1HNEE

Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-angstroms resolution
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
218
structure length
218
Chain Sequence
IVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFEDGYDPVNLLNDIVILQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN LEUCOCYTE ELASTASE
publication title Structure of human neutrophil elastase in complex with a peptide chloromethyl ketone inhibitor at 1.84-A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 39
structure length 218
sequence length 218
ec nomenclature ec 3.4.21.37: Leukocyte elastase.
pdb deposition date 1989-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hneE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hneE02
1AD8H 3R0FA 3MOCA 1YPJH 1MKWH 2NU0E 3M7QA 4X0WU 3S69A 2HWLB 5ETXA 1BQYA 4Q7YA 3RC5A 2Y7XA 4ZKSU 1SQTA 2VH6A 3LPRA 1ETTH 1EAUA 4K3JA 3RU4T 5AFYH 1AKSB 7KMEH 1UCYE 3L33A 1GI5A 1PPHE 1P06A 1TOMH 2ZQ1A 3KEEA 1C2LA 1TIOA 1V2NT 5E2PA 5JB8S 3RXDA 1O5CB 4ABGA 4RN6A 3H7TA 3MWIU 1OXGA 4KP0A 3SQHE 3CS0A 3EYDA 2XWBI 5IDKA 5JB9S 1C1QA 1OOKB 1NFYA 3JZ1B 4K1SA 1P2KA 2IOTA 2LPRA 1VITG 1XX9A 4NWLA 1A1RA 3U8RH 1CHOF 2TGDA 3QK1A 3U69H 2CGAA 1AIXH 1A3EH 1N8OC 3BEIB 1A61H 1BCUH 2GD4B 3GYLB 4YM9A 1FONA 4BXSA 3F9HA 3VB7A 4IN1A 2PW8H 1HB0B 2GCHG 2ANWA 2V6NA 1SB1H 3PROA 1C5TA 4AYYB 4O3TA 1QRWA 3ZVGA 4X8UH 2F9VA 1GMCG 1HGTH 2CMYA 1IOEA 1XKAC 1C5UA 2BY9X 2ZDVH 5T6FA 1Y3YA 3BTEE 3MH7A 1K1MA 1U6QA 7ESTE 3KQEA 4X1PU 4FUEA 4MQAA 1FPHH 2RDLA 4X2WA 2A2XH 3PWCA 1F5RA 3BIVH 3SJIA 1YCPH 4JZDH 4NFFA 2ZCKP 1AU8A 3KIDU 2FOMB 4GSOA 2ZCHP 1ELGA 3T29A 3SGBE 1OYQA 1HXEH 1LDTT 1NTPA 1LHFH 1O5EH 1TGNA 1UVTH 3D62A 3M5MA 1Y8TA 5JYIA 3A86A 4WH8A 3Q76A 2BMGB 1EKBB 1HCGA 3UWJH 1H9IE 2WYGA 3TGJE 3IG6B 4ABBA 1HAPH 3MMGA 1THPB 4ISHH 1XUHA 1KXAA 2BX4A 4Y7BA 3SJKA 1GI0A 1HAIH 1C5RA 3P92A 2ZFFH 1A2CH 1A4WH 4BAKB 1GG6B 4DJZB 2AMQA 1P2MA 1NU7B 1FAKH 2KAIB 1H8DH 5K0HA 3N7OA 2AGEX 2ZIQH 2Q6GA 2Z9KA 4MDSA 3MU8A 3RXGA 1O5DH 4CRCA 1QHRB 2OINA 1GBKA 2EI8A 1DITH 2OUAA 1ZGIA 4SGAE 4XFQA 2ZGHA 1Y5AT 1UCYH 1IQHA 1G3DA 1TYNA 2XTTB 1MQ6A 3RXIA 5HYOA 5FAHA 3CENA 1ANEA 1C2FA 2HNTF 1RFNA 3A7ZA 1FLEE 2B7DH 2WINI 3GCTG 4PROA 1C5LH 1J17T 4JYUH 1C5PA 2OC1A 4CRFA 1LKAA 4K1EA 4YOGA 1OX1A 2CF8H 3GY4A 3RUOA 2THFB 4A92A 1AVGH 1A5IA 1SC8U 4ABEA 3WY8A 2B0FA 1N6XA 4CH2B 3GOVB 8ESTE 1J8AA 2NU4E 1GCTB 1Z8GA 3OX7U 2CJIA 1O2KA 4A1VA 3DFJA 1B5GH 1F92A 2VWLA 1F5KU 1E35B 1SFIA 1UHBB 3TH3H 1BRCE 1TNKA 4JCNA 1K28D 1FQ3A 2D2DA 3RLYH 5EG4A 4BANB 3SU2A 1ACBE 1DWBH 1SFQB 1GG6C 1LVBA 4AOQA 1RXPA 2A5AA 4JZEH 3ZVAA 3M3SA 5L2YH 2SGDE 1CO7E 1XM1A 2FMJA 1SGPE 1GBBA 1GBEA 1SLUB 1PPFE 1IQJA 1SOTA 4A1XA 1SQOA 3SNBA 1ZOMA 2F3CE 1TNGA 4ABAA 1EP6A 1V2MT 1YPMH 1YBWA 2A45B 1N6YA 2QYIA 1ZR0A 1ID5H 2ZGJA 4CH8B 3UQVA 5A2MH 5L30H 3SW2B 2V3HH 3H7OA 1ELVA 1G30B 2FP7B 5FPSA 1PFXC 4CRAA 2A5KA 1LCYA 1CA0C 1AUTC 1C1RA 1EOLA 1YPHE 3TVJB 4I31A 3SUFA 1V2ST 1AE8H 2BD3A 4X1QU 5F03A 2GP9B 3SNEA 1GCTC 1O3EA 4OS1A 3SU3A 1MCVA 2QGRA 2ZU2A 3UTUH 1BRAA 4ASHA 1FY4A 2A4GA 3SN8A 4D76A 4DCDA 1VITH 1FY5A 1TPSA 2OLGA 3K6YA 3RXEA 2C4FH 2GDDA 3B9FH 3RMMH 2WPIS 1SMFE 1C5OH 2GT7A 3EE0B 2BDYA 1K1LA 3IITA 1TQ7B 1GJDB 2ZA5A 2ODQA 4X6PA 2PUQH 1H8IH 1P3EA 1BUIA 1TX8A 2ZU4A 2PLXA 1VITF 1HUTH 1FY1A 2C8YB 2ZTXA 1MUEB 1QB6A 1TA6A 2GMTB 5GPIB 5C5OA 2IPHA 1LQDB 5DP4A 1D3PB 2PWXA 1CQQA 3SZNA 1BOQA 2FYQA 1V6DA 1MTNC 1IQEA 4FUGA 3MO3A 3QO6A 1SHHB 2G5NA 5CE1A 1MTWA 2R2MB 1GJ8B 3OTJE 5LPFA 2AIQA 3O8CA 1TOCB 2DE9A 1KXCA 2FOBA 3PLBA 3MHWU 3URCA 1CA8B 4O3UA 2BD2A 3ZZCA 1ELEE 3TJUA 1HNEE 1O39A 1AWHB 1O5BB 5BRRE 2SNWA 2Z3DA 3HK6B 3A7VA 1O2VA 1XUKA 3QX5H 5LPEA 1KLTA 3QTOH 3ZZDA 3A8DA 3MU1A 1EP5A 1SR5C 1OYTH 2ZGBH 4UDWH 5DJ7A 5EPYA 1QCPA 6GCHG 3V3MA 2G00A 2H6MA 1OKXA 4O03A 1D3TB 2UWPA 1V2LT 3PV4A 2V35A 3SNDA 1T8NA 1P01A 1NFUA 4ZHLU 5FPYA 4X6MA 1AVWA 1FZZA 1O2LA 1GMDG 3OU0A 2EA3A 1ANCA 2GMTC 2Z9GA 1GGDB 1OWDA 1RGQA 3PB1E 2SGAA 1CHOG 2P59A 2YNBA 1QY6A 4X6NA 1BJUA 2WPKS 1O2YA 1EATA 1O38A 2ODYB 3UWIA 4MPUA 4BNRA 1QGFA 1ZGVA 1OP0A 1DX5M 3V13A 4CBNA 1C5XB 1E38B 1GMHF 3SI3H 1PPCE 4MG3A 1NS3A 3VGCB 7LPRA 1DICA 1FAXA 3PTBA 1EXFA 1DXWA 1PQ7A 3KQCA 1MTSA 1PQ8A 3LOXA 4BTTB 1GI8B 2XC4A 3ZZAA 1AN1E 4DIHH 2HVXA 2VWOA 1ESBA 3GCTF 1TNIA 2FS8A 4XBBA 4UONA 3DHKH 4U30A 4JK5A 2A4OA 2ZCLP 4ZKRU 1WV7H 3S9CA 1KXFA 2BD5A 3Q00A 3B23B 3M36A 1JWTA 5FCRA 1H9HE 1P2QA 4LOYH 1AE5A 3CS7A 1Z6JH 2ZO3H 3FAOA 2SGFE 3E91A 2D26C 2BY5X 3RXHA 3LGYA 1OP8A 1FPCH 4DIIH 3ATMA 1MD8A 1K1NA 2F9PA 2TGPZ 4RKOB 3EA7A 5J4QA 1Y3XA 2AMDA 3BG4C 1KSNA 3KL6A 4GHTA 4WMDA 1YLDA 1BTZA 3RC4A 1EJMA 2HRVA 1GBDA 1GGDC 1UTOA 3NXPA 1DSTA 1S84A 3SHCH 1YPKH 2Q1JA 3JZ2B 1CE5A 1GBFA 3GY2A 2EC9H 3PO1B 2GZ9A 3P8GA 4UFGH 1YCPM 2XBYA 2BDGA 1MZDA 1UTMA 4JZ1A 4X2XA 4Y6DA 1EZSC 2V3OH 2FX4A 1KTSB 1SLVB 2GDEH 1TRYA 3O8RA 4E7NA 1Z7KA 3ZVEA 1D4PB 1S6FA 1XMNB 3ZVBA 4J1YA 1IHTH 2ZU3A 1ZRBA 4UFFH 1MBQA 5TJXA 4A1TA 5FHTA 1O3NA 2OBQA 3E6PH 4XOJA 2WV4A 1O3JA 2EI6A 1F5LA 1GBLA 4IMZA 1Y5UT 1CT2E 3AAVA 1TBQH 3HATH 1ARCA 4X1RU 4LK4A 3OY6U 2FIRH 4HTCH 1MZAA 1A7SA 3D49H 1GJBB 2Z3CA 3RXSA 1F0TA 1C2IA 4INLA 3GDUA 4D8NA 2BD9A 1RTFB 2FTMA 3AW1A 4B2CA 2W5EA 1YPHC 4NSYA 5A8XA 1BRBE 1A46H 3I78A 4DURA 1TNHA 1GHWH 1QBNA 2WPMS 3VFEA 3ITIA 3FP7E 1SLXB 2AEIH 1ARBA 3E16B 2FDAA 2NU3E 2UWOA 1TBRH 1PQAA 4AORA 2UUFB 4HZHA 3F9FA 1IQNA 3U1IB 4YESB 3PO1C 2HPPH 1NROH 1OS8A 3SUDA 1ETSH 5H4IB 3RXAA 1ELFA 1G32B 1LHDH 2VIWA 2XNIA 4NWKA 5EU8A 2J9NA 2Z9LA 1C1TA 5I25A 1TB6H 1TPPA 2C90B 2ZDKA 1K1PA 3PMHB 2PHBA 1OP2A 2FOHA 5A0CA 5HGGA 1C5YB 4GCHG 1P3CA 1GPZA 1KXEA 2OXSA 4U01A 4BAMB 1TPAE 1NFXA 2QXJA 4Y10E 1VJAU 2VVVA 4LZ1H 4R8TB 4TY6A 3SORA 2JKHA 5I46H 2UUYA 5C1UA 1EUFA 3ZZ6A 4ZKOU 2HLCA 4ZXXH 2WYJA 3DT0H 3MNBA 4ISLA 2ZPRA 2I6QA 2F9NA 3LONA 3Q77A 3S7KB 4TPYA 1LVOA 1W7GH 1QA0A 2AH4X 5AVDA 4FUIA 5F8ZA 1CGHA 1YPGH 3PTNA 3ODFA 4X8TH 1C5VA 2WV5A 4X8SH 1HDTH 1C2KA 3M37A 3MO9A 2R3UA 2Z94A 1DXPA 4Y8XA 1DUEA 2ZHDA 4INHA 1BTPA 1NESE 2QA9E 1TONA 1QJ7B 2UUJB 5FXLA 1C1SA 1O2RA 3ZVCA 3TIUA 1BJVA 1SOZA 5L6NH 1GI1A 1WBGB 4XBCA 2B5TB 2BLQA 3M3VA 3S9BA 6GCHF 1GL1A 4JZIA 1T4UH 1FNIA 1QBVH 2H1UA 1O2GH 1Q31A 4WF8A 2FODA 3NK8A 2BDHA 3MYWA 1GDQA 1YLCA 4DY7B 2QF3A 5F6MA 5DP7A 4DT7B 1BBRK 1GMDF 1UVUH 3RXFA 4K60A 1PJPA 3P70B 3ZZ4A 3TJVA 4AFSA 1AI8H 3GDVA 4UFDH 4M7GA 1A0JA 1V2RT 2VVCA 3FFGA 1BMAA 5AFZH 1W10U 1ESAA 2GVFA 3GY5A 3SO3A 1EOJA 3LT3A 1WCZA 4FUDA 1ZPBA 3HPTB 1UJ1A 4KGAA 4K69A 5B6OA 2ZEBA 3L3TA 4B73A 3ZZ9A 3ZV9A 3DD2H 1L4ZA 4Y7AA 4Y76A 5A8YA 1S83A 1KY9A 2ALVA 1F0RA 1NZQH 2ZTZA 1O2UA 2VIPA 1VGCC 2Q6FA 3HKIB 4WXVA 2ANKH 3GCOA 3KGPA 8KME2 3SJ9A 3TNTA 1SQAA 2Z6BD 2TGTA 2ZGCA 1GI7B 4WXIA 1FXYA 3SU4A 4FUFA 5LGOA 4UFEH 2RA3A 2BY6X 4FUBA 3LC5A 4X6OA 5A8ZA 3A83A 3F1SB 1L0ZA 2WUBA 3TH2H 1PQ5A 3UY9A 1FIWA 1IQMA 1E36B 1TNJA 2SGPE 2BD7A 1KTTB 1V2JT 4BOHA 2SFAA 3F9GA 2RG3A 2SGEE 5FX5A 1VR1H 4BTUB 3BTKE 4AN7A 1AO5A 2H9EH 2ZDNA 3ZVDA 1DOJA 4LXBH 1GMHG 1OPHB 1ZHPA 4X1SU 1AQ7A 3TJOA 3HGPA 1EPTC 2PSYA 2BX3A 3GDSA 4XSKU 5T6GA 4NIVA 3VXFH 2O8TA 1S85A 3ZZ7A 4NG9H 1C5MD 5TCAA 1C5WB 1M9UA 4Z6AH 1MAXA 1G36A 1Y59T 2G52A 4J2YB 1SL3A 4OS6A 3KQDA 1C9TA 1AFEH 1QJ6B 3HGNA 4YOJA 4ZAEA 1C1PA 5E8EH 1HPGA 3GISB 5JPMH 1NFWA 3UR6A 3GCHC 3LC3A 1HAHH 1O3MA 2BZ6H 5EOKA 1SGFA 3OSYA 1O2QA 3A84A 1TBZH 2VVUA 3T2NA 1CA0B 1D6WA 1P11E 2VB0A 2OP9A 5EGMA 2HPQH 4GLYA 5DP8A 4OGYA 1NO9H 2FI4E 1E37B 1Z6EA 2PTNA 1FIZA 4XE4A 3VPKA 3LH3A 5EPNA 4ESTE 3BTME 1QIXB 1T7CA 5HMAA 2FI5E 4B1TA 4K1TA 1S82A 4D7GA 3M61U 1O3KA 1SGNE 1NT1A 4YLUA 2BLWA 1GDNA 4FVDA 2PFEA 4Q7ZA 4KTUA 1MAYA 4VGCB 2A31A 2AGIX 2GZ7A 2VWMA 1UTNA 4AB8A 3P17H 1D3DB 1WSSH 1FJSA 4IC5A 5C67A 1P03A 4MTBA 2AMPA 2J2UA 4GCHF 4O9VA 3TGKE 3SNAA 4KELA 1JBUH 3ATLA 1W13U 4ABJA 4AFZA 1HJ8A 3M5NA 1L4DA 4I8JA 4UEHH 1XVOA 1EJAA 3T27A 2P8OB 2ODPA 1UMAH 4B74A 4F49A 3V7TA 3SU1A 3SGAE 4WY3A 1A3BH 1LPZB 3RC6A 2AIPA 1HJAC 1RD3B 5FBIA 1MTNB 1LVYA 4D9RA 3MO6A 4FVBA 3MNXA 6CHAB 1DS2E 1MU6B 1ZMLA 3M7UA 1CU1A 1QR3E 3B8JA 4X1NU 1O3GA 1BHXB 1SHYA 2ZGXH 2C8WB 2FS9A 2ZNKH 1XXDA 1G3EA 1IHSH 2BLOA 2J94A 2O8UA 5FBEA 4AYVB 1YPLH 3AVZA 1O3OA 3TITA 2QIQA 2ULLA 3RXMA 1C4Y2 2TRMA 4MNYA 2ANMH 1YC0A 2Y6TA 2R9PA 3FZZA 2A0QB 4UD9H 2ZPQA 1DLEA 3UREA 2PKAA 2WPJS 2J95A 2CHAB 3SUGA 1W8BH 1O2PA 4VGCC 5GIBA 2TPIZ 4AB9A 1W11U 2BVSH 3ELAH 2LNCA 1A0HB 2UUKB 2R0LA 1C1NA 1SLWB 2JH0D 4RSPA 2QF0A 1BTWA 2BD8A 2XRCA 4UE7H 1UTPA 1PPGE 1OWEA 4CR5A 1IQLA 3RXLA 1O5GH 1QA7A 2BVRH 1Z71A 1TGBA 1P0SH 2CN0H 2ZP0H 3GYMA 2PGBB 5DKMA 1X7AC 2ZU5A 1LHCH 1O3IA 1QFKH 3BTDE 1QBOA 3PLKA 1C5ZB 4K8BA 4O97A 2H5DA 4Y8ZA 2P8OC 1KDQA 2IJOB 5C3NA 3GICB 3UPEA 4MNVA 2D8WA 2Q6DA 2BYAX 1L1NA 2VWNA 2BDCA 1P12E 2G4UA 2ZI2H 4LZ4B 1PPEE 3TLOA 5E0HA 3VXEH 1DY9A 1RJXB 1CT4E 3P6ZB 2R2WU 6CHAC 4CR9A 3NKKA 3BTGE 5BPEA 1O3PB 1W3CA 4ZROA 1MH0A 1MQ5A 1E0FD 3QDZB 3LJOA 3L6PA 2SNVA 4U32A 5DPAA 5JBBS 4AFUA 1YF4A 2ZF0H 4AZ2B 1W14U 1CHGA 4BTIB 1HYLA 1TMUH 1GVZA 1KLIH 4MPVA 2XCFA 3SQEE 9LPRA 1UTKA 2BB4A 3KQBA 1DM4B 2ANYA 1HAVA 1AGJA 3G01A 2BHGA 2FI3E 2CHAC 1O36A 3RXKA 5F8XA 4GAWA 4NIWA 1O35A 4AFQA 2PUXB 1V2QT 3I77A 3LGIA 1NRSH 1FY8E 2EI7A 2JETB 3U9AH 3VB6A 2Y5GA 2OQ5A 1S81A 1H4WA 1EASA 1Q3XA 4OS7A 4JK6A 1EAIA 3BG4B 3UUZA 1XUJA 1ELCA 1MKWK 2FOAA 2A5IA 3SGQE 1SSXA 1W0ZU 5ESBA 4YOIA 3E0NB 5E2OA 2PKSB 1UO6A 3RMOH 2K1QA 3T26A 3RDZA 1O5FH 4NFEA 4QT8C 2ZHFH 3VB4A 2BQWB 1YKTA 4Y0ZE 3OY5U 1ELAA 1RIWC 2GGVB 1CT0E 3BTHE 1EPTA 1JRSA 2FLBH 3STJA 1O3LA 4ABDA 1QRZA 1GI2A 1T32A 2IN2A 3MI4A 1XVMA 4AGKA 2F9OA 4ABFA 4E05H 2ZTYA 1Y5BT 1S6HA 5GCHG 1O0DH 2FWWA 2ZWLH 3FP8E 1G3BA 1TRMA 4FXGH 1A5GH 2O8MA 1O33A 1FN6A 1YYY1 1GJ4H 3KF2A 4NCYA 2BDIA 1P05A 3MTYA 1G9IE 4THNH 3SBKA 2AYWA 1P2JA 2VU8E 3QZQA 1SGRE 1O3FA 4BAOB 3A7WA 4YO9A 1ELTA 3SU5A 1TWXB 4BAQB 4CRDA 2JETC 1THRH 1HLTH 2UWLA 1ZHRA 4MPXA 2BOHB 5AF9H 2BDBA 3T28A 5E0GA 1G3CA 2C3SA 2XWAA 4CHAB 1FY3A 1VJ9U 2FX6A 1QJ1B 1F2SE 4YT6H 1DSUA 1GBJA 4Y11E 1DUAA 2XXLA 2NU1E 1KYNA 3BG8A 4FUCA 2PKSC 4Y8YA 1P09A 2J4IA 5JBAS 5J4SA 3NPSA 2A7JA 5EXLA 3RXUA 3T62A 2G5VA 1V2PT 1VCWA 1C9PA 1BTHH 2SGQE 2RA0A 1FN8A 1UTLM 3F68H 3RXTA 2YNAA 2ZFPH 2ZDAH 1Y3WA 2Y7ZA 2F9BH 3IWMA 1A0LA 3VEQB 1EB2A 2O9QA 3UQOA 3BTQE 2ZDMA 3S9AA 4E7RG 1TABE 1RTLA 1CSOE 2W7UA 2I6SA 1FDPA 1L1JA 2P95A 2ZFTA 4ZXYH 1B0FA 4ABHA 3MH4A 3GY8A 3RXCA 4I32A 2FM2A 3LIWA 4ZHAA 2P3FH 2BQ7B 1C2GA 1UK2A 1BMNH 1V2KT 1OWIA 2JH5D 4CRGA 3MNCA 3O8DA 3SI4H 1DDJA 1JRTA 4WWYA 2VIQA 2ZHWH 1O2TA 1TALA 4ZKNU 1ZHMA 3RU4D 4CHAC 3P8FA 1P9UA 4NZLA 3FZDA 2A32A 3Q3KA 2PKAB 3ZZ3A 3EGKH 4B2AA 1D9IA 2FYRA 4ZMAH 1O2SA 4TYDA 3LU9B 2BZAA 2ZFRH 1TMTH 1ZMNA 4ISIH 4WVPE 4K2YA 2Y5HA 5DO4H 1IAUA 1NU9A 1O3DA 1UCYK 4KKDA 3RXVA 5CMXH 1LKBA 1O5AB 1A5HA 1O30A 1UVPA 3LGVA 4GHQA 3QN7A 4Y0YE 5K7RA 2GCTB 4MLFB 4NIYA 4Q7XA 1ZTJA 1KDQB 5GWZA 4KTCA 3RXBA 1O3HA 3ODDA 1TGSZ 1QL7A 3RXJA 2BVXH 4GUXA 3RM0H 2O8WA 4U2WA 4H42U 4FU8A 1DWDH 4ISNA 1DWEH 1KXBA 4YLQH 3V12A 3K2UA 1TMBH 5DG6A 2WUCA 1J16A 1W2KH 1ZTKA 2FOCA 4IC6A 1NRQH 2P16A 1TGCA 3E3TA 1C4U2 4X2YA 3M7TA 1GDUA 1ZYOA 1GHYH 4MNXA 1F0UA 1LMWB 1ZSJA 3RMNH 1Y3UA 2ZPSA 3SV9A 1SI5H 4K5ZA 3BEFB 1S0QA 1ORFA 1NN6A 2RCEA 1TAWA 3QGJA 4IBLH 5DK1A 3RU4E 2QY0B 4GVUA 1C4V2 1HAVB 5EODA 2BY8X 1C2MA 4NIXA 3ZVFA 4FUJA 1ZMJA 1WQSA 1O37A 1WTHD 2FESH 2XC5A 1GBHA 2W26A 4HGCA 1YGCH 2PV9B 1GJCB 2PR3A 1VGCB 3BF6H 1GWAA 2AFQB 3ATIA 3ESTA 3QUMP 4JZFH 4OS2A 1O2WA 1MMJN 3EA8A 3TH4H 1SG8B 1PYTC 3KN2A 2BM2A 2Y81A 5C5NA 1ZSKA 1UTQA 1NRPH 3A7TA 5FCKA 3A80A 3A8BA 2GCTC 2C8ZB 4NSVA 1ABJH 3U8OH 4TPIZ 1C1VH 1LHEH 1MKXK 2AERH 1GHBG 3LKWA 1ZPZA 3RXRA 1OWHA 1OSSA 1LQEA 3E0PB 5G4BA 4ZUHA 2OC0A 1K1JA 3MU0A 5F8TA 1QL8A 1WYKA 4FU7A 4MVNA 3GY3A 1C2JA 3U1JB 3PLPA 2ZKSA 2GKVE 1DWCH 2BDAA 2A7HA 1EAWA 1GBAA 2ZZUH 4DW2U 8GCHF 4Y71A 3UR9A 2H2ZA 1DFPA 1IQFA 1EPTB 1P2IA 1WUNH 1T8MA 2H9TH 2ZQ2A 2DUCA 1GBCA 3UOPA 1E34B 3EAJA 1BMLA 1WQVH 2A4QA 4NA7A 1HAXB 5GCHF 1K9OE 1VCPA 4ABIA 1H1BA 3RLWH 1FUJA 5LH8A 1WU1A 2ESTE 3SV7A 3ZYEA 4DGJA 2QXHA 2FPZA 1IQKA 5EQSA 1CGIE 1O2IA 5CHAB 5HXFA 2DE8A 3C27B 5EXMA 2VINA 3GCHB 1ESTA 1SGIB 1RS0A 2G51A 2QV1A 1C2EA 3SHAH 4KTSA 1T4VH 1P57B 4OGXA 1FV9A 1C5QA 1F7ZA 2G81E 3A81A 1GHVH 1NC6A 5SGAE 1UK3A 1V2VT 2OBOA 2GTBA 3KCGH 2BD4A 1C5SA 1BBRE 2ALPA 2FOGA 1CGJE 1TX7A 1O3AA 4GPGA 3AAUA 1EB1H 1K22H 4HFPB 1GVKB 1O2JA 1UVSH 5E0JA 1KLJH 1HRTH 4A5TS 1L2EA 2P3UB 2P94A 3TK9A 1OWJA 1BZXE 2HALA 1QRXA 4XBDA 1JIMA 2QAAA 1IQIA 2STBE 5C1XA 5L2ZH 3T5FH 1ZZZA 2FXRA 1UTJA 4IW4E 1K1OA 1TGTA 4D7FA 1T31A 1XUFA 3BTTE 3EQ0H 1CVWH 1RRKA 3O8BA 3SV2H 4A7IB 3W94A 3VB3A 1WOFA 2OCVB 1TA2A 1IQGA 1C5NH 1GBMA 5ESTE 1VCQA 1VZQH 1GI6A 2J38A 3RM2H 2A2QH 1BMMH 2Y5FA 2G8TA 1K2I1 5A09A 4INKA 1HJAB 5DP9A 5CHAC 2G4TA 5ABWA 9ESTA 3A87A 1O34A 1SBWA 4I33A 1TX6A 2P93A 1XKBC 1SGFG 1ZPCA 5T3HA 4D9QA 3GY7A 1QB9A 1BITA 3RMLH 2QN5T 2QXIA 1ANBA 1ELBA 3P95A 3H5CB 3T25A 1NPMA 1Y3VA 3EA9A 3NZIA 5LPRA 1P8VC 4FU9A 2AGGX 2R3YA 4CBOA 3K9XB 3UOUA 1EZUC 1AY6H 1SGQE 1GHAG 3TPIZ 3E1XB 1TE0A 5IYTA 1MBMA 1D6RA 2WPHS 1V2TT 3BSQA 1W7XH 3NCLA 4TY7A 2EEKA 1J9CH 1ZJDA 3UNRA 1LHGH 4WMEA 2XBVA 3QLPH 1SGTA 1EZQA 1JMOH 1MU8B 2VH0A 3BEUA 3DUXH 1P2OA 4RKJB 4ZHMU 4B76A 4H6TA 1GJ5H 3URDA 2P3TB 5C2ZA 1TNLA 1HAZB 3QZRA 3RXOA 1BT7A 3TU7H 4CRBA 1JOUB 3D65E 3LGUA 4R0IA 1C2HA 2CF9H 2GV6A 2XYAA 4NA8A 4AGJA 1G2LA 2QC2A 3HK3B 2FZZA 1LPKB 1DE7H 1V3XA 5DGJA 3KHVA 4JYVH 2STAE 1GCDA 3DFLA 3AW0A 3KNXA 3F9EA 1BHXF 4I8KA 3RP2A 1QQUA 1UK4A 4MPWA 4K8YA 3TGIE 2OQUA 3S7HB 1O2ZA 4TWYA 2VIVA 2NU2E 1Z8RA 1QQ4A 2HNTC 7GCHF 2QCYA 3TK6A 2HGTH 1V2WT 2GZ8A 1BBRH 1MKXH 1TRNA 1WAYB 1XXFA 2GT8A 2BOKA 4F4OC 2W7SA 1GBTA 4Y79A 4WJG2 1LVMA 1SGEE 3M35A 2FO9A 1EX3A 5T6DA 3TJNA 2Y82A 1DY8A 1W12U 1PYTD 1G2MA 3AASA 4B71A 5C1YA 3D23A 1MCTA 2B9LA 1GHBF 2G55A 1NRRH 1ELDE 3R3GB 2ASUB 4XDEA 3A85A 3SV6A 4DOQA 3QTVH 1C2DA 2TGAA 1QURH 2Z9JA 4AG1A 4X8VH 1J14A 1QL9A 2ZU1A 3PMJA 1J15A 1HIAA 4YZUA 5EQRA 5PTPA 1FMGA 3SJOA 3K65B 3U8TH 1O3CA 4IGDA 5JBTA 1DT2A 1MD7A 2VIDA 1YPEH 1AFQB 2WPLS 2ZHQH 4JMYA 1TFXA 1Z1IA 2H5CA 3MH5A 1GBIA 2ZC9H 3HKJB 1RIWB 1GJ9B 3E8LA 2GCHF 1AWFH 3ATKA 1GJ7B 2TIOA 2PGQB 3M5LA 1LTOA 1NY22 4Q80A 3UNQA 1JIRA 1GMCF 2ZHEH 5DP6A 1V2UT 4X2VA 3PWBA 1AB9B 1O2NA 3SU0A 1P9SA 1B0EA 4ZH8A 4B2BA 2BQ6B 5GDSH 1QB1A 3ENSB 1FI8A 2OTVA 1HXFH 1ANDA 1GVLA 2OC7A 4AG2A 4B75A 1AKSA 2VGCB 1W0YH 2F91A 3VB5A 1HAOH 1T8OA 3MU5A 2J34A 5GXPA 1HV7A 2AS9A 1ZLRA 3BTFE 1AHTH 2ILNA 1AVXA 1PPBH 1SPJA 3A88A 4E06H 5HM9A 1Z1JA 3ZZ8A 2VIOA 3UIRA 3OYPA 2V0BA 1TQ0B 1EJNA 1SGYE 3BN9A 3LJJA 3SUEA 1LPGB 1AFQC 1BB0B 8GCHG 1AUJA 1O3BA 1NRNH 4DG4A 4AX9H 2C8XB 2FLRH 3P8NA 3PMBB 2Z3EA 1KXDA 1ABIH 1YM0A 1GI9B 3FP6E 4OS4A 2JH6D 1Z8JB 3LGTA 1HAGE 3S0NA 1JXPA 1AB9C 3ZZ5A 1Z8IB 3P8OA 1YP9A 1Q2WA 1PPZA 5GJ4B 1MTVA 3A89A 4Q2KA 1C1MA 2BY7X 3A8CA 1G37A 2FTLE 3CP7A 2CXVA 1K1IA 1LO6A 1V2OT 2FOFA 5EQQA 3BV9B 2NWNA 2C93B 2J92A 4IN2A 5A0AE 1SGDE 1QNJA 3TNSA 2ZFQH 2VGCC 2XCNA 3LGWA 4I8LA 5AHGH 1C1OA 2W3IA 1QTFA 3Q3YA 3QWCH 1ZTLA 1SVPA 3A82A 2F9UA 4ISOA 4YTAA 3BTWE 1DVAH 3M5OA 3Q3XA 4HI3A 1THSH 3A7YA 5JBCS 4CREA 2H9HA 1CBWB 1GHAF 2VNTA 4IMQA 1HAYB 2BXTH 5DP5A 4Z0KA 3A8AA 2VJ1A 1S5SA 3DA9B 3TK5A 3V0XA 1P2NA 1O2MA 1L1GA 3GCNA 1GJAB 2Z7FE 2GV7A 1XUIA 2Z9IA 2XBXA 4H4FA 3LH1A 3F6UH 1HBTH 1OWKA 1ZRKA 5HM2A 1O2XA 3ATWA 1YCPK 5EW1H 1DANH 3FVFB 1KIGH 1O31A 5TCCA 8LPRA 1ZJKA 3C1KA 3W95A 3PYHA 2OC8A 1AMHA 2XW9A 2R0KA 3RXPA 2YOLA 1K21H 2F83A 4FUHA 3UNSA 4NZQA 1BDAA 3VGCC 4OS5A 2KAIA 4WMFA 2BXUH 1BA8B 3BIUH 1BTXA 4JYTA 3RXQA 5DP3A 3SNCA 2FEQH 2O8LA 3FANA 1B7XB 3MNSA 5EXNA 4A6LA 1GHXH 5JDUB 2D1JA 2B8OH 4BAHB 2HOBA 2ZFSA 2OD3B 2PSXA 1H9LB 4NGAH 3MH6A 2PTCE 4WH6A 1NM6A 1CBWC 3ZZBA 1XUGA 1GL0E 1HFDA 3ZV8A 1F0SA 3PM3A 1C1WH 3QGNB 2XC0A 3STIA 1AZ8A 3I29A 1GHZA 4I7YH 1ZSLA 5EW2H 2M5TA 1O2HA 1EQ9A 1RTKA 3NWUA 1T8LA 1O2OA 1P02A 2A7CA 2TBSA 2A1DB 2BLVA 1BTYA 4NA9H 3MFJA 4I8GA 2ZDLA 1EZXC 1C1UH 5FX6A 1EAXA 3SJ8A 2QXGA 4YT7H 1GI3A 1UHBA 1AZZA 1O32A 2A4RA 2ZECA 2GX4A 3PMAB 3SV8A 5C20A 3ZYDA 1BRUP 1DLKB 1N1LA 2Y80A 1INCA 3U98H 1HIAB 6ESTA 4MNWA 1HJ9A 4IS5A 1GJ6A 2ZG0H 1P04A 1BTUA 1UVOA 3M3TA 1MTUA 1P10A 1DPOA 1S0RA 3UFAA 3SU6A 4I8HA 3NUMA 5A0BA 3EDXB 3MU4A 2XBWA 4DVAU 3K6ZA 4SGBE 4H6SB 5FPTA 3A7XA 3LDXH 2CV3A 2W3KA 6LPRA 1SGCA 1D3QB 1N8OB 1TPOA 4TWWA 1ETRH 3GY6A 2BTCE 4BXWA 3SOSA 3E90B 2HNTE 1GI4A 1WTGH 1TLDA 2FOEA 1BIOA 7GCHG
chains in the Genus database with same CATH superfamily
1AD8H 3R0FA 3MOCA 1WDIA 1YPJH 1MKWH 2NU0E 3M7QA 4X0WU 3S69A 2HWLB 3U28C 3KYFA 5ETXA 1BQYA 4Q7YA 3RC5A 2Y7XA 4ZKSU 1SQTA 2VH6A 3LPRA 1ETTH 1EAUA 4K3JA 3RU4T 5AFYH 1AKSB 7KMEH 1UCYE 3L33A 1GI5A 1PPHE 2JJ2D 1P06A 1TOMH 2ZQ1A 3KEEA 1C2LA 1TIOA 1V2NT 5E2PA 5JB8S 3RXDA 1O5CB 3FKSD 4ABGA 4RN6A 3H7TA 3MWIU 1OXGA 4KP0A 3SQHE 2AHME 3CS0A 3EYDA 2XWBI 5IDKA 2F43B 5JB9S 1C1QA 1OOKB 1NFYA 3JZ1B 4K1SA 1P2KA 2IOTA 2LPRA 1VITG 1XX9A 4NWLA 1A1RA 3U8RH 1CHOF 2TGDA 3QK1A 3U69H 2CGAA 1AIXH 1A3EH 1N8OC 3BEIB 1A61H 1BCUH 2GD4B 3GYLB 4YM9A 1FONA 4BXSA 3F9HA 3VB7A 4IN1A 2PW8H 1HB0B 2GCHG 2ANWA 2V6NA 1SB1H 3PROA 1C5TA 4AYYB 4O3TA 1QRWA 3ZVGA 4X8UH 2F9VA 1GMCG 1HGTH 2CMYA 1IOEA 1XKAC 1C5UA 2BY9X 2ZDVH 5T6FA 1Y3YA 3BTEE 3MH7A 1K1MA 1U6QA 7ESTE 3KQEA 4X1PU 4FUEA 4MQAA 1FPHH 2RDLA 1COWD 4X2WA 2A2XH 3PWCA 1F5RA 3BIVH 3SJIA 1YCPH 4JZDH 4NFFA 2ZCKP 4Z1MD 3OEHD 1AU8A 3KIDU 2FOMB 4GSOA 2ZCHP 1ELGA 3T29A 3SGBE 1YWUA 1YY3A 1OYQA 1HXEH 1LDTT 1NTPA 1LHFH 1O5EH 1TGNA 1UVTH 3D62A 3M5MA 1Y8TA 5JYIA 3A86A 4WH8A 2XOKD 3Q76A 2OK5A 2BMGB 1EKBB 1HCGA 3UWJH 1H9IE 2WYGA 3TGJE 3IG6B 4ABBA 1HAPH 3MMGA 1THPB 4ISHH 1XUHA 1KXAA 2BX4A 4Y7BA 3SJKA 1GI0A 1HAIH 1C5RA 1FX0B 3P92A 2ZFFH 1A2CH 1A4WH 4BAKB 1GG6B 4DJZB 2AMQA 1P2MA 1NU7B 1FAKH 2KAIB 1H8DH 5K0HA 3N7OA 2AGEX 2ZIQH 2Q6GA 2Z9KA 4MDSA 3MU8A 3RXGA 2IJD1 1O5DH 4CRCA 1QHRB 2OINA 1GBKA 2EI8A 3DCLA 3PRBA 1DITH 2OUAA 1ZGIA 4SGAE 4XFQA 2ZGHA 1Y5AT 1UCYH 1IQHA 1G3DA 1TYNA 2XTTB 1MQ6A 3RXIA 5HYOA 5FAHA 3CENA 1ANEA 1C2FA 2HNTF 1RFNA 3A7ZA 1FLEE 2B7DH 2WINI 3GCTG 4PROA 1C5LH 1J17T 4JYUH 1C5PA 2OC1A 4CRFA 1LKAA 4K1EA 4YOGA 1OX1A 2CF8H 3GY4A 3RUOA 2THFB 4A92A 1AVGH 1A5IA 1SC8U 4ABEA 3WY8A 2B0FA 1N6XA 4CH2B 3GOVB 8ESTE 1J8AA 2NU4E 1GCTB 1Z8GA 3OX7U 2CJIA 1O2KA 4A1VA 3DFJA 3DSOA 1B5GH 1F92A 2VWLA 1F5KU 1E35B 1SFIA 1UHBB 3TH3H 1BRCE 1TNKA 4JCNA 1K28D 1FQ3A 2D2DA 3RLYH 2EQNA 5EG4A 4BANB 3SU2A 1ACBE 1DWBH 1SFQB 1GG6C 1LVBA 4AOQA 1RXPA 2A5AA 4JZEH 3ZVAA 3M3SA 5L2YH 2SGDE 1CO7E 1XM1A 2FMJA 1SGPE 1GBBA 1GBEA 1SLUB 1PPFE 1IQJA 1SOTA 4A1XA 1SQOA 3SNBA 1EFRD 1ZOMA 2F3CE 1TNGA 4ABAA 1EP6A 1V2MT 1YPMH 1YBWA 2A45B 2XNDD 1N6YA 4F48B 2QYIA 1ZR0A 1ID5H 2KCYA 2ZGJA 4CH8B 3UQVA 5A2MH 5L30H 3SW2B 2V3HH 3H7OA 1ELVA 1G30B 2K8IA 2FP7B 5FPSA 1PFXC 4CRAA 2A5KA 1LCYA 1CA0C 1AUTC 1C1RA 1EOLA 1YPHE 1VKYA 3TVJB 4I31A 3SUFA 1V2ST 1AE8H 2BD3A 4X1QU 5F03A 2GP9B 3SNEA 1GCTC 1O3EA 4OS1A 3SU3A 1MCVA 2QGRA 2ZU2A 3UTUH 1BRAA 4ASHA 4OM9A 1FY4A 2A4GA 3SN8A 4D76A 4DCDA 1VITH 1FY5A 1TPSA 2OLGA 3K6YA 1W0JD 3RXEA 2WSSD 4TT3D 2C4FH 2GDDA 3B9FH 3RMMH 2GJGA 2WPIS 1SMFE 1C5OH 2GT7A 3EE0B 2BDYA 1K1LA 5C17A 3IITA 1TQ7B 1GJDB 2ZA5A 2ODQA 4X6PA 2PUQH 3ZIAD 1H8IH 1P3EA 1BUIA 1TX8A 2ZU4A 2PLXA 1VITF 1HUTH 4XRNA 1FY1A 2C8YB 2ZTXA 1MUEB 1QB6A 1TA6A 2GMTB 5GPIB 5C5OA 2IPHA 1LQDB 5DP4A 1D3PB 2PWXA 1CQQA 3SZNA 1BOQA 2FYQA 1V6DA 1MTNC 1IQEA 4FUGA 3MO3A 3QO6A 1SHHB 2V7QD 2G5NA 5CE1A 1MTWA 1H8HD 2R2MB 1GJ8B 3OTJE 5LPFA 2AIQA 3O8CA 1TOCB 2DE9A 1KXCA 2FOBA 3PLBA 3MHWU 3URCA 1E79D 1CA8B 4O3UA 2BD2A 3ZZCA 1ELEE 3TJUA 1HNEE 2IPQX 1O39A 1AWHB 1O5BB 5BRRE 2SNWA 2Z3DA 3HK6B 3A7VA 1O2VA 1XUKA 3QX5H 5LPEA 1KLTA 3QTOH 3ZZDA 3A8DA 3MU1A 1EP5A 1SR5C 1OYTH 2ZGBH 4UDWH 5DJ7A 5EPYA 1QCPA 6GCHG 3V3MA 2G00A 2H6MA 1OKXA 4O03A 1D3TB 2UWPA 1V2LT 3PV4A 2V35A 3SNDA 1T8NA 1P01A 1NFUA 4ZHLU 5FPYA 4X6MA 1AVWA 1FZZA 1O2LA 1GMDG 3OU0A 2EA3A 1ANCA 2GMTC 2Z9GA 1GGDB 1OWDA 1RGQA 3PB1E 2SGAA 1CHOG 2P59A 2YNBA 1QY6A 4X6NA 1BJUA 2WPKS 1O2YA 1EATA 1O38A 2ODYB 3UWIA 4MPUA 4BNRA 1QGFA 1ZGVA 1OP0A 1DX5M 3V13A 4CBNA 1C5XB 1E38B 1GMHF 2QF5A 3SI3H 1PPCE 4MG3A 1NS3A 3VGCB 7LPRA 1DICA 5KEDA 1FAXA 3PTBA 1EXFA 1DXWA 1PQ7A 2LP6A 3KQCA 1MTSA 1PQ8A 3LOXA 4BTTB 1GI8B 2XC4A 3ZZAA 1AN1E 4DIHH 2HVXA 2VWOA 1ESBA 3GCTF 1TNIA 2F4LA 2FS8A 4XBBA 4UONA 3DHKH 4U30A 4JK5A 2A4OA 2KZ4A 2ZCLP 4ZKRU 2RDEA 1WV7H 3S9CA 1KXFA 2BD5A 3Q00A 3B23B 3M36A 1JWTA 5FCRA 1H9HE 1P2QA 4LOYH 1AE5A 3CS7A 1Z6JH 2ZO3H 3FAOA 2SGFE 3E91A 2D26C 2BY5X 3RXHA 3LGYA 1OP8A 1FPCH 4DIIH 3ATMA 1MD8A 1K1NA 2F9PA 2TGPZ 4RKOB 3EA7A 5J4QA 1Y3XA 4AC9A 2AMDA 3BG4C 1KSNA 3KL6A 4GHTA 4WMDA 1YLDA 1BTZA 3RC4A 1EJMA 2HRVA 1GBDA 1GGDC 1UTOA 3NXPA 1DSTA 1S84A 3SHCH 1YPKH 2Q1JA 3JZ2B 1CE5A 1GBFA 3GY2A 1KMHB 2EC9H 3PO1B 2GZ9A 3P8GA 4UFGH 1YCPM 3MQKC 2XBYA 2BDGA 1MZDA 1UTMA 4JZ1A 4X2XA 5DSFA 4Y6DA 1EZSC 2V3OH 2FX4A 1KTSB 1SLVB 2GDEH 1TRYA 3O8RA 4E7NA 1Z7KA 3ZVEA 1D4PB 1S6FA 1XMNB 3ZVBA 4J1YA 1IHTH 2ZU3A 1ZRBA 2WZQA 4P00A 4UFFH 4RI0A 1MBQA 5TJXA 4A1TA 5FHTA 1O3NA 2OBQA 3E6PH 4XOJA 2WV4A 1O3JA 2EI6A 1F5LA 1GBLA 4IMZA 5CDFE 1Y5UT 1CT2E 3AAVA 1TBQH 3HATH 1ARCA 4X1RU 4LK4A 4DT4A 3OY6U 2FIRH 4HTCH 1MZAA 1A7SA 3D49H 1GJBB 2Z3CA 3RXSA 1F0TA 1C2IA 4INLA 3GDUA 4D8NA 2BD9A 1RTFB 2FTMA 3AW1A 4B2CA 2W5EA 1YPHC 4NSYA 5A8XA 1BRBE 1A46H 3I78A 4DURA 1TNHA 1GHWH 1QBNA 2WPMS 3VFEA 3ITIA 3FP7E 1SLXB 2AEIH 1ARBA 3E16B 2FDAA 2NU3E 2UWOA 1TBRH 1PQAA 4FETA 4AORA 2UUFB 4HZHA 3F9FA 5B6LA 1IQNA 3U1IB 1E1RD 4YESB 3PO1C 2HPPH 1NROH 1OS8A 3SUDA 1ETSH 5H4IB 1K0HA 3RXAA 1ELFA 1G32B 1LHDH 2VIWA 2XNIA 4NWKA 3DSPA 2J9NA 2Z9LA 5EU8A 1C1TA 5I25A 1TB6H 1TPPA 2C90B 2ZDKA 1K1PA 3PMHB 2PHBA 1OP2A 2FOHA 5A0CA 5HGGA 1C5YB 4GCHG 1P3CA 2KR7A 1GPZA 1KXEA 2OXSA 4TSFD 4U01A 1TPAE 4BAMB 1NFXA 2QXJA 4Y10E 1VJAU 4F55A 2VVVA 4LZ1H 4R8TB 4TY6A 3SORA 2JKHA 5I46H 2UUYA 5C1UA 1EUFA 3ZZ6A 4ZKOU 2HLCA 4ZXXH 2WYJA 3DT0H 3MNBA 4ISLA 2ZPRA 2I6QA 2F9NA 3LONA 3Q77A 3S7KB 4TPYA 1LVOA 5C0TA 1W7GH 1QA0A 2AH4X 5AVDA 4FUIA 5F8ZA 1CGHA 1YPGH 3PTNA 3ODFA 4X8TH 1C5VA 1NBMD 2WV5A 4X8SH 1HDTH 3F2FA 1C2KA 3M37A 3MO9A 2R3UA 2Z94A 1DXPA 4Y8XA 1DUEA 2ZHDA 4INHA 1BTPA 1NESE 2QA9E 1TONA 1QJ7B 2UUJB 5FXLA 1C1SA 1O2RA 3ZVCA 3TIUA 1BJVA 1SOZA 5L6NH 1GI1A 1WBGB 1BMFD 4XBCA 2B5TB 2BLQA 3M3VA 3S9BA 6GCHF 1GL1A 4JZIA 1T4UH 1FNIA 1QBVH 2H1UA 4RT0A 1O2GH 1Q31A 4WF8A 2FODA 3NK8A 2BDHA 3MYWA 2YMSB 1GDQA 1YLCA 4DY7B 2QF3A 5F6MA 5DP7A 4DT7B 1BBRK 1GMDF 1UVUH 3RXFA 4K60A 5GNDA 1PJPA 3P70B 3ZZ4A 3TJVA 4AFSA 1AI8H 3GDVA 4B6EA 4UFDH 4M7GA 1A0JA 1V2RT 2VVCA 3FFGA 1BMAA 5AFZH 1W10U 1ESAA 2GVFA 3GY5A 2KCOA 3SO3A 1EOJA 3LT3A 1WCZA 4FUDA 1ZPBA 3HPTB 1UJ1A 4KGAA 4K69A 5B6OA 1NBME 2ZEBA 2J98A 3L3TA 4B73A 3ZZ9A 3ZV9A 4Q63A 3DD2H 1L4ZA 4Y7AA 4Y76A 5A8YA 1S83A 1KY9A 2ALVA 1F0RA 1NZQH 2ZTZA 1O2UA 2VIPA 5KGOA 1VGCC 2Q6FA 3HKIB 4WXVA 2ANKH 3GCOA 3KGPA 8KME2 3SJ9A 3TNTA 1SQAA 2Z6BD 2TGTA 4YXWD 2ZGCA 1GI7B 4WXIA 1FXYA 3SU4A 2YMSC 4FUFA 5LGOA 4UFEH 2RA3A 2BY6X 4FUBA 3LC5A 4X6OA 5A8ZA 3A83A 3F1SB 1L0ZA 2WUBA 3TH2H 1PQ5A 3UY9A 1FIWA 1IQMA 1E36B 1TNJA 2KX4A 2SGPE 2BD7A 1KTTB 1V2JT 4BOHA 2SFAA 3F9GA 2RG3A 2SGEE 5FX5A 1VR1H 4BTUB 3BTKE 3SYJA 4AN7A 1AO5A 2H9EH 2ZDNA 3ZVDA 1DOJA 4LXBH 1GMHG 1OPHB 1ZHPA 4X1SU 1AQ7A 3TJOA 3HGPA 1EPTC 2PSYA 2BX3A 3GDSA 4XSKU 5T6GA 4NIVA 3VXFH 2O8TA 1S85A 3ZZ7A 4NG9H 1C5MD 5TCAA 1C5WB 1M9UA 4Z6AH 1MAXA 1G36A 1Y59T 2G52A 4J2YB 1SL3A 4OS6A 3KQDA 1C9TA 1AFEH 1QJ6B 3HGNA 3W1EA 4YOJA 4ZAEA 1C1PA 5E8EH 1HPGA 3GISB 5JPMH 1NFWA 3UR6A 3NRLA 3GCHC 3LC3A 5C94A 1HAHH 1O3MA 2BZ6H 5EOKA 1SGFA 3OSYA 1O2QA 3A84A 1TBZH 2VVUA 3T2NA 1CA0B 1D6WA 1P11E 2VB0A 2OP9A 5EGMA 2HPQH 4GLYA 5DP8A 4OGYA 1NO9H 2FI4E 1E37B 1Z6EA 2PTNA 1FIZA 4XE4A 3KQ5A 3VPKA 3LH3A 5EPNA 4ESTE 3BTME 1QIXB 1T7CA 5T1VA 5HMAA 2FI5E 3PV5A 4B1TA 4K1TA 1S82A 4D7GA 3M61U 1O3KA 1SGNE 1NT1A 4YLUA 2BLWA 1GDNA 4FVDA 2PFEA 4Q7ZA 4KTUA 1MAYA 4VGCB 2EY4C 2A31A 2AGIX 2GZ7A 2VWMA 1UTNA 4AB8A 3P17H 1D3DB 1WSSH 3H09A 1FJSA 4IC5A 5C67A 1P03A 4MTBA 2AMPA 2J2UA 4GCHF 4O9VA 3TGKE 3SNAA 4KELA 1JBUH 3ATLA 1W13U 4ABJA 4AFZA 1HJ8A 3M5NA 1L4DA 4I8JA 4UEHH 1XVOA 1EJAA 3T27A 2P8OB 2ODPA 4HG6A 1UMAH 4B74A 4F49A 3V7TA 3SU1A 3SGAE 4WY3A 1A3BH 1LPZB 3RC6A 2AIPA 1HJAC 1RD3B 5FBIA 1MTNB 1LVYA 4ACAA 4D9RA 3MO6A 4FVBA 3MNXA 6CHAB 1DS2E 1MU6B 1ZMLA 3M7UA 1CU1A 1QR3E 3B8JA 4X1NU 1O3GA 1BHXB 1SHYA 2ZGXH 2C8WB 2FS9A 2ZNKH 1XXDA 1G3EA 1IHSH 2BLOA 2J94A 2O8UA 5FBEA 4AYVB 1YPLH 3AVZA 1O3OA 3TITA 2QIQA 2ULLA 3RXMA 1C4Y2 2TRMA 4MNYA 2ANMH 1YC0A 4P02A 2Y6TA 2R9PA 3FZZA 2A0QB 4UD9H 2ZPQA 1DLEA 3UREA 2PKAA 2WPJS 2J95A 2CHAB 2KFWA 1W8BH 3SUGA 1O2PA 4VGCC 5GIBA 2TPIZ 4AB9A 1W11U 2BVSH 3ELAH 2LNCA 1A0HB 2UUKB 2R0LA 1C1NA 1SLWB 2JH0D 4RSPA 3N99A 2QF0A 1BTWA 2BD8A 2XRCA 4UE7H 1UTPA 1PPGE 1OWEA 4CR5A 1IQLA 3RXLA 1O5GH 1QA7A 2BVRH 1Z71A 1TGBA 1P0SH 2CN0H 2ZP0H 3GYMA 2PGBB 5DKMA 1X7AC 2ZU5A 1LHCH 1O3IA 1QFKH 3BTDE 1QBOA 4XD7D 3PLKA 1C5ZB 4K8BA 4O97A 2H5DA 4Y8ZA 2P8OC 1KDQA 2IJOB 5C3NA 2CK3D 3GICB 3UPEA 4MNVA 2D8WA 2Q6DA 2BYAX 1L1NA 2VWNA 2JIZD 1H8ED 2BDCA 1P12E 2G4UA 2ZI2H 4LZ4B 1PPEE 3TLOA 5E0HA 3VXEH 1DY9A 1RJXB 1CT4E 3P6ZB 2R2WU 6CHAC 4CR9A 3NKKA 3BTGE 5BPEA 1O3PB 1W3CA 4ZROA 1MH0A 1MQ5A 1E0FD 3QDZB 2J98B 3WWFA 3LJOA 3L6PA 2SNVA 4U32A 5DPAA 5JBBS 4AFUA 1YF4A 2ZF0H 4AZ2B 1W14U 1CHGA 4BTIB 1HYLA 1TMUH 1GVZA 1KLIH 4MPVA 2WHXA 2XCFA 3SQEE 9LPRA 1UTKA 2BB4A 3KQBA 1DM4B 2ANYA 1HAVA 1AGJA 3G01A 2BHGA 2FI3E 2CHAC 1O36A 3RXKA 5F8XA 4GAWA 4NIWA 2WPDD 1O35A 4AFQA 2PUXB 5HIYA 1V2QT 3I77A 3LGIA 1NRSH 1FY8E 2EI7A 2JETB 3U9AH 3VB6A 2Y5GA 2OQ5A 2YMSD 1S81A 1H4WA 1EASA 1Q3XA 4OS7A 4JK6A 1EAIA 3BG4B 3UUZA 1XUJA 1ELCA 1MKWK 2FOAA 2A5IA 3SGQE 1SSXA 1W0ZU 5ESBA 4YOIA 3E0NB 5E2OA 2PKSB 1UO6A 3RMOH 2K1QA 1YLNA 3T26A 3RDZA 1O5FH 4NFEA 4QT8C 2ZHFH 3VB4A 2BQWB 1YKTA 4Y0ZE 3OY5U 1ELAA 5EJLA 1RIWC 2GGVB 4ASUD 1CT0E 3BTHE 1EPTA 1JRSA 2FLBH 3STJA 1O3LA 4ABDA 1QRZA 3OEED 1GI2A 1T32A 2IN2A 3MI4A 1XVMA 4AGKA 2F9OA 4ABFA 2QF4A 4E05H 2ZTYA 1Y5BT 1S6HA 5GCHG 1O0DH 2FWWA 2ZWLH 3FP8E 1G3BA 1TRMA 3FN8A 4FXGH 1A5GH 2JJ1D 5EJZA 2O8MA 3N7DA 1O33A 1FN6A 1YYY1 1GJ4H 3KF2A 4NCYA 2BDIA 1P05A 3MTYA 1G9IE 4THNH 3SBKA 2AYWA 1P2JA 2VU8E 3QZQA 1SGRE 1O3FA 4BAOB 3A7WA 3PRDA 4YO9A 1ELTA 3SU5A 1TWXB 4BAQB 4CRDA 2JETC 1THRH 1HLTH 2UWLA 1ZHRA 4MPXA 2BOHB 5AF9H 2BDBA 3T28A 5E0GA 3UB0A 1G3CA 2C3SA 2XWAA 4CHAB 1FY3A 1VJ9U 2FX6A 1QJ1B 1F2SE 4YT6H 1DSUA 1GBJA 4Y11E 1DUAA 2XXLA 2NU1E 1KYNA 3BG8A 4FUCA 2PKSC 4Y8YA 1P09A 2J4IA 5JBAS 5J4SA 3NPSA 2A7JA 5EXLA 3RXUA 3T62A 2G5VA 1V2PT 1VCWA 1C9PA 1BTHH 2SGQE 2RA0A 1FN8A 1UTLM 3F68H 3RXTA 2YNAA 2ZFPH 2ZDAH 1Y3WA 2Y7ZA 2F9BH 3IWMA 1A0LA 3VEQB 1EB2A 2O9QA 3UQOA 3BTQE 2ZDMA 3S9AA 4E7RG 4ZCNA 1TABE 1RTLA 1CSOE 2W7UA 2LELA 4Q4LA 2I6SA 1FDPA 1L1JA 2P95A 2ZFTA 4ZXYH 1B0FA 4ABHA 2J97A 3GY8A 3MH4A 3RXCA 1SKYE 4I32A 2FM2A 3LIWA 4ZHAA 2P3FH 2BQ7B 1C2GA 1UK2A 1BMNH 1V2KT 1OWIA 2JH5D 4CRGA 3MNCA 3O8DA 3SI4H 1DDJA 1JRTA 4WWYA 2VIQA 2ZHWH 1E1QD 1O2TA 1TALA 4ZKNU 1ZHMA 3RU4D 4CHAC 3P8FA 1P9UA 4NZLA 3FZDA 2A32A 1W0KD 3Q3KA 2PKAB 3ZZ3A 3EGKH 4B2AA 1D9IA 2FYRA 4ZMAH 1O2SA 4TYDA 3LU9B 2BZAA 2ZFRH 1TMTH 1ZMNA 2RFKC 4ISIH 4WVPE 4K2YA 2KCAA 2Y5HA 5DO4H 1IAUA 1NU9A 1O3DA 1UCYK 4KKDA 3RXVA 5CMXH 1LKBA 3WW7A 1O5AB 3WWBA 1A5HA 1O30A 1UVPA 3LGVA 4GHQA 3QN7A 4Y0YE 5K7RA 2GCTB 4MLFB 4NIYA 4Q7XA 1ZTJA 1KDQB 5GWZA 4KTCA 3RXBA 2K0QA 1O3HA 3ODDA 1TGSZ 1QL7A 3RXJA 2BVXH 4GUXA 3RM0H 2O8WA 4U2WA 4H42U 4FU8A 1DWDH 4ISNA 1DWEH 1KXBA 4YLQH 3V12A 3K2UA 1TMBH 5DG6A 2WUCA 1J16A 1W2KH 1ZTKA 2FOCA 4IC6A 1NRQH 2P16A 1TGCA 3E3TA 1C4U2 4X2YA 3M7TA 1GDUA 1ZYOA 1GHYH 4MNXA 1F0UA 1LMWB 1ZSJA 3RMNH 1Y3UA 2ZPSA 3SV9A 1SI5H 4K5ZA 3BEFB 1S0QA 1ORFA 1NN6A 2RCEA 1TAWA 3QGJA 4IBLH 5DK1A 3RU4E 2QY0B 3F2HA 4GVUA 1C4V2 1HAVB 5EODA 2BY8X 1C2MA 4NIXA 3ZVFA 3KYGA 1ZMJA 1WQSA 4FUJA 1O37A 1WTHD 2FESH 2XC5A 1GBHA 2W26A 4HGCA 1YGCH 2PV9B 1GJCB 2PR3A 1VGCB 3BF6H 1GWAA 2AFQB 3F3BA 3ATIA 3ESTA 3QUMP 4JZFH 4OS2A 1O2WA 1MMJN 3EA8A 3TH4H 1SG8B 1PYTC 3KN2A 2BM2A 2Y81A 5C5NA 1ZSKA 3OFND 1UTQA 1NRPH 3A7TA 5FCKA 3A80A 3A8BA 2GCTC 2C8ZB 4NSVA 1ABJH 3U8OH 4TPIZ 1C1VH 1LHEH 1MKXK 2AERH 1GHBG 3LKWA 1ZPZA 3RXRA 1OWHA 1OSSA 1LQEA 3E0PB 3F0PA 5G4BA 4ZUHA 2OC0A 1K1JA 3MU0A 5F8TA 1QL8A 1WYKA 4FU7A 4MVNA 3GY3A 1C2JA 3U1JB 3PLPA 2ZKSA 2GKVE 1DWCH 2BDAA 2A7HA 1WXRA 1EAWA 1GBAA 2ZZUH 4DW2U 8GCHF 4Y71A 3UR9A 2H2ZA 1DFPA 1IQFA 1EPTB 1P2IA 1WUNH 1T8MA 2H9TH 2ZQ2A 2DUCA 1GBCA 3UOPA 2HLDD 1E34B 3EAJA 1BMLA 1WQVH 2A4QA 4NA7A 1HAXB 5GCHF 1K9OE 1VCPA 3FOAA 4ABIA 1H1BA 3RLWH 1FUJA 5LH8A 1WU1A 2ESTE 3SV7A 3ZYEA 4DGJA 2QXHA 4FOUC 2FPZA 1IQKA 5EQSA 1CGIE 1O2IA 5CHAB 5HXFA 2DE8A 3C27B 5EXMA 2VINA 3GCHB 1ESTA 1SGIB 1RS0A 2G51A 2QV1A 1C2EA 3SHAH 4KTSA 1T4VH 1P57B 4OGXA 1FV9A 1C5QA 1F7ZA 2G81E 3A81A 1GHVH 1NC6A 5SGAE 1UK3A 1OHHD 1V2VT 2OBOA 2GTBA 3KCGH 2BD4A 1C5SA 1BBRE 2ALPA 2FOGA 1CGJE 1TX7A 1O3AA 4GPGA 3AAUA 1EB1H 1K22H 4HFPB 1GVKB 1O2JA 1UVSH 5E0JA 1KLJH 1HRTH 4A5TS 2JDID 1L2EA 2P3UB 2P94A 3TK9A 1OWJA 1BZXE 2HALA 5FL7D 1QRXA 4XBDA 1JIMA 2QAAA 1IQIA 2STBE 5C1XA 5L2ZH 3T5FH 1ZZZA 2FXRA 5DN6D 1UTJA 2VBCA 1K1OA 1TGTA 4IW4E 4D7FA 1T31A 1XUFA 3BTTE 3EQ0H 1CVWH 1RRKA 3O8BA 3SV2H 4A7IB 3F0OA 3W94A 3VB3A 1WOFA 2OCVB 1TA2A 1IQGA 1C5NH 1GBMA 5ESTE 1VCQA 1VZQH 1GI6A 2J38A 3RM2H 2A2QH 1BMMH 2Y5FA 2G8TA 1K2I1 4M9FA 5A09A 4INKA 1HJAB 5DP9A 5CHAC 2G4TA 5ABWA 9ESTA 3A87A 1O34A 1SBWA 4I33A 1TX6A 2P93A 1XKBC 3GS9A 1SGFG 1ZPCA 5T3HA 4D9QA 3GY7A 1QB9A 1BITA 3RMLH 2QN5T 2QXIA 1ANBA 1ELBA 3P95A 3H5CB 3T25A 1NPMA 1Y3VA 3EA9A 3NZIA 2L74A 5LPRA 1P8VC 4FU9A 2AGGX 5IK2D 2R3YA 4CBOA 2QE7D 3K9XB 5EIYA 3UOUA 1EZUC 1S6LA 1AY6H 1SGQE 1GHAG 3TPIZ 3E1XB 1TE0A 5IYTA 1MBMA 1D6RA 2WPHS 1V2TT 3BSQA 1W7XH 3NCLA 4TY7A 2EEKA 1J9CH 1ZJDA 3UNRA 1LHGH 4WMEA 2XBVA 3QLPH 1SGTA 1EZQA 1JMOH 1MU8B 2VH0A 3BEUA 3DUXH 1P2OA 4RKJB 4ZHMU 4B76A 2V3MA 4H6TA 1GJ5H 3URDA 2P3TB 5C2ZA 1TNLA 1HAZB 3QZRA 2KCPA 3RXOA 1BT7A 5EJ1A 3TU7H 4CRBA 1JOUB 3D65E 3LGUA 4R0IA 1C2HA 2CF9H 2GV6A 2XYAA 4NA8A 2HVYB 4AGJA 1G2LA 2QC2A 3HK3B 1QZ8A 2FZZA 2KM0A 1LPKB 1DE7H 1V3XA 5DGJA 3KHVA 4JYVH 2STAE 1GCDA 3DFLA 3AW0A 3KNXA 3F9EA 1BHXF 4I8KA 3RP2A 3OE7D 1QQUA 1UK4A 4MPWA 4K8YA 3TGIE 1UW7A 2OQUA 3S7HB 1O2ZA 4TWYA 2VIVA 3N7EA 2NU2E 1Z8RA 1QQ4A 2HNTC 7GCHF 2QCYA 3TK6A 2HGTH 1V2WT 2GZ8A 1BBRH 1MKXH 1TRNA 1WAYB 1XXFA 2GT8A 2BOKA 4F4OC 2W7SA 1GBTA 3FO8D 4Y79A 4WJG2 1LVMA 1SGEE 3M35A 2FO9A 1EX3A 5T6DA 3TJNA 2Y82A 1DY8A 1MABB 5HIZA 1W12U 1PYTD 1G2MA 3AASA 4B71A 3SZEA 5C1YA 3D23A 1MCTA 2B9LA 3AK5A 3CNRA 1GHBF 2G55A 1NRRH 1ELDE 3R3GB 2ASUB 4XDEA 3A85A 3SV6A 4DOQA 3QTVH 1C2DA 2TGAA 1QURH 2Z9JA 4AG1A 4X8VH 1J14A 1QL9A 2ZU1A 3PMJA 2W6JD 1J15A 1HIAA 4YZUA 5EQRA 5PTPA 1FMGA 3SJOA 3K65B 3U8TH 1O3CA 4IGDA 5JBTA 1DT2A 1MD7A 2VIDA 1YPEH 1AFQB 2WPLS 2ZHQH 4JMYA 1TFXA 4I86A 1Z1IA 2H5CA 3MH5A 1GBIA 2ZC9H 3HKJB 1RIWB 1GJ9B 3E8LA 3DSGA 2GCHF 1AWFH 3ATKA 1GJ7B 2TIOA 2PGQB 3M5LA 1LTOA 1NY22 4Q80A 3UNQA 1JIRA 1GMCF 2ZHEH 5DP6A 1V2UT 4X2VA 3PWBA 5C0UA 1AB9B 1O2NA 3SU0A 1P9SA 1B0EA 4ZH8A 4B2BA 2BQ6B 5GDSH 1QB1A 3ENSB 1FI8A 2OTVA 1HXFH 1ANDA 1GVLA 2OC7A 4AG2A 4B75A 1AKSA 2VGCB 1W0YH 3UAIC 2F91A 3VB5A 1HAOH 1T8OA 3MU5A 2J34A 5GXPA 1HV7A 2AS9A 1ZLRA 3BTFE 1AHTH 2ILNA 1AVXA 3PV2A 1PPBH 1SPJA 3A88A 4E06H 4ACBA 5HM9A 4B6FA 1Z1JA 3ZZ8A 2VIOA 3UIRA 3OYPA 2V0BA 1TQ0B 1EJNA 1SGYE 3BN9A 3LJJA 3SUEA 1LPGB 1AFQC 1BB0B 5KECA 8GCHG 1AUJA 1O3BA 1NRNH 4DG4A 4AX9H 2C8XB 2FLRH 3P8NA 3PMBB 2J5UA 2Z3EA 1KXDA 1ABIH 1YM0A 1GI9B 3FP6E 4OS4A 2JH6D 1Z8JB 3LGTA 1HAGE 3S0NA 1JXPA 5F53A 1AB9C 3ZZ5A 1Z8IB 3P8OA 1YP9A 1Q2WA 1PPZA 5GJ4B 1MTVA 3A89A 4Q2KA 1C1MA 2BY7X 3A8CA 1G37A 2FTLE 3CP7A 2CXVA 1K1IA 1LO6A 1V2OT 2FOFA 5EQQA 3BV9B 2NWNA 2C93B 2J92A 4IN2A 5A0AE 1SGDE 1QNJA 3TNSA 2ZFQH 2VGCC 2XCNA 3LGWA 4I8LA 5AHGH 1C1OA 2W3IA 1QTFA 3Q3YA 3QWCH 1ZTLA 1SVPA 3A82A 2F9UA 2PP6A 4ISOA 4YTAA 3OTPA 3BTWE 1DVAH 3M5OA 3Q3XA 4HI3A 1THSH 3A7YA 5JBCS 4CREA 2H9HA 1CBWB 1GHAF 2VNTA 4IMQA 1HAYB 2BXTH 5DP5A 4Z0KA 3A8AA 2VJ1A 1S5SA 3DA9B 3TK5A 3V0XA 1P2NA 1O2MA 1L1GA 3GCNA 1GJAB 2Z7FE 2GV7A 1XUIA 2Z9IA 2XBXA 4H4FA 3LH1A 3F6UH 1HBTH 1OWKA 1ZRKA 5HM2A 1O2XA 3OAAD 3ATWA 3F2GA 1YCPK 5EW1H 1DANH 3FVFB 1KIGH 1O31A 5TCCA 8LPRA 1ZJKA 5HKKD 3C1KA 3W95A 3PYHA 2OC8A 1AMHA 2XW9A 2R0KA 3EE7A 5CHBA 3RXPA 2YOLA 1K21H 2F83A 4FUHA 3UNSA 4NZQA 1BDAA 3VGCC 4OS5A 2KAIA 4WMFA 2BXUH 1BA8B 3BIUH 1BTXA 4JYTA 3RXQA 5DP3A 3SNCA 2FEQH 2O8LA 3FANA 1B7XB 3MNSA 5EXNA 4A6LA 1GHXH 5JDUB 2D1JA 2B8OH 4BAHB 2HOBA 2ZFSA 2OD3B 2PSXA 1H9LB 4NGAH 3MH6A 2PTCE 4WH6A 1NM6A 1CBWC 3ZZBA 1XUGA 1GL0E 1HFDA 3ZV8A 1F0SA 3PM3A 1C1WH 3QGNB 2XC0A 3STIA 1AZ8A 2W6ID 3I29A 1GHZA 4I7YH 1ZSLA 5EW2H 2M5TA 1O2HA 1EQ9A 1RTKA 2M2AA 3NWUA 1T8LA 1O2OA 1P02A 2A7CA 2TBSA 2A1DB 2BLVA 1BTYA 4NA9H 3MFJA 4I8GA 2WV9A 2ZDLA 1EZXC 1C1UH 5FX6A 1EAXA 3SJ8A 2QXGA 4YT7H 1GI3A 1UHBA 1AZZA 1O32A 2A4RA 2ZECA 2GX4A 4RT1A 3PMAB 3SV8A 5C20A 3ZYDA 1BRUP 1DLKB 1N1LA 2Y80A 1INCA 3U98H 1HIAB 6ESTA 4MNWA 1HJ9A 4IS5A 1GJ6A 2ZG0H 1P04A 1BTUA 1UVOA 3M3TA 1MTUA 1P10A 1DPOA 1S0RA 3UFAA 3SU6A 2L6OA 4I8HA 3NUMA 5A0BA 3VG8A 3EDXB 3MU4A 2XBWA 4DVAU 3K6ZA 4SGBE 4H6SB 5FPTA 3A7XA 3LDXH 2CV3A 2W3KA 6LPRA 1SGCA 1D3QB 1N8OB 1TPOA 4TWWA 1ETRH 3GY6A 2BTCE 4BXWA 3SOSA 3E90B 1SQRA 2HNTE 1GI4A 1WTGH 1TLDA 2FOEA 1BIOA 7GCHG
chains in the Genus database with same CATH topology
1AD8H 3R0FA 3MOCA 1YPJH 1MKWH 2NU0E 3M7QA 4X0WU 3S69A 2HWLB 5ETXA 1BQYA 4Q7YA 3RC5A 2Y7XA 4ZKSU 1SQTA 2VH6A 3LPRA 1ETTH 1EAUA 4K3JA 3RU4T 5AFYH 1AKSB 7KMEH 1UCYE 3L33A 1GI5A 1PPHE 1P06A 1TOMH 2ZQ1A 3KEEA 1C2LA 1TIOA 1V2NT 5E2PA 5JB8S 3RXDA 1O5CB 4ABGA 4RN6A 3H7TA 3MWIU 1OXGA 4KP0A 3SQHE 3CS0A 3EYDA 2XWBI 5IDKA 5JB9S 1C1QA 1OOKB 1NFYA 3JZ1B 4K1SA 1P2KA 2IOTA 2LPRA 1VITG 1XX9A 4NWLA 1A1RA 3U8RH 1CHOF 2TGDA 3QK1A 3U69H 2CGAA 1AIXH 1A3EH 1N8OC 3BEIB 1A61H 1BCUH 2GD4B 3GYLB 4YM9A 1FONA 4BXSA 3F9HA 3VB7A 4IN1A 2PW8H 1HB0B 2GCHG 2ANWA 2V6NA 1SB1H 3PROA 1C5TA 4AYYB 4O3TA 1QRWA 3ZVGA 4X8UH 2F9VA 1GMCG 1HGTH 2CMYA 1IOEA 1XKAC 1C5UA 2BY9X 2ZDVH 5T6FA 1Y3YA 3BTEE 3MH7A 1K1MA 1U6QA 7ESTE 3KQEA 4X1PU 4FUEA 4MQAA 1FPHH 2RDLA 4X2WA 2A2XH 3PWCA 1F5RA 3BIVH 3SJIA 1YCPH 4JZDH 4NFFA 2ZCKP 1AU8A 3KIDU 2FOMB 4GSOA 2ZCHP 1ELGA 3T29A 3SGBE 1OYQA 1HXEH 1LDTT 1NTPA 1LHFH 1O5EH 1TGNA 1UVTH 3D62A 3M5MA 1Y8TA 5JYIA 3A86A 4WH8A 3Q76A 2BMGB 1EKBB 1HCGA 3UWJH 1H9IE 2WYGA 3TGJE 3IG6B 4ABBA 1HAPH 3MMGA 1THPB 4ISHH 1XUHA 1KXAA 2BX4A 4Y7BA 3SJKA 1GI0A 1HAIH 1C5RA 3P92A 2ZFFH 1A2CH 1A4WH 4BAKB 1GG6B 4DJZB 2AMQA 1P2MA 1NU7B 1FAKH 2KAIB 1H8DH 5K0HA 3N7OA 2AGEX 2ZIQH 2Q6GA 2Z9KA 4MDSA 3MU8A 3RXGA 1O5DH 4CRCA 1QHRB 2OINA 1GBKA 2EI8A 1DITH 2OUAA 1ZGIA 4SGAE 4XFQA 2ZGHA 1Y5AT 1UCYH 1IQHA 1G3DA 1TYNA 2XTTB 1MQ6A 3RXIA 5HYOA 5FAHA 3CENA 1ANEA 1C2FA 2HNTF 1RFNA 3A7ZA 1FLEE 2B7DH 2WINI 3GCTG 4PROA 1C5LH 1J17T 4JYUH 1C5PA 2OC1A 4CRFA 1LKAA 4K1EA 4YOGA 1OX1A 2CF8H 3GY4A 3RUOA 2THFB 4A92A 1AVGH 1A5IA 1SC8U 4ABEA 3WY8A 2B0FA 1N6XA 4CH2B 3GOVB 8ESTE 1J8AA 2NU4E 1GCTB 1Z8GA 3OX7U 2CJIA 1O2KA 4A1VA 3DFJA 1B5GH 1F92A 2VWLA 1F5KU 1E35B 1SFIA 1UHBB 3TH3H 1BRCE 1TNKA 4JCNA 1K28D 1FQ3A 2D2DA 3RLYH 5EG4A 4BANB 3SU2A 1ACBE 1DWBH 1SFQB 1GG6C 1LVBA 4AOQA 1RXPA 2A5AA 4JZEH 3ZVAA 3M3SA 5L2YH 2SGDE 1CO7E 1XM1A 2FMJA 1SGPE 1GBBA 1GBEA 1SLUB 1PPFE 1IQJA 1SOTA 4A1XA 1SQOA 3SNBA 1ZOMA 2F3CE 1TNGA 4ABAA 1EP6A 1V2MT 1YPMH 1YBWA 2A45B 1N6YA 2QYIA 1ZR0A 1ID5H 2ZGJA 4CH8B 3UQVA 5A2MH 5L30H 3SW2B 2V3HH 3H7OA 1ELVA 1G30B 2FP7B 5FPSA 1PFXC 4CRAA 2A5KA 1LCYA 1CA0C 1AUTC 1C1RA 1EOLA 1YPHE 3TVJB 4I31A 3SUFA 1V2ST 1AE8H 2BD3A 4X1QU 5F03A 2GP9B 3SNEA 1GCTC 1O3EA 4OS1A 3SU3A 1MCVA 2QGRA 2ZU2A 3UTUH 1BRAA 4ASHA 1FY4A 2A4GA 3SN8A 4D76A 4DCDA 1VITH 1FY5A 1TPSA 2OLGA 3K6YA 3RXEA 2C4FH 2GDDA 3B9FH 3RMMH 2WPIS 1SMFE 1C5OH 2GT7A 3EE0B 2BDYA 1K1LA 3IITA 1TQ7B 1GJDB 2ZA5A 2ODQA 4X6PA 2PUQH 1H8IH 1P3EA 1BUIA 1TX8A 2ZU4A 2PLXA 1VITF 1HUTH 1FY1A 2C8YB 2ZTXA 1MUEB 1QB6A 1TA6A 2GMTB 5GPIB 5C5OA 2IPHA 1LQDB 5DP4A 1D3PB 2PWXA 1CQQA 3SZNA 1BOQA 2FYQA 1V6DA 1MTNC 1IQEA 4FUGA 3MO3A 3QO6A 1SHHB 2G5NA 5CE1A 1MTWA 2R2MB 1GJ8B 3OTJE 5LPFA 2AIQA 3O8CA 1TOCB 2DE9A 1KXCA 2FOBA 3PLBA 3MHWU 3URCA 1CA8B 4O3UA 2BD2A 3ZZCA 1ELEE 3TJUA 1HNEE 1O39A 1AWHB 1O5BB 5BRRE 2SNWA 2Z3DA 3HK6B 3A7VA 1O2VA 1XUKA 3QX5H 5LPEA 1KLTA 3QTOH 3ZZDA 3A8DA 3MU1A 1EP5A 1SR5C 1OYTH 2ZGBH 4UDWH 5DJ7A 5EPYA 1QCPA 6GCHG 3V3MA 2G00A 2H6MA 1OKXA 4O03A 1D3TB 2UWPA 1V2LT 3PV4A 2V35A 3SNDA 1T8NA 1P01A 1NFUA 4ZHLU 5FPYA 4X6MA 1AVWA 1FZZA 1O2LA 1GMDG 3OU0A 2EA3A 1ANCA 2GMTC 2Z9GA 1GGDB 1OWDA 1RGQA 3PB1E 2SGAA 1CHOG 2P59A 2YNBA 1QY6A 4X6NA 1BJUA 2WPKS 1O2YA 1EATA 1O38A 2ODYB 3UWIA 4MPUA 4BNRA 1QGFA 1ZGVA 1OP0A 1DX5M 3V13A 4CBNA 1C5XB 1E38B 1GMHF 3SI3H 1PPCE 4MG3A 1NS3A 3VGCB 7LPRA 1DICA 1FAXA 3PTBA 1EXFA 1DXWA 1PQ7A 3KQCA 1MTSA 1PQ8A 3LOXA 4BTTB 1GI8B 2XC4A 3ZZAA 1AN1E 4DIHH 2HVXA 2VWOA 1ESBA 3GCTF 1TNIA 2FS8A 4XBBA 4UONA 3DHKH 4U30A 4JK5A 2A4OA 2ZCLP 4ZKRU 1WV7H 3S9CA 1KXFA 2BD5A 3Q00A 3B23B 3M36A 1JWTA 5FCRA 1H9HE 1P2QA 4LOYH 1AE5A 3CS7A 1Z6JH 2ZO3H 3FAOA 2SGFE 3E91A 2D26C 2BY5X 3RXHA 3LGYA 1OP8A 1FPCH 4DIIH 3ATMA 1MD8A 1K1NA 2F9PA 2TGPZ 4RKOB 3EA7A 5J4QA 1Y3XA 2AMDA 3BG4C 1KSNA 3KL6A 4GHTA 4WMDA 1YLDA 1BTZA 3RC4A 1EJMA 2HRVA 1GBDA 1GGDC 1UTOA 3NXPA 1DSTA 1S84A 3SHCH 1YPKH 2Q1JA 3JZ2B 1CE5A 1GBFA 3GY2A 2EC9H 3PO1B 2GZ9A 3P8GA 4UFGH 1YCPM 2XBYA 2BDGA 1MZDA 1UTMA 4JZ1A 4X2XA 4Y6DA 1EZSC 2V3OH 2FX4A 1KTSB 1SLVB 2GDEH 1TRYA 3O8RA 4E7NA 1Z7KA 3ZVEA 1D4PB 1S6FA 1XMNB 3ZVBA 4J1YA 1IHTH 2ZU3A 1ZRBA 4UFFH 1MBQA 5TJXA 4A1TA 5FHTA 1O3NA 2OBQA 3E6PH 4XOJA 2WV4A 1O3JA 2EI6A 1F5LA 1GBLA 4IMZA 1Y5UT 1CT2E 3AAVA 1TBQH 3HATH 1ARCA 4X1RU 4LK4A 3OY6U 2FIRH 4HTCH 1MZAA 1A7SA 3D49H 1GJBB 2Z3CA 3RXSA 1F0TA 1C2IA 4INLA 3GDUA 4D8NA 2BD9A 1RTFB 2FTMA 3AW1A 4B2CA 2W5EA 1YPHC 4NSYA 5A8XA 1BRBE 1A46H 3I78A 4DURA 1TNHA 1GHWH 1QBNA 2WPMS 3VFEA 3ITIA 3FP7E 1SLXB 2AEIH 1ARBA 3E16B 2FDAA 2NU3E 2UWOA 1TBRH 1PQAA 4AORA 2UUFB 4HZHA 3F9FA 1IQNA 3U1IB 4YESB 3PO1C 2HPPH 1NROH 1OS8A 3SUDA 1ETSH 5H4IB 3RXAA 1ELFA 1G32B 1LHDH 2VIWA 2XNIA 4NWKA 5EU8A 2J9NA 2Z9LA 1C1TA 5I25A 1TB6H 1TPPA 2C90B 2ZDKA 1K1PA 3PMHB 2PHBA 1OP2A 2FOHA 5A0CA 5HGGA 1C5YB 4GCHG 1P3CA 1GPZA 1KXEA 2OXSA 4U01A 4BAMB 1TPAE 1NFXA 2QXJA 4Y10E 1VJAU 2VVVA 4LZ1H 4R8TB 4TY6A 3SORA 2JKHA 5I46H 2UUYA 5C1UA 1EUFA 3ZZ6A 4ZKOU 2HLCA 4ZXXH 2WYJA 3DT0H 3MNBA 4ISLA 2ZPRA 2I6QA 2F9NA 3LONA 3Q77A 3S7KB 4TPYA 1LVOA 1W7GH 1QA0A 2AH4X 5AVDA 4FUIA 5F8ZA 1CGHA 1YPGH 3PTNA 3ODFA 4X8TH 1C5VA 2WV5A 4X8SH 1HDTH 1C2KA 3M37A 3MO9A 2R3UA 2Z94A 1DXPA 4Y8XA 1DUEA 2ZHDA 4INHA 1BTPA 1NESE 2QA9E 1TONA 1QJ7B 2UUJB 5FXLA 1C1SA 1O2RA 3ZVCA 3TIUA 1BJVA 1SOZA 5L6NH 1GI1A 1WBGB 4XBCA 2B5TB 2BLQA 3M3VA 3S9BA 6GCHF 1GL1A 4JZIA 1T4UH 1FNIA 1QBVH 2H1UA 1O2GH 1Q31A 4WF8A 2FODA 3NK8A 2BDHA 3MYWA 1GDQA 1YLCA 4DY7B 2QF3A 5F6MA 5DP7A 4DT7B 1BBRK 1GMDF 1UVUH 3RXFA 4K60A 1PJPA 3P70B 3ZZ4A 3TJVA 4AFSA 1AI8H 3GDVA 4UFDH 4M7GA 1A0JA 1V2RT 2VVCA 3FFGA 1BMAA 5AFZH 1W10U 1ESAA 2GVFA 3GY5A 3SO3A 1EOJA 3LT3A 1WCZA 4FUDA 1ZPBA 3HPTB 1UJ1A 4KGAA 4K69A 5B6OA 2ZEBA 3L3TA 4B73A 3ZZ9A 3ZV9A 3DD2H 1L4ZA 4Y7AA 4Y76A 5A8YA 1S83A 1KY9A 2ALVA 1F0RA 1NZQH 2ZTZA 1O2UA 2VIPA 1VGCC 2Q6FA 3HKIB 4WXVA 2ANKH 3GCOA 3KGPA 8KME2 3SJ9A 3TNTA 1SQAA 2Z6BD 2TGTA 2ZGCA 1GI7B 4WXIA 1FXYA 3SU4A 4FUFA 5LGOA 4UFEH 2RA3A 2BY6X 4FUBA 3LC5A 4X6OA 5A8ZA 3A83A 3F1SB 1L0ZA 2WUBA 3TH2H 1PQ5A 3UY9A 1FIWA 1IQMA 1E36B 1TNJA 2SGPE 2BD7A 1KTTB 1V2JT 4BOHA 2SFAA 3F9GA 2RG3A 2SGEE 5FX5A 1VR1H 4BTUB 3BTKE 4AN7A 1AO5A 2H9EH 2ZDNA 3ZVDA 1DOJA 4LXBH 1GMHG 1OPHB 1ZHPA 4X1SU 1AQ7A 3TJOA 3HGPA 1EPTC 2PSYA 2BX3A 3GDSA 4XSKU 5T6GA 4NIVA 3VXFH 2O8TA 1S85A 3ZZ7A 4NG9H 1C5MD 5TCAA 1C5WB 1M9UA 4Z6AH 1MAXA 1G36A 1Y59T 2G52A 4J2YB 1SL3A 4OS6A 3KQDA 1C9TA 1AFEH 1QJ6B 3HGNA 4YOJA 4ZAEA 1C1PA 5E8EH 1HPGA 3GISB 5JPMH 1NFWA 3UR6A 3GCHC 3LC3A 1HAHH 1O3MA 2BZ6H 5EOKA 1SGFA 3OSYA 1O2QA 3A84A 1TBZH 2VVUA 3T2NA 1CA0B 1D6WA 1P11E 2VB0A 2OP9A 5EGMA 2HPQH 4GLYA 5DP8A 4OGYA 1NO9H 2FI4E 1E37B 1Z6EA 2PTNA 1FIZA 4XE4A 3VPKA 3LH3A 5EPNA 4ESTE 3BTME 1QIXB 1T7CA 5HMAA 2FI5E 4B1TA 4K1TA 1S82A 4D7GA 3M61U 1O3KA 1SGNE 1NT1A 4YLUA 2BLWA 1GDNA 4FVDA 2PFEA 4Q7ZA 4KTUA 1MAYA 4VGCB 2A31A 2AGIX 2GZ7A 2VWMA 1UTNA 4AB8A 3P17H 1D3DB 1WSSH 1FJSA 4IC5A 5C67A 1P03A 4MTBA 2AMPA 2J2UA 4GCHF 4O9VA 3TGKE 3SNAA 4KELA 1JBUH 3ATLA 1W13U 4ABJA 4AFZA 1HJ8A 3M5NA 1L4DA 4I8JA 4UEHH 1XVOA 1EJAA 3T27A 2P8OB 2ODPA 1UMAH 4B74A 4F49A 3V7TA 3SU1A 3SGAE 4WY3A 1A3BH 1LPZB 3RC6A 2AIPA 1HJAC 1RD3B 5FBIA 1MTNB 1LVYA 4D9RA 3MO6A 4FVBA 3MNXA 6CHAB 1DS2E 1MU6B 1ZMLA 3M7UA 1CU1A 1QR3E 3B8JA 4X1NU 1O3GA 1BHXB 1SHYA 2ZGXH 2C8WB 2FS9A 2ZNKH 1XXDA 1G3EA 1IHSH 2BLOA 2J94A 2O8UA 5FBEA 4AYVB 1YPLH 3AVZA 1O3OA 3TITA 2QIQA 2ULLA 3RXMA 1C4Y2 2TRMA 4MNYA 2ANMH 1YC0A 2Y6TA 2R9PA 3FZZA 2A0QB 4UD9H 2ZPQA 1DLEA 3UREA 2PKAA 2WPJS 2J95A 2CHAB 3SUGA 1W8BH 1O2PA 4VGCC 5GIBA 2TPIZ 4AB9A 1W11U 2BVSH 3ELAH 2LNCA 1A0HB 2UUKB 2R0LA 1C1NA 1SLWB 2JH0D 4RSPA 2QF0A 1BTWA 2BD8A 2XRCA 4UE7H 1UTPA 1PPGE 1OWEA 4CR5A 1IQLA 3RXLA 1O5GH 1QA7A 2BVRH 1Z71A 1TGBA 1P0SH 2CN0H 2ZP0H 3GYMA 2PGBB 5DKMA 1X7AC 2ZU5A 1LHCH 1O3IA 1QFKH 3BTDE 1QBOA 3PLKA 1C5ZB 4K8BA 4O97A 2H5DA 4Y8ZA 2P8OC 1KDQA 2IJOB 5C3NA 3GICB 3UPEA 4MNVA 2D8WA 2Q6DA 2BYAX 1L1NA 2VWNA 2BDCA 1P12E 2G4UA 2ZI2H 4LZ4B