1HNOA

Crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
263
structure length
248
Chain Sequence
NEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of delta(3)-delta(2)-enoyl-CoA isomerase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
molecule keywords D3,D2-ENOYL COA ISOMERASE ECI1
total genus 88
structure length 248
sequence length 263
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1hnoA00
1XO6A 4JCQA 1HNUA 2ZQQA 3H0UA 1WDMA 1ON3A 1PIXA 4HC8A 3TDCA 4QFEA 4IZBA 2F9IB 4QIJA 2VREA 5KDRA 3R9TA 5G1RA 4YLHA 2J5SA 1Q52A 3V5IA 2J5IA 5DUCA 4RYFA 3P85A 1EF9A 3ZWBA 2ZL3A 2Q35A 1NZYA 1XNVA 2VSSA 1ON9A 1Y7OA 2J5GD 5FUSA 1Q51A 3LKEA 3QMJA 5DKPA 3H0JA 1FC9A 5DUFA 2A7KA 4JYLA 3R6HA 3H81A 4K2NA 4L6WA 4EMLA 3V5EA 3TRRA 1K32A 2FW2A 3GKBA 3GF7A 3HP0A 4OMRA 2D3TA 4IZCA 1HZDA 3BPPA 3SLLA 3ISAA 3Q0JA 3T89A 3TVWA 5JBWA 3OT6A 2IEXA 3U9TB 3ZWCA 3R0OA 4JJTA 2W3PA 5MGBA 4ZDEA 4GM2A 3M6NA 5CTBA 4RCNA 1HNOA 1XNWA 3PGQA 1XX4A 3PEAA 5DZKH 3BEZA 2J5II 1OD2A 2PBPA 5INFA 1K39A 3KTIA 4FZWA 3TZ3A 4I42A 4JYJA 3M6MA 4MI2A 2A81A 1FC7A 3KQFA 3MYBA 4KWBA 4JCSA 5DTPA 4NEKA 2QQ3A 3WG5A 3R9QA 2DEOA 3NJDA 3QXZA 4JFCA 2F9YA 4KNPA 4B3JA 4OG1A 5IKLB 2VSUC 3RSIA 1W2XA 4ZDDA 3U9SB 3TT7A 3Q0GA 2VSUE 3Q7HA 5DU4A 1RJMA 4K3WA 3FF6A 2J5IB 4FB8A 4JOTA 4K29A 3H0SA 3OMEA 5E0SH 4G2RA 3T8AA 1WDLA 2FBMA 1UIYA 3GMAA 5E0SA 4ZDBA 2DUBA 4U19A 3L3SA 3ZWAA 3QK8A 2UZFA 3T88A 3QKAA 4MXIA 1WDKA 5DU8A 1NZYB 1UYVA 4FZWC 3IBBA 3SWXA 4U0GH 4Q0GA 1JXZA 3PE8A 2FZSA 4WZ8B 3TV5A 2HW5A 3K8XA 3G64A 2CE3A 1SZOA 4MOUA 4KPKA 4WCZA 2CBYA 5DU6A 3MFMA 1DUBA 3BF0A 5E0NX 2A7SA 2F9IA 2VSSE 4ZDFA 2PG8A 1TYFA 5JBXA 1PJHA 2J5GA 3KTKA 4F47A 4HNKA 3T3WA 1J7XA 4B3HA 4ASIA 4FN8A 2ZQRA 4NNQA 3HE2A 3STAA 2C8TA 4EMMA 3HRXA 1XNYA 1TG6A 4JCTA 3TT6A 1YG8A 2ZL0A 5DZKA 2ZL4A 3KTHA 3KTGA 4ZU2A 3Q1TA 3DORA 4JSBA 3ZW9A 2VX2A 1N6FA 4Q1IA 4DI1A 2VSUA 3MT6A 4FNBA 4FJWD 1YG6A 3TLFA 4WYOB 4U1AA 5FIFA 3JU1A 2BZRA 2VSUF 1O8UA 4IZDA 2F6IA 4FN7A 3RSTA 2F9YB 2X24A 3GLMA 4U18A 5G1SA 4U0GA 1FC6A 5KJPA 2Q34A 4GHNA 4L8KA 4ELSA 3VIVA 2Q2XA 1FCFA 3R9SA 4EMPA 3MOYA 3T8BA 1SG4A 3OC7A 4QIIA 1UYSA 1UYTA 3I47A 4Z0MA 3H02A 3H0QA 3IB9A 5C9GA 2VSSF 1EY3A 3TVUA 3DJAA 1EF8A 2GTRA 3QYRA 4ELXA 1X0UA 2EJ5A 3GF3A 1N6EA 3FDUA 4I52A 4JWVA 4OLQA 2WTBA 4ZDCA 5C90A 4LK5A 5INIA 1OD4A 3NJBA 4RYFH 5G1QA 4JCRA 3P2LA 5CTCA 1WZ8A 3ZW8A 4KD6A 3QWDA 4FNDA 4U0HA 5DTWA 2X58A 1UYRA 5INGA 4ELWA 3ST9A 3PZKA 2ZL2A 1DCIA 3U9RB 3LAOA 2F6QA 3HINA 2PPYA 3RRVA 3N6RB 5DL1A 4I4ZA 1RJNA 3P5MA 3IAVA 3HLN1 1N6DA 3QXIA 2NP9A 3QREA 3K50A 4B3IA 1MJ3A 3KTJA 4JVTA 5KDRB 1VRGA
chains in the Genus database with same CATH superfamily
1XO6A 4JCQA 1HNUA 2ZQQA 3H0UA 1WDMA 1ON3A 1PIXA 4HC8A 3TDCA 4QFEA 4IZBA 2F9IB 4QIJA 2VREA 5KDRA 3R9TA 5G1RA 4YLHA 5HUQA 2J5SA 3BPTA 1Q52A 4J2UA 3V5IA 2J5IA 5DUCA 4RYFA 3P85A 1EF9A 3ZWBA 2ZL3A 2Q35A 1NZYA 1XNVA 2VSSA 1ON9A 1Y7OA 2J5GD 5FUSA 1Q51A 3LKEA 3QMJA 5DKPA 3H0JA 1FC9A 5DUFA 2A7KA 4JYLA 3R6HA 3H81A 4K2NA 4L6WA 4EMLA 3V5EA 3TRRA 1K32A 2FW2A 3GKBA 3GF7A 3HP0A 4OMRA 2D3TA 4IZCA 1HZDA 3BPPA 3SLLA 3ISAA 3Q0JA 3T89A 3TVWA 5JBWA 4NARA 3OT6A 2IEXA 3U9TB 3ZWCA 3R0OA 4JJTA 2W3PA 5MGBA 4ZDEA 4GM2A 3M6NA 5CTBA 4RCNA 1HNOA 1XNWA 3PGQA 1XX4A 3PEAA 5DZKH 3BEZA 2J5II 1OD2A 2YJGA 2PBPA 5INFA 1K39A 3KTIA 4FZWA 3TZ3A 4I42A 4JYJA 3M6MA 4MI2A 2A81A 1FC7A 3KQFA 3MYBA 4KWBA 4JCSA 5DTPA 4NEKA 2QQ3A 3WG5A 3R9QA 2DEOA 3NJDA 3QXZA 4JFCA 2F9YA 4KNPA 4B3JA 4OG1A 5IKLB 2VSUC 3RSIA 1W2XA 4ZDDA 3U9SB 3TT7A 3Q0GA 2VSUE 3Q7HA 5DU4A 1RJMA 4K3WA 3FF6A 2J5IB 4FB8A 4JOTA 4K29A 3H0SA 3OMEA 5E0SH 4G2RA 3T8AA 1WDLA 2FBMA 1UIYA 3GMAA 5E0SA 4ZDBA 2DUBA 4U19A 3L3SA 3ZWAA 3QK8A 2UZFA 3T88A 3QKAA 4MXIA 1WDKA 5DU8A 1NZYB 1UYVA 4FZWC 3IBBA 3SWXA 4U0GH 4Q0GA 1JXZA 3PE8A 2FZSA 4WZ8B 3TV5A 2HW5A 3K8XA 3G64A 2CE3A 1SZOA 4MOUA 4KPKA 4WCZA 2CBYA 5DU6A 3MFMA 1DUBA 3BF0A 5E0NX 2A7SA 2F9IA 2VSSE 4ZDFA 2PG8A 1TYFA 5JBXA 1PJHA 2J5GA 3KTKA 4F47A 4HNKA 3T3WA 1J7XA 4B3HA 4ASIA 4FN8A 2ZQRA 4NNQA 3HE2A 3STAA 2C8TA 4EMMA 3HRXA 1XNYA 1TG6A 4JCTA 3TT6A 1YG8A 2ZL0A 5DZKA 2ZL4A 3KTHA 3KTGA 4ZU2A 3Q1TA 3DORA 4JSBA 3ZW9A 2VX2A 1N6FA 4Q1IA 4DI1A 2VSUA 3MT6A 4FNBA 4FJWD 1YG6A 3TLFA 4WYOB 4U1AA 5FIFA 3JU1A 2BZRA 2VSUF 1O8UA 4IZDA 2F6IA 4FN7A 3RSTA 2F9YB 2X24A 3GLMA 4U18A 5G1SA 4U0GA 1FC6A 5KJPA 2Q34A 4GHNA 4L8KA 4ELSA 3VIVA 2Q2XA 1FCFA 3R9SA 4EMPA 3MOYA 3T8BA 1SG4A 3OC7A 4QIIA 1UYSA 1UYTA 3I47A 4Z0MA 3H02A 3H0QA 3IB9A 5C9GA 2VSSF 1EY3A 3TVUA 3DJAA 4ELXA 1EF8A 2GTRA 3QYRA 1X0UA 2EJ5A 3GF3A 1N6EA 3FDUA 4I52A 4JWVA 4OLQA 2WTBA 4ZDCA 5C90A 4LK5A 5INIA 1OD4A 3NJBA 4RYFH 5G1QA 4JCRA 3P2LA 5CTCA 1WZ8A 3ZW8A 4KD6A 3QWDA 4FNDA 4U0HA 5DTWA 2X58A 1UYRA 5INGA 4ELWA 4HDTA 3ST9A 3PZKA 2ZL2A 1DCIA 3U9RB 3LAOA 2F6QA 3HINA 2PPYA 3RRVA 3N6RB 5DL1A 4I4ZA 1RJNA 3P5MA 3IAVA 3HLN1 1N6DA 3QXIA 2NP9A 3QREA 3K50A 4B3IA 1MJ3A 3KTJA 4JVTA 5KDRB 1VRGA
chains in the Genus database with same CATH topology
1XO6A 4JCQA 1HNUA 2ZQQA 3H0UA 1WDMA 1ON3A 1PIXA 4HC8A 3TDCA 4QFEA 4IZBA 2F9IB 4QIJA 2VREA 5KDRA 3R9TA 5G1RA 4YLHA 5HUQA 2J5SA 3BPTA 1Q52A 4J2UA 3V5IA 2J5IA 5DUCA 4RYFA 3P85A 1EF9A 3ZWBA 2ZL3A 2Q35A 1NZYA 1XNVA 2VSSA 1ON9A 1Y7OA 2J5GD 5FUSA 1Q51A 3LKEA 3QMJA 5DKPA 3H0JA 1FC9A 5DUFA 2A7KA 4JYLA 3R6HA 3H81A 4K2NA 4L6WA 4EMLA 3V5EA 3TRRA 1K32A 2FW2A 3GKBA 3GF7A 3HP0A 4OMRA 2D3TA 4IZCA 1HZDA 3BPPA 3SLLA 3ISAA 3Q0JA 3T89A 3TVWA 5JBWA 4NARA 3OT6A 2IEXA 3U9TB 3ZWCA 3R0OA 4JJTA 2W3PA 5MGBA 4ZDEA 4GM2A 3M6NA 5CTBA 4RCNA 1HNOA 1XNWA 3PGQA 1XX4A 3PEAA 5DZKH 3BEZA 2J5II 1OD2A 2YJGA 2PBPA 5INFA 1K39A 3KTIA 4FZWA 3TZ3A 4I42A 4JYJA 3M6MA 4MI2A 2A81A 1FC7A 3KQFA 3MYBA 4KWBA 4JCSA 5DTPA 4NEKA 2QQ3A 3WG5A 3R9QA 2DEOA 3NJDA 3QXZA 4JFCA 2F9YA 4KNPA 4B3JA 4OG1A 5IKLB 2VSUC 3RSIA 1W2XA 4ZDDA 3U9SB 3TT7A 3Q0GA 2VSUE 3Q7HA 5DU4A 1RJMA 4K3WA 3FF6A 2J5IB 4FB8A 4JOTA 4K29A 3H0SA 3OMEA 5E0SH 4G2RA 3T8AA 1WDLA 2FBMA 1UIYA 3GMAA 5E0SA 4ZDBA 2DUBA 4U19A 3L3SA 3ZWAA 3QK8A 2UZFA 3T88A 3QKAA 4MXIA 1WDKA 5DU8A 1NZYB 1UYVA 4FZWC 3IBBA 3SWXA 4U0GH 4Q0GA 1JXZA 3PE8A 2FZSA 4WZ8B 3TV5A 2HW5A 3K8XA 3G64A 2CE3A 1SZOA 4MOUA 4KPKA 4WCZA 2CBYA 5DU6A 3MFMA 1DUBA 3BF0A 5E0NX 2A7SA 2F9IA 2VSSE 4ZDFA 2PG8A 1TYFA 5JBXA 1PJHA 2J5GA 3KTKA 4F47A 4HNKA 3T3WA 1J7XA 4B3HA 4ASIA 4FN8A 2ZQRA 4NNQA 3HE2A 3STAA 2C8TA 4EMMA 3HRXA 1XNYA 1TG6A 4JCTA 3TT6A 1YG8A 2ZL0A 5DZKA 2ZL4A 3KTHA 3KTGA 4ZU2A 3Q1TA 3DORA 4JSBA 3ZW9A 2VX2A 1N6FA 4Q1IA 4DI1A 2VSUA 3MT6A 4FNBA 4FJWD 1YG6A 3TLFA 4WYOB 4U1AA 5FIFA 3JU1A 2BZRA 2VSUF 1O8UA 4IZDA 2F6IA 4FN7A 3RSTA 2F9YB 2X24A 3GLMA 4U18A 5G1SA 4U0GA 1FC6A 5KJPA 2Q34A 4GHNA 4L8KA 4ELSA 3VIVA 2Q2XA 1FCFA 3R9SA 4EMPA 3MOYA 3T8BA 1SG4A 3OC7A 4QIIA 1UYSA 1UYTA 3I47A 4Z0MA 3H02A 3H0QA 3IB9A 5C9GA 2VSSF 1EY3A 3TVUA 3DJAA 4ELXA 1EF8A 2GTRA 3QYRA 1X0UA 2EJ5A 3GF3A 1N6EA 3FDUA 4I52A 4JWVA 4OLQA 2WTBA 4ZDCA 5C90A 4LK5A 5INIA 1OD4A 3NJBA 4RYFH 5G1QA 4JCRA 3P2LA 5CTCA 1WZ8A 3ZW8A 4KD6A 3QWDA 4FNDA 4U0HA 5DTWA 2X58A 1UYRA 5INGA 4ELWA 4HDTA 3ST9A 3PZKA 2ZL2A 1DCIA 3U9RB 3LAOA 2F6QA 3HINA 2PPYA 3RRVA 3N6RB 5DL1A 4I4ZA 1RJNA 3P5MA 3IAVA 3HLN1 1N6DA 3QXIA 2NP9A 3QREA 3K50A 4B3IA 1MJ3A 3KTJA 4JVTA 5KDRB 1VRGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XO6 A;  4JCQ A;  1HNU A;  2ZQQ A;  3H0U A;  1WDM A;  1ON3 A;  1PIX A;  4HC8 A;  3TDC A;  4QFE A;  4IZB A;  2F9I B;  4QIJ A;  2VRE A;  5KDR A;  3R9T A;  5G1R A;  4YLH A;  2J5S A;  1Q52 A;  3V5I A;  2J5I A;  5DUC A;  4RYF A;  3P85 A;  1EF9 A;  3ZWB A;  2ZL3 A;  2Q35 A;  1NZY A;  1XNV A;  2VSS A;  1ON9 A;  1Y7O A;  2J5G D;  5FUS A;  1Q51 A;  3LKE A;  3QMJ A;  5DKP A;  3H0J A;  1FC9 A;  5DUF A;  2A7K A;  4JYL A;  3R6H A;  3H81 A;  4K2N A;  4L6W A;  4EML A;  3V5E A;  3TRR A;  1K32 A;  2FW2 A;  3GKB A;  3GF7 A;  3HP0 A;  4OMR A;  2D3T A;  4IZC A;  1HZD A;  3BPP A;  3SLL A;  3ISA A;  3Q0J A;  3T89 A;  3TVW A;  5JBW A;  3OT6 A;  2IEX A;  3U9T B;  3ZWC A;  3R0O A;  4JJT A;  2W3P A;  5MGB A;  4ZDE A;  4GM2 A;  3M6N A;  5CTB A;  4RCN A;  1HNO A;  1XNW A;  3PGQ A;  1XX4 A;  3PEA A;  5DZK H;  3BEZ A;  2J5I I;  1OD2 A;  2PBP A;  5INF A;  1K39 A;  3KTI A;  4FZW A;  3TZ3 A;  4I42 A;  4JYJ A;  3M6M A;  4MI2 A;  2A81 A;  1FC7 A;  3KQF A;  3MYB A;  4KWB A;  4JCS A;  5DTP A;  4NEK A;  2QQ3 A;  3WG5 A;  3R9Q A;  2DEO A;  3NJD A;  3QXZ A;  4JFC A;  2F9Y A;  4KNP A;  4B3J A;  4OG1 A;  5IKL B;  2VSU C;  3RSI A;  1W2X A;  4ZDD A;  3U9S B;  3TT7 A;  3Q0G A;  2VSU E;  3Q7H A;  5DU4 A;  1RJM A;  4K3W A;  3FF6 A;  2J5I B;  4FB8 A;  4JOT A;  4K29 A;  3H0S A;  3OME A;  5E0S H;  4G2R A;  3T8A A;  1WDL A;  2FBM A;  1UIY A;  3GMA A;  5E0S A;  4ZDB A;  2DUB A;  4U19 A;  3L3S A;  3ZWA A;  3QK8 A;  2UZF A;  3T88 A;  3QKA A;  4MXI A;  1WDK A;  5DU8 A;  1NZY B;  1UYV A;  4FZW C;  3IBB A;  3SWX A;  4U0G H;  4Q0G A;  1JXZ A;  3PE8 A;  2FZS A;  4WZ8 B;  3TV5 A;  2HW5 A;  3K8X A;  3G64 A;  2CE3 A;  1SZO A;  4MOU A;  4KPK A;  4WCZ A;  2CBY A;  5DU6 A;  3MFM A;  1DUB A;  3BF0 A;  5E0N X;  2A7S A;  2F9I A;  2VSS E;  4ZDF A;  2PG8 A;  1TYF A;  5JBX A;  1PJH A;  2J5G A;  3KTK A;  4F47 A;  4HNK A;  3T3W A;  1J7X A;  4B3H A;  4ASI A;  4FN8 A;  2ZQR A;  4NNQ A;  3HE2 A;  3STA A;  2C8T A;  4EMM A;  3HRX A;  1XNY A;  1TG6 A;  4JCT A;  3TT6 A;  1YG8 A;  2ZL0 A;  5DZK A;  2ZL4 A;  3KTH A;  3KTG A;  4ZU2 A;  3Q1T A;  3DOR A;  4JSB A;  3ZW9 A;  2VX2 A;  1N6F A;  4Q1I A;  4DI1 A;  2VSU A;  3MT6 A;  4FNB A;  4FJW D;  1YG6 A;  3TLF A;  4WYO B;  4U1A A;  5FIF A;  3JU1 A;  2BZR A;  2VSU F;  1O8U A;  4IZD A;  2F6I A;  4FN7 A;  3RST A;  2F9Y B;  2X24 A;  3GLM A;  4U18 A;  5G1S A;  4U0G A;  1FC6 A;  5KJP A;  2Q34 A;  4GHN A;  4L8K A;  4ELS A;  3VIV A;  2Q2X A;  1FCF A;  3R9S A;  4EMP A;  3MOY A;  3T8B A;  1SG4 A;  3OC7 A;  4QII A;  1UYS A;  1UYT A;  3I47 A;  4Z0M A;  3H02 A;  3H0Q A;  3IB9 A;  5C9G A;  2VSS F;  1EY3 A;  3TVU A;  3DJA A;  1EF8 A;  2GTR A;  3QYR A;  4ELX A;  1X0U A;  2EJ5 A;  3GF3 A;  1N6E A;  3FDU A;  4I52 A;  4JWV A;  4OLQ A;  2WTB A;  4ZDC A;  5C90 A;  4LK5 A;  5INI A;  1OD4 A;  3NJB A;  4RYF H;  5G1Q A;  4JCR A;  3P2L A;  5CTC A;  1WZ8 A;  3ZW8 A;  4KD6 A;  3QWD A;  4FND A;  4U0H A;  5DTW A;  2X58 A;  1UYR A;  5ING A;  4ELW A;  3ST9 A;  3PZK A;  2ZL2 A;  1DCI A;  3U9R B;  3LAO A;  2F6Q A;  3HIN A;  2PPY A;  3RRV A;  3N6R B;  5DL1 A;  4I4Z A;  1RJN A;  3P5M A;  3IAV A;  3HLN 1;  1N6D A;  3QXI A;  2NP9 A;  3QRE A;  3K50 A;  4B3I A;  1MJ3 A;  3KTJ A;  4JVT A;  5KDR B;  1VRG A; 
#chains in the Genus database with same CATH topology
 1XO6 A;  4JCQ A;  1HNU A;  2ZQQ A;  3H0U A;  1WDM A;  1ON3 A;  1PIX A;  4HC8 A;  3TDC A;  4QFE A;  4IZB A;  2F9I B;  4QIJ A;  2VRE A;  5KDR A;  3R9T A;  5G1R A;  4YLH A;  5HUQ A;  2J5S A;  3BPT A;  1Q52 A;  4J2U A;  3V5I A;  2J5I A;  5DUC A;  4RYF A;  3P85 A;  1EF9 A;  3ZWB A;  2ZL3 A;  2Q35 A;  1NZY A;  1XNV A;  2VSS A;  1ON9 A;  1Y7O A;  2J5G D;  5FUS A;  1Q51 A;  3LKE A;  3QMJ A;  5DKP A;  3H0J A;  1FC9 A;  5DUF A;  2A7K A;  4JYL A;  3R6H A;  3H81 A;  4K2N A;  4L6W A;  4EML A;  3V5E A;  3TRR A;  1K32 A;  2FW2 A;  3GKB A;  3GF7 A;  3HP0 A;  4OMR A;  2D3T A;  4IZC A;  1HZD A;  3BPP A;  3SLL A;  3ISA A;  3Q0J A;  3T89 A;  3TVW A;  5JBW A;  4NAR A;  3OT6 A;  2IEX A;  3U9T B;  3ZWC A;  3R0O A;  4JJT A;  2W3P A;  5MGB A;  4ZDE A;  4GM2 A;  3M6N A;  5CTB A;  4RCN A;  1HNO A;  1XNW A;  3PGQ A;  1XX4 A;  3PEA A;  5DZK H;  3BEZ A;  2J5I I;  1OD2 A;  2YJG A;  2PBP A;  5INF A;  1K39 A;  3KTI A;  4FZW A;  3TZ3 A;  4I42 A;  4JYJ A;  3M6M A;  4MI2 A;  2A81 A;  1FC7 A;  3KQF A;  3MYB A;  4KWB A;  4JCS A;  5DTP A;  4NEK A;  2QQ3 A;  3WG5 A;  3R9Q A;  2DEO A;  3NJD A;  3QXZ A;  4JFC A;  2F9Y A;  4KNP A;  4B3J A;  4OG1 A;  5IKL B;  2VSU C;  3RSI A;  1W2X A;  4ZDD A;  3U9S B;  3TT7 A;  3Q0G A;  2VSU E;  3Q7H A;  5DU4 A;  1RJM A;  4K3W A;  3FF6 A;  2J5I B;  4FB8 A;  4JOT A;  4K29 A;  3H0S A;  3OME A;  5E0S H;  4G2R A;  3T8A A;  1WDL A;  2FBM A;  1UIY A;  3GMA A;  5E0S A;  4ZDB A;  2DUB A;  4U19 A;  3L3S A;  3ZWA A;  3QK8 A;  2UZF A;  3T88 A;  3QKA A;  4MXI A;  1WDK A;  5DU8 A;  1NZY B;  1UYV A;  4FZW C;  3IBB A;  3SWX A;  4U0G H;  4Q0G A;  1JXZ A;  3PE8 A;  2FZS A;  4WZ8 B;  3TV5 A;  2HW5 A;  3K8X A;  3G64 A;  2CE3 A;  1SZO A;  4MOU A;  4KPK A;  4WCZ A;  2CBY A;  5DU6 A;  3MFM A;  1DUB A;  3BF0 A;  5E0N X;  2A7S A;  2F9I A;  2VSS E;  4ZDF A;  2PG8 A;  1TYF A;  5JBX A;  1PJH A;  2J5G A;  3KTK A;  4F47 A;  4HNK A;  3T3W A;  1J7X A;  4B3H A;  4ASI A;  4FN8 A;  2ZQR A;  4NNQ A;  3HE2 A;  3STA A;  2C8T A;  4EMM A;  3HRX A;  1XNY A;  1TG6 A;  4JCT A;  3TT6 A;  1YG8 A;  2ZL0 A;  5DZK A;  2ZL4 A;  3KTH A;  3KTG A;  4ZU2 A;  3Q1T A;  3DOR A;  4JSB A;  3ZW9 A;  2VX2 A;  1N6F A;  4Q1I A;  4DI1 A;  2VSU A;  3MT6 A;  4FNB A;  4FJW D;  1YG6 A;  3TLF A;  4WYO B;  4U1A A;  5FIF A;  3JU1 A;  2BZR A;  2VSU F;  1O8U A;  4IZD A;  2F6I A;  4FN7 A;  3RST A;  2F9Y B;  2X24 A;  3GLM A;  4U18 A;  5G1S A;  4U0G A;  1FC6 A;  5KJP A;  2Q34 A;  4GHN A;  4L8K A;  4ELS A;  3VIV A;  2Q2X A;  1FCF A;  3R9S A;  4EMP A;  3MOY A;  3T8B A;  1SG4 A;  3OC7 A;  4QII A;  1UYS A;  1UYT A;  3I47 A;  4Z0M A;  3H02 A;  3H0Q A;  3IB9 A;  5C9G A;  2VSS F;  1EY3 A;  3TVU A;  3DJA A;  4ELX A;  1EF8 A;  2GTR A;  3QYR A;  1X0U A;  2EJ5 A;  3GF3 A;  1N6E A;  3FDU A;  4I52 A;  4JWV A;  4OLQ A;  2WTB A;  4ZDC A;  5C90 A;  4LK5 A;  5INI A;  1OD4 A;  3NJB A;  4RYF H;  5G1Q A;  4JCR A;  3P2L A;  5CTC A;  1WZ8 A;  3ZW8 A;  4KD6 A;  3QWD A;  4FND A;  4U0H A;  5DTW A;  2X58 A;  1UYR A;  5ING A;  4ELW A;  4HDT A;  3ST9 A;  3PZK A;  2ZL2 A;  1DCI A;  3U9R B;  3LAO A;  2F6Q A;  3HIN A;  2PPY A;  3RRV A;  3N6R B;  5DL1 A;  4I4Z A;  1RJN A;  3P5M A;  3IAV A;  3HLN 1;  1N6D A;  3QXI A;  2NP9 A;  3QRE A;  3K50 A;  4B3I A;  1MJ3 A;  3KTJ A;  4JVT A;  5KDR B;  1VRG A; 
#chains in the Genus database with same CATH homology
 1XO6 A;  4JCQ A;  1HNU A;  2ZQQ A;  3H0U A;  1WDM A;  1ON3 A;  1PIX A;  4HC8 A;  3TDC A;  4QFE A;  4IZB A;  2F9I B;  4QIJ A;  2VRE A;  5KDR A;  3R9T A;  5G1R A;  4YLH A;  5HUQ A;  2J5S A;  3BPT A;  1Q52 A;  4J2U A;  3V5I A;  2J5I A;  5DUC A;  4RYF A;  3P85 A;  1EF9 A;  3ZWB A;  2ZL3 A;  2Q35 A;  1NZY A;  1XNV A;  2VSS A;  1ON9 A;  1Y7O A;  2J5G D;  5FUS A;  1Q51 A;  3LKE A;  3QMJ A;  5DKP A;  3H0J A;  1FC9 A;  5DUF A;  2A7K A;  4JYL A;  3R6H A;  3H81 A;  4K2N A;  4L6W A;  4EML A;  3V5E A;  3TRR A;  1K32 A;  2FW2 A;  3GKB A;  3GF7 A;  3HP0 A;  4OMR A;  2D3T A;  4IZC A;  1HZD A;  3BPP A;  3SLL A;  3ISA A;  3Q0J A;  3T89 A;  3TVW A;  5JBW A;  4NAR A;  3OT6 A;  2IEX A;  3U9T B;  3ZWC A;  3R0O A;  4JJT A;  2W3P A;  5MGB A;  4ZDE A;  4GM2 A;  3M6N A;  5CTB A;  4RCN A;  1HNO A;  1XNW A;  3PGQ A;  1XX4 A;  3PEA A;  5DZK H;  3BEZ A;  2J5I I;  1OD2 A;  2YJG A;  2PBP A;  5INF A;  1K39 A;  3KTI A;  4FZW A;  3TZ3 A;  4I42 A;  4JYJ A;  3M6M A;  4MI2 A;  2A81 A;  1FC7 A;  3KQF A;  3MYB A;  4KWB A;  4JCS A;  5DTP A;  4NEK A;  2QQ3 A;  3WG5 A;  3R9Q A;  2DEO A;  3NJD A;  3QXZ A;  4JFC A;  2F9Y A;  4KNP A;  4B3J A;  4OG1 A;  5IKL B;  2VSU C;  3RSI A;  1W2X A;  4ZDD A;  3U9S B;  3TT7 A;  3Q0G A;  2VSU E;  3Q7H A;  5DU4 A;  1RJM A;  4K3W A;  3FF6 A;  2J5I B;  4FB8 A;  4JOT A;  4K29 A;  3H0S A;  3OME A;  5E0S H;  4G2R A;  3T8A A;  1WDL A;  2FBM A;  1UIY A;  3GMA A;  5E0S A;  4ZDB A;  2DUB A;  4U19 A;  3L3S A;  3ZWA A;  3QK8 A;  2UZF A;  3T88 A;  3QKA A;  4MXI A;  1WDK A;  5DU8 A;  1NZY B;  1UYV A;  4FZW C;  3IBB A;  3SWX A;  4U0G H;  4Q0G A;  1JXZ A;  3PE8 A;  2FZS A;  4WZ8 B;  3TV5 A;  2HW5 A;  3K8X A;  3G64 A;  2CE3 A;  1SZO A;  4MOU A;  4KPK A;  4WCZ A;  2CBY A;  5DU6 A;  3MFM A;  1DUB A;  3BF0 A;  5E0N X;  2A7S A;  2F9I A;  2VSS E;  4ZDF A;  2PG8 A;  1TYF A;  5JBX A;  1PJH A;  2J5G A;  3KTK A;  4F47 A;  4HNK A;  3T3W A;  1J7X A;  4B3H A;  4ASI A;  4FN8 A;  2ZQR A;  4NNQ A;  3HE2 A;  3STA A;  2C8T A;  4EMM A;  3HRX A;  1XNY A;  1TG6 A;  4JCT A;  3TT6 A;  1YG8 A;  2ZL0 A;  5DZK A;  2ZL4 A;  3KTH A;  3KTG A;  4ZU2 A;  3Q1T A;  3DOR A;  4JSB A;  3ZW9 A;  2VX2 A;  1N6F A;  4Q1I A;  4DI1 A;  2VSU A;  3MT6 A;  4FNB A;  4FJW D;  1YG6 A;  3TLF A;  4WYO B;  4U1A A;  5FIF A;  3JU1 A;  2BZR A;  2VSU F;  1O8U A;  4IZD A;  2F6I A;  4FN7 A;  3RST A;  2F9Y B;  2X24 A;  3GLM A;  4U18 A;  5G1S A;  4U0G A;  1FC6 A;  5KJP A;  2Q34 A;  4GHN A;  4L8K A;  4ELS A;  3VIV A;  2Q2X A;  1FCF A;  3R9S A;  4EMP A;  3MOY A;  3T8B A;  1SG4 A;  3OC7 A;  4QII A;  1UYS A;  1UYT A;  3I47 A;  4Z0M A;  3H02 A;  3H0Q A;  3IB9 A;  5C9G A;  2VSS F;  1EY3 A;  3TVU A;  3DJA A;  4ELX A;  1EF8 A;  2GTR A;  3QYR A;  1X0U A;  2EJ5 A;  3GF3 A;  1N6E A;  3FDU A;  4I52 A;  4JWV A;  4OLQ A;  2WTB A;  4ZDC A;  5C90 A;  4LK5 A;  5INI A;  1OD4 A;  3NJB A;  4RYF H;  5G1Q A;  4JCR A;  3P2L A;  5CTC A;  1WZ8 A;  3ZW8 A;  4KD6 A;  3QWD A;  4FND A;  4U0H A;  5DTW A;  2X58 A;  1UYR A;  5ING A;  4ELW A;  4HDT A;  3ST9 A;  3PZK A;  2ZL2 A;  1DCI A;  3U9R B;  3LAO A;  2F6Q A;  3HIN A;  2PPY A;  3RRV A;  3N6R B;  5DL1 A;  4I4Z A;  1RJN A;  3P5M A;  3IAV A;  3HLN 1;  1N6D A;  3QXI A;  2NP9 A;  3QRE A;  3K50 A;  4B3I A;  1MJ3 A;  3KTJ A;  4JVT A;  5KDR B;  1VRG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...