1HNUA

Crystal structure of peroxisomal delta3-delta2-enoyl-coa isomerase from saccharomyces cerevisiae
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
263
structure length
248
Chain Sequence
b'NEKISYRIEGPFFIIHLINPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D3,D2-ENOYL COA ISOMERASE ECI1
publication title The crystal structure of delta(3)-delta(2)-enoyl-CoA isomerase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Isomerase
total genus 87
structure length 248
sequence length 263
ec nomenclature ec 5.3.3.8: Delta(3)-Delta(2)-enoyl-CoA isomerase.
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 1hnuA00
3IB9A 4I52A 5G1QA 3V5IA 5FUSA 2IEXA 3VIVA 4I4ZA 3JU1A 1SG4A 2PPYA 1K39A 1O8UA 2A7SA 4FNBA 4JCSA 1UYVA 3QREA 1TYFA 3MT6A 2VSUE 1EF8A 3ZW9A 1FC9A 4WZ8B 4KNPA 3LAOA 3TT7A 4U19A 3T8AA 3OMEA 4U0GA 5E0NX 4HC8A 5INGA 3PZKA 4KD6A 4B3JA 2DUBA 3P85A 5CTCA 4JOTA 2ZQRA 2F9YA 3GLMA 1MJ3A 1WDKA 2Q2XA 5KDRA 2BZRA 4U0HA 5FIFA 1EF9A 4ZDFA 2UZFA 4JFCA 2W3PA 3QMJA 3H0QA 3H0UA 4K2NA 5JBWA 5G1RA 3NJDA 3OC7A 1VRGA 4JYLA 5DUCA 4YLHA 1WDLA 4JCQA 2A81A 3WG5A 3QKAA 3K50A 4U0GH 3R9TA 3R9SA 2F9YB 2ZL0A 4ZU2A 4F47A 4IZBA 2J5GA 3IAVA 1PJHA 1FC6A 1K32A 1PIXA 5DZKH 1WZ8A 3MOYA 3KTKA 1DCIA 5KJPA 2ZQQA 2HW5A 5MGBA 2VSUA 3QXIA 3BPPA 3PGQA 3SWXA 5INFA 4LK5A 2WTBA 3NJBA 3ISAA 1RJNA 5DL1A 2VREA 1X0UA 3RSTA 2GTRA 2VSUF 5C90A 2FW2A 3GKBA 4JVTA 1UYSA 1ON3A 4ZDBA 2Q35A 4IZDA 2F9IB 3QXZA 3TV5A 4RYFA 5C9GA 1NZYB 4B3IA 3STAA 3Q0JA 3HE2A 3ZW8A 3ZWCA 3PE8A 2VX2A 4U1AA 2J5SA 4FJWD 4ASIA 1HNOA 4I42A 3U9SB 2VSUC 1OD4A 1N6EA 1WDMA 4JCRA 1SZOA 3HLN1 2F6QA 3Q1TA 4U18A 3P2LA 2FBMA 4EMMA 4Q1IA 3KTHA 4FN8A 3RSIA 3BEZA 4QIJA 3TVWA 1DUBA 3DJAA 3KTIA 5DTPA 1XNVA 2CE3A 3IBBA 2ZL4A 5DUFA 4NEKA 2C8TA 4JCTA 2F9IA 4RCNA 1EY3A 1NZYA 4MOUA 3U9RB 1HNUA 4ELXA 4GHNA 3V5EA 2J5IB 3OT6A 4FB8A 3T88A 4FZWA 4ZDCA 2Q34A 3K8XA 3R6HA 2PG8A 4QIIA 5CTBA 2J5GD 4L8KA 4ZDDA 1XX4A 3HP0A 2FZSA 5DU6A 3HRXA 2X58A 3P5MA 5DU4A 1UIYA 3RRVA 3QYRA 3QK8A 4JJTA 1TG6A 1FCFA 3T3WA 3TT6A 3GF7A 1XO6A 4IZCA 5DU8A 2VSSE 5DTWA 3H02A 1N6DA 2A7KA 2F6IA 2PBPA 1FC7A 4MI2A 5INIA 1W2XA 1RJMA 1N6FA 4WCZA 1Y7OA 4OG1A 3H81A 4MXIA 4L6WA 1JXZA 1HZDA 2ZL2A 3T8BA 3MYBA 1YG6A 2NP9A 4FZWC 1XNYA 4WYOB 3M6MA 3FF6A 4Q0GA 4ELWA 4K3WA 4JSBA 3DORA 1UYTA 2J5II 4ZDEA 4QFEA 4G2RA 3N6RB 2X24A 5DZKA 3SLLA 4RYFH 1Q52A 2DEOA 3KQFA 3Q7HA 4HNKA 2J5IA 4KPKA 5E0SA 3BF0A 3FDUA 3MFMA 4ELSA 3TZ3A 3U9TB 4Z0MA 4B3HA 4GM2A 3I47A 1Q51A 4FNDA 2D3TA 3KTGA 3GMAA 4JYJA 5IKLB 5DKPA 3TLFA 4FN7A 3ZWAA 3LKEA 1J7XA 3G64A 4KWBA 3ZWBA 4NNQA 4OLQA 3TVUA 3M6NA 2ZL3A 1YG8A 1XNWA 4DI1A 2VSSA 4EMPA 3KTJA 5G1SA 3PEAA 2CBYA 3ST9A 3H0SA 1OD2A 3R9QA 5KDRB 3GF3A 5E0SH 3T89A 3L3SA 3TRRA 3Q0GA 5JBXA 2VSSF 4JWVA 4OMRA 3TDCA 3H0JA 2EJ5A 3R0OA 3QWDA 1UYRA 1ON9A 3HINA 4EMLA 4K29A 2QQ3A
chains in the Genus database with same CATH superfamily
3IB9A 4I52A 5G1QA 3V5IA 5FUSA 2IEXA 3VIVA 4I4ZA 3JU1A 1SG4A 2PPYA 1K39A 1O8UA 2A7SA 4FNBA 4JCSA 1UYVA 3QREA 1TYFA 3MT6A 2VSUE 1EF8A 3ZW9A 1FC9A 4WZ8B 4KNPA 3LAOA 3TT7A 4U19A 3T8AA 3OMEA 4U0GA 5E0NX 4HC8A 5INGA 3PZKA 4KD6A 4B3JA 2DUBA 3P85A 5CTCA 4JOTA 2ZQRA 2F9YA 3GLMA 1MJ3A 1WDKA 2Q2XA 5KDRA 2BZRA 4U0HA 5FIFA 1EF9A 4ZDFA 2UZFA 4JFCA 2W3PA 3QMJA 3H0QA 3H0UA 4K2NA 5JBWA 5G1RA 3NJDA 3OC7A 1VRGA 4JYLA 3BPTA 5DUCA 4YLHA 1WDLA 4JCQA 2A81A 3WG5A 3QKAA 3K50A 4U0GH 3R9TA 3R9SA 2F9YB 2ZL0A 4ZU2A 4F47A 4IZBA 2J5GA 3IAVA 1PJHA 1FC6A 1K32A 1PIXA 5DZKH 1WZ8A 3MOYA 3KTKA 1DCIA 5KJPA 2ZQQA 2HW5A 5MGBA 2VSUA 3QXIA 3BPPA 3PGQA 3SWXA 5INFA 4LK5A 2WTBA 3NJBA 3ISAA 1RJNA 5DL1A 2VREA 1X0UA 5HUQA 3RSTA 2GTRA 2VSUF 5C90A 2FW2A 3GKBA 4JVTA 1UYSA 1ON3A 4ZDBA 2Q35A 4IZDA 2F9IB 3QXZA 3TV5A 4RYFA 5C9GA 1NZYB 4B3IA 3STAA 3Q0JA 3HE2A 3ZW8A 3ZWCA 3PE8A 2VX2A 4U1AA 2J5SA 4FJWD 4ASIA 1HNOA 4I42A 3U9SB 2VSUC 1OD4A 1N6EA 1WDMA 4JCRA 1SZOA 3HLN1 2F6QA 3Q1TA 4U18A 3P2LA 2FBMA 4EMMA 4Q1IA 3KTHA 4FN8A 3RSIA 3BEZA 4QIJA 4NARA 3TVWA 1DUBA 3DJAA 3KTIA 5DTPA 1XNVA 2CE3A 3IBBA 2ZL4A 5DUFA 4NEKA 2C8TA 4JCTA 2F9IA 4RCNA 1EY3A 1NZYA 4MOUA 3U9RB 1HNUA 4ELXA 4GHNA 3V5EA 2J5IB 3OT6A 4FB8A 3T88A 4FZWA 4ZDCA 2Q34A 3K8XA 3R6HA 2PG8A 4QIIA 5CTBA 2J5GD 4L8KA 4ZDDA 1XX4A 3HP0A 2FZSA 5DU6A 3HRXA 2X58A 3P5MA 5DU4A 1UIYA 3RRVA 3QYRA 3QK8A 4JJTA 1TG6A 1FCFA 3T3WA 3TT6A 3GF7A 1XO6A 4IZCA 5DU8A 2VSSE 5DTWA 3H02A 1N6DA 2A7KA 2F6IA 2PBPA 1FC7A 4MI2A 5INIA 1W2XA 1RJMA 1N6FA 4WCZA 1Y7OA 4OG1A 3H81A 4MXIA 4L6WA 1JXZA 1HZDA 2ZL2A 3T8BA 3MYBA 1YG6A 2NP9A 4FZWC 1XNYA 4WYOB 3M6MA 3FF6A 4Q0GA 4ELWA 4K3WA 4JSBA 3DORA 1UYTA 2J5II 4ZDEA 4QFEA 4G2RA 3N6RB 2X24A 5DZKA 3SLLA 4RYFH 1Q52A 2DEOA 3KQFA 3Q7HA 4HNKA 2J5IA 4KPKA 5E0SA 3BF0A 3FDUA 3MFMA 4ELSA 3TZ3A 3U9TB 4Z0MA 4B3HA 4GM2A 3I47A 1Q51A 4FNDA 2D3TA 3KTGA 3GMAA 4JYJA 5IKLB 5DKPA 3TLFA 4FN7A 3ZWAA 3LKEA 2YJGA 1J7XA 3G64A 4KWBA 3ZWBA 4NNQA 4OLQA 3TVUA 3M6NA 4HDTA 2ZL3A 1YG8A 1XNWA 4DI1A 2VSSA 4EMPA 3KTJA 5G1SA 3PEAA 2CBYA 3ST9A 3H0SA 1OD2A 3R9QA 5KDRB 3GF3A 5E0SH 3T89A 3L3SA 3TRRA 3Q0GA 5JBXA 2VSSF 4JWVA 4OMRA 3TDCA 3H0JA 2EJ5A 3R0OA 3QWDA 4J2UA 1UYRA 1ON9A 3HINA 4EMLA 4K29A 2QQ3A
chains in the Genus database with same CATH topology
3IB9A 4I52A 5G1QA 3V5IA 5FUSA 2IEXA 3VIVA 4I4ZA 3JU1A 1SG4A 2PPYA 1K39A 1O8UA 2A7SA 4FNBA 4JCSA 1UYVA 3QREA 1TYFA 3MT6A 2VSUE 1EF8A 3ZW9A 1FC9A 4WZ8B 4KNPA 3LAOA 3TT7A 4U19A 3T8AA 3OMEA 4U0GA 5E0NX 4HC8A 5INGA 3PZKA 4KD6A 4B3JA 2DUBA 3P85A 5CTCA 4JOTA 2ZQRA 2F9YA 3GLMA 1MJ3A 1WDKA 2Q2XA 5KDRA 2BZRA 4U0HA 5FIFA 1EF9A 4ZDFA 2UZFA 4JFCA 2W3PA 3QMJA 3H0QA 3H0UA 4K2NA 5JBWA 5G1RA 3NJDA 3OC7A 1VRGA 4JYLA 3BPTA 5DUCA 4YLHA 1WDLA 4JCQA 2A81A 3WG5A 3QKAA 3K50A 4U0GH 3R9TA 3R9SA 2F9YB 2ZL0A 4ZU2A 4F47A 4IZBA 2J5GA 3IAVA 1PJHA 1FC6A 1K32A 1PIXA 5DZKH 1WZ8A 3MOYA 3KTKA 1DCIA 5KJPA 2ZQQA 2HW5A 5MGBA 2VSUA 3QXIA 3BPPA 3PGQA 3SWXA 5INFA 4LK5A 2WTBA 3NJBA 3ISAA 1RJNA 5DL1A 2VREA 1X0UA 5HUQA 3RSTA 2GTRA 2VSUF 5C90A 2FW2A 3GKBA 4JVTA 1UYSA 1ON3A 4ZDBA 2Q35A 4IZDA 2F9IB 3QXZA 3TV5A 4RYFA 5C9GA 1NZYB 4B3IA 3STAA 3Q0JA 3HE2A 3ZW8A 3ZWCA 3PE8A 2VX2A 4U1AA 2J5SA 4FJWD 4ASIA 1HNOA 4I42A 3U9SB 2VSUC 1OD4A 1N6EA 1WDMA 4JCRA 1SZOA 3HLN1 2F6QA 3Q1TA 4U18A 3P2LA 2FBMA 4EMMA 4Q1IA 3KTHA 4FN8A 3RSIA 3BEZA 4QIJA 4NARA 3TVWA 1DUBA 3DJAA 3KTIA 5DTPA 1XNVA 2CE3A 3IBBA 2ZL4A 5DUFA 4NEKA 2C8TA 4JCTA 2F9IA 4RCNA 1EY3A 1NZYA 4MOUA 3U9RB 1HNUA 4ELXA 4GHNA 3V5EA 2J5IB 3OT6A 4FB8A 3T88A 4FZWA 4ZDCA 2Q34A 3K8XA 3R6HA 2PG8A 4QIIA 5CTBA 2J5GD 4L8KA 4ZDDA 1XX4A 3HP0A 2FZSA 5DU6A 3HRXA 2X58A 3P5MA 5DU4A 1UIYA 3RRVA 3QYRA 3QK8A 4JJTA 1TG6A 1FCFA 3T3WA 3TT6A 3GF7A 1XO6A 4IZCA 5DU8A 2VSSE 5DTWA 3H02A 1N6DA 2A7KA 2F6IA 2PBPA 1FC7A 4MI2A 5INIA 1W2XA 1RJMA 1N6FA 4WCZA 1Y7OA 4OG1A 3H81A 4MXIA 4L6WA 1JXZA 1HZDA 2ZL2A 3T8BA 3MYBA 1YG6A 2NP9A 4FZWC 1XNYA 4WYOB 3M6MA 3FF6A 4Q0GA 4ELWA 4K3WA 4JSBA 3DORA 1UYTA 2J5II 4ZDEA 4QFEA 4G2RA 3N6RB 2X24A 5DZKA 3SLLA 4RYFH 1Q52A 2DEOA 3KQFA 3Q7HA 4HNKA 2J5IA 4KPKA 5E0SA 3BF0A 3FDUA 3MFMA 4ELSA 3TZ3A 3U9TB 4Z0MA 4B3HA 4GM2A 3I47A 1Q51A 4FNDA 2D3TA 3KTGA 3GMAA 4JYJA 5IKLB 5DKPA 3TLFA 4FN7A 3ZWAA 3LKEA 2YJGA 1J7XA 3G64A 4KWBA 3ZWBA 4NNQA 4OLQA 3TVUA 3M6NA 4HDTA 2ZL3A 1YG8A 1XNWA 4DI1A 2VSSA 4EMPA 3KTJA 5G1SA 3PEAA 2CBYA 3ST9A 3H0SA 1OD2A 3R9QA 5KDRB 3GF3A 5E0SH 3T89A 3L3SA 3TRRA 3Q0GA 5JBXA 2VSSF 4JWVA 4OMRA 3TDCA 3H0JA 2EJ5A 3R0OA 3QWDA 4J2UA 1UYRA 1ON9A 3HINA 4EMLA 4K29A 2QQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IB9 A;  4I52 A;  5G1Q A;  3V5I A;  5FUS A;  2IEX A;  3VIV A;  4I4Z A;  3JU1 A;  1SG4 A;  2PPY A;  1K39 A;  1O8U A;  2A7S A;  4FNB A;  4JCS A;  1UYV A;  3QRE A;  1TYF A;  3MT6 A;  2VSU E;  1EF8 A;  3ZW9 A;  1FC9 A;  4WZ8 B;  4KNP A;  3LAO A;  3TT7 A;  4U19 A;  3T8A A;  3OME A;  4U0G A;  5E0N X;  4HC8 A;  5ING A;  3PZK A;  4KD6 A;  4B3J A;  2DUB A;  3P85 A;  5CTC A;  4JOT A;  2ZQR A;  2F9Y A;  3GLM A;  1MJ3 A;  1WDK A;  2Q2X A;  5KDR A;  2BZR A;  4U0H A;  5FIF A;  1EF9 A;  4ZDF A;  2UZF A;  4JFC A;  2W3P A;  3QMJ A;  3H0Q A;  3H0U A;  4K2N A;  5JBW A;  5G1R A;  3NJD A;  3OC7 A;  1VRG A;  4JYL A;  5DUC A;  4YLH A;  1WDL A;  4JCQ A;  2A81 A;  3WG5 A;  3QKA A;  3K50 A;  4U0G H;  3R9T A;  3R9S A;  2F9Y B;  2ZL0 A;  4ZU2 A;  4F47 A;  4IZB A;  2J5G A;  3IAV A;  1PJH A;  1FC6 A;  1K32 A;  1PIX A;  5DZK H;  1WZ8 A;  3MOY A;  3KTK A;  1DCI A;  5KJP A;  2ZQQ A;  2HW5 A;  5MGB A;  2VSU A;  3QXI A;  3BPP A;  3PGQ A;  3SWX A;  5INF A;  4LK5 A;  2WTB A;  3NJB A;  3ISA A;  1RJN A;  5DL1 A;  2VRE A;  1X0U A;  3RST A;  2GTR A;  2VSU F;  5C90 A;  2FW2 A;  3GKB A;  4JVT A;  1UYS A;  1ON3 A;  4ZDB A;  2Q35 A;  4IZD A;  2F9I B;  3QXZ A;  3TV5 A;  4RYF A;  5C9G A;  1NZY B;  4B3I A;  3STA A;  3Q0J A;  3HE2 A;  3ZW8 A;  3ZWC A;  3PE8 A;  2VX2 A;  4U1A A;  2J5S A;  4FJW D;  4ASI A;  1HNO A;  4I42 A;  3U9S B;  2VSU C;  1OD4 A;  1N6E A;  1WDM A;  4JCR A;  1SZO A;  3HLN 1;  2F6Q A;  3Q1T A;  4U18 A;  3P2L A;  2FBM A;  4EMM A;  4Q1I A;  3KTH A;  4FN8 A;  3RSI A;  3BEZ A;  4QIJ A;  3TVW A;  1DUB A;  3DJA A;  3KTI A;  5DTP A;  1XNV A;  2CE3 A;  3IBB A;  2ZL4 A;  5DUF A;  4NEK A;  2C8T A;  4JCT A;  2F9I A;  4RCN A;  1EY3 A;  1NZY A;  4MOU A;  3U9R B;  1HNU A;  4ELX A;  4GHN A;  3V5E A;  2J5I B;  3OT6 A;  4FB8 A;  3T88 A;  4FZW A;  4ZDC A;  2Q34 A;  3K8X A;  3R6H A;  2PG8 A;  4QII A;  5CTB A;  2J5G D;  4L8K A;  4ZDD A;  1XX4 A;  3HP0 A;  2FZS A;  5DU6 A;  3HRX A;  2X58 A;  3P5M A;  5DU4 A;  1UIY A;  3RRV A;  3QYR A;  3QK8 A;  4JJT A;  1TG6 A;  1FCF A;  3T3W A;  3TT6 A;  3GF7 A;  1XO6 A;  4IZC A;  5DU8 A;  2VSS E;  5DTW A;  3H02 A;  1N6D A;  2A7K A;  2F6I A;  2PBP A;  1FC7 A;  4MI2 A;  5INI A;  1W2X A;  1RJM A;  1N6F A;  4WCZ A;  1Y7O A;  4OG1 A;  3H81 A;  4MXI A;  4L6W A;  1JXZ A;  1HZD A;  2ZL2 A;  3T8B A;  3MYB A;  1YG6 A;  2NP9 A;  4FZW C;  1XNY A;  4WYO B;  3M6M A;  3FF6 A;  4Q0G A;  4ELW A;  4K3W A;  4JSB A;  3DOR A;  1UYT A;  2J5I I;  4ZDE A;  4QFE A;  4G2R A;  3N6R B;  2X24 A;  5DZK A;  3SLL A;  4RYF H;  1Q52 A;  2DEO A;  3KQF A;  3Q7H A;  4HNK A;  2J5I A;  4KPK A;  5E0S A;  3BF0 A;  3FDU A;  3MFM A;  4ELS A;  3TZ3 A;  3U9T B;  4Z0M A;  4B3H A;  4GM2 A;  3I47 A;  1Q51 A;  4FND A;  2D3T A;  3KTG A;  3GMA A;  4JYJ A;  5IKL B;  5DKP A;  3TLF A;  4FN7 A;  3ZWA A;  3LKE A;  1J7X A;  3G64 A;  4KWB A;  3ZWB A;  4NNQ A;  4OLQ A;  3TVU A;  3M6N A;  2ZL3 A;  1YG8 A;  1XNW A;  4DI1 A;  2VSS A;  4EMP A;  3KTJ A;  5G1S A;  3PEA A;  2CBY A;  3ST9 A;  3H0S A;  1OD2 A;  3R9Q A;  5KDR B;  3GF3 A;  5E0S H;  3T89 A;  3L3S A;  3TRR A;  3Q0G A;  5JBX A;  2VSS F;  4JWV A;  4OMR A;  3TDC A;  3H0J A;  2EJ5 A;  3R0O A;  3QWD A;  1UYR A;  1ON9 A;  3HIN A;  4EML A;  4K29 A;  2QQ3 A; 
#chains in the Genus database with same CATH topology
 3IB9 A;  4I52 A;  5G1Q A;  3V5I A;  5FUS A;  2IEX A;  3VIV A;  4I4Z A;  3JU1 A;  1SG4 A;  2PPY A;  1K39 A;  1O8U A;  2A7S A;  4FNB A;  4JCS A;  1UYV A;  3QRE A;  1TYF A;  3MT6 A;  2VSU E;  1EF8 A;  3ZW9 A;  1FC9 A;  4WZ8 B;  4KNP A;  3LAO A;  3TT7 A;  4U19 A;  3T8A A;  3OME A;  4U0G A;  5E0N X;  4HC8 A;  5ING A;  3PZK A;  4KD6 A;  4B3J A;  2DUB A;  3P85 A;  5CTC A;  4JOT A;  2ZQR A;  2F9Y A;  3GLM A;  1MJ3 A;  1WDK A;  2Q2X A;  5KDR A;  2BZR A;  4U0H A;  5FIF A;  1EF9 A;  4ZDF A;  2UZF A;  4JFC A;  2W3P A;  3QMJ A;  3H0Q A;  3H0U A;  4K2N A;  5JBW A;  5G1R A;  3NJD A;  3OC7 A;  1VRG A;  4JYL A;  3BPT A;  5DUC A;  4YLH A;  1WDL A;  4JCQ A;  2A81 A;  3WG5 A;  3QKA A;  3K50 A;  4U0G H;  3R9T A;  3R9S A;  2F9Y B;  2ZL0 A;  4ZU2 A;  4F47 A;  4IZB A;  2J5G A;  3IAV A;  1PJH A;  1FC6 A;  1K32 A;  1PIX A;  5DZK H;  1WZ8 A;  3MOY A;  3KTK A;  1DCI A;  5KJP A;  2ZQQ A;  2HW5 A;  5MGB A;  2VSU A;  3QXI A;  3BPP A;  3PGQ A;  3SWX A;  5INF A;  4LK5 A;  2WTB A;  3NJB A;  3ISA A;  1RJN A;  5DL1 A;  2VRE A;  1X0U A;  5HUQ A;  3RST A;  2GTR A;  2VSU F;  5C90 A;  2FW2 A;  3GKB A;  4JVT A;  1UYS A;  1ON3 A;  4ZDB A;  2Q35 A;  4IZD A;  2F9I B;  3QXZ A;  3TV5 A;  4RYF A;  5C9G A;  1NZY B;  4B3I A;  3STA A;  3Q0J A;  3HE2 A;  3ZW8 A;  3ZWC A;  3PE8 A;  2VX2 A;  4U1A A;  2J5S A;  4FJW D;  4ASI A;  1HNO A;  4I42 A;  3U9S B;  2VSU C;  1OD4 A;  1N6E A;  1WDM A;  4JCR A;  1SZO A;  3HLN 1;  2F6Q A;  3Q1T A;  4U18 A;  3P2L A;  2FBM A;  4EMM A;  4Q1I A;  3KTH A;  4FN8 A;  3RSI A;  3BEZ A;  4QIJ A;  4NAR A;  3TVW A;  1DUB A;  3DJA A;  3KTI A;  5DTP A;  1XNV A;  2CE3 A;  3IBB A;  2ZL4 A;  5DUF A;  4NEK A;  2C8T A;  4JCT A;  2F9I A;  4RCN A;  1EY3 A;  1NZY A;  4MOU A;  3U9R B;  1HNU A;  4ELX A;  4GHN A;  3V5E A;  2J5I B;  3OT6 A;  4FB8 A;  3T88 A;  4FZW A;  4ZDC A;  2Q34 A;  3K8X A;  3R6H A;  2PG8 A;  4QII A;  5CTB A;  2J5G D;  4L8K A;  4ZDD A;  1XX4 A;  3HP0 A;  2FZS A;  5DU6 A;  3HRX A;  2X58 A;  3P5M A;  5DU4 A;  1UIY A;  3RRV A;  3QYR A;  3QK8 A;  4JJT A;  1TG6 A;  1FCF A;  3T3W A;  3TT6 A;  3GF7 A;  1XO6 A;  4IZC A;  5DU8 A;  2VSS E;  5DTW A;  3H02 A;  1N6D A;  2A7K A;  2F6I A;  2PBP A;  1FC7 A;  4MI2 A;  5INI A;  1W2X A;  1RJM A;  1N6F A;  4WCZ A;  1Y7O A;  4OG1 A;  3H81 A;  4MXI A;  4L6W A;  1JXZ A;  1HZD A;  2ZL2 A;  3T8B A;  3MYB A;  1YG6 A;  2NP9 A;  4FZW C;  1XNY A;  4WYO B;  3M6M A;  3FF6 A;  4Q0G A;  4ELW A;  4K3W A;  4JSB A;  3DOR A;  1UYT A;  2J5I I;  4ZDE A;  4QFE A;  4G2R A;  3N6R B;  2X24 A;  5DZK A;  3SLL A;  4RYF H;  1Q52 A;  2DEO A;  3KQF A;  3Q7H A;  4HNK A;  2J5I A;  4KPK A;  5E0S A;  3BF0 A;  3FDU A;  3MFM A;  4ELS A;  3TZ3 A;  3U9T B;  4Z0M A;  4B3H A;  4GM2 A;  3I47 A;  1Q51 A;  4FND A;  2D3T A;  3KTG A;  3GMA A;  4JYJ A;  5IKL B;  5DKP A;  3TLF A;  4FN7 A;  3ZWA A;  3LKE A;  2YJG A;  1J7X A;  3G64 A;  4KWB A;  3ZWB A;  4NNQ A;  4OLQ A;  3TVU A;  3M6N A;  4HDT A;  2ZL3 A;  1YG8 A;  1XNW A;  4DI1 A;  2VSS A;  4EMP A;  3KTJ A;  5G1S A;  3PEA A;  2CBY A;  3ST9 A;  3H0S A;  1OD2 A;  3R9Q A;  5KDR B;  3GF3 A;  5E0S H;  3T89 A;  3L3S A;  3TRR A;  3Q0G A;  5JBX A;  2VSS F;  4JWV A;  4OMR A;  3TDC A;  3H0J A;  2EJ5 A;  3R0O A;  3QWD A;  4J2U A;  1UYR A;  1ON9 A;  3HIN A;  4EML A;  4K29 A;  2QQ3 A; 
#chains in the Genus database with same CATH homology
 3IB9 A;  4I52 A;  5G1Q A;  3V5I A;  5FUS A;  2IEX A;  3VIV A;  4I4Z A;  3JU1 A;  1SG4 A;  2PPY A;  1K39 A;  1O8U A;  2A7S A;  4FNB A;  4JCS A;  1UYV A;  3QRE A;  1TYF A;  3MT6 A;  2VSU E;  1EF8 A;  3ZW9 A;  1FC9 A;  4WZ8 B;  4KNP A;  3LAO A;  3TT7 A;  4U19 A;  3T8A A;  3OME A;  4U0G A;  5E0N X;  4HC8 A;  5ING A;  3PZK A;  4KD6 A;  4B3J A;  2DUB A;  3P85 A;  5CTC A;  4JOT A;  2ZQR A;  2F9Y A;  3GLM A;  1MJ3 A;  1WDK A;  2Q2X A;  5KDR A;  2BZR A;  4U0H A;  5FIF A;  1EF9 A;  4ZDF A;  2UZF A;  4JFC A;  2W3P A;  3QMJ A;  3H0Q A;  3H0U A;  4K2N A;  5JBW A;  5G1R A;  3NJD A;  3OC7 A;  1VRG A;  4JYL A;  3BPT A;  5DUC A;  4YLH A;  1WDL A;  4JCQ A;  2A81 A;  3WG5 A;  3QKA A;  3K50 A;  4U0G H;  3R9T A;  3R9S A;  2F9Y B;  2ZL0 A;  4ZU2 A;  4F47 A;  4IZB A;  2J5G A;  3IAV A;  1PJH A;  1FC6 A;  1K32 A;  1PIX A;  5DZK H;  1WZ8 A;  3MOY A;  3KTK A;  1DCI A;  5KJP A;  2ZQQ A;  2HW5 A;  5MGB A;  2VSU A;  3QXI A;  3BPP A;  3PGQ A;  3SWX A;  5INF A;  4LK5 A;  2WTB A;  3NJB A;  3ISA A;  1RJN A;  5DL1 A;  2VRE A;  1X0U A;  5HUQ A;  3RST A;  2GTR A;  2VSU F;  5C90 A;  2FW2 A;  3GKB A;  4JVT A;  1UYS A;  1ON3 A;  4ZDB A;  2Q35 A;  4IZD A;  2F9I B;  3QXZ A;  3TV5 A;  4RYF A;  5C9G A;  1NZY B;  4B3I A;  3STA A;  3Q0J A;  3HE2 A;  3ZW8 A;  3ZWC A;  3PE8 A;  2VX2 A;  4U1A A;  2J5S A;  4FJW D;  4ASI A;  1HNO A;  4I42 A;  3U9S B;  2VSU C;  1OD4 A;  1N6E A;  1WDM A;  4JCR A;  1SZO A;  3HLN 1;  2F6Q A;  3Q1T A;  4U18 A;  3P2L A;  2FBM A;  4EMM A;  4Q1I A;  3KTH A;  4FN8 A;  3RSI A;  3BEZ A;  4QIJ A;  4NAR A;  3TVW A;  1DUB A;  3DJA A;  3KTI A;  5DTP A;  1XNV A;  2CE3 A;  3IBB A;  2ZL4 A;  5DUF A;  4NEK A;  2C8T A;  4JCT A;  2F9I A;  4RCN A;  1EY3 A;  1NZY A;  4MOU A;  3U9R B;  1HNU A;  4ELX A;  4GHN A;  3V5E A;  2J5I B;  3OT6 A;  4FB8 A;  3T88 A;  4FZW A;  4ZDC A;  2Q34 A;  3K8X A;  3R6H A;  2PG8 A;  4QII A;  5CTB A;  2J5G D;  4L8K A;  4ZDD A;  1XX4 A;  3HP0 A;  2FZS A;  5DU6 A;  3HRX A;  2X58 A;  3P5M A;  5DU4 A;  1UIY A;  3RRV A;  3QYR A;  3QK8 A;  4JJT A;  1TG6 A;  1FCF A;  3T3W A;  3TT6 A;  3GF7 A;  1XO6 A;  4IZC A;  5DU8 A;  2VSS E;  5DTW A;  3H02 A;  1N6D A;  2A7K A;  2F6I A;  2PBP A;  1FC7 A;  4MI2 A;  5INI A;  1W2X A;  1RJM A;  1N6F A;  4WCZ A;  1Y7O A;  4OG1 A;  3H81 A;  4MXI A;  4L6W A;  1JXZ A;  1HZD A;  2ZL2 A;  3T8B A;  3MYB A;  1YG6 A;  2NP9 A;  4FZW C;  1XNY A;  4WYO B;  3M6M A;  3FF6 A;  4Q0G A;  4ELW A;  4K3W A;  4JSB A;  3DOR A;  1UYT A;  2J5I I;  4ZDE A;  4QFE A;  4G2R A;  3N6R B;  2X24 A;  5DZK A;  3SLL A;  4RYF H;  1Q52 A;  2DEO A;  3KQF A;  3Q7H A;  4HNK A;  2J5I A;  4KPK A;  5E0S A;  3BF0 A;  3FDU A;  3MFM A;  4ELS A;  3TZ3 A;  3U9T B;  4Z0M A;  4B3H A;  4GM2 A;  3I47 A;  1Q51 A;  4FND A;  2D3T A;  3KTG A;  3GMA A;  4JYJ A;  5IKL B;  5DKP A;  3TLF A;  4FN7 A;  3ZWA A;  3LKE A;  2YJG A;  1J7X A;  3G64 A;  4KWB A;  3ZWB A;  4NNQ A;  4OLQ A;  3TVU A;  3M6N A;  4HDT A;  2ZL3 A;  1YG8 A;  1XNW A;  4DI1 A;  2VSS A;  4EMP A;  3KTJ A;  5G1S A;  3PEA A;  2CBY A;  3ST9 A;  3H0S A;  1OD2 A;  3R9Q A;  5KDR B;  3GF3 A;  5E0S H;  3T89 A;  3L3S A;  3TRR A;  3Q0G A;  5JBX A;  2VSS F;  4JWV A;  4OMR A;  3TDC A;  3H0J A;  2EJ5 A;  3R0O A;  3QWD A;  4J2U A;  1UYR A;  1ON9 A;  3HIN A;  4EML A;  4K29 A;  2QQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...