TGCA 2AIPA 4MQAA 5C0UA 4MLFB 2BLQA 2FESH 2F3CE 5EQSA 1XUKA 1QZ8A 1C4Y2 1MKXH 3LONA 5DP8A 1HAOH 1UVUH 2GX4A 4FU7A 3P8NA 3MU8A 4D9QA 4R0IA 3NWUA 1FY8E 2BQ7B 1HUTH 1A5IA 1GJAB 5ABWA 3RXKA 1PQAA 2BD8A 3M5LA 1O3LA 1S82A 5ESBA 2WV4A 2ZGXH 2GDEH 3RXDA 3P6ZB 3RXOA 1GMHF 3EA9A 4YLQH 4BAQB 3BN9A 6LPRA 4MNVA 1OPHB 1QRZA 2ZDAH 1ELBA 1DICA 3JZ2B 3P8OA 4MTBA 1HJAB 1CGIE 1OYQA 5A8XA 2OP9A 5EIYA 2WINI 2Z9IA 1JIMA 1G36A 3LGUA 3KNXA 5I25A 1GCTB 3BTME 2Z94A 1F7ZA 2R0LA 5A8YA 1GBFA 2EY4C 1HB0B 3ZZ8A 3K2UA 1E38B 1J8AA 1GPZA 1KLIH 1XMNB 3D49H 4F48B 4ISHH 4AORA 2O8LA 4NIVA 2FEQH 2ZU3A 3GCHC 3MNCA 4B2CA 2Y81A 1IHTH 1O3DA 1G37A 1GI2A 5E0HA 1ZPBA 2KAIA 2GV6A 1GJ9B 2TGTA 1DXPA 3SNBA 1ZTKA 1C1OA 1O31A 2GV7A 3SU1A 5A0CA 2VVVA 4AB9A 1BIOA 3RC6A 3IWMA 1GGDC 3N7EA 4ABAA 4AB8A 4FOUC 3SU2A 3URCA 4ABGA 2G81E 2Y7ZA 4X1SU 2G00A 4B76A 2I6SA 2QGRA 1W3CA 4IN2A 5DP7A 3MO6A 1E1QD 3A88A 7LPRA 1AE8H 4INLA 1FQ3A 2GTBA 3NUMA 2ZDMA 3O8DA 1SFQB 4AZ2B 1YPGH 3PB1E 4IS5A 3UIRA 2P95A 1GI1A 3FP6E 2KX4A 2IJD1 1MQ5A 1QY6A 1TGSZ 2D2DA 3GDVA 3RDZA 4E7NA 1O2JA 3ZVFA 4JYUH 2HNTF 2KAIB 1BRUP 3BSQA 3FZZA 2OC7A 1MU8B 5J4SA 2P3UB 3FZDA 1CVWH 1EP5A 3QGNB 5EPYA 1A5GH 1AB9C 2ZDNA 3SU6A 2WYJA 1TAWA 2HVYB 4B2AA 4YM9A 2FI5E 2WPLS 3RLWH 3SNAA 1C5SA 4RT0A 1A0HB 2THFB 2ZFSA 4JZ1A 1AIXH 1MBMA 5GWZA 3F0OA 1K9OE 3SHCH 1O2UA 4FUCA 1BTUA 3AW0A 3IG6B 4B1TA 5DN6D 2VGCB 2PTCE 3W1EA 1HJ8A 1TFXA 5GJ4B 4I8KA 1D4PB 3RU4E 3SOSA 4ZHLU 1YKTA 2ZFRH 1UTNA 2AMDA 1TPSA 4A5TS 2GVFA 2EI6A 2VB0A 1C5UA 3F68H 4Y7AA 4JZFH 1Y5BT 3M37A 3K6YA 2ZHQH 2VH0A 1FI8A 2BXUH 1GHWH 4UFFH 1O2OA 2XC0A 2OINA 1DITH 4O03A 1ELDE 3U28C 2VIVA 5F6MA 4Q7YA 1UVPA 4OS7A 3RMOH 1EXFA 4X2VA 1BTHH 4GCHF 9LPRA 3TK6A 3ENSB 3TJUA 1THRH 4NIYA 4YTAA 1W2KH 1KDQB 2ZNKH 1AE5A 1N6YA 2BQWB 1T7CA 3UUZA 1W14U 2ZPQA 4B2BA 3GCNA 2TGDA 3D62A 1TA2A 2C3SA 3W94A 3LGIA 4Q80A 4YOGA 4WH8A 4YOIA 2BY8X 2A2QH 1YM0A 1PQ5A 2F9VA 1QIXB 3GOVB 2H6MA 1K2I1 1LO6A 1B5GH 1O2TA 3GY7A 1KIGH 3VB6A 3QX5H 1YLDA 1SVPA 4Y8ZA 3F9EA 3BV9B 1Z8JB 1GBBA 1NU9A 3SNDA 1EQ9A 1SGNE 1O5GH 3WWBA 2BLVA 5AHGH 2BVRH 5A0BA 4XBCA 2VWLA 2XCNA 4DT7B 1W0KD 5C0TA 1UTJA 2V0BA 1A46H 4BANB 4K8BA 1V2QT 5JBCS 2G55A 3EAJA 3S7HB 1CHGA 1TPAE 3OE7D 1IQFA 2SGAA 3QLPH 1Y3YA 3MO9A 4MDSA 1YPLH 1Z8IB 3DHKH 1V6DA 1AUTC 1OP0A 2ALPA 4H42U 5E2OA 4XOJA 2KR7A 1C1VH 3EA8A 1GJ6A 3HGPA 1YY3A 1ZR0A 2FOEA 1O35A 2G4TA 4DGJA 1IQNA 5DP6A 1O2VA 1QQ4A 1O2LA 3UWIA 3LJJA 3KYFA 5GCHG 3SNEA 4K1EA 1EAWA 4XBDA 1VCPA 3EGKH 4UE7H 3EQ0H 4O9VA 2QV1A 3VXFH 1WCZA 3A7WA 1CSOE 1GBDA 2BZAA 5BRRE 1E37B 2B5TB 1IQKA 4VGCC 5HMAA 1O5CB 1FDPA 5E2PA 1GMCF 2CXVA 2WPIS 2PGQB 1XUFA 1V2TT 2ZPSA 5I46H 2ZHFH 2P94A 3KCGH 2WUCA 3RMNH 3P17H 3VFEA 2Z6BD 1P9SA 1K1OA 3KQ5A 1VGCC 3ZV9A 1QB9A 2BDIA 1UVOA 3TVJB 1SLVB 1EATA 2V3OH 3A8BA 3B9FH 3PLBA 3M36A 1KXCA 1GHVH 1CHOF 1AVWA 3RXRA 3KN2A 3OEHD 1WYKA 1Z8RA 4X2YA 1QJ1B 3Q00A 5EG4A 1UCYH 3V12A 1S83A 2W3KA 3ZYDA 2OD3B 1Z6EA 2Z3DA 2XWAA 3KQBA 1QBOA 1DDJA 2VBCA 4BTTB 4ZXXH 3TPIZ 1C2KA 2PWXA 2XTTB 3Q3YA 4ESTE 3V13A 1ZTJA 1IHSH 5CHAC 3M35A 3FAOA 1O2RA 4UFGH 3SUGA 2DE8A 2JKHA 4X0WU 1KMHB 3U1IB 2ANKH 2BDCA 3I29A 1Y5AT 1GL0E 3GY8A 1DWBH 3NZIA 1N8OC 3GDSA 1P05A 8ESTE 1C1SA 4ZKNU 5JB9S 1GBEA 1FNIA 5C20A 3MNSA 3ZZBA 1HAGE 2VIOA 3RXIA 3AAUA 1MAXA 4AOQA 1QQUA 1L0ZA 3LH1A 3RLYH 3ZYEA 1FPHH 1TALA 3ATMA 3S9CA 2B9LA 4ABBA 1E79D 3KGPA 3ZZAA 1DLKB 4INKA 1DY9A 4FXGH 1QGFA 3V0XA 3UR6A 1BUIA 2BDHA 1KDQA 2FOCA 2A1DB 4NFEA 1A7SA 1HPGA 3BTHE 2CF9H 3SV2H 3CS7A 1QBNA 1ANDA 1BMLA 1LVOA 2AFQB 1AUJA 1DWEH 1Z8GA 1AWFH 2KCYA 2JETC 1L4ZA 1NRNH 3FVFB 1UVSH 1CT0E 2QF5A 4JCNA 1TNGA 2FOFA 2VINA 4NIWA 2FIRH 1QL8A 3CS0A 1A4WH 4BXSA 1W10U 1P2MA 2AGGX 2VIQA 3ATIA 4ZCNA 2XC5A 2BLOA 2YMSB 1P2QA 3UFAA 1TMUH 4HZHA 1O2YA 3PTBA 1QA7A 1Q2WA 1CE5A 5C17A 2SNVA 1UTKA 2EQNA 1EZUC 5FAHA 1KXFA 1D3TB 1RGQA 1UJ1A 2P16A 1E34B 5EODA 3RXHA 2H9EH 3FP7E 4ASHA 3A7TA 1BMAA 3RC4A 4YT6H 2XBXA 2JH0D 1WTGH 1GCDA 1GJ4H 1V2MT 2Z7FE 1VITH 2HWLB 2J5UA 3RXJA 1ZJKA 2OK5A 3H5CB 2CGAA 2GCTB 1DY8A 1TLDA 3MU5A 3RXLA 1DT2A 3A83A 1DX5M 2HOBA 3OTPA 1GWAA 2NU3E 4X6PA 3MNXA 1Z1IA 3S0NA 4I32A 2A32A 3F1SB 4XBBA 2H1UA 1PPHE 4E7RG 5CHAB 3QUMP 1ANBA 2A5KA 1TOCB 2QXJA 1LVYA 3K6ZA 3UTUH 1H4WA 3KF2A 2V3MA 1UTMA 3RC5A 1C1TA 1C5MD 1P2JA 1BRAA 1O39A 1S84A 3HKIB 3M7QA 3TJNA 1EJMA 1IQJA 2NU2E 5F8TA 1EOJA 2Y7XA 5EQQA 3A82A 1Y59T 2ZP0H 1CA0B 1UK2A 4F4OC 4GPGA 3RXTA 1NFYA 1AWHB 2Y5FA 2SGPE 3UQOA
chains in the Genus database with same CATH topology
3VGCC 1GJ8B 4KTCA 5EXMA 1WBGB 4FUHA 5C67A 1SGDE 1BT7A 1CO7E 1P2OA 1P9UA 2QCYA 6ESTA 7GCHF 2HLCA 5FX6A 1EZQA 3SBKA 2M5TA 1GI8B 3KL6A 1PYTC 1TPOA 1C2HA 1HRTH 1NC6A 2QIQA 2ZHWH 2ZDVH 4VGCB 1T8MA 2ZA5A 1W0YH 4YZUA 3UPEA 1TA6A 1LQDB 4Y10E 2OQ5A 1TX8A 2PSXA 2CV3A 1TGBA 3BTFE 1YYY1 1KLTA 2BQ6B 1NFXA 2OXSA 1XUHA 3GICB 1NT1A 1UO6A 1BCUH 4DURA 2ZIQH 4MPXA 1NN6A 5EQRA 1GBKA 2I6QA 4X1RU 1INCA 4ZXYH 4KKDA 4ABEA 1AGJA 1SOTA 4ABIA 5EOKA 2EI7A 4SGBE 1V2ST 2Z9KA 4I8HA 4A1XA 3K9XB 1V2KT 2XW9A 4QT8C 1ACBE 3A8DA 2WUBA 3P70B 2TBSA 2QA9E 1ZMLA 2VNTA 1FLEE 1O5BB 3RU4D 4Y71A 5AF9H 4JYVH 4X6NA 1O34A 3GISB 1C2MA 1IQLA 3ZZDA 3ZVEA 1AFQB 1HDTH 4IN1A 4KGAA 3RXGA 2A4QA 3QWCH 4SGAE 2SGDE 1UTQA 5AFYH 4I31A 1GI6A 1XXFA 1FJSA 1C1WH 4RKOB 5IYTA 1Z1JA 2H9HA 3U8TH 4LXBH 3M3SA 4ISOA 1C1RA 1O2HA 3LPRA 1P02A 2PKAA 3MYWA 1KXEA 1GBJA 4NSYA 3WY8A 2ZWLH 2C8ZB 2W26A 3ZVCA 4BOHA 1SQOA 2ZU1A 3I78A 1KY9A 1RTKA 4RKJB 2FXRA 3ODFA 2Q6DA 2W7SA 7KMEH 1AQ7A 3EE0B 5A09A 1SGTA 1GMHG 1HYLA 1J16A 2UUYA 3LH3A 1AU8A 2A4RA 2OBQA 1SSXA 4KELA 3E6PH 5JBBS 2G52A 1QBVH 4AFUA 3ZVDA 2G8TA 1F0UA 3BEUA 3V7TA 4O3UA 1MTNB 1IQGA 1EZSC 3U8OH 4DCDA 2ZCLP 2G4UA 4Z0KA 4BXWA 4GHQA 4CHAC 2J92A 1AN1E 2HVXA 4Q7XA 1P57B 3R0FA 4H4FA 5DP9A 3SUDA 4KP0A 5LPFA 2XCFA 2OC1A 2P8OB 2F9BH 2GZ7A 2ASUB 1TNIA 2EI8A 5LGOA 1VGCB 1UCYK 1BTPA 1TB6H 4I8LA 5HM9A 1XXDA 3GY3A 1O3KA 1PYTD 4ZROA 2BLWA 5TCAA 3S7KB 3E3TA 1C5YB 1OSSA 3A81A 1FN8A 2FPZA 2HNTE 1GBMA 1HAYB 2FYQA 2PKSB 1P2KA 1HAHH 2D8WA 1G30B 1CT4E 1LVMA 1GG6C 4LK4A 4IC6A 2Z3CA 5GIBA 4DJZB 1AKSB 1A2CH 1C5PA 2Q1JA 3LC5A 4DY7B 1V3XA 1ZHMA 2AIQA 1ELFA 4UD9H 2BXTH 4WXIA 3LIWA 4O97A 1G2MA 2C4FH 5FBEA 1UTPA 2WPKS 1WOFA 3MOCA 5EGMA 1BTYA 1CQQA 1MKXK 1C5NH 3TU7H 2RDLA 4Y8YA 1O2IA 2OC0A 1E36B 1SLUB 3GY6A 5EXNA 1ZHRA 4O3TA 1SQAA 2HPQH 2BY5X 3M7TA 1GBLA 1FY1A 2AEIH 3TJVA 2Z3EA 2A4OA 1JIRA 2TRMA 3PMBB 1TX7A 2FX4A 1GJCB 2CF8H 2VWOA 3M3TA 5PTPA 1LPKB 1JOUB 4JZDH 2F91A 1ZMJA 4J2YB 1EKBB 3G01A 1VZQH 4Q7ZA 1LQEA 2G5VA 4YO9A 1C1PA 1GL1A 4RN6A 2FI3E 1BQYA 1ELCA 1WU1A 2V3HH 3NXPA 4NA9H 4DIIH 3MHWU 1WQVH 3H7TA 1YCPK 1ETSH 1O2ZA 1AZ8A 3LU9B 4MNXA 1C1QA 3TH2H 5E0GA 3A7XA 4X1PU 1CBWC 1K1JA 4D9RA 1SLXB 2Y82A 3M5NA 1MUEB 1O32A 1P04A 1BZXE 4CRBA 1T8OA 2ZCHP 1WTHD 2A5IA 1CGJE 4KTUA 1TOMH 3TIUA 2Z9LA 2A45B 1O2GH 1AVGH 2FOMB 5TCCA 2BD7A 2BVSH 2WYGA 1P06A 4K69A 3BTEE 2ZTZA 4E06H 1BTXA 2ZCKP 3LKWA 2ZFFH 3MTYA 5ETXA 3SW2B 1OWDA 3FANA 2JETB 3VB5A 1XUIA 1V2OT 4WH6A 1SG8B 1SGYE 1D9IA 1FY3A 1W12U 3QN7A 4UDWH 2A2XH 3ZZCA 3MU1A 1NTPA 3AVZA 4ZKRU 1HXEH 4GVUA 4UONA 1XUJA 3TGKE 4NZLA 3M5MA 4GUXA 4NA7A 1T4VH 4X1QU 3TJOA 2J95A 2ZQ2A 4NWKA 1O3AA 1GHBF 4NIXA 4U01A 1LHDH 1UCYE 1Y3VA 2VGCC 2ZO3H 2EEKA 2OBOA 3ZZ3A 1P2IA 1O3OA 1O30A 3E1XB 1CHOG 1DWCH 1YPHC 4J1YA 4DIHH 3SZNA 3D65E 3BF6H 1NPMA 3PROA 4CR5A 1DANH 2BD9A 1EPTC 1OWJA 1P03A 4NWLA 4D76A 1ANEA 1THSH 3SV9A 2GCHG 5F8XA 3BTWE 5DP3A 2VVUA 3GCTG 1UK3A 5EW2H 1O3IA 2LPRA 1F0RA 1ID5H 2Q6FA 1IQHA 8KME2 1QL9A 2ZHDA 1UTLM 2CHAC 2YOLA 3O8RA 1D3PB 2P3TB 1W7XH 4U30A 2B7DH 4Y0ZE 1DSTA 1HGTH 1EZXC 1XM1A 1QCPA 2A7HA 5L6NH 4ZMAH 1HBTH 2F9NA 1XKAC 1KLJH 2ANWA 1P3EA 1A1RA 1TNHA 1JXPA 1GGDB 2JH6D 3PLPA 4UEHH 3ZV8A 1SPJA 1BMMH 1AKSA 2G5NA 1AFQC 3BTQE 3PO1B 3KQCA 2FTMA 4GCHG 2F9PA 1A3BH 5JPMH 5EW1H 1O5DH 1ZPZA 1MD7A 1NRSH 1WSSH 2GZ8A 2GMTB 2ZI2H 3LDXH 1VITG 1QNJA 1K28D 2ILNA 8GCHF 2IOTA 5C5OA 4ZAEA 1HAXB 1NO9H 1TIOA 6GCHG 4XDEA 3GCOA 1OOKB 2BX3A 1S6FA 2XBYA 3SJ8A 3ITIA 2PUXB 2XC4A 5ESTE 1F92A 4DG4A 1C2FA 1ZRKA 1SMFE 2SNWA 1XVMA 1JRSA 4ISNA 3E91A 4CRDA 3VEQB 1W0ZU 3SJIA 2FWWA 3B8JA 1MBQA 1ABJH 1HIAA 1QL7A 1YLCA 2ZHEH 4A1TA 3RXQA 1ZJDA 2WPJS 3PTNA 1TGNA 1O2KA 3OY6U 1QR3E 2RA0A 3E0NB 3Q76A 2FOAA 2QYIA 4D7FA 1LKBA 4K8YA 1N6XA 3A7YA 3VB3A 4ISLA 3OU0A 1AY6H 2Y5GA 2ULLA 4ZH8A 4CH8B 3N7OA 4KTSA 5C3NA 4A1VA 1YC0A 1MTUA 3D23A 1UMAH 1ZMNA 1K1LA 2FOHA 1B0FA 4M7GA 1RS0A 2ZEBA 3A80A 1SOZA 1GHAF 1V2LT 3BG4B 3DA9B 4JK6A 2FLBH 4ABDA 1O2NA 1ESAA 1LMWB 5JYIA 1BOQA 3SUEA 6CHAC 5C2ZA 5DPAA 1L2EA 3PV4A 3URDA 1GVZA 2IPHA 1KXDA 1P8VC 4DW2U 4ZUHA 5LPRA 3RXSA 5IDKA 1MZAA 5A8ZA 1P01A 1MAYA 3ZZ9A 2SGEE 3S69A 3AW1A 2F9OA 4YT7H 4TWWA 1C2GA 1L1JA 2QF3A 4E05H 1SLWB 5G4BA 4Y0YE 2R9PA 3BTGE 1BRCE 1O3FA 3OTJE 3SHAH 1FY5A 2OCVB 1SGIB 4WMDA 1BDAA 1SGFG 3RMMH 3C1KA 3HK6B 3RXEA 1PQ7A 2PGBB 2J38A 2C8XB 3DFJA 3LGWA 2Y80A 3Q3XA 2FM2A 5C1UA 3PYHA 1F5KU 1ESBA 1XVOA 3PWCA 1TBQH 1BJVA 1C5TA 1O3BA 2CMYA 1CA8B 3OYPA 2XNIA 2AYWA 3DFLA 4ABJA 2BM2A 2P8OC 4AFQA 4HTCH 1MCVA 4XSKU 4A92A 1MTNC 2FS9A 4FUDA 2PUQH 3U98H 1UHBB 3RXFA 1J17T 4AYYB 1PFXC 2BDGA 2BY6X 4GSOA 1O3EA 4K3JA 4OS1A 2RCEA 1V2PT 1G2LA 7ESTE 3KQDA 4FUEA 1EJAA 5JBAS 3T2NA 3VPKA 2C90B 2Y6TA 3TK9A 2BY7X 3TNSA 2ZC9H 2B0FA 2PLXA 2ZGCA 2QY0B 1LHCH 2BDBA 1K22H 1GHYH 2YNBA 1FAKH 1RIWB 5GPIB 4K2YA 3ATLA 3V3MA 1DWDH 3F9HA 4OS6A 1C9TA 2SGQE 3LT3A 3L3TA 5C1YA 1TRNA 1OP8A 2BMGB 1MH0A 1MKWH 1W8BH 4AX9H 3STJA 1QJ6B 2PSYA 1E0FD 2UUJB 4MNWA 5DK1A 4FVBA 3UNRA 1EAIA 1K1NA 1OWIA 1ZTLA 1FZZA 3ZZ5A 1VITF 4BNRA 1QJ7B 5EXLA 3BIUH 1V2WT 2LNCA 1TNKA 3Q77A 1PPZA 5DG6A 1RTLA 3RU4T 1MKWK 4U32A 3ATWA 3TLOA 3ZVBA 4MPUA 2VVCA 1IQIA 5T6FA 1TE0A 1ZPCA 2G51A 1NROH 2HNTC 1JRTA 1DSUA 1LHFH 3SGQE 1CGHA 1DPOA 3B23B 1TRYA 2NWNA 1TGTA 3MH7A 2FOGA 3MWIU 1O3MA 2GT8A 1GVKB 1PPBH 2GP9B 1GBHA 3QGJA 5L2ZH 1TYNA 1DLEA 1KTTB 1DS2E 1A3EH 3CP7A 2O8UA 4OS5A 2DE9A 1FONA 5HXFA 1GHZA 4D8NA 3PM3A 1AI8H 1FUJA 1GMCG 3LGTA 1BB0B 1VCQA 1HCGA 1UTOA 1VR1H 2CN0H 2VH6A 4LOYH 4FVDA 1C2EA 2GCHF 2R3UA 2OTVA 1QHRB 1HAZB 3LGYA 4CH2B 4MNYA 3RXPA 4DOQA 1CA0C 1C5LH 4XFQA 1DE7H 2XYAA 5C1XA 2HPPH 4FUIA 1C5OH 4BTIB 3FP8E 3HPTB 3QDZB 5A0AE 3O8BA 1X7AC 3SQHE 1D6RA 3L6PA 1H9HE 4MPWA 3E8LA 1SGFA 2TIOA 4HFPB 1G3CA 4B74A 2YNAA 2J9NA 1GI3A 1YF4A 2OC8A 2BD4A 1ANCA 3MNBA 3IITA 1J14A 2FYRA 1O3GA 1SGPE 1AFEH 1O3JA 1YPEH 3A89A 1F0SA 1UVTH 1FMGA 1DOJA 3STIA 1T4UH 1C1MA 1O3PB 2AERH 1O3CA 1EJNA 1V2UT 1T31A 1BBRE 1C2LA 2ZU2A 1MCTA 1SGCA 2ZKSA 2V35A 4TY6A 1ZRBA 4BAHB 5F03A 1Y3UA 2FOBA 1P10A 1SHHB 2C93B 4NG9H 4UFEH 1AO5A 3P8FA 1ETRH 3M7UA 2UUKB 1NFUA 3M3VA 1C5XB 1SB1H 2W7UA 2GD4B 3GY2A 1MMJN 3TITA 5B6OA 2UWOA 2ZDKA 1O0DH 4CBNA 4X8VH 3BG8A 1NM6A 3PLKA 4I8JA 2R0KA 1K1PA 1TRMA 3P95A 4INHA 3MH6A 2HRVA 1H8IH 3T5FH 2GKVE 3SN8A 1HXFH 4I7YH 5FBIA 5BPEA 1TNJA 4ZHAA 1BRBE 1FPCH 1LHGH 2ZDLA 1ELTA 4NCYA 4A7IB 1RTFB 4FUJA 3OSYA 1HAVA 3UNSA 1TMTH 1L1GA 2BYAX 1GI4A 3QZQA 3BG4C 1TMBH 2FP7B 4MPVA 2ODYB 2UUFB 3ESTA 3TH3H 3NK8A 1LPGB 1YGCH 1NRQH 1NRPH 2ODQA 3SGAE 1KXAA 5DP4A 5E0JA 3M5OA 1BJUA 1TNLA 1GDNA 5DGJA 1GDUA 5LH8A 3ZZ4A 2QXHA 2QF0A 1H1BA 1S6HA 2ZU4A 2TPIZ 4Y7BA 2BDYA 1EX3A 1KTSB 1EB2A 1OYTH 1N1LA 4K1SA 3MO3A 2VU8E 1VJ9U 1GG6B 1G3EA 3A7VA 4FUBA 2BDAA 1ZHPA 2FLRH 2A4GA 2HALA 3P92A 4IBLH 4K1TA 4BAMB 1S85A 2VIWA 3T26A 4Z6AH 2ODPA 3AAVA 1P11E 3GYLB 2EC9H 4NA8A 2PTNA 3TH4H 1IQEA 3EYDA 3NCLA 4ABHA 3RUOA 3BTTE 2O8MA 1H9IE 3OX7U 2ZFPH 1Z71A 2QN5T 1Q3XA 1W11U 3RXCA 3SJOA 1AMHA 3ODDA 2A31A 1RFNA 1OWKA 4FUFA 2PR3A 3C27B 3SQEE 3GY5A 5DO4H 2GT7A 1G3DA 1O38A 1GJ5H 5FPYA 2NU0E 2ZPRA 2AH4X 2PHBA 1SL3A 3T28A 4ZKOU 1NS3A 3T27A 2VIPA 3VB7A 1L4DA 2A7JA 1J9CH 2DUCA 3RXAA 3JZ1B 1SI5H 1JBUH 2B8OH 1GJDB 2A7CA 3TNTA 1MQ6A 3U8RH 3E0PB 1Z6JH 1Q31A 1A61H 1HAIH 1A0JA 2CHAB 4D7GA 3MI4A 9ESTA 2BVXH 3VB4A 2QXGA 1RD3B 2R2WU 3SGBE 3GY4A 1O2MA 2ESTE 1ETTH 1G3BA 2H5DA 1HNEE 1Z7KA 5DKMA 4ISIH 1IQMA 1F5RA 2BD3A 6GCHF 1FV9A 1Y3XA 3SU4A 2SFAA 2RA3A 1CT2E 2ANYA 1P12E 2Z9JA 3KQEA 1ESTA 2C8WB 3MFJA 3W95A 1P3CA 5L2YH 1PQ8A 2QAAA 1O3NA 1S5SA 5K0HA 1A5HA 3UOUA 4Y79A 2Q6GA 2FTLE 1F0TA 1LKAA 3H7OA 1RXPA 1QFKH 1HJ9A 2BOKA 3RM0H 2QXIA 4CR9A 1O37A 1QURH 3AASA 3TGJE 5JB8S 4OGXA 5A2MH 2TGAA 5DJ7A 4B75A 5CMXH 2Y5HA 1BITA 4IGDA 1ORFA 1GJ7B 1MTWA 1V2NT 5EU8A 1RRKA 1FIZA 2XRCA 3MH5A 2VJ1A 1QRXA 5C5NA 1YCPH 5GDSH 1YP9A 1K21H 3I77A 1O5AB 4GAWA 3GCTF 1T8LA 3BIVH 1O2WA 4CRCA 4JYTA 4OS4A 1Y5UT 4WY3A 4AGKA 5HGGA 3SO3A 1AZZA 4AYVB 1HFDA 2P93A 3F9GA 1FIWA 3K65B