1HNVA

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
total genus 137
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hnvA05
4F3TA 2IGIA 4IRDA 3NE6A 1J5OA 1JXBA 3KLFB 4FCYA 3RRGA 4HYKA 3TI0A 2KQ2A 5DLGA 1UWBA 3H40A 4L8RB 1RT1B 1ZYQA 2VG7A 3H08A 5KFCA 1IKWB 3KK1A 4DL3A 3PUFA 4DL6A 3CJ5A 1L3TA 2JGUA 1N48A 3CJ4A 4FZXC 2BR0A 4XIUA 3OLBA 1QE1B 2B6AA 1RYSA 1N5YB 2G8WA 1K6YA 3K57A 1RTIB 3K5NA 4C8MA 3EY1A 2ZKUA 4LH4A 3V6KA 3MR3A 2WK4A 4IOBA 5I3UA 2XWYA 1Z4UA 3TAMB 2LSNA 4LSLA 4M42A 4YR3A 3O3GA 3SI8A 4W5RA 4IH7A 5KFUA 1JLCB 4DSLA 3E01B 4Z4HA 3CM5A 3WNHA 1C0TB 3I5CA 4FJLA 1LWFB 4J9OA 1Q8IA 5DK5A 2OPRA 4B9NA 4O3RA 3QNNA 4JS4A 3M8PB 4AHRA 4J2AA 4ED7A 3OHAA 3ZSXA 4B8CA 5F9LA 3L2UA 1B9DA 4IFVA 5HRPA 4NLYA 3QZ7A 4CF1A 2A1RA 1TKTA 3T19A 3ZSWA 3ZSQA 4DTJA 2G8IA 3KLIB 1S1XA 1MU2A 4DSEA 4WFZA 4AILC 4EYHB 3UR0A 4CIFA 3SQ2A 1RT6B 3SV3A 1U47A 1WSJA 2ATQA 4KHQA 3CFOA 3PHEA 4ICLB 4KTZA 4N76A 3N6NA 3H5YA 5KGXA 3D0PA 3M8RA 3GV7B 3AO3A 3RR7A 3VQEA 1NHVA 3OS1A 1ZBHA 4CIGA 3VQSA 3SUNA 4I2QB 2F8SA 4G1QA 4NLDA 4ECXA 4CJ4A 4KO0B 3OYAA 2DPIA 4TY8B 3MEGA 4BWJA 2KZZA 1VSKA 4NCBA 2D5RA 2AWZA 4UQGA 3MECB 3DRPB 3QGHA 4OGEA 3KIOA 3PW2A 2PYJA 2GIRA 3H2LA 2HHQA 3IG1B 1U09A 2YKNB 4DG1A 3IS9B 2QKKA 1GX5A 1BHLA 3CYMA 2OZSA 2FJXA 4BE0A 2CKWA 1VSJA 3NGYA 1RCHA 4CJPA 4H4MB 4YR0A 3H4DA 2R8HA 1YVFA 4MIBA 3K5OA 4KB7A 4E7LA 1QAIA 2WHOA 5KFHA 1C0MA 4FK4A 3PO4A 2IS3A 1VRUB 4R5PB 3TR8A 3SQ4A 2RF2B 5KFDA 1RT5B 5F8MA 4FK2A 1LW2B 1XHXA 4TY9A 4O55A 3IN5A 1QQCA 3LAKA 5KFBA 2FBYA 1ASWA 3GV5B 5F8JA 1WSEA 4NLUA 4E7JA 2Q3SA 1IKVA 1HNIB 1UOCA 3QGGA 1EETA 2GV9A 2XHBA 3WNFA 3BGRA 4I2PB 1I3AA 3QEPA 3AVNA 1CSJA 1S1WB 2BE2A 3ZSVA 4CJFA 3MEEA 5JS2A 1CXQA 4EP4A 4OL8A 1S1UA 3DRRA 3DMJB 5KG1A 4B3OA 4YP3A 1BQMA 1RAJA 4YFUA 2Y1JA 4M3ZA 4PUOA 1HQEB 4CFCA 3L3VA 4ED0A 3RB6A 1QAJA 2EC0A 3DLGA 2R8IA 3NKYA 1NNDA 1RDAA 1NJZA 3KLHB 4Y3CA 2B4JA 5I42B 4DSJA 4U6PA 3TQ1A 4KAZA 2FVSA 4FJ9A 4MIAA 5HROB 4KE5A 2W9CB 4Y34A 4J9LA 2AQ4A 4BWMA 4B08A 4CHPA 1S5JA 4IH5A 2XGPA 4DQIA 4DWIA 1BCMA 3ZT1A 4XPEA 2FJVA 2DPJA 4XPCA 4FJ8A 4KHWA 4RW6B 1JIHA 2UVWA 3FQLA 4KKOA 5KFTA 1C1AA 5J2PA 4FLYA 3DYAA 4CECA 1XI1A 2UVUA 3ZCMA 2X78A 4IQXA 3NH0A 4CJ5A 4ZHRB 4CHQA 3SZ2A 1B9FA 1LW0B 4KV8B 4WZQA 4MKAA 3A2FA 1TKZB 4CERA 4KB1A 1JLEB 3D45A 3RMAA 4CGJA 1X9MA 4O3NA 1S1TA 4W5NA 1JLGB 2ASDA 3QERA 4JV2A 4RW7B 3RRHA 4EP5A 4FW2A 2I1RA 3LAMA 5KFRA 3DOKB 5EWEA 1VSEA 1Z26A 4CJSA 3NAEA 4F2RA 1RT4B 4KHSA 3KK3B 3MTKA 1KVCA 5KFGA 3BSAA 4LH5A 2HMIA 1S9GA 2PY5A 1EXQA 1U04A 4Z4GA 1SL0A 2W9BB 5CZ1A 4NLRA 3RTVA 3QEXA 2ASLA 4CIEA 4DTOA 4F3OA 4NLVA 1EKEA 1TK5A 3NGDA 3EPIA 3CIZA 3BREA 5EWGA 1RDBA 2W9CA 2UVRA 1SV5A 4FS2A 3HPHA 2IM3A 3KKSA 3L2QA 5J2QA 1JLQA 1RT2B 4CEOA 4W5TA 2HNDB 3FRZA 3NMAA 4J9QA 1A5VA 1C1BA 4BE1A 3RMBA 4H4OA 4JUZA 3GIMA 2YNIB 1NHUA 4LSNA 3V6DA 4DTMA 3H4BA 3PX4A 1VSFA 3HKWA 2R2UA 1KHWA 1TL3B 3G10A 3VQCA 3DLEB 3IGVA 1DTQA 3U3GA 4RW8B 2WTFA 4BDPA 3DOLB 4K4XA 3MXMA 2AGPA 3HVTB 2ATLA 3AA4A 3ISND 1TKZA 4CHNA 1HNVA 2WCXA 2XGQA 3BQ0A 4I9LA 2BQRA 2QXFA 1JLEA 4F50A 1SH0A 4TXSA 3V9ZA 4M3UA 5FDLA 4FVMA 4WFYA 2W9AA 4W5QA 1TVRB 1TQLA 3FSIA 3BSNA 1JLGA 2IMWP 4O4GA 2W8KA 3KTQA 3CG7A 1RT3A 4DTUA 2BGGA 4CFAA 2V9WA 4N41A 3TAQA 5L1LA 3HYFA 4IR1A 3QO9B 5KFWA 4KSEB 1EX4A 2R8KA 2W9BA 4ECRA 3PJWA 2HNZB 3RBDA 3RMDA 3GIKA 3P83D 3ZSOA 4M3TA 2Z1GA 2GBZA 3V6JA 5K14A 2X6SA 4CJKA 4DTRA 3K5LA 1N4LA 3HO1A 3AVGA 3QIOA 3AVKA 2YNGB 4DF8A 4FLUA 1S1VA 1KLMB 5F8LA 2OPQB 4K8XA 4WE1B 4ED3A 5KT2A 1RA7A 1S0NA 3PW5A 3MR6A 5HBMB 2HHTA 4FLTA 2G8UA 3I0SB 4CJEA 3U6FA 3TANA 1REVA 1NJXA 3ICLA 1EP4B 1FK9B 4NCGA 2FVCA 4IH6A 4RUCA 3B6OA 4M45A 3H98A 1J5OB 1WAJA 2BQUA 5C25A 4ECWA 1Q9XA 4GW6A 3KNAA 4ELVA 2PZSA 3KMQA 2QE5A 3MEDA 1UWBB 1IG9A 4CGHA 4RNFA 4PY5A 4LD0A 4E89A 3KK1B 4FJGA 2YNFB 3FDSA 2FC0A 5KFMA 1S9FA 5T14A 4RNOA 4CEQA 4JRQA 2JEGA 2IBKA 4K4YA 2HNZA 2B6AB 5CYQA 5DMRA 3ASMA 2C28A 3SFUA 2VA2A 2HHXA 3LP2A 4FLXA 3HK2A 3C94A 2VWKA 5I3UB 1TAQA 2FVRA 3RAQA 3IRXA 4LSLB 1KLMA 1S10A 3ULDA 3Q8QB 1XHZA 3SUQA 3V6HA 3SQ1A 4ECYA 2W8LA 4DL2A 1SKSA 3VQ8A 4C8KA 3QINA 3RMCA 1X9SA 1HYVA 2BRKA 4RNMA 3NF7A 4KI6A 1ZETA 5F8GA 3ZSYA 4CE9A 4CF8A 2C2DA 3NH1A 5KFEA 3PO5A 5KFFA 3C95A 1EP4A 3I5AA 4X2BA 1IH7A 4ZVEA 2IOCA 1NK8A 5DGAA 5D3GA 1Z25A 4IFVB 2Z1JA 3N6LA 2GC8A 3MFIA 3EYZA 1TKTB 3Q8SB 4GC6A 1L3UA 1SH2A 4YR2A 3TAGA 4JLHA 5F8HA 1RTHA 1S1XB 1MU2B 3I0RA 2HB5A 1TGOA 4O0IA 5KG4A 4FM1A 4F4KA 5KTQA 2O4GA 5C24B 4E0DA 2ZD1A 2CJQA 1LWCA 4CK3A 1ASUA 3SV4A 4M94A 2YNFA 3KHGA 4JV1A 5KFNA 4ECVA 2D0CA 3DM2A 1BI4A 1RBUA 2GIQA 5KFYA 4N47A 2FBTA 5KT6A 4J9PA 2KFZA 4G1QB 5JS1A 4KBIA 5FRNA 5DGBA 3TARA 3CDEA 2ZQBA 4ID1A 3KLGA 5DQHA 1JLAA 3MEGB 4R8UA 1TAUA 2F8EX 3AVIA 3QEWA 1SL2A 3RWUA 1NK6A 1A5WA 2HWHA 4WFXA 3CVKA 4G3IA 4ED6A 4DG1B 2ILYA 5L1KA 4LY7A 1C0UA 4QWCA 1D0EA 2KTQA 4FYDA 3U3YA 3OYMA 2KZMA 4ZPDA 3OL8A 1HYZA 2V4QA 3AVJA 2DFEA 1RNHA 4W5OA 3VQBA 1JXLA 4WXOA 4E3SA 4AH9A 4FXDA 1NK5A 4Z0UA 4J9MA 4Q45A 1C1CA 2IA6A 1U45A 2VWJA 3C6TA 3GILA 4FJ5A 2BRLA 4ZTFA 4B9MA 5C24A 4EBCA 3TWHA 4QW9A 2R8GA 2ILZA 1RDDA 4J9NA 3BQ1A 1RILA 3KLVA 1YVUA 3I8DA 2JLEA 1HMVA 4FBUA 4GVMA 5KG0A 1TL1A 4QOZB 1IKVB 1EETB 2C2RA 3BGRB 3THVA 3O3FA 4RNNA 4NYFA 3OS0A 4Z4CA 3OYLA 2XI3A 2BE2B 3BQ2A 3AVMA 3MEEB 3T5KA 3KMSA 2I5JA 1RBTA 2VA3A 5HP1A 1S1UB 3DRRB 2D3UA 1R0AA 4B3OB 4CF0A 5F9NA 1BQMB 3AVLA 1HARA 4LQ9A 4PUOB 2HHSA 3JYTA 1K1QA 2R2RA 3OJSA 3DLGB 3V4IB 4BDZA 5KFSA 4DFJA 4EZ6A 4I7FB 3I5BA 4KFBB 3H59A 2D3ZA 3KOAA 4K4VA 4J9SA 4FJIA 1W0HA 3KHLA 5EDWA 3HVWA 2IJFA 4K4TA 4ED8A 2G8VA 1ZBLA 4WYWA 3LZIA 4KI4A 4RUAA 3G6YA 3GYNA 3T5JA 4KKOB 3LP1A 5J2PB 4KAIA 4CJVA 3DYAB 4DL7A 2YNHA 4FJNA 2EHGA 4CFDA 4NZ0A 2QV6A 4E19A 1L5UA 1QS4A 3PJXA 1KLNA 1KHVA 3BSOA 3VQPA 3L3UA 3RB3A 1XC9A 1RBVA 4OPJA 2R7YA 3RBEA 1JKHA 4Z4IA 3VQQA 4FLZA 4JRPA 1RDRA 4OPKA 4J2DA 3V81A 4B9VA 1S1TB 4HHTA 5KFKA 4IRCA 3OJUA 3SUOA 4F4YA 3PVXA 1S49A 4PWDA 1K1SA 1NK0A 1DLOB 1GOBA 1SKRA 2DTUA 1CXUA 2HMIB 3KD5E 3NGIA 1S9GB 5JUMA 2IC3A 4CHZA 1WLJA 3V4IA 2E6MA 3OYEA 4FJKA 5KG6A 4I7FA 4CJTA 1BCOA 4KFBA 4IG0A 3AVCA 3KK2A 4KHNA 2YKMA 3VQAA 2G8HA 5DG8A 2YV0X 1SV5B 3C6UA 4ZPCA 3EPGA 3AO5A 3ZT0A 2WONA 4MK8A 4ZMMA 3HT3A 4NYNA 5J2QB 2HVHA 4QWBA 1JLQB 1KVAA 5J2MB 1C1BB 1C2PA 1I39A 3VA0A 2JEJA 4CGDA 1BQNA 2AGQA 1S0OA 5F8NA 4H4OB 1LAVA 4RU9A 4LSNB 3V6DB 4PA1A 4TYAA 4MH8A 3VQ5A 3N6MA 1VRTB 4ZVGA 1U4BA 1DTQB 4Y1DA 4J2EA 2IDOA 1KFSA 4MK7A 5KFZA 4CGIA 3OSNA 3T3FA 3MF5A 5J1EA 3VQ7A 3HVRA 1HNVB 3QIDA 4ZTJA 4HCCA 5DQGA 1S48A 3T5HA 1NOYA 4Q0BA 4N56A 4GC7A 2X6NA 1NJYA 2XI2A 5FDLB 1X9WA 1SL1A 2VG6A 1BISA 4KRFA 1S6QA 1VSMA 4O4GB 4EBEA 4O0JA 3H5XA 1QSLA 1RT3B 3VN5A 4QAGA 5SZTA 4KHRA 2IJNA 4CJUA 4NYZA 3KHHA 4AHCA 1CZBA 1L3VA 3OSPA 1DLOA 2JC1A 4M3YA 2AGOA 2ZE2A 4DU1A 3GQCA 3LPTA 4ZVFA 3D28A 3ITHA 5KG5A 3IGNA 4F4ZA 4CK2A 4QPXA 1BIZA 1TKXA 5K14B 1SH3A 1U48A 4FJMA 5KI6A 3WNEA 4E7IA 5HLFA 1G15A 4CK1A 1KFDA 1S1VB 1GOAA 2HVIA 3PW4A 3JSMA 4FLWA 5J2MA 4Q43A 4C8NA 3BR9A 2XY8A 4ED2A 4DFKA 4HTUA 5KFPA 3SYZA 5EWFA 3OL9A 3CJ2A 1JXEA 1WSFA 1D1UA 3NFAA 1REVB 2OPPA 1VRTA 1XR5A 3OHBA 3V9UA 2XY5A 4IG3A 4NCGB 1NK7A 2D0AA 1N56A 3AO1A 4J2BA 1FKPA 2O4IA 3ZT2A 1TP7A 1QHTA 1HRHA 1KSPA 1T7PA 1C6VA 4CEAA 3M9OB 3NHGA 3OYDA 1VSIA 4H54A 3CM6A 1IO2A 5C25B 2DFFA 4CJ3A 3H5UA 4NLTA 3OYGA 3K5MA 2P5OA 4FJJA 3MEDB 5KFQA 3QIPA 2BDPA 3LP0A 4CJRA 1N6QA 4Q44A 3L2VA 4CJWA 3K2PA 3PR5B 1JLBA 5T7BA 3G0ZA 3LWLA 5CYQB 1WNSA 2HHUA 3HM9A 5HRSA 1RTJA 3GV8B 3VA3A 3LP2B 1FKOA 1SUQB 1UA0A 1ZBUA 4ID5A 4IDKA 2UUTA 1CZ9A 2WB4A 4CJLA 4O3QA 4AHTA 4BE2A 2YHBA 3IRXB 1XR6A 1RDCA 2E9TA 3M8QA 1T03A 3OYCA 3LP3A 2E6LA 5JXSA 2BQ3A 1S0MA 4MKBA 4XO0A 4O3SA 5DG7A 3SUPA 3FFIB 3CQ8A 2B5JA 1O1WA 1NJWA 5D3GB 3HP6A 3GIJA 4Z4EA 4NLQA 4KTWA 5KT3A 4MFBB 3ZSRA 3B6PA 4HUEA 1YTUA 4CESA 4AHUA 4PQUA 4RG8A 1T3NA 2KW4A 1RTHB 3QLHA 1S4FA 3I0RB 3V1RA 4DMNA 1JLFA 3GIIA 1TKDA 1RT7A 4KHMA 3ISNC 5J2NA 2ZD1B 1LWCB 4CF2A 3SJJA 3ZT4A 1WSHA 3MR2A 4RW4A 3MR5A 4ZP6A 1TV6A 2X74A 4IRKA 1QTMA 2JEIA 4H8KA 1DTTA 4OLAA 4ED1A 4ZVHA 4DU4A 3DM2B 1BI4B 4K8ZA 2XRIA 1Y97A 1S9EA 4MK9A 3S3OA 3VQ6A 1SUQA 4J9KA 1LWEB 1KRPA 2IAJB 3LANA 4NLGA 4BACA 3KLGB 1JLAB 3HXMA 4R8UB 4URGA 3QGIA 2FLPA 3OY9A 2UUWA 2BANA 1T05A 5KT5A 4C8OA 3M9NB 3Q8PB 3KHRA 4E1MA 1WSIA 1RTDB 3AV9A 3LDSA 2FBVA 3TAFA 1C0UB 1BGXT 2V4RA 4HVJA 2JC0A 2W42A 3OL7A 3FFIA 1CLQA 3F9KA 4B9UA 4GMJB 4URQU 3D5MA 4O5BA 3PV8A 4MFBA 4CGFA 2RN2A 4YMEA 4NLWA 1VK0A 3CDWA 1MMLA 4TQRA 2WOMA 4HUGA 4DQRA 1C1CB 4DQSA 3FQKA 3C6TB 3HPOA 5E41A 5F8IA 3P5JA 3TABA 4URSA 4NLPA 3DLBA 3DLKA 3NBPA 2RPIA 1HMVB 2Y1IA 4CCHA 1TL1B 4EO6A 1UAXA 3VQ4A 1IKXA 2R2SA 3RB4A 4OLBA 3AA3A 3P1GA 4M3WA 4Q8FA 4NRUA 4FS1A 1NKBA 5L9XA 4DLGA 1HPZA 4LQ3A 4E7HA 3HSTB 2I5JB 1IKYA 4Y1CA 4FJXA 5HP1B 1FXXA 3UIQA 3OYHA 1LWEA 1R0AB 2HNYB 4F4XA 2IAJA 2E9RX 4K50A 2IM1A 4ZPAA 1D8YA 3JYTB 3KLEA 3SCXA 4NLSA 4DTSA 4M41A 1L3SA 3F73A 2O5DA 1ZTWA 4Y2AA 1RTDA 3NL0A 1J9AA 3PY8A 3M9MB 3AA5X 3QETA 1IM4A 4DFPA 2VG5A 5CYMA 1HQUA 3K58A 3CFRA 3SI6A 4KPYA 2OPSA 5KT7A 3DI6A 2PYLA 4RW9A 5SWMA 3KJVA 2RDJA 3NAHA 1J53A 3LP1B 4O44A 1VSDA 1ZBIA 2YNHB 4E1NA 4IFYA 4HUFA 1HYSA 3AVHA 3AVFA 3RAXA 5KG2A 4RZRA 4FJ7A 4I9QA 5KFVA 1HJRA 4CEFA 4QWAA 3G6XA 5KFLA 3CFPA 4KREA 3MXJA 3HHKA 3OYJA 3NDKA 4F2SA 1JKHB 3KLFA 1ASVA 3DRSB 2RDIA 1B92A 4NCAA 3OYBA 3LPUA 3SPZA 3QNOA 2HW3A 3V81B 1NK9A 3O4QA 2EX3A 4QW8A 3NF6A 4OJRA 4CEBA 1RT1A 4OVLA 3PX0A 3S9HA 4E7KA 4PWDB 1IKWA 4QWDA 2WRMA 2HNYA 4AHSA 3CO9A 1XR7A 2B43A 5KG7A 3NF8A 4B9LA 1QE1A 4ELTA 1OS5A 2IC3B 3V1QA 2C22A 4CEZA 3DLHA 1N5YA 3KKRA 1RTIA 3AO4A 3BSCA 2XY7A 3EZ5A 1ITGA 1VSHA 4IG0B 4DL5A 3KK2B 2P51A 3LWMA 2YKMB 2HAIA 3TAMA 3C6UB 3G6VA 3V1OA 2WONB 1QSSA 2GUIA 1JLCA 3E01A 1C0TA 1LWFA 4O3PA 5KRSA 1BQNB 2QKBA 4F4WA 3RR8A 3M8PA 4ECQA 2FLLA 5DG9A 5EU7A 4KHYA 1YTAA 5CZ2A 2NUBA 2KFNA 1RYRA 3ZSZA 3QYYA 5KGWA 4CEEA 1J54A 4KHUA 3V9WA 2OA8A 1TK8A 5J1EB 3O4NA 4YNQA 4ZPBA 4Q0BB 2P5GA 3DRSA 3KLIA 3QZ8A 1RT6A 2VG6B 2R8JA 1S6QB 5KFJA 3TVKA 4IR9A 3AVAA 3SFGA 3KD1E 1A5XA 2ASJA 1I6JA 1S6PB 4EZ9A 2ZE2B 4ICLA 2J6UA 2J6SA 2ITGA 4YQWA 4FZZA 1LAWA 3ITHB 5CY4A 1KCFA 4CFBA 4EO8A 2G8KA 1U49A 3MAQA 1QSYA 5L1JA 4I2QA 1NKEA 1TKXB 4KO0A 4DTPA 2D41A 3PZPA 1UA1A 2HHWA 4KTQA 4TY8A 4R0EA 3OYKA 3QEVA 4NLOA 4IKFA 2FLNA 5HLFB 2OH2A 4DS5A 4FBTA 5FROA 4EEYA 2ETJA 3MECA 1RBRA 3DRPA 3T1AA 3JSMB 4DLEA 3IG1A 2YKNA 3OL6A 1W25A 1WAFA 3IS9A 4MQ3A 4CHYA 3OYFA 3BJYA 3OVNA 3SNNA 4DS4A 5L1IA 2DFHA 3CJ3A 2OPPB 4ZP7A 4CJQA 3IAYA 4IG3B 1BL3A 1WNEA 4H4MA 1WSGA 1FKPB 4Q8EA 5KG3A 3EZUA 5KRTA 4ELUA 3HVAA 1VRUA 4R5PA 1SKWA 2RF2A 4FZYA 4ZP9A 1RT5A 3VQDA 1LW2A 3QIPB 1YT3A 3PW7A 1VSLA 1ZBFA 5KFAA 3LP0B 1ZTTA 4CHOA 2HWIA 1NOZA 3OS2A 5HRNA 1D9DA 3HP9A 1N6QB 3PR4A 3L2WA 5FRMA 3V9SA 1S6PA 1HNIA 1QUVA 4M3XA 1JLBB 2YHAA 4I2PA 5C42B 1S1WA 4B9SA 4WZMA 4FW1A 1RBSA 3LZJA 1RTJB 1NK4A 3AVBA 1TK0A 2FVPA 3HPGA 3DMJA 4CEDA 3NH2A 1FKOB 4ECUA 4ID5B 4IDKB 2ALZA 4IKAA 4HCBA 1HQEA 3OLAA 2JEFA 2DY4A 5KFIA 3VQ9A 5KT4A 2E4LA 3S3NA 3TAPA 3KLHA 4JS5A 3M8QB 1T03B 4N5SA 4DL4A 5I42A 3RB0A 1T8EA 2HHVA 2A1SA 3CJ0A 4DU3A 5HROA 1X1PA 3AO2A 4DSIA 2B5JB 2R2TA 3MXIA 1JL1A 4RW6A 4O3OA 2XY6A 2IM2A 3CWJA 1GX6A 4AHVA 4PQUB 1Q9YA 3QLHB 2J6TA 4IBNA 2XCAA 2RKIB 1RA6A 4BDYA 4K4UA 1JLFB 3UDLA 4ZHRA 2FBXA 1RT7B 2OYQA 1LW0A 5KFXA 4KV8A 5J2NB 4EBDA 1LV5A 3ALYA 3T5LA 4WXWA 4O4RA 4DQQA 4RW4B 1JL2A 4WYLA 1TV6B 4JV0A 4DFMA 2QK9A 5C42A 4EYIB 1DTTB 3G86A 4RW7A 2F96A 4TQSA 2AX1A 4FK0A 2C2EA 3AA2A 3DOKA 1S9EB 4TLRA 2OZMA 1RT4A 1JX4A 3KK3A 3M8SA 4ECZA 4Z4FA 3DDKA 2FJWA 2XO7A 3K59A 4FM2A 4TN2A 2V0NA 4DSFA 3CDUA 2BANB 1T05B 2FVQA 5C5JA 3PX6A 3MFHA 3Q8RB 4Y2CA 4NLXA 4CF9A 4TSXA 3LALA 3SPYA 5DQIA 5KFOA 1GOCA 4DTNA 1RT2A 3BDPA 2HNDA 1F21A 4QWEA 4CGGA 2YNIA 4ECSA 4C8LA 2WOMB 2RKIA 1TL3A 1KVBA 3DLEA 1KTQA 3TAEA 4DSKA 4RW8A 2IM0A 3DOLA 3HVTA 4DQPA 3SQ0A 3HL8A 4U7CA 2D7SA 2XCPA 4RNHA 1D5AA 2P1JA 3OYNA 3DLKB 3NBPB 1NKCA 3QESA 4DTXA 3NCIA 1TVRA 1XWLA 1IKXB 4OGCA 2AX0A 3OYIA 2F8TA 1HPZB 4ECTA 4QCLA 3L2RA 3NGZA 1IKYB 2VG7B 3QO9A 4K4ZA 5DLFA 3PW0A 3O3HA 2W7OA 4TYBA 3S3MA 1WN7A 4B8AB 4OKJA 1W9HA 3KLEB 3UQSA 1BIUA 4KB0A 3V9XA 3QEIA 2Z1IA 4DEZA 3DLRA 4Q5VA 4J9RA 3UPFA 3HJFA 2W7PA 2E9ZA 2YNGA 3H5SA 1D9FA 4K4WA 3L8BA 2VG5B 2OPQA 3NAIA 5CYMB 1HQUB 4M95A 4WE1A 2UVVA 4NRTA 2G8FA 3WNGA 2OPSB 2AU0A 2D0BA 3DI6B 4RW9B 3KJVB 3NF9A 5HBMA 2OPRB 1T94A 4K4SA 2AJQA 4FJHA 3E51A 3I0SA 4O44B 4IFYB 4OKEA 1S97A 1HYSB 2Z1HA 4HKQA 4B9TA 5EUHA 5HRRA 1FK9A 4OKKA 3ZT3A 4FLVA 4DF4A 4ZP8A 4F8RA 2XC9A 4M3RA 4FM0A
chains in the Genus database with same CATH superfamily
1PBAA 3CCRN 3OVSA 3PSIA 3KLFB 4FCYA 4V1Ak 2OMLA 3TZYA 1W2BR 1VFJA 2XMAA 5ETKA 1WSVA 2JLFA 4WP3A 1ZYQA 3QBXA 2QG9B 2VU5A 4ZJLA 1H2VZ 1U02A 4L6V3 3CJ5A 2G1HA 1CZAN 2E7VA 2B56A 4OHVA 3H1VX 4ZVSB 3OV7A 2BR0A 3WXJA 3BN4A 3BEXA 1NSPA 2G8WA 4CBWA 3SJHA 2NNWA 3KZBA 3EY1A 1MN7A 4LH4A 1GFWB 2HK3A 3V6KA 1B0TA 4PL7A 1MDUB 2KHCA 4M5DA 5BPNA 4W5RA 1CG2A 1RCOB 4C1NI 3R1XA 3G8SA 3E01B 4OX7A 3M8WA 1YBTA 4FJLA 3TRGA 1R8AA 3WDOA 3I8BA 5M1NA 2OPRA 1FJGF 3HSCA 3QNNA 4Q7AA 3CJQA 3S1TA 3MM9A 1F2GA 3ZSXA 1R0CB 3L2UA 4YHHJ 4DV7K 4CF1A 3G82A 3ZZPA 4MO5A 4DTJA 4DV6J 4JKCA 1S1XA 3P49B 4LBIA 5EX3A 2LDYA 3BGOP 1BC6A 4WFZA 2VJVA 4XEIA 2WUSA 3ZZTA 3NCRA 2AD9A 2RH3A 2HAFA 3TNVA 1FRIA 3DLLQ 1U47A 2ATQA 1RDWX 4KHQA 3CFOA 3PYDA 1U2CA 1RKJA 4IUFA 3H5YA 1ZC6A 3AO3A 2GJFA 2XG8A 2C2MB 4G1QA 4MLHA 5JMVA 2J0XA 1S72S 1ELOA 4TY8B 3MEGA 1MW7A 4NCBA 1N34F 1UAWA 2CQIA 2AWZA 4FF3A 2C3UA 3QGHA 4JD2A 4OGEA 2O66A 1FXLA 1H74A 4X4PA 2HHQA 3H3OB 1VBYA 2CQ2A 4DG1A 4EWTA 4KGZB 3CCEN 5IWAJ 1APSA 1U1RA 2CKWA 2ITMA 4GV6A 2NXEA 2QO3A 2YWEA 2EW9A 1X4CA 1E4GT 4QS7A 1MN9A 2AYEA 4KIAA 2KLAA 4JBCA 1NZAA 1C0MA 4FK4A 1JK9B 3P8BB 3TR8A 2JJ4D 3SQ4A 4UTGA 1BD6A 1Q81T 5F8MA 4FK2A 4LREA 2R7TA 1X4BA 1EB0A 3X3UA 3KHYA 2IHR1 2FBYA 1ASWA 2N4DA 3GV5B 5F8JA 1WSEA 4IOXA 2CG4A 4NLUA 3OW2R 1IJEB 3I9V9 4JI2J 2XHBA 3WNFA 1H2UX 4CZGA 3QEPA 4B3SF 2BKPA 2BE2A 4PR6A 1FA0A 4B1UB 3DMJB 3D67A 2W4CA 1BQMA 4EI2A 4YP3A 4ZLNA 3O44A 2MGZB 1QAYA 1LFWA 1UZHA 2KH9A 3THWB 3F2KA 2CYYA 4MKVA 2B4JA 4DSJA 1N36F 3EL2A 3US5A 2V7YA 2QA2A 4FJ9A 5HROB 4CHPA 4IH5A 2XGPA 4J9UE 4M5JA 1BCMA 4BR9A 3ZT1A 2FJVA 1ZAXA 3T41A 4ZIWA 2EFNA 5LY3A 2ADCA 2AMCB 3FQLA 3J81Y 2MQPA 3SDEA 2BH1A 5J2PA 2OKQA 2AJ2A 2FLOA 2J9CA 1FRJA 3ZCMA 2X78A 3R9PA 4IQXA 2BKNA 1YF5L 2AYMA 4A8XA 2KM8C 3SZ2A 1B9FA 2UUCF 3TU5A 1CJTB 3A2FA 1TKZB 3O8MA 4CERA 1VQ7S 1JLEB 3CF5L 3D45A 3RMAA 2GAHC 1U2RA 1FJCA 1UJ4A 3CC4N 1DKGD 1S1TA 3QERA 4JV2A 4WFBL 2OANA 3DOKB 5EWEA 4JI8K 2VFVA 3PEJA 4WTYA 1OIAA 4LFBJ 1PCAA 2LMIA 5KFGA 3Q24A 2FF3B 1NNEA 5FLXU 2ASLA 2G2YA 2H4YB 1NMEB 3L4QA 1E6VA 3EPIA 3CIZA 3CJCA 3THYB 2ACMA 1VQSA 2VPXB 2AW0A 4P2XA 4USKA 2W9CA 1SV5A 4WJBA 2E1YA 2ZH7A 4BC2A 2IM3A 1NGGA 1EIYB 4JI5J 4GKJJ 4W5TA 3QT5A 2HNDB 3FRZA 3KDOA 5TKYA 1KVJA 2XMUA 4H4OA 4JUZA 4Y28C 1Q5YA 4LSNA 4OZ1A 4DTMA 2Q66A 1VSFA 3LDQA 2UXCF 3MMBA 3A8EA 1TL3B 3G10A 5K8MA 3IGVA 4RW8B 3H2UB 3DOLB 2LU1A 4K4XA 4X62K 2G1DA 2DR8A 3D9BA 4CHNA 1HNVA 4I9LA 3BQ0A 1B4SA 3HTVA 1SH0A 3IC1A 4M5NA 2P6TA 5MAOA 3O9UA 1R7IA 4FVMA 2W9AA 3MPVA 3UKRB 4B3TK 4OYZA 2W8KA 2JWNA 4JB8B 4N41A 3TAQA 5L1LA 2V2ZA 3QO9B 3IR6B 2HFZA 5KFWA 4Z94A 1Z6RA 4EK2A 1CJUB 4BRNA 2KHDA 2W9BA 2HNZB 1LXJA 3RMDA 3ZSOA 3CMEN 2WBNA 2D4WA 5BXIA 2X6SA 1T9YA 4RO0A 4FKYA 4JKHA 4CJKA 2P9LA 4DI6A 3K5LA 2YKQA 3HO1A 3AVGA 2Y0BB 3QIOA 2ZM6K 1HNZK 3EN9A 1KLMB 5C7PA 3DKDA 4K8XA 1YJUA 5KT2A 4JI4J 3PIPQ 1NH7A 4HWIA 2A1BA 1S0NA 1HKBA 2FB0A 3BO2A 4KGMA 3B78A 5HBMB 2D69A 3E8OA 3U6FA 2P9SB 4FP9A 1NJXA 2OHDA 2C2ZB 2BKOA 2LYVA 3CJ9A 2LQJA 1FK9B 2F5GA 3JQJA 3CQYA 2A0FB 1JJ2M 2CJKA 3DRYA 3B6OA 4M45A 3AXKA 3CQXA 3C0BA 2OJ3A 1WAJA 3I32A 4ECWA 1Q9XA 1RSCA 2D1CA 2QE5A 4CGHA 5HMYA 1IJFB 1R6YA 1E4FT 3ZX0A 3NGKA 4NMLA 2IDLA 4DUZK 3PYEA 4AF1A 2FC0A 1URNA 3ZZRA 2VKZG 5KFMA 2D9OA 2FF6A 5H9FK 4JRQA 2IBKA 4CO1A 3CCTA 2FXUA 4NA1A 4PG4A 3CC7S 3LP2A 3MN5A 2DGUA 1JJCB 4M5MA 2DHSA 5K8PA 4M5DB 3F5TA 4AE5A 2IY5B 1HHTP 1M5OC 3HD2A 3ULDA 2UXBF 5LT5A 3BYPA 4DL2A 4B1YB 4I0WA 4C8KA 3QINA 1HYVA 2IIRA 3R5AA 5F8GA 4CE9A 1H1VA 3CCWA 3OXFA 2A6AA 2PEBA 3MM9B 1EP4A 3I5AA 2WTUA 1IH7A 4ZVEA 3U1LA 3EYZA 1GTHA 2IYGA 4CZCA 3KWMA 1SH2A 4YR2A 3TAGA 5F8HA 3UFCX 1S1XB 3I0RA 1BO5O 2CJAA 4O0IA 4X4NA 4M7YA 4F4KA 2V2KA 4FM1A 1V3SA 5KTQA 2VQEK 4E0DA 4ISEA 2MZTA 1EQ0A 5AXKA 2CIMA 4UZCA 2QL9B 4P2FA 4JV1A 2HVEA 2H5IB 4C2MA 4ECVA 2CQ0A 3LOUA 3DM2A 2VFUA 1BI4A 2GO8A 3UWTA 1HBMA 4DV4K 2VQFK 4J9PA 3R6GB 2PC6A 1Q8BA 4G1QB 2E2PA 3N01A 2OTLN 1SQFA 5DGBA 3TARA 3KLGA 5MLCV 3MEGB 2GAGC 3I55S 3TSUA 3HZ6A 1L3KA 2DHHA 1WKLA 2CJBA 5I9EB 4XTTA 3RWUA 1NK6A 1A5WA 4OZ2A 4DV5F 3UB5A 2NRTA 2CG8A 4ED6A 4DG1B 2ZH9A 4DR4J 4LY7A 2UV8A 1D0EA 1YI2N 2KTQA 4LJMA 2G9OA 2FSJA 3C66A 3U27A 2VV5A 3E2EA 5AR0A 1OY9A 4FYVB 4FWOA 3U4LA 3OL8A 4NA3A 2YX4A 4ZVPB 2V4QA 1IG8A 3LM9A 1YX2A 4BC5A 2JVOA 2F7TA 2ZC3A 4EBCA 2R8GA 2ILZA 1RDDA 3BQ1A 1RILA 1FRLA 3I8DA 1HMVA 4FBUA 4HI2A 1TL1A 4QOZB 4JYAK 3O3FA 1N5VA 5IFMA 3OS0A 4RX6A 3BQ2A 2BE2B 3AVMA 1ZZNA 3T5KA 3HSJA 5AQRA 1R0AA 4OJHA 4ANEA 4CF0A 1BQMB 4DCOB 2GWJA 2E2OA 4LQ9A 3JYTA 2B7CB 1C0FA 3M7VA 1TMMA 2QLXA 2HHHJ 1WSRA 2OAUA 3QAEA 4JEPA 3R27A 5KFSA 1D4XA 3VENA 4DFJA 4I7FB 1TFWA 4I6WA 1AYEA 3H59A 1H7WA 3L7OA 1P27B 1RAGB 4DV6K 2OUGA 3MPDA 2A3JA 3VGVA 2KKHA 5F2RA 1CC7A 1VI7A 2XBPA 1DBDA 2K3IA 4LF6F 3L95X 2R3VA 3LP1A 3BZQA 3SDEB 1Q7YT 5J2PB 3PTWA 2OFGX 3OD2A 5GAHI 3PRVA 1KC8O 4HT5A 4E19A 3PJXA 4CH0S 2J0WA 1KHVA 3CGIA 5DS7A 2V67A 1LCUA 3H6EA 1HWJA 1VQ4S 3QBWA 3CNQP 4TU8A 3MM7A 2HGNA 1OH7A 3VQQA 2DNLA 5CZXA 2ZVSA 1S1TB 4HHTA 5KFKA 2DNKA 3OJUA 3ILIA 4B3MJ 3SUOA 1IUJA 1SB6A 4DV1K 1S49A 1DT9A 2OEJA 4C98A 2OCEA 2DO4A 1NK0A 3LDNA 1DLOB 2ADBA 3N4QA 2HFVA 2N3OA 2PMHA 3NGIA 4FWRA 1P8GA 1E6VB 3R8YA 2JH3A 4NWBA 2J0SD 1T95A 5KG6A 3AJ1A 2H4WB 4K41A 3IBFB 1EJ7L 3GE9A 4ZN1A 1T0TV 1FDDA 1BCOA 3VQAA 1SV5B 4ZPCA 1KAZA 4B9QA 2HZVA 3PIOQ 4MK8A 2BVZA 3L9ZA 3W62A 1RWNB 1V3RA 3I4HX 1I39A 2QRRA 5LMNJ 2JEJA 2AGQA 4WP9A 4H4OB 3FJ2A 4LSNB 4LF9J 3T1YJ 1RISA 4MH8A 4JN4A 4C9DA 3MMBB 3MMVA 3FZHA 1U4BA 1Z2ZA 4IJAA 1D09B 4CGIA 3BBCA 3T3FA 1W2BM 3MF5A 5J1EA 1HNVB 4CLFA 5CXTA 3VEXA 1NOYA 4G1PA 1YG0A 4N56A 4GC7A 2W41A 1SL1A 1FJGJ 2VG6A 5C2GA 1S6QA 3TEGA 4EBEA 3VN5A 5SZTA 1ILYA 3P38A 2JDJA 2IJNA 4CJUA 3KHHA 2CJYB 4AHCA 1L3VA 2I8EA 2ZE2A 2CRLA 3GQCA 3LPTA 5D0EA 2Q3PA 4EAHD 4F4ZA 4CK2A 4QPXA 4UUWA 3OVAA 4BRFA 1BIZA 4USUA 5BJRA 2P9LB 4FJMA 5KI6A 2CADA 1R8PA 3MOJB 5HLFA 4CK1A 2CGKA 1GOAA 3BPDA 2QTDA 3N0VA 1WB9A 4OZ3A 1BHNA 4Q43A 1XMQK 4ED2A 4DFKA 2GMJA 5I4MA 2W4PA 3SYZA 5EWFA 4ERDA 4JNEA 4KH6A 1GLFO 1RUSA 1NUEA 4C3KA 1Y5NB 4N8OA 3NY0A 4IO9L 3OHBA 2XY5A 3CB4A 3NGTA 1FKPA 3ZT2A 1N32F 1N34J 1NGEA 4HH0A 4DCPB 4JKBA 1S6OA 1KSPA 3NHGA 4H54A 2QTWA 1YK9A 3R3LA 2P9KA 3H25A 2CQ3A 4IOCL 3O1LA 3QIPA 4ZLLA 1WC5A 3QBCA 2XS7A 1N6QA 3CW2C 4Q44A 4DV0F 2ZF5O 4BR7A 5E33A 3S41A 1VYAA 3PYFA 4CJWA 3K2PA 3NOGA 4B1WB 4LFCJ 3G0ZA 2IBOA 4LT6A 1WNSA 3HM9A 1F5AA 4JI5K 3LP2B 1FKOA 1ZBUA 1U1MA 2UUTA 3K9JA 4CJLA 3TZXA 3GSDA 3OTOF 1NU0A 2RJZA 3QT7A 2C3MA 3NRBA 2AP6A 4LF4F 2H3EB 4KC5A 1HHQA 3OYCA 2H65B 3N4WA 4B3SJ 5LSRA 1S0MA 4MKBA 2LP4A 5A8KA 5DG7A 1G7CB 3FFIB 2DHAA 4G1IA 1RGVA 1EAYC 4E8UA 4PKDB 1KOHA 4KTWA 2AHOB 1BU6O 3N28A 1GMWD 2O01C 2GX8A 4RG8A 1SVDA 4DPXA 2K2PA 3I0RB 3OTCA 3MMJA 3V1RA 1TKDA 2I6WA 1VQMN 3OW2M 1S76D 2BM1A 4NL5A 4OYBA 4F67A 2EEYA 2RRBA 5GAHP 4X4UA 1QTMA 4L74A 2JEIA 4ZVHA 3DM2B 4IOAQ 1BI4B 1HBMB 1Y7PA 4K8ZA 1HR0F 1Y97A 4MK9A 3S3OA 2ZWPA 4JI4K 2KT3A 4C1NK 1W26A 2IAJB 4NLGA 3FBFA 2KO1A 5IV4A 3KLGB 3HXMA 5G4DA 4PXBA 4PXDA 2E5HA 2XS2A 3ZTPA 2FLPA 1MG7A 3S7RA 2UUWA 1XK8A 4L3QA 4TKTA 1T05A 5AQYA 2ACYA 4C8OA 2Q43A 2R7OA 3AV9A 2QA1A 3TAFA 1BGXT 2V4RA 2N82B 5AQQA 4K5RA 4WKYA 4RWWA 4O5BA 2BACA 2V8HA 1FXDA 4CGFA 4K2XA 1VQ8N 2GHPA 2WOMA 5AQKA 2ZOMA 5IT9O 4KGVB 5AE1A 2NXJA 1NJIT 3NNAA 1U1PA 1UW4A 3VAHA 3DLBA 1XNQF 2XWXA 5KOXA 1HMVB 4A4JA 1K8AO 4HEA9 8AT1B 1TL1B 2J76E 3VQ4A 1IKXA 3RB4A 4OLBA 3MN6A 4M3WA 1KONA 4M5GA 4ZIVA 4CTAA 2UXCJ 4Y1CA 1IKYA 1I94K 4U8YA 3LL3A 4FOIA 1R0AB 4F4XA 5A76A 1D8YA 1X4EA 3JYTB 4FXWA 2L9WA 1MA9B 1TMJA 2Z8QA 2Z2ZA 1L3SA 3J80O 3CCMN 5AQMA 4USMA 4Y2AA 3UD4P 4PG7A 3PY8A 3NL0A 3M9MB 2NRVA 3KNGA 2RQKA 4PYDA 1BWEA 1YJRA 4C97A 4LC9B 3ULEA 3K58A 2Y1LB 3CFRA 1NRKA 5KT7A 1YBAA 2PYLA 5SWMA 3P45B 3AOBA 4FOEA 2BOPA 3NAHA 1J53A 3LP1B 2VPZB 1VSDA 1YRUA 1M5KC 3NCPA 4DPYA 1KD1T 3DCAA 1G6BA 4RZRA 4WF9L 3OFHA 1OKJA 5KFVA 3GYGA 4LF5F 3CCZA 3G6XA 4K42A 5KFLA 3MM7B 3THTA 3M5RA 1ASVA 2BBEA 3DRSB 2CPDA 5E7OB 3QNOA 3VVUA 1NK9A 4JI3K 1VQON 4I69A 3NF6A 1S99A 4OJRA 5D0GA 3POTA 3I56N 4DJBA 3MD1A 2MKJA 2EG2A 1FEHA 4OJGA 4DX8H 2YWWA 5LL6d 1FE4A 2V4JA 2R7QA 4DR4K 3NOCA 5E3AA 2R9LA 5L39A 5C2CA 2M88A 4QYRA 5B0GA 2QA4G 3AO4A 5HN0A 4M1KA 4A61A 2B0GA 1VSHA 4GVEA 2P9GA 3TAMA 3KUEA 2F3JA 1QSSA 4BG9A 3N5BA 2QEXN 3A8YA 3DAWA 1RHJB 1C4CA 1HNXF 3M8PA 1T9VA 1QQOA 4H0PA 3QQCD 5JLHA 2RSQA 2AF6A 2OIHA 3ZSZA 4CEEA 3DU6A 1T9XA 3HT0A 2OA8A 5J1EB 2UXBJ 4OZLA 2P5GA 3IXQA 2QC3A 3QZ8A 2DH7A 2VG6B 2R8JA 1S6QB 2QA4N 2PFFB 4NASA 2DITA 2HQ3A 2RT3A 3D3CJ 4WFNL 2B4UA 4PKHA 1UEVA 4FWNA 4FWSA 1GMWA 4UZBA 2ZE2B 2HRUA 2J6SA 2ITGA 1VS3A 4C0HA 4YB6A 4E1JA 2HSEB 2L41A 1U2VA 1LK5A 2G8KA 1UTAA 3OFFA 1U49A 4CH7A 4XK8C 4D3HA 4I2QA 1EQYA 2NYIA 2XMMA 4DTPA 2D41A 1UA1A 2DIVA 1ZXOA 4C8ZA 5HLFB 3X1LB 5C10A 3J81U 3NVMA 3VF2A 2Z2YB 5C15A 3O08A 2G0CA 3VOVA 3OR2A 3IG1A 1SQKA 1EHWA 1WAFA 3OYFA 1EKRA 4OX6A 3UVJA 3OVNA 4ANDA 4CZJA 1ROFA 3CJ3A 3DHWC 4ZP7A 4CJQA 4AL5A 3MPWA 3TTCA 4H4MA 1FKPB 9RUBA 1EX8A 2MLXA 3EZUA 2JFDA 4DV5J 4ELUA 3CD6S 3HVAA 1VRUA 3CJRA 4R5PA 5T7LA 2P9KB 2ZH2A 3L6QA 2NXNA 4ZP9A 1RT5A 3TOQA 4NXMJ 3QIPB 1YT3A 5KFAA 4XDCA 5CHCB 4CHOA 3OS2A 3HP9A 1N6QB 2E1MC 1S6PA 3P96A 3R6LB 4I2PA 1VDHA 4OYWA 5CD4H 4B9SA 4WZMA 2V9KA 3EKUA 4FW1A 3M30B 2WVBA 1VQLS 1NK4A 2E5LJ 1NGJA 2Z57B 3WXKA 1FKOB 1NM2A 5AQTA 5LMNK 1WOPA 4C6AA 1WG1A 4LF9K 3TAPA 1VC5A 1N8RO 2XO6A 4BQLA 2YJFA 2X3DA 3H46O 2LA6A 2L9NA 1KDNA 2R7VA 3CJAA 4KH0B 2BJDA 2VOOA 1DQAA 4BLGA 5A8KB 1O6XA 4CLUA 4JI6J 4RW6A 3MUVP 1VQYA 3D0GE 3JAMY 2IM2A 3DLLL 4CZEA 4HDGA 3P6YC 2IRUA 4ES1A 4AHVA 4DV7F 3ZX3A 1F60B 2J6TA 1YHQS 1RA6A 4BDYA 1VQNS 1H73A 4ZHRA 1LW0A 5KFXA 2ZDOA 4KV8A 3DFEA 1HPMA 3T5LA 2M4MA 4WXWA 1CULA 4ZLJA 4DQQA 3U1NA 3NNHA 3V2UC 2NYHA 3BF4A 2YHYA 5C42A 4EYIB 4DR1J 4RW7A 1HFEL 4TLRA 3KK3A 1H6KX 2VUGA 3NGRA 4Z4FA 5I3QA 4IO1A 2MQ8A 2E2NA 1SQEA 2XO7A 2DJWA 4TN2A 3G71N 3HSZA 1T05B 1RP5A 3TW0A 5C5JA 1QUPA 1HW9A 4CF9A 1VQ6N 1Q86T 3LALA 1ZS6A 5ETRA 2ZJPQ 3Q0AA 5KFOA 2QL7B 2J8SA 5G0RA 5IC6B 2A40A 3FZ2A 3OTEA 4QR1A 1RT2A 3C6AA 3B82A 4CJ7A 1BMQB 1MMNA 4ECSA 2WOMB 4UQTA 2PMWA 1ZBSA 2RRAA 1KVBA 2NREA 3FCVA 4EUVA 1IR2A 4LFCK 3HVTA 4QIFA 1F5BA 3BBBA 4A2AA 1D5AA 3FK4A 4BHQA 5B0CA 1RACB 2DNMA 4CO0A 3QESA 4DTXA 2RHKA 1XWLA 4UOHA 1IKXB 2DR7A 1RWVB 5K8OA 4HHHA 3OYIA 2F8TA 4CTAB 2HVZA 2WSFC 4KR0B 1IKYB 2VG7B 5KQ8A 3O3HA 5IC4B 1OH8A 2V52B 1VBKA 3IWNC 3TSQA 1WN7A 5AQLA 2QX0A 4FYWB 2WVCA 3MN7A 3FVYA 1QD1A 3QJLA 2A2DA 3B4DA 1YITS 3GLJA 5LM7E 4Q5VA 4J9RA 1P8ZA 2E29A 2Z2LA 3UPFA 2XSFA 2YNGA 4GMKA 4K4WA 3VPZA 3L8BA 3O5TB 3BPSP 1BUXA 3ULEB 4NRTA 2G8FA 1M1GA 4XAKA 2K06A 2VPWB 2YWGA 4MMOA 2AJQA 3G6EN 4CLSA 4FJHA 3M1VA 3E51A 5C2DA 3LA0A 4WK3A 4ZK7M 3DHXA 5EUHA 5HRRA 3ZT3A 4FLVA 3R5DA 4DF4A 1RHRB 1T3VA 2XC9A 1UP1A 2ASOA 4HTJA 1IBMK 3ZZZA 4IRDA 3TVZA 4H03B 3RRGA 2V68A 2GUPA 1U1NA 1WC4A 2B9XA 3POTB 2WVEA 3WQTA 3H08A 2QWNA 2MLYA 1FRKA 4DL6A 1L3TA 2JGUA 2XLKA 3CJ4A 4DHYA 4JI8F 1ZH5A 2V4JB 2A42A 3OLBA 3BP8A 2UXDK 7FD1A 3RUBL 5AQUA 1M1HA 1GLDG 3K57A 4KHPJ 1PJ6A 2ZKUA 2WK4A 2XNRA 5I3UA 4DR2J 4BGBA 3TAMB 2RU9A 5H1SV 2MKSA 1M90T 2F9DA 4F7VA 1CJKB 3VEWA 1Z05A 4DV3J 3HLUA 4L3KA 3WNHA 4J9OA 2OD4A 3TWZA 5DK5A 4O8KA 4B9NA 4O3RA 2A6OA 2QLWA 1RABB 4JS4A 3M8PB 4OLPA 3OHRA 4J2AA 3JXUA 4JAXA 1VQMS 2EFQA 1SJ1A 1HD1A 3OTOJ 4IFVA 1Y11A 4NLYA 3QZ7A 1TKTA 3T19A 1SQGA 4X62F 4LF4J 3UR3C 5EVZA 2KB2A 3BB5A 4LF7K 1HBOA 5TKWA 4AILC 3SQ2A 1YIJS 3BO3A 1EWQA 1VQPS 4B3TF 1NSAA 5JVHQ 2YTCA 2ZBQA 3PHEA 1DY3A 2QWLA 3N6NA 1T6CA 1RK8A 2HBRB 4GY2B 4OI2A 3D0PA 2W25A 1U2VB 1NGFA 5ADZA 3FZBA 3PIPL 1NHVA 3OS1A 2MJNA 2ZH6A 1Q5VA 5E5NA 4YS2A 4I2QB 2F8SA 2RD5C 3FGVA 3BGFA 1URRA 5AQNA 4JK8A 3W64A 4BWJA 3HFVA 1F2HA 2ZM6F 1HNZF 3RYLA 3H2LA 3IG1B 2OFHX 2QKKA 1Q8LA 2R7WA 1K73O 1BHLA 2OZSA 2FJXA 5HQ8A 1CBKA 3C7NB 1IQZA 2KYXA 1P90A 4U8VA 4H4MB 1GLEG 3T1HJ 2VD3A 2R8HA 3MCSA 4KB7A 1IVZA 4E7LA 2HWTA 3PO4A 1BQXA 1NCLA 2E5IA 3CUNA 1VRUB 5T7LB 4R5PB 2ASYA 5M2UA 2Z0GA 1RT5B 1Y3KA 3EZOA 1YVNA 5AZJA 2QXLA 3EX7B 4TY9A 1H3DA 1J5EK 5KFBA 3MOZA 1SKUB 3SCJE 1PSDA 4DUZF 4E7JA 2Q3SA 1NMDA 3K89A 4LVNP 1EETA 2GV9A 3CPWR 4I2PB 1YJ9N 3AVNA 1FVQA 3E9LA 4CJFA 2CPHA 3EE3A 4EP4A 5LMUK 1S1UA 2IPOB 4B3OA 3SMZA 5AE2A 1OY6A 3MX5A 1DARA 4M3ZA 4PUOA 5K9FA 3L3VA 3J7AP 3OA9A 3RB6A 1XNQJ 2R8IA 1NJZA 1NNDA 1RDAA 1HD0A 4Y3CA 4P75A 1KXPA 3GTYX 1R8BA 2RHSB 5LL6Z 4MKYA 2DBBA 3FUYA 5DDQC 1E3MA 4KAZA 2B51A 4I1TA 1YQHA 4J9LA 2AQ4A 4PABA 1ULRA 5KOWA 4B08A 3Q83A 4DWIA 5AQIA 3RRKA 1NBWA 4PKGA 4CLPA 4KHWA 4RW6B 2DXFA 1JIHA 3LPYA 2UVWA 3FEZA 4KKOA 3DYAA 2FGCA 4CM0A 1MWZA 2P9PA 5CYJA 2UVUA 1HKGA 3FZLA 4CJ5A 3L7PA 4ZHRB 1LW0B 2V8DA 4KV8B 1SJ3P 3G8TA 4MKAA 1HQ2A 1FEEA 2VQEF 2LDIA 4KB1A 1CULB 1PKUA 2F7VA 4QJVA 3HSDA 1HWUA 3Q86A 1F3FA 3J8AA 1HNWK 3THPA 4A8QA 4RW7B 2V2VA 5J1NA 4EP5A 1PILA 4DZDA 3LAMA 2CDQA 1Z26A 3NAEA 4KHSA 5GIPA 5FLXO 3KK3B 4H5NA 4EHTA 4DV4F 1KVCA 1CVJA 5D4NA 4M63A 2HMIA 2PY5A 1EXQA 4LF5J 1SL0A 1RADB 5CZ1A 2ZVIA 4CIEA 3J7ZT 1EKEA 1HA1A 2KDOA 3G8QA 3NGDA 1F6TA 4OPAA 3IMXA 2MYFA 4CRJA 1RDBA 3ENHA 3ILJA 3DJCA 1VCTA 4IFEA 3GFXA 3HPHA 3TJ9A 3GG0A 1SJQA 2ZBRA 4NA2A 5BYSA 3ELHA 1OQ6A 2AA4A 3KKSA 3WIVA 1RT2B 3AT1B 5HATA 1U24A 3EWGA 4RR5A 3NMAA 1A5VA 4NXMK 3GIMA 3IR7B 1X5OA 1NHUA 4KRWA 3V6DA 4KPCA 1HBNA 3HKWA 1RHMB 2R2UA 3CDAA 3VZIA 3OR1A 3U3GA 4AYBD 2WTFA 3HVTB 3D6RA 2ATLA 4OZ5A 2WCXA 2DXDA 3IM9A 2XGQA 2BQRA 1EWRA 3V9ZA 5E84A 4YDUC 4DPWA 2DY1A 1TQLA 1JLGA 4RCHA 1HNXJ 3CG7A 1RT3A 2BGGA 4JYAF 4CFAA 2V9WA 6AT1B 5F0UA 2KM8B 1UPMB 2D3O1 5EOYA 3U9DA 2QT7A 4P72A 3WX4A 3LGNA 1EX4A 4NYPA 4ILHA 3D2WA 5D4OA 3A0IX 3K7RA 1NSKL 3PJWA 3RBDA 2GBZA 4JI6K 5CCLA 3TA2A 3AAPA 2YNGB 2G2OA 5JICA 5F8LA 4USHA 3AY9A 4DUTA 4DV6F 3J81j 3PW5A 2AJ4A 1WJ9A 4L75A 3QFWA 1WHYA 2HHTA 3M1VB 3VAJA 4CJEA 2A18A 1VQKS 1UVNA 4TLQA 1RAIB 2FVCA 1FTRA 4DR1K 1FJEB 3Q89A 1OVYA 3MWTA 4O8UA 3A3PB 2DEJA 4PXCA 4GW6A 3ENAA 4ELVA 2AJ0A 2UU9J 1I1GA 2KJVA 2PZSA 3MEDA 2MDAA 4U9RA 2DNHA 1N33K 4PY5A 4E89A 4FJGA 5I3PA 2YNFB 4DV1F 1YJ7A 4QYZJ 3VEYA 2BJ8A 5T14A 4RNOA 2FC8A 4ZLPA 3C3LA 5GAEP 4A48A 5CYQA 1RU2A 3BKTA 4USTA 2HHXA 2OEMA 3O1BA 3HK2A 3C94A 2HF3A 3BR8A 5I3UB 2V2QA 2FVRA 3CCVS 3RAQA 3KK7A 1S10A 1XHZA 3SQ1A 2W8LA 2ATCB 4DCHA 3VQ8A 3VWSA 1X9SA 3RMCA 5BR9A 4KI6A 1S72N 1PIEA 3NS6A 3N5FA 2C2DA 4C7QA 5KFEA 3PO5A 3O80A 3C95A 1QQMA 4NPOA 1CQMA 4R25A 4GVLA 1Z25A 4IFVB 2Z1JA 2VF3A 4OI6A 2GC8A 1TKTB 3Q8SB 4GC6A 2HVDA 3ENWA 4ZCMA 3QRQA 1L3UA 3WBZA 5GADU 2ZWHA 1RTHA 2HB5A 1HBOB 4X64J 3BS9A 1TGOA 4ZS6A 1G1XA 4PWUA 1HLUA 3FFKB 3UD3P 2O4GA 5C24B 2CJQA 1WWHA 1K8KA 3VGKA 4H0TB 2HS3A 2VOPA 2C3OA 3W63A 2WZ1A 1J6ZA 1SJRA 4CLTA 3W5XA 1VJWA 3QPIA 2D0CA 3HHEA 2DISA 4IEIA 4DV7J 2GIQA 4N47A 1NMNA 1IWGA 2CPEA 2ZQBA 3CMAS 1JLAA 3H1QA 4XDDA 5D4PA 3GPAA 3AVIA 2QW9A 2ZGZA 2HWHA 4Y2MA 3T9NA 2RQ4A 1YDLA 4G3IA 1JNZB 5L1KA 1XMQF 4CYUA 2NXCA 4WIQA 4FF4A 2GV1A 5B0FA 2KG1A 4WTOB 1JMTA 3OYMA 4ZVRB 3MPYA 4ZPDA 1HYZA 1F5CA 2DGTA 3JB9k 4BQZA 3Q2SC 4F3MA 3VQBA 3W5ZA 3M6UA 1MLAA 3QFUA 4Z0UA 1H72C 5AXLA 1U45A 2SXLA 3C6TA 3ZTQA 5AQXA 4ZTFA 2WFBA 5B0AA 5HVGA 5AZJB 4QW9A 4EU0A 3B8HA 3KLVA 1YVUA 4KHPK 3ZNUA 2DRAA 1RWUA 2MSSA 4C48A 2ZZTA 3OTBA 1EETB 3A12A 4OHYA 5C0YA 4CBXA 4Z4CA 2B8QA 3BYRA 1O5JA 2XI3A 2RVJA 3DOMA 1S57A 1RBTA 5HP1A 3NLCA 1S1UB 4DV3K 4B3OB 5F9NA 1VQ7N 4FWQA 4JI5F 1HARA 3CJTA 4FPIA 4F0HA 4PUOB 4GKJF 2DNQA 2RRNA 1KBRA 4NEYA 3V4IB 2BABA 5C12A 4KFBB 5BYRA 2UP1A 2D3ZA 2FZGB 2KVIA 5E3PA 2UUBJ 2AEMA 4IDHA 3J7YU 4UOGA 3L09A 3KHLA 1NPKA 5IV3A 2XSJA 2IJFA 1I51B 2G8VA 1N0UA 1ZBLA 1WG5A 3LZIA 1YJWS 2Y3YA 3T6JA 1U6BA 5A8WA 2QMWA 1Y4ZB 2FD2A 3T5JA 4KKOB 2FY8A 5FD1A 2BUPA 2DR6A 3DYAB 4DL7A 2YNHA 2P9PB 1RAOA 2FJEB 1HIYA 1GNKA 1QS4A 4CDIA 3BSOA 1TL5A 1RBVA 4CZLA 2CH5A 2B4VA 1RDRA 1XQSC 3ET6A 4LF2A 4USWA 2IA0A 4FWLA 4F4YA 4UF4A 5SUHA 3PVXA 2MHNA 1S12A 3H7HB 1GOBA 2DTUA 3TA0A 4JI4F 2HMIB 4LUBA 4ZKAA 1WDTA 4LF8J 2WC9A 4WQ4C 4CHZA 3L3CA 2W7AA 4BR2A 3WXIA 3OYEA 1Q95G 2L9DA 1YLXA 4JI7K 2BJEA 2YKOA 4NXNK 3AVCA 3KK2A 3T1HK 2C2NA 3M8YA 4KHNA 3NNCA 2YKMA 1VIOA 3KDNA 3W1YC 3C6UA 1CS4A 3AO5A 2HFSA 3W9JA 5ETVA 4ZMMA 4H0VB 3HJVA 2B9YA 3TTFA 4CBUA 5JVGQ 5E26A 2MQQA 2HVHA 1KVAA 3M1FA 5J2MB 3VA0A 4J7CA 1S0OA 3WX8A 2IVFB 1RHQB 2QYGA 4RU9A 3V6DB 4Y2IA 3VQ5A 3AAWB 1VRTB 4BRLA 1SCJB 4ZVGA 1FNOA 3OR1B 4Y1DA 4PXEA 1OJ4A 4J2EA 5KFZA 3M8ZA 1NGDA 2KKZA 4ZDNA 4X65K 4DOZA 3HVRA 2EKNA 1JQGA 4FYYB 4Q0BA 3VERA 4YY3J 2CNKB 2X6NA 1NJYA 4C3MA 2LEPA 3GJQB 1EO1A 1R8HA 3GSIA 3OQ2A 3H5XA 1RT3B 4A57A 2K1RA 2PI4A 1CZBA 4M3YA 4S0MA 1WACA 1I94F 4WWSA 1X3MA 4X62J 5HOOA 4P7TA 3IGNA 2FZCB 3HD1A 3CCLS 2EFVA 2O8BA 1ZPVA 2GEMA 3JXOA 2FDNA 4I6YA 4WBFA 3WNEA 4E7IA 2F8MA 3KG1A 4B3TJ 2HOEA 3JAMU 4MIWA 4IQMA 3PCOB 1R31A 1XMOK 3CC7N 3JTPA 1VMBA 3BR9A 5GMEA 1JXEA 1WSFA 2NZCA 2ZNYA 2A10A 1XR5A 3TZWA 3V9UA 2AIRB 4X84A 2FC9A 1TUGB 3AO1A 4B3RK 2DRDA 1QHTA 1ZA1B 1AXQA 4YOTA 4FO0A 4RBTA 4DCJB 3E66A 4OHWA 2MKCA 2B8PA 2ZM6J 4CEAA 3BZCA 3M9OB 3OYDA 3EO3A 1RXOB 3H5UA 3M6WA 4HT7A 2ZH1A 4NLTA 3OYGA 3MN9A 4A8OA 3MEDB 4ZCLA 5KFQA 1QY7A 4MAKA 4JHDB 4F9OA 4AL6A 1RTZA 1LWXA 2ZH3A 3BKFA 1OSDA 2ROEA 5CR4A 3CPEA 3PR5B 4OZNA 3LWLA 5M1FA 2A6MA 5CYQB 4DR4F 3E9OA 3I9ZA 5HRSA 2ERRA 4BC3A 3GV8B 1SUQB 2GVDA 2WB4A 4O3QA 4ILLA 4YDDB 2MKKA 1NGCA 1KQFB 2YHXA 2QLFB 2QLBB 2ZNZA 3M8QA 3BY5A 4DUZJ 4PPZA 2WAQD 1FESA 2MQMA 2E6LA 2C1EB 5KPZA 2EPIA 2KXFA 5CAAA 3I55N 1LEOA 3SUPA 4YB7A 3CQ8A 4Z2XA 3BH7B 2YHWA 5KT3A 3IA0A 4MFBB 1JJ4A 2OLWA 2KRBA 1RWOB 1YTUA 3G4SS 2DGQA 2KW4A 1RTHB 1S4FA 2BYCA 4DMNA 2LEAA 1RGIA 3SIPB 3QJPA 4KHMA 3ISNC 2H51B 1GLBG 1K8KB 4CF2A 3MCMA 3CPWM 1M5SA 1WSHA 4EIAA 3H20A 3TJ8A 3VVTA 4UUXA 1J2VA 2ZZNA 1FW6A 4H8KA 4OLAA 1DTTA 2LXUA 4ED1A 2HEKA 3O8WA 4PL8A 3GG1A 3ISZA 1R89A 4DU8A 1W7WA 1WF0A 1PC4A 1JLAB 2VQEJ 2JX2A 5KT5A 1GLLO 2CQPA 3AA8A 1A9NB 5KAKA 3QMLA 4JKDA 4E1MA 1SS6A 1RTDB 2FBVA 4CYUB 2GNKA 3IFRA 1CLQA 4DV4J 5D6GA 2VQFJ 4B9UA 2VODA 2UU9K 3D5MA 3K2YA 3TQEA 1WELA 4DQ8A 2DTJA 3PV8A 3VEOA 5IM0A 2RN2A 2YQ0A 1K0VA 4B3MF 4AXJA 1U1LA 4HUGA 2KT5A 2UUCK 2HRTA 3KJQB 4ZVQB 4DQSA 2EWSA 3C6TB 3CCJS 2YWKA 2E7XA 3P5JA 1HW8A 4URSA 3VGLA 2Y1IA 3ZX2A 2BV3A 1RAFB 4AUKA 1UAXA 1UVIA 1UPPA 3AA3A 2K3KA 2ZZMA 1HPZA 2F1FA 3DOMB 5AQSA 2FY1A 1VQ4N 5HP1B 3UIQA 3I82A 1LWEA 4DR6K 4U67Q 2E9RX 4K50A 1UVMA 2L3MA 2DYAA 1VR6A 1D8ZA 5LMNF 2GQCA 4UW2A 4DTSA 3FGUA 4LF9F 3T1YF 3F73A 2CPFA 3QT8A 2HZAA 4JYAJ 2N7CA 3HKZD 3QT6A 2XSJB 3G9CA 5CYMA 1HQUA 3HZGA 5CZVA 4X64K 1NXIA 2JOQA 4NEZA 3DI6A 4RW9A 1WEXA 5A8WB 4C11A 2RDJA 2J4RA 3PXGa 2H48B 3AD8C 1OPIA 2YNHB 4E1NA 4IFYA 4HUFA 1DQ8A 3AVHA 3ZO7A 1OSCA 1Q4RA 2HKEA 3AVFA 3EVOA 4FJ7A 9ATCB 3FZMA 5CH7B 3W61A 4QWAA 3GE1A 2V63A 2LQ8A 4P52A 3HHKA 2C3PA 2RDIA 4DKWA 3CJSA 2EK6A 2F4FA 3ET6B 1YZ7A 3MPUB 2PT0A 2KU7A 5CABA 3W2VA 4CEBA 3D3BJ 1RT1A 3TO8A 3PX0A 4E7KA 3CDBA 1IKWA 2HNYA 2PA3A 3C14A 4AHSA 3MM6A 3CO9A 2XMJA 2B43A 2DD8S 1QE1A 1UZDA 4ELTA 3D54A 2NLXA 5ETQA 4CEZA 3DXBA 1PJ5A 2NUHA 5U47A 1NEEA 3EZ5A 1ITGA 3A8JA 1ZM9A 3VALA 4DL5A 3KK2B 2CGLA 2W40A 2YKMB 1GLAG 3C6UB 1CS4B 3G6VA 2HK2A 4DV1J 1EARA 2MMYA 1JLCA 2VC1A 5M1PA 1C0TA 1LWFA 4DPOA 2XLIA 1DURA 5KRSA 2CH6A 2QKBA 2P6SA 4F4WA 5HL7Q 2FQQB 5DG9A 4KHYA 2RE1A 1TL7A 1YTAA 2Q31A 1SI9A 4A46A 1J54A 4KHUA 3V9WA 3FC9A 1JCGA 4LFCF 4Q0BB 4YB1P 3KLIA 3UKUA 1QM9A 4WU2A 2ZBIA 3TVKA 3ULHA 2K1RB 3AVAA 3TA1A 1A5XA 3GP9A 4Y0FA 1I6JA 4EZ9A 3CCUS 4ICLA 2HZCA 4DR3K 2UUBK 2HBZB 2F65A 4PG6A 4EO8A 1XBWA 3VAFA 3QFPA 1U1OA 2YWFA 1QSYA 1UMJA 2O8BB 1NKEA 3J81O 2HHWA 4IKFA 5IT4A 5FPDA 2OD6A 3JSBA 3MECA 3DRPA 3T1AA 3EVMA 2ZBCA 3H0PA 2E7WA 5F41A 3KWGA 3IS9A 3BJYA 4CWBA 5DZ6A 3SNNA 1UVJA 4JOUA 5L1IA 4DS4A 2DFHA 4JV5J 3H42A 1BL3A 5M1OA 1WSGA 3RBXA 4CD3A 2V94A 2MHEA 4OYXA 2BJ9A 5KRTA 2YPYA 1TR0A 2Q36A 4J5OA 3AQOA 1XMQJ 4FZYA 4LF8K 1LW2A 2R7RA 3BF3A 1FRHA 2VFRA 1R43A 2HWIA 5HRNA 1RKIA 2Y9HA 3HOSA 3OUYA 3AOAA 1IBKK 2MEWA 3WUHA 3HCXA 3FBEA 2YHAA 3H3NO 2BJ7A 4WP8A 3W9HA 1FF2A 3LZJA 3AVBA 2UXDF 3UNGC 2ZH4A 4ECUA 2HBYB 2GVDB 4IKAA 1HQEA 2AJFE 4K2JA 5B8HA 2DHGA 4YEAA 3VQ9A 4P9SA 5KT4A 2E4LA 3S3NA 2P9IA 3BGLA 3KLHA 3M8QB 1WHXA 2HQGA 3VGUA 2X7IA 1FKAF 3RB0A 3WEEA 2NPIA 1OYDA 2A1SA 1WF2A 1X1PA 4NLCA 3PACA 4YY3K 4OMFG 4DSIA 3MR7A 1JL1A 1K8AT 3GJSB 2RS8A 2XEXA 1G4CA 3CWJA 4FN5A 3JTNA 5JVHL 4WKRA 4BRPA 1P9QC 2FPHX 1H2TZ 3A5LC 5LOQA 2RKIB 1WOQA 4K4UA 2FUG9 4LF7F 4ETZA 2EG1A 1AB8A 3U02A 1NGIA 4P74A 2VWBA 1QVGR 4DX6A 3MK6A 4WYLA 2VICA 4ZVOB 2QK9A 1DTTB 1EKSA 4DN0A 2F96A 2AX1A 1T9WA 1PYOB 3NCQA 4KYZA 4BRMA 4CZMA 3IM8A 1O13A 2YJEA 3MM5A 3TUPA 1X0PA 2BEFA 3DDKA 2HGLA 2V0NA 2BXJA 2FVQA 3MCPA 3MFHA 4ITSA 4TSXA 2OTJS 2MQNA 1S77D 2OSRA 2XNQA 1Q7LB 2E8AA 2HFOA 1XIQA 1RLDA 2V5HG 3OTDA 5AQJA 2EC2A 2IFXA 4CGGA 1FWPA 1IBLK 2GWKA 3AJDA 2J5AA 3MAAA 4ENOA 1WBBA 5IM0B 2YNIA 1KP6A 4QZVB 4OX9J 3FMWA 2V6AA 3DLEA 4DSKA 3TAEA 4DQPA 3SQ0A 3HL8A 4U7CA 4QIWD 1X3NA 3ATVA 2D1KA 3BUZB 1YKWA 3RSEA 5LJ5Y 5BREA 5HJYA 4CH1A 1J5EF 1TVRA 5L9NA 1ATNA 5EXWA 5LJ3Y 4OGCA 1HPZB 4ECTA 4QCLA 3NGZA 5DLFA 2NRZA 5LMUF 3S3MA 1KOOA 2W2PP 4OKJA 2F4VJ 3UQSA 5F3TA 1GXTA 3LW5C 1HHSA 4KB0A 3V9XA 2P5VA 1XERA 3CCQS 1DEJA 3GWCA 2DH9A 1U6FA 3HULA 4A8YA 3HJFA 2DR5A 1DRZA 2W7PA 3LDPA 3H5SA 3PFOA 2GVZA 2OPQA 3NAIA 5CYMB 1HQUB 4WE1A 3AD7C 2Q1NA 1I94J 2AYBA 2AU0A 3DI6B 4RW9B 2PO4A 2VH7A 4C11B 5GINA 2OPRB 3I0SA 2CQBA 3VGMA 4M7XA 2ZC4A 3GB0A 4IFYB 3CSKA 4B9TA 4HTIA 1ZAVA 4AFFA 4GRSA 2G13A 4WQ5C 3UCUP 4M3RA 2IGIA 3G82B 2P8IA 2ZHBA 3NE6A 1J5OA 3VHQA 2Y0SD 1JXBA 1VHIA 2DCUB 4HYKA 1ACMB 3IWLA 5DM7Q 3TI0A 2KQ2A 2NPFA 5DLGA 3DWLA 1UWBA 3H40A 3W2VB 4DR5J 3M6GA 2XMWA 1RT1B 4L8RB 2CJXB 4DZ6A 1HNWF 5KFCA 1IKWB 3KK1A 2MTLA 3MM6B 1N48A 3SK3A 4FZXC 1QE1B 2VBZA 4YDUA 1S0VA 5BPMA 2B6AA 1SIWB 3G96A 1RYSA 4ATNA 4K0KK 1WTBA 1K6YA 3TX8A 2ZWOA 3K5NA 3A5NC 1Y5LB 5KPTA 5ETSA 4IOBA 5A2QU 1RB0A 5T41A 3GCXP 1Z4UA 4RKUC 4JI3J 4M42A 3KJFB 4AQYK 1PAEX 1JLCB 2DH8A 4C3LA 4Z4HA 4JD2B 1C0TB 1LWFB 3RGIA 4LF1A 2M2BA 1RQ0A 4WK1A 4NXMF 4AHRA 1SC3B 2ZJQQ 1GTEA 3OHAA 5D78A 3E9PA 2YKPA 5F9LA 4J91A 2BM0A 1B9DA 3UCZP 3K0JA 1FDBA 1RBAA 1QTNB 3ZSWA 2OEKA 4A8WA 2Y8WA 2NRWA 3KLIB 2ZDPA 1MU2A 2Q0UA 1KKHA 5ELZA 3UKUB 2E5LF 4CIFA 2QL5B 1KQSR 4DV0K 1GXLA 4J90A 2XYPB 2P9CA 1WF1A 3LH2S 3SV3A 1WSJA 4M63C 1LFPA 1N8RT 2CZVC 4ICLB 4KTZA 3SBGA 3FBBA 3CD6N 2DGSA 3AB2B 1K47A 5KGXA 3M8RA 3GV7B 1VK8A 4F04B 1ZBHA 4CIGA 3VQSA 3SUNA 1XQIA 2CPYA 2IYIA 4JI6F 2GTDA 5ETPA 2D5RA 3MGJA 4UQGA 3MECB 3DRPB 3TUJC 3PW2A 1VQLN 2PYJA 3R97A 2GIRA 5DO2A 4CLKA 4GKKK 4JI1J 3EE8A 2CQHA 3TX0A 5GAHU 4FPAA 3VAGA 3IS9B 3ONQA 3CYMA 4FNIA 3NGYA 4OZJA 4A8FA 1RCHA 4CJPA 1X5SA 3ZZOA 2ZJRQ 4U7UD 3MMAA 4KGKA 3CERA 3H4DA 1VBZA 2KFYA 4DR1F 1QAXA 2ABYA 2XHWA 4PPDA 1CEZA 3QNWB 1Y9OA 1QAIA 2WHOA 5KFHA 2X51A 4BRKA 4ID8A 3ZXWA 4ANCA 3WIUA 3JQMA 2C3YA 5KFDA 1LW2B 1H7XA 3D6TB 2E20A 2HGMA 4ALZA 4O55A 3IN5A 1FFSB 1N33F 3OUYB 1OYEA 2RUSA 1HR0K 3DNCA 1YHQN 1I3AA 1OH6A 1TYQA 1VQNN 3ZSVA 1M0SA 3MEEA 1CXQA 4A47A 4OL8A 5EY4A 3DDIA 2FJDB 3DRRA 3FE1A 1X60A 3E3XA 4YFUA 1RAJA 1H0HB 2KN4A 1HQEB 4QQBA 1T6DA 2JVRA 1PYTA 1U8SA 1QAJA 2ASPA 3NKYA 4N7TA 3KLHB 1HX1A 5BYQA 3HX9A 2JLGA 4GV3A 2HHPA 3WEEB 1W7AA 2FVSA 2FTRA 1U1QA 3DLJA 4KE5A 2W9CB 4ILMA 2RS2A 4D3GA 1ZM3A 4IEEA 5IS2A 1N5SA 4DQIA 4BCAA 2VGNA 1FWKA 4XPEA 4ZA1A 2DPJA 3FMBA 2IMOA 4UT4A 4V19X 2RILA 1C1AA 4O0NA 1B0VA 1XI1A 1U7LA 1YAGA 3NH0A 4CHQA 2MZJA 3RJMB 3MM8A 1S79A 4I56A 3AXMA 2CDRB 4CGJA 5AQFA 3ETMA 4DL0C 4Y2KA 4MDBA 4O3NA 4W5NA 3R1HA 2AYGA 3RRHA 2I1RA 2FHOB 1K9MT 2L08A 1VSEA 4F2RA 4CJSA 2HQIA 7AT1B 4X4VA 3MM5B 3AARA 3MTKA 1U2FA 3BSAA 2MGZA 1S9GA 2W9BB 3RTVA 3QEXA 3C2PA 1M5VC 2KL8A 4NLVA 2HS4A 3TSPA 1O8BA 4JV5K 5DDPC 5EWGA 2W01A 3CJ7A 1AT1B 3ZZUA 2CWKA 2IDEA 2APOA 2UVRA 4FS2A 1TTHB 3IRWP 3SQOP 2NQPA 3WC0A 1KVIA 3L2QA 4OZ0A 2CQ1A 5J2QA 2XMTA 1JLQA 4CEOA 3G87A 1S7HA 3M3ZA 2KXNB 1YBUA 4J9QA 4UOCA 3MAAB 3IUCA 1N5QA 1YITN 2YNIB 2EFOA 3PX4A 5DM6L 4ZITA 2IVOA 3HDSA 1BG3A 2J9DE 4CLZA 5EX0A 1KHWA 3DLEB 1YRTA 3L4IA 5HANA 2W2OP 3O4WA 2AGPA 3MXMA 6FDRA 3B6BA 3ISND 1VK3A 1TKZA 1IWAA 2IJRA 2ALYB 1JLEA 4H0XB 3A5OC 4PG5A 2PA8D 3RSEB 5BR8K 3GR1A 2DNPA 4WFYA 1N0VC 5GAGI 1KN6A 4W5QA 4KHPF 1TVRB 3BSNA 2IMWP 4O4GA 1MMDA 2P9NA 2CA9A 4WF9Q 3MCOA 4F26A 2AP1A 3ZTSA 4DR2F 4FYXB 3GFHA 5B7WA 1IBCB 3HYFA 4NZ7A 1F1BB 2EK1A 4KSEB 4DV3F 4P2MA 1PAUB 1U1KA 3QWPA 2NUUG 3GIKA 3UD5A 4M3TA 2Z1GA 3OT9A 2KXHA 2MZSA 5LXRA 4BGAA 1GEHA 3CEDA 2GVZB 1S1VA 4KQZA 2OPQB 1IV0A 1UEUA 4WE1B 3C65A 4WQ4A 3EM1A 2GIFA 3CE8A 4HI1A 2DY9A 3I0SB 5AQWA 1REVA 3D4JA 4BBYA 3ICLA 1X0FA 4H0YB 2KVQE 1EP4B 4MJKA 1ZOTA 3JSYA 4IH6A 4RUCA 1AFJA 2YBVA 4ER8A 2MQOA 3DU5A 1J5OB 3M2VA 3SCIE 2BQUA 1D3WA 1X4FA 3KNAA 3TZZA 1ATRA 3EDRB 4QIGA 1UWBB 1S59A 2CQ4A 4USVA 4RNFA 3WQPA 4LD0A 3KK1B 1S6UA 3W2WA 3FDSA 1V5IB 1S9FA 1MROA 2QI2A 2UUAK 2OP5A 3S01A 4I6AA 3EKSA 3VTHA 4K4YA 3ENBA 2HNZA 2B6AB 2QYCA 1K44A 2ZUAA 5DMRA 5AQZA 1IBMJ 4LR8A 1YIJN 1K73T 1A7GE 4WFNQ 2V34A 3D2EA 3WXMB 2C28A 3SFUA 3MUTP 4EHUA 1VQPN 2ZH8A 4JI7F 5BN9A 4NXNF 3BF1A 4OX9K 4FWPA 3T1HF 1KLMA 4W92B 1FDAA 1WHWA 3R5CA 3Q8QB 4ISFA 1W2IA 7FDRA 3V6HA 3AHPA 4I4BA 2E88A 2W4DA 1VAZA 2BRKA 1ZETA 4CF8A 2UXDJ 2HS0A 3NH1A 2U1AA 5KFFA 1V4TA 1FFGB 2IOCA 3TUZC 3DXKA 1VQ9S 4DDFA 4DU7A 3N6LA 3MFIA 2GELA 2N4CA 3CC2S 2KG0A 3I33A 4X65F 3O9SA 1MU2B 1FD2A 5KG4A 2PFUA 3UCGA 3E1YA 2F4VK 2V69A 4QU7A 2ZD1A 1LWCA 3R9LA 3VR1A 3RU0A 1YJTA 4M94A 1KTVA 1X5TA 3KKFA 4KJIA 3KHGA 3LDOA 1KAXA 3VF0B 4WCEL 1RBUA 2W1BA 2XQCA 5K20B 3O9TA 1PO6A 1UETA 2H1YA 2CPJA 2KFZA 2E1ZA 3D1OA 4LF7J 5JS1A 4KBIA 4DV2K 3CDEA 4ID1A 5DQHA 3C8YA 3RW7A 2NR0A 1TAUA 3QEWA 3B8AX 2B9EA 3CVKA 4WPAA 3PKYA 1XMOF 3LPEA 2CZ9A 3A13A 2AJ1A 1C0UA 1VQ5S 3GL1A 1M1KO 3U3YA 4DB3A 2EI5A 2OELA 2HIQA 2JSXA 2I0XA 1CC8A 2EWHA 2KZMA 2QSWA 3MMAB 4DR5K 3AVJA 4DMZA 3OPKA 1JXVA 4A8KA 4W5OA 2DNZA 1LOUA 3CD5A 3D68A 4B3RF 2VDHA 4WXOA 1AW0A 4AH9A 4FXDA 1NK5A 2HLUA 4QPTA 2IA6A 3GILA 1QVGM 4FJ5A 1RCXB 2BRLA 4B9MA 5E3CA 3TWHA 1FJ7A 1YXQA 3KG0A 4LFAJ 2ROPA 2JLEA 2ZGYA 5KG0A 3VEVA 2Y1RI 3RG6A 4NYFA 2CJ9A 1TYQB 3MEEB 1MWQA 1X8DA 3KMSA 1PJ7A 2I5JA 2M8HA 3M6XA 5B09A 3DRRB 1NAQA 4PEOA 1NH8A 2D3UA 2PMZD 3AVLA 3BEGB 2HHSA 1K1QA 5GAGP 1Q53A 1S4EA 2YCHA 2R2RA 2GCFA 5HMWA 3IDHA 3BH6B 3PRDA 5KPRA 4A8MP 1J5EJ 2VBWA 4EZ6A 2HBKA 2WB1D 3I5BA 3DXMA 3KOAA 1X7VA 1UJ6A 4FJIA 1W0HA 2BW2A 3HVWA 3NMRA 5LMUJ 4K4TA 1MWMA 4ED8A 2R7XA 4KBOA 4KI4A 4RUAA 3G6YA 5DRKA 2WSCC 5DDOC 2YPZA 1B7YB 3BDEA 4FJNA 4USIA 2EHGA 4CFDA 3SXLA 2QV6A 2NZTA 2F40A 3AD9C 4HL9A 4W4MA 1KLNA 3MXHP 3VQPA 1F0XA 4HH1A 1XC9A 3MM8B 1RAAB 2FHKA 2A41A 3ZEUA 1NB2A 3RBEA 2VL1A 3MZIA 1JKHA 4Z4IA 2M3DA 4FLZA 3O1WA 3G2XA 3VMFB 5CD4A 3O9QA 2FHJD 4HVZA 2QMUB 3CIPA 4N77A 4DR7J 3BO4A 1SKRA 4JI1K 1HWKA 1S9GB 2RIJA 2IC3A 1WLJA 3HI0A 4DPUA 3NG8A 1TL4A 4CVNE 4FJKA 2WW8A 4I7FA 3PJ9A 3FEXB 5L38A 2N7YA 5DG8A 3EPGA 1HNWJ 3UNYA 3ZT0A 2WONA 1U0SA 2VGMA 3CJKA 4RTFD 2RMLA 3Q22A 5J2QB 3M32A 1JLQB 3RZAA 1BQNA 5F8NA 4OI3A 2UU9F 1LAVA 4PA1A 3L7UA 2W2QP 2HQFA 2Q2RA 3SSRA 2ZEJA 1R8CA 1HLWA 1KFSA 4HACA 3R8EA 3VQ7A 3QIDA 4ZPVR 4HCCA 5DQGA 4CLYA 4U67L 1FRMA 2XI2A 1VQKN 2C42A 1BISA 5ETNA 1VSMA 4O4GB 2P9NB 1HI1A 5MLCQ 2JL9A 5ETTA 4KHRA 5DDRC 1RWPB 3EXYA 3B4MA 4ZJOA 3OSPA 1DLOA 3K5PA 4CO4A 2DB1A 4FF2A 4DU1A 2ZHOA 3R1LA 4OYAA 3I6PA 4JI0K 4DR6F 4WYBA 4PQAA 4DUYJ 4ZVFA 3ITHA 2CQDA 1FRXA 1UVKA 4TU7A 3W3DA 2E1PA 4OI1A 2Z2MA 2X1AA 3JAMO 5JLFA 4LIRA 5H9EJ 2OO4A 4R0JA 3HF5A 3FSXA 1YJNS 3ZZYA 1G15A 2L48A 2VHGA 2JWKA 1S1VB 2HVIA 1NLKL 1H38A 5BN8A 1NWKA 5GMDA 1WTFA 4ZCKA 4FLWA 3QRPA 2RNEA 4Q2MA 4C8NA 3NVKA 4X64F 3LUYA 4OYMA 5KFPA 1DJ0A 3CT9A 3OL9A 1GLCG 3CJ2A 3AOCA 4BRHA 3CCVN 2O8DA 1REVB 2QM1A 4PCQA 3VAKA 4IG3A 5RUBA 2D0AA 2R7SA 4CI0B 4NX9A 1B7FA 2O4IA 4J2BA 1HUXA 3KG4A 4H5RA 4ZCIA 1HRHA 1KQSM 1T7PA 3M2VB 1IO2A 4CJ3A 1X4DA 1YGYA 1M5HA 3K5MA 2P5OA 4FJJA 4K59A 4QBUA 4YUDA 3MWPA 3LP0A 4A8SA 3BGUA 3UDVA 4U95A 4CJRA 3W2WB 4V19J 4YORA 1FCAA 3L2VA 1MROB 4YDXA