1HNVA

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 137
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hnvA05
2OPQA 2FJXA 5F8NA 3H4BA 3QNNA 4B9NA 1SKRA 2JC1A 4LD0A 3RB0A 3QESA 1KVAA 3P5JA 1SUQA 3DLKA 4FVMA 3L2WA 3HXMA 2BE2B 1WAJA 3JYTA 5C42A 4CEAA 4CJSA 4WXOA 4CFCA 4O44B 1LW2A 1HNVB 4KHNA 1IH7A 4O44A 4M3YA 4YMEA 1JLFA 1HQEB 2GC8A 3OL9A 3UR0A 1TAQA 4NLDA 3RB6A 3K5MA 4IOBA 3V4IB 3HVRA 2C2RA 5HRPA 4O5BA 5HRSA 1N5YB 1S0OA 3ULDA 2B5JB 4MK9A 1TL3B 3MR3A 3V9SA 3OY9A 1ITGA 3MEEB 4Y2AA 2BRLA 5E41A 2W9AA 1XWLA 4PA1A 4EO8A 1RT7A 3ZSZA 3SFUA 2OA8A 4NLQA 4KO0B 3HL8A 4M3TA 3ZSWA 4CF0A 3O4QA 3CFRA 5KFBA 1CXQA 5HROA 4R5PA 3NGYA 4CESA 4XO0A 1WSGA 1R0AB 4BWJA 5C5JA 2YNFA 1TKTB 5J2QA 3QGIA 1RT3B 2IA6A 5J2MA 4YNQA 2R8IA 4DTUA 3H2LA 1DTQA 2JEIA 3PX4A 3QIOA 2HNYB 3KK1A 1K1QA 1K1SA 4ECWA 4B8CA 3CJ2A 3RMDA 4O3QA 1C6VA 3OYLA 1LAWA 4FJ9A 4CJTA 2A1RA 4MKAA 1JLEA 1B9FA 3BDPA 1SL0A 4WYWA 5JXSA 3TI0A 5HP1A 3CWJA 2W9BB 3NF7A 1L3TA 4ED3A 4M3WA 4KB0A 3THVA 4RNFA 2KW4A 1RTJA 4FLWA 3F9KA 3OYGA 4DQRA 1SKSA 1J5OB 4F4WA 3VQ9A 1VRTA 3KTQA 3V9XA 4YR0A 2W8LA 3PX6A 3MF5A 4TY8B 4DL2A 3DOKA 3KHHA 3EYZA 2P1JA 3ZSOA 3KD5E 3ZT3A 3OYFA 2C2DA 5J2NA 1KCFA 1NHVA 3C6UA 4H4MA 2WOMB 1HNIA 5FROA 4J9OA 5CZ1A 5KT5A 3FQLA 1FK9B 4QWAA 2XWYA 3OJUA 1C0TA 4C8NA 4EP4A 1J5OA 2W8KA 4AHVA 4RW6B 1HQUB 4K8ZA 1S1UA 2D41A 3AVNA 2X6SA 1U4BA 1QHTA 4GVMA 4EBDA 4FW1A 4FJJA 3T5LA 3QLHA 4E1MA 4F2RA 3ZT0A 4OPKA 3RMCA 3H40A 2QV6A 3M8SA 1RTDA 3S3OA 2I5JB 4ED6A 4IFVB 1JLGB 4HCBA 4J2AA 1RT4A 4K4ZA 3V1OA 2OPSA 4KV8A 4OKJA 3O4NA 1GOAA 1NOYA 3I5AA 2D3UA 5KG6A 3DMJB 3LP0B 4J9RA 1C1CB 4KHWA 1C1BB 2YNGB 3N6LA 4E7HA 4OL8A 1S5JA 3HSTB 1VK0A 2IM1A 4Q5VA 4CECA 1WSEA 2DFHA 4FXDA 4UQGA 3K2PA 2VA3A 1JL2A 5F9NA 3SQ2A 4FBTA 1J53A 2GUIA 1TKXB 2E9RX 3AVHA 3TAQA 5C25B 1RT7B 3AVMA 1NK9A 5KFTA 2G8VA 4IG3B 4O3OA 3K57A 4RW4B 4EBEA 4DU4A 4CIEA 1EETA 4AHSA 3KLGB 4IBNA 4KTWA 4AILC 2VWKA 3CFOA 3TAGA 3RAXA 1ASVA 1YVUA 1BGXT 5C24A 3QIPB 4J2BA 1S9GB 2XO7A 1ZBUA 3L3VA 3GYNA 3DLEB 2HHQA 2BRKA 5DQHA 4AHCA 4Q8FA 4GMJB 4JRPA 4B3OA 3KNAA 3DLBA 3KLEA 4NLYA 3VA0A 1HQEA 4DEZA 3M8QA 1QUVA 3AVFA 3LPTA 4RW9A 2AWZA 3AA3A 3BGRA 3LWMA 2OPRA 4C8MA 5KFKA 1VSMA 3K58A 2JEFA 1N6QA 1RDAA 1SV5B 2E4LA 3P83D 1RDRA 4LSLA 1IKVA 1ZBFA 2BE2A 4DQIA 1T05B 3OL7A 3KK2A 3UDLA 1S1VA 1VRUA 4CJQA 3IS9A 3UIQA 4KHMA 5J2NB 4F4YA 4NCGA 1HNVA 2FJVA 4NLPA 3BSAA 1S1TB 3NAEA 4LH4A 4YR3A 1IKWB 3HVWA 4KHUA 3AVGA 4CGGA 2OYQA 4Z0UA 2XRIA 4R8UB 1RT2A 3OS2A 4I7FA 2UUWA 4CGIA 1FK9A 1TKZA 2IDOA 4DU3A 3OL8A 3ALYA 4CJKA 3C94A 3DYAB 2YNHB 3SZ2A 5D3GB 2XI3A 1GX6A 3PZPA 2B6AA 4Y34A 2X74A 1S4FA 2Z1JA 4KAZA 3ZT4A 1RCHA 4KHQA 3KJVA 4DFMA 4OKKA 3SQ0A 4YFUA 3PY8A 4KSEB 4AHRA 4E7LA 2IBKA 4ELUA 5C25A 2IC3A 2QXFA 2JC0A 4NLRA 1BCMA 4NRUA 5K14A 2ILYA 3AO4A 1A5WA 1W25A 2FBVA 4Y1DA 3IGVA 4M41A 4CHZA 3T5KA 4CFAA 4H4OA 3OLBA 1IKYA 4B9TA 2BANB 2R8KA 1D0EA 1WSFA 1QTMA 1VSFA 4DSKA 2AJQA 3GV7B 4NLVA 2V4RA 5KFNA 5KI6A 4DSLA 2HHVA 4ZPCA 1LW0A 2O5DA 2UVRA 4O4GB 4CK3A 3KOAA 3AVAA 1ZETA 4Q8EA 1RT5B 1TKZB 3V1QA 4RW7A 3MEGB 1J54A 2RF2B 2YNHA 2NUBA 3KIOA 3S3NA 3LP3A 5KGXA 4DL4A 1F21A 1BIZA 3HVTB 1HRHA 1SKWA 3H59A 2PZSA 1UAXA 3VN5A 5CYQA 4M3RA 4F4XA 5KGWA 3LDSA 4CJ5A 3KJVB 1NHUA 1ZBHA 1B9DA 3AO3A 2W9CA 2FVRA 1K6YA 1BQNB 2ATLA 1JX4A 2WRMA 3KMQA 5KG0A 3V4IA 3LP2B 1TV6A 2IAJB 2OZSA 2HHXA 1G15A 3MEDB 1CXUA 1U45A 4IH7A 1EXQA 4ELVA 1RT6A 1SL1A 1RYSA 4IRDA 2D0AA 2D5RA 1BQMB 4IR1A 3P1GA 2UVWA 4J9QA 4DTXA 1HYVA 2GIQA 5SWMA 4WYLA 2CKWA 1RT5A 1EX4A 3FQKA 5KG4A 3RB3A 2ITGA 4N41A 1C1AA 4TYBA 1KVCA 1TV6B 4N5SA 4OPJA 3MTKA 2XY8A 2YHAA 4IH6A 3LANA 2W7PA 3PV8A 4ZPAA 4NLXA 5KFEA 1RTJB 3OYIA 1Q9XA 3T19A 1ASWA 1S1XB 4J9PA 3RTVA 3L2VA 3HPOA 3ZT1A 3JYTB 1LWFB 2VA2A 4YP3A 5JS1A 4NYZA 5KFYA 3H5UA 5DG9A 4M94A 4KREA 3AVBA 2VG7A 4WFYA 3ZCMA 4CEQA 2ZD1B 4RUAA 3N6NA 3F73A 1CLQA 1Z26A 5KFFA 4AHUA 4M42A 3JSMA 5KFHA 5HLFA 1FXXA 3QEVA 4KFBA 5KG5A 4NCGB 4DG1B 5HBMA 3CVKA 4CJ4A 1QQCA 2RDIA 2OH2A 3MXMA 4DU1A 4N47A 1JXEA 4IQXA 1ZTTA 3MFIA 4IRCA 4FJNA 1NOZA 1JL1A 4ECRA 1BL3A 3LP0A 3AO1A 4Y1CA 2BQ3A 4N56A 4I2PB 4H54A 4TY9A 1MU2A 2EC0A 4J9LA 2HHWA 5C42B 3C6TB 4KV8B 4E3SA 4B3OB 1WSHA 4KHRA 4MH8A 4NYFA 3SYZA 2W7OA 2BR0A 1JLAB 2VG6B 2F8TA 3EZUA 5KFVA 4F50A 2F96A 3SQ1A 2OPQB 4RW8A 4CF1A 2ALZA 2D0BA 4EZ9A 4NLWA 1KFDA 4TQSA 3VQ5A 3OHAA 1NJXA 3ICLA 1TVRB 3T3FA 4DTNA 2YKMA 2FLPA 4WFXA 4QCLA 3IS9B 2HVHA 1VRUB 1U49A 4FJHA 4YQWA 2VWJA 2ZKUA 3B6PA 4CHNA 4CEFA 1DTTB 2HMIB 2RKIA 3LALA 4DQQA 2XY6A 3VQ6A 3NMAA 3NDKA 1QSLA 4FCYA 3BQ1A 1C1BA 2YNGA 4DMNA 3E01A 3KLHB 3HP9A 3H5XA 3HKWA 4B9LA 2R2TA 1XR7A 1TKXA 5JUMA 5CZ2A 1TP7A 3RRHA 4K8XA 2HB5A 1TK5A 3PR5B 3KLFA 5KFZA 4ZHRA 4RNOA 4F4KA 4HUFA 2RKIB 5L1LA 3QYYA 1DLOA 4I2QA 3V6DA 1JXLA 4FLVA 5DK5A 2R2SA 2E9ZA 3QETA 4E7JA 2BDPA 1VSJA 3TR8A 3SUNA 4O3NA 3L8BA 4TQRA 1TVRA 5KT2A 4DS5A 5J1EB 5KFDA 2BQRA 3VQ8A 4F3OA 3OS0A 4O4RA 3I0RB 4Q43A 4K4WA 4NYNA 5KFQA 2ASDA 1DTTA 5KFMA 4Q44A 2AGQA 1NJYA 4MKBA 3TAPA 1OS5A 4NLSA 2WCXA 4KKOB 5KFSA 3KK1B 3IN5A 3OL6A 3BSNA 4K50A 3HT3A 4IKAA 3GIMA 4I9LA 4O0JA 4DS4A 2ZQBA 3AVKA 4KRFA 1IKWA 4DL5A 1KLMB 4EBCA 1D5AA 2EX3A 1JLCA 3NH2A 3T1AA 4K4TA 4F2SA 4MFBB 3ZSVA 3SQ4A 3KK2B 4W5RA 4E19A 3V6HA 4ZTFA 1JXBA 2WK4A 1L5UA 1TL1A 4ED2A 3MECA 3KLVA 3KLIA 4FBUA 1BIUA 3UQSA 4HTUA 3D5MA 1T7PA 3NL0A 2ASLA 2YHBA 3NE6A 3OYBA 3OHBA 4CEBA 3EPIA 5F8HA 4ZHRB 1YVFA 2E9TA 3QEIA 1JLFB 2F8EX 1WAFA 5F8GA 3QZ8A 1HNIB 4FZXC 5FDLB 3G10A 1J9AA 1SL2A 4RZRA 2W9CB 2P51A 1RTHA 4URQU 5T14A 2AX0A 2E6MA 4ED7A 3VQSA 5J2PB 5L1IA 1BHLA 5J1EA 3MFHA 5DGAA 4CIFA 3C95A 1O1WA 4EYIB 3AO2A 4RNMA 3HPGA 5HRNA 1RBSA 4RW7B 1SH3A 5KFOA 1SUQB 1BI4A 2DFFA 3SNNA 2HW3A 3KLFB 5I42A 4MK7A 4BDZA 4HUEA 2YNIB 3DLGA 3IRXA 4Q0BA 4IFYB 1S97A 3KHLA 4XIUA 3MXIA 1RTHB 5DGBA 4ED0A 1FKPA 3DRPB 3VQ4A 2KZMA 1NNDA 3V6DB 5KRTA 2XC9A 3M9OB 3PW5A 3TQ1A 4MK8A 3QIDA 4C8OA 3IAYA 3PUFA 5FRNA 5KT3A 3K59A 1ZYQA 3RMBA 3LP2A 4KHSA 5KRSA 2AU0A 4ZVGA 4JS4A 5F8LA 3RR8A 3PW2A 2EHGA 1U47A 3NBPB 1NKEA 4FJ8A 3G0ZA 4M3UA 4FLUA 4ZTJA 4FS2A 2QKBA 1WNEA 1KLMA 1TKDA 4K4VA 3MEDA 5KT7A 4CGJA 2R8HA 3DLRA 4Z4CA 3I0SB 2HHUA 4QW8A 2IAJA 4NLUA 3I0SA 1KTQA 1RA6A 1UA0A 4LSNA 1C0UA 2D0CA 3DOLA 1I6JA 1EETB 1S9FA 4O0IA 2O4IA 1RTIA 3HM9A 1HARA 4PQUB 4J9NA 1GOBA 5KFUA 2JEJA 4CGHA 2XHBA 1IM4A 4GC6A 4HVJA 2D3ZA 2UUTA 3CIZA 4NZ0A 4K4UA 3NAHA 3OSNA 2IJNA 1HJRA 1JLQB 4DFKA 4DG1A 4CFBA 4G3IA 4DQPA 2IM3A 3T5HA 4ECXA 4IRKA 3SI8A 3I8DA 4I9QA 4ECQA 4J9MA 4ZPBA 5HLFB 1N48A 3RRGA 3VA3A 4BWMA 1RDDA 1JIHA 5KFIA 1A5VA 3LZJA 1L3VA 1S1WA 3QGHA 4FJKA 3DRRA 3U3GA 2KFZA 3QEXA 3TAMB 2RN2A 1L3UA 4KI6A 1D8YA 2YKMB 4GC7A 4ZP6A 2JGUA 4ICLB 3NF9A 2YV0X 5HP1B 3LAMA 5KG3A 2GV9A 4CJUA 4CJLA 4ECUA 1C0TB 1RAJA 4Z4IA 4OVLA 4E1NA 2B6AB 3RB4A 2ZD1A 3V81B 1QAIA 4ZPDA 2V0NA 4KBIA 2CJQA 1QSSA 4RUCA 4TXSA 4FJGA 3FRZA 2AGPA 1CSJA 1ZBIA 1Q9YA 5EUHA 1BISA 3NGIA 1TAUA 1S1XA 4I2PA 2HWIA 1TGOA 1S6QA 3QGGA 2HNDA 4FJ7A 3AVIA 4U7CA 4B8AB 2D7SA 2FBYA 3CFPA 2VG5A 1NK8A 1S9EA 4CEEA 1GOCA 3CYMA 4NCBA 4O4GA 3B6OA 3H5SA 1XR6A 1SV5A 3I5BA 4F4ZA 4LSLB 1NKBA 3MAQA 3D0PA 1IKXB 1RT1B 3FFIB 3KLIB 1RBRA 2B5JA 4JS5A 4BE2A 4JLHA 4Y3CA 4RW6A 1HYSA 3HVTA 2WONB 3CDUA 4LY7A 2BANA 1REVA 3ITHB 4WE1A 1T03B 1RT6B 1X9MA 2Z1HA 2G8KA 3SUPA 1Y97A 5KFCA 4O3SA 3PR4A 5F8JA 4X2BA 2PYJA 2KQ2A 3VQBA 2J6TA 2R7YA 2WTFA 3NCIA 4C8KA 4QW9A 5C24B 4CHQA 2QKKA 3KHRA 4IR9A 1LWEA 3M8PB 2WHOA 4CEOA 5T7BA 4ELTA 1SH2A 2Z1IA 3JSMB 2Z1GA 3OYCA 4FZZA 2G8IA 4DTSA 4ZP7A 1LWEB 3M8PA 2XY5A 4FK4A 2HHTA 3QEWA 3OYMA 4WXWA 4U6PA 5FDLA 3ISND 2GBZA 3NH0A 3BR9A 1VSLA 2OZMA 4BE1A 1S1WB 3ZSXA 2IC3B 2HNZA 1RBVA 3NHGA 1X9SA 4LQ3A 1A5XA 1NK0A 4CJVA 4KTZA 1LWCB 1HYZA 1D9DA 1IKXA 1RT1A 4Z4EA 3SV3A 4KB7A 2AQ4A 4QAGA 3ZSQA 1DLOB 2HHSA 3EZ5A 4DSJA 3GIJA 4TSXA 3Q8QB 1TK8A 2FLLA 2FJWA 2V4QA 3CJ5A 2P5GA 4DTPA 2WOMA 3WNFA 3VQCA 4AH9A 1N6QB 5KFLA 1LAVA 2G8UA 1C2PA 4E89A 4QWCA 4F8RA 1T94A 2FBXA 1RT3A 1TL1B 2RDJA 3TWHA 2IM2A 3KLEB 3M8RA 4PWDB 4HCCA 4R5PB 2HMIA 3SV4A 1S1VB 2IMWP 1JLBB 5D3GA 3DLEA 5DLFA 2BQUA 3VQPA 1RA7A 4DSIA 1UOCA 1NK4A 2PY5A 2G8FA 1YTUA 2BGGA 4IH5A 2B4JA 2OPRB 3PHEA 4DFPA 4OKEA 2GIRA 3S9HA 2R2RA 3KK3B 3H08A 4DWIA 4KI4A 1ZTWA 3MEGA 4B9UA 1JLBA 3PX0A 4FW2A 1N4LA 2FVQA 1T05A 4KKOA 3UPFA 5F9LA 1QE1B 2DTUA 4LQ9A 4W5OA 3DM2A 1VRTB 4K4YA 4EYHB 3SJJA 3A2FA 4JV1A 4CE9A 3NGDA 3PW4A 3CM6A 2QE5A 4HYKA 2XGPA 2FVPA 2FC0A 5KFPA 1JLEB 3U6FA 5I3UB 5F8MA 5I42B 2W9BA 3TAMA 4TN2A 1W9HA 3TABA 4H4OB 2ASJA 1R0AA 5KFAA 4L8RB 4IDKB 3GV8B 4FLZA 1QE1A 1X9WA 3K5OA 3NGZA 1S48A 3QLHB 3D45A 2R8GA 2X78A 3VQQA 2PYLA 3SPYA 3IRXB 4R8UA 4Z4HA 4Z4FA 2YNIA 3DLGB 1YTAA 3U3YA 4J9KA 2FBTA 4CGFA 3PJWA 4IG3A 2X6NA 4ECZA 4W5TA 2YNFB 1S6PB 3FDSA 1MMLA 4HKQA 1NK6A 4KO0A 4Y2CA 3BSOA 1QAJA 1RTDB 5KG2A 4XPEA 3CDWA 2YKNB 1CZ9A 3AO5A 3BQ0A 1RTIB 4PY5A 3L3UA 4JRQA 3M9NB 1S1TA 4CK1A 4CEZA 3LAKA 4RW8B 5L9XA 4NCAA 5KG1A 4ED1A 1FKOA 5DQIA 1N5YA 4DL6A 4WFZA 5EWGA 4CEDA 4TY8A 2VG6A 5HRRA 4AHTA 4ECVA 4B08A 2G8HA 1JLGA 1KFSA 1REVB 3ITHA 4XPCA 2WONA 3HJFA 2UVUA 3C6TA 1S9GA 1BQMA 4FK0A 2FLNA 3RWUA 1I39A 3CJ0A 3HVAA 2IS3A 1KHWA 4Z4GA 2RPIA 3DDKA 3M8QB 2W42A 3OVNA 2Y1IA 1T8EA 5KFXA 3VQAA 3LPUA 5L1JA 4DSEA 3KD1E 4BDYA 3QIPA 1RBTA 1S6PA 3DLKB 1TK0A 4KB1A 3HHKA 1KLNA 2UVVA 1LWFA 3ISNC 4CF8A 4RW4A 1D9FA 4MIBA 3AA4A 2YKNA 4IG0B 4NRTA 3NKYA 3IG1A 2HNZB 4FJMA 5KG7A 3AV9A 4QOZB 3Q8SB 5HROB 2IM0A 1KHVA 5F8IA 3DRRB 2FVSA 1KSPA 4F3TA 1BI4B 1WLJA 3DLHA 4EP5A 4IDKA 1LW0B 5KT6A 4DLEA 3V1RA 4OJRA 3KMSA 3OYKA 4KE5A 2G8WA 3MEEA 4FLYA 2KTQA 2C2EA 3GIKA 1BCOA 1UA1A 2HVIA 4B9SA 3OYAA 3RR7A 4O3RA 4GW6A 1HQUA 4TYAA 4DTJA 4NLOA 5KTQA 1RDCA 3PO4A 3I5CA 4ID1A 2OPSB 2DPIA 3KHGA 2VG5B 4CHYA 3MR6A 1RYRA 5I3UA 3OJSA 2ZE2A 3DRSA 4URSA 1BQNA 4FYDA 4ZP8A 4PUOA 3SI6A 1HYSB 2I1RA 1S0MA 4JV0A 1QSYA 1W0HA 3E51A 3SFGA 3MR2A 3PVXA 4NLTA 4ED8A 4CJWA 4QWBA 3EY1A 2LSNA 1RDBA 2DY4A 4JUZA 3H5YA 4K4SA 1D1UA 1JLAA 4WZMA 5KT4A 3H98A 4DLGA 2HWHA 2AX1A 4ECTA 1RBUA 2ATQA 4B9VA 3V81A 3LP1A 4K4XA 3KKRA 2FVCA 1XHZA 3S3MA 4I7FB 4RNHA 3KK3A 4KTQA 3BJYA 1RT2B 1U09A 3MR5A 4IKFA 2IGIA 3I0RA 3G6YA 2Y1JA 3DOLB 2WB4A 4DFJA 3HPHA 3CJ4A 1Z4UA 3Q8RB 4FLTA 3PW7A 3V6KA 3DOKB 4DTRA 1JKHB 4OLAA 3QZ7A 3CJ3A 5DQGA 1NK7A 2R2UA 4RU9A 4ZP9A 3NFAA 3V9UA 3CO9A 3D28A 4O55A 1IKYB 3L2RA 3N6MA 3VQ7A 4CCHA 4E0DA 4WZQA 1WN7A 3OYJA 1FKOB 3O3GA 1B92A 4ECSA 1Q8IA 1LWCA 3HO1A 4CJFA 1HMVB 4CF2A 4FLXA 4QWDA 1VSKA 4OLBA 3K5NA 4FS1A 4ID5A 1TKTA 5J2QB 4W5NA 3CDEA 3AA5X 3GIIA 4I2QB 2E6LA 4CGDA 3QNOA 1FKPB 3DRPA 5L1KA 1ZBLA 4ZVEA 4EO6A 4DTMA 4RNNA 1RNHA 4DL3A 4ECYA 4IG0A 4Q0BB 2J6SA 4KFBB 4PQUA 1XI1A 4M3XA 1DTQB 3E01B 3KLHA 3RBEA 4ZVFA 3H4DA 5J2MB 1KRPA 3SUQA 4QWEA 4DQSA 1LV5A 3V9WA 3TAEA 3QERA 1CZBA 4FZYA 3TVKA 3OLAA 4RG8A 4BACA 3QO9A 2VG7B 2OPPA 3ASMA 3OYNA 4ZMMA 3OYHA 4M95A 4W5QA 2KFNA 2XI2A 1T03A 3NAIA 3ZSRA 3DI6A 3G6XA 1GX5A 3IGNA 3MECB 1C1CA 4YR2A 2XY7A 4C8LA 5DG8A 4J9SA 1LW2B 3T5JA 3L2QA 3GQCA 4EEYA 4LSNB 1C0UB 3OYDA 4PUOB 4KHYA 1TL3A 2J6UA 3FFIA 4CJRA 3HP6A 4CF9A 3MXJA 1VSIA 3SCXA 2XCAA 5KFGA 4FK2A 3DM2B 1XC9A 5CY4A 2P5OA 1S9EB 3GILA 3AA2A 1S10A 4DTOA 4FJLA 1VSEA 3LWLA 1NJZA 3VQEA 3HK2A 4H4MB 2Q3SA 2XCPA 2F8SA 2XGQA 4IFYA 4CIGA 1S1UB 3V9ZA 2KZZA 3Q8PB 3KLGA 3QINA 3NBPA 3G86A 2V9WA 2DPJA 2OPPB 1TQLA 3LP1B 4FM1A 1WSIA 3BQ2A 3HYFA 3PJXA 3WNEA 4MFBA 1VSHA 4DL7A 3NF6A 1NJWA 4MIAA 1QS4A 1T3NA 3QO9B 4CK2A 4J2DA 1WSJA 1S6QB 3L2UA 1L3SA 5HBMB 3LZIA 5CYQB 3AVLA 5KFWA 4E7IA 5CYMA 3NF8A 1X1PA 2JEGA 4FJXA 4B9MA 4ICLA 5KFRA 3TARA 1N56A 3ZSYA 4QPXA 4TLRA 4Q45A 3K5LA 1NK5A 1HPZA 4E7KA 3O3FA 2R8JA 1ASUA 3V6JA 3OYEA 3CM5A 4FJ5A 4IFVA 2I5JA 5JS2A 2HNYA 5SZTA 1SH0A 4FM2A 5J2PA 5EWFA 1C0MA 4OGCA 1U04A 4BDPA 2B43A 3DMJA 4MQ3A 5FRMA 1I3AA 4O3PA 3ZT2A 3OS1A 3GV5B 1UWBA 1XR5A 5KFJA 1HPZB 3DYAA 3BREA 1RT4B 5DMRA 4CJEA 3KKSA 2C28A 3WNHA 3OSPA 4G1QB 4WE1B 3WNGA 1Z25A 1JLCB 4CFDA 2HAIA 1YT3A 3RBDA 2DFEA 4CERA 3CQ8A 4BE0A 4URGA 3G6VA 1VSDA 3RAQA 3NH1A 4CHPA 2RF2A 2IJFA 3SUOA 3TAFA 2O4GA 4M3ZA 1KVBA 1WNSA 4LH5A 3C6UB 2C22A 4CJ3A 3M9MB 4DF4A 3PO5A 5EWEA 1XHXA 2JLEA 3BGRB 4RW9B 1S49A 4G1QA 4ZVHA 1IO2A 2ZE2B 3DRSB 4H8KA 5DLGA 3DI6B 1EKEA 1RILA 4NLGA 4KPYA 3AVJA 4OGEA 4EZ6A 2QK9A 3O3HA 3RMAA 3TANA 2A1SA 4CJPA 4PWDA 1IKVB 2IOCA 5K14B 3CG7A 1UWBB 3SPZA 1MU2B 2ILZA 2AGOA 5EU7A 5EDWA 4FM0A 2HNDB 1NKCA 1HMVA 3EPGA 4CHOA 4DSFA 3QEPA 3VQDA 3FSIA 4M45A 5DG7A 1JLQA 4KAIA 4N76A 4DF8A 4FJIA 1IG9A 4HUGA 4R0EA 1S0NA 3AVCA 1JKHA 4JV2A 5CYMB 3BSCA 1U48A 1EP4A 4ID5B 3IG1B 4J2EA 4HHTA 3PW0A 1EP4B 2ETJA
chains in the Genus database with same CATH superfamily
3FUYA 4M63C 3QNNA 2JC1A 3M30A 3CCMS 4LD0A 1SUQA 4YOVA 4NA2A 5C42A 4CEAA 4WXOA 4CFCA 4O44B 5C2CA 4P2FA 1LW2A 4EWTA 1YK9A 3HCXA 4O44A 5LXRA 1Q4RA 2CDQA 2NRZA 1H2TZ 4M3YA 1FWLA 5HATA 1TAQA 5BN9A 3FBFA 4NLDA 4QU6A 2YI1A 5HRPA 4ZIVA 1P9QC 3CE8A 1SCJB 3ULDA 3HTVA 3MR3A 5D78A 3MEEB 2QL7B 2BRLA 5BXIA 2R7VA 5LSLA 2BEFA 5D4NA 4OX9J 2C42A 1FDNA 1RT7A 3SFUA 3ZETB 3O4QA 5A8KB 2MLYA 5ITHA 4R5PA 3NGYA 4FF3A 1TKTB 5J2QA 3VR1A 2R8IA 5BYSA 2ZWPA 4IJAA 1JCGA 1CZAN 3SMSA 3K5PA 3AAWB 2HIQA 1FVQA 3BYPA 4AFFA 4B8CA 3CJ2A 4O3QA 3B8AX 1C6VA 4ISFA 3OYLA 4CJTA 4MKAA 5ETTA 2F9WA 1JLEA 2JVOA 1B9FA 3NF7A 1PC4A 3FZKA 3OYGA 4DQRA 4HDGA 5EX0A 1J5OB 4F4WA 3BS9A 3QBCA 4PRFA 3D2FA 3S6EA 1J5EK 3PIPQ 4TY8B 3WIVA 4CO2A 3KHHA 3BPSP 2J0SD 2DGUA 3B4MA 3KD5E 3BH6B 3BZCA 5I3PA 5B09A 1M5OC 3HZGA 3OYFA 2EBGA 1B0TA 4X62J 4YOEA 1F3VA 1WC3A 1HNIA 4J9OA 3OTOK 4B1ZA 5I9EB 3EXYA 4C8NA 4QIFA 4RW6B 6FD1A 1AZSB 5CA5A 4G65A 2HFVA 4GVMA 1SKUB 4EK2A 1SI9A 5IS2A 3RMCA 2QT7A 1RTDA 3O9QA 4ED6A 3AJDA 3BYRA 4HCBA 4LF7J 3G87A 3V1OA 2OPSA 1Q1KA 4OKJA 2EI5A 3MAHA 8RUCA 3DMJB 4OYBA 1C1CB 2HRYA 2XMAA 3UR3C 3VV2B 1JB0C 1Q86T 3F5TA 4OL8A 4U8VA 2NYIA 3KJFB 1VK0A 1WSEA 2G1DA 1W7AA 1OH7A 2BJDA 4WQ5A 3HX9A 4ED4A 4BHQA 3G82B 3HHLA 5F9NA 3SQ2A 2XSJA 1WOPA 1ZPWX 4FBTA 3PRVA 1J53A 1I3OB 1RT7B 1A0OB 2U2FA 2HIYA 3EDQB 2G8VA 4IG3B 4O3OA 4DX7A 4RW4B 1EETA 5CD4H 3J7YU 2B56A 4IBNA 4KTWA 2VWKA 4B9QA 3D7EO 2PEHA 3THPA 4YDDB 3IFRA 3AXKA 2HG4A 4XAKA 2HHQA 1H0HB 1CJVA 1VQ7N 4WIQA 2AJFE 3TZXA 3S41A 5BYQA 4WCEQ 1NGAA 3CETA 4GMJB 3SLCA 4QS8A 4B3OA 3ZC4A 1VI7A 3I32A 4DEZA 1FEHA 1QUVA 2J0XA 3S01A 2NR0A 3V2UC 1S79A 3HSZA 3QBXA 5KFKA 1YX2A 2GWJA 1VSMA 4M1KA 3P83D 4IXCA 4LSLA 1ZBFA 2BE2A 3QSYB 4Y28C 3VGUA 3UB5A 2LA4A 3KK2A 4ZITA 1VRUA 4CJQA 2A5XA 5A8RB 4CDIA 5D4PA 3BSAA 1S1TB 4LH4A 4YR3A 1IKWB 3HVWA 2VZ9A 3AVGA 2RAQA 1K73O 4H0OA 4A5BA 5IM0A 3IWLA 2UUWA 4MMOA 1FK9A 2CQHA 3OL8A 3D1OA 4USJC 1XNRF 3C94A 2YNHB 2XI3A 4C11A 1GX6A 3NGSA 4F3QA 1WOOA 4OKKA 2Q97A 2Z56B 2P9NB 2ACMA 2A0FB 3J81O 3PY8A 2ZM6J 3C6HA 3CJ8A 1V4SA 2GMHA 3M2VA 4ELUA 4E7LA 4JI2J 5AQGA 3TUZC 4JI2K 2Q31A 2A42A 4NXNK 4JI3K 1RWKB 4NRUA 5K14A 5AE1A 4GKJK 2IY5B 2MY7A 2Q6BA 4Y1DA 3RBZA 4DI6A 3J7A1 5IV4A 3VGKA 4B9TA 2PGCA 2AJQA 3DJCA 1IJEB 1VQNS 4DR6J 3GV7B 4TU9A 1CQMA 4DR2J 3A8JA 2K06A 1S59A 1GTHA 4NLVA 2HHVA 3AD8C 3W64A 3MM7A 5DS7A 2UVRA 1HPMA 4DV7F 5GADU 3UW1A 3GFXA 3R5JB 2IRXA 4B02A 5HQ8A 4YS2A 2YNHA 4O0NA 5LMNK 4GO7X 2ZBCA 5KGXA 3HVTB 1RWNB 2PZSA 2UU9F 5AQIA 4CQ1A 4F4XA 5KGWA 4CJ5A 4AUKA 3I4HX 4LF9K 2W9CA 4I6YA 5AFUH 3UNYA 3KMQA 3V4IA 1YRUA 4DDFA 4B17A 4CM0A 3EL2A 4Y6IA 1IWAA 1WD6A 4TLQA 1U45A 1YJUA 4DX5A 4TU7A 4HHJA 2PA8D 4X4RA 3BO2A 3W2WA 3EZWA 3H7HB 2MKJA 2FY1A 5LJ3Y 4IR1A 1F9EB 3RGIA 1HLUA 3HHLC 2FF3B 4BS2A 2CKWA 1RT5A 1FDAA 5KG4A 7FD1A 4JK8A 4N41A 2H51B 2B8QA 1HNWF 2NUUG 1TELA 4OPJA 2MKCA 3CQXA 4IH6A 4ZJQA 4BG8A 5KFEA 1P6TA 3HF5A 4DV5F 1Q9XA 3T19A 4J9PA 3NRBA 3L2VA 4KHPK 4ENOA 3HPOA 4L74A 3ZT1A 4CLFA 2VA2A 3UCGA 4B3SK 3AVBA 3I33A 3ZZOA 2ZBQA 2VG7A 2DNLA 4DR3J 4CEQA 4YY3F 3N6NA 1CLQA 4F7VA 5ADZA 3JSMA 4KH5A 1FO1A 1MA9B 3QEVA 1CBKA 1RGVA 4KFBA 2NXNA 5GAGI 4WFNQ 1M90O 5HBMA 2G9OA 2RT3A 2QYCA 4CJ4A 1QQCA 3U9DA 3KHYA 1JXEA 1DQAA 3MFIA 4CT9A 4F36A 2DO0A 5AE3A 5AR0A 5BRHA 2L3MA 1N0UA 3HSGA 4D3GA 1VIXA 5AQKA 3LP0A 1WELA 2R42A 1RAHB 1IXKA 2BM0A 3D3CJ 5EX3A 2HHWA 2YPYA 4ES1A 3IKMA 4NYFA 2FHJD 2DB1A 2W7OA 1RAIB 4Y2IA 1JLAB 2W40A 2G13A 2G4BA 3C2PA 2QX0A 3SQ1A 3W8PA 4CF1A 2ALZA 2D0BA 2V6AA 1NJXA 3ICLA 1AUDA 1NMNA 2H5JB 3OR2B 1HBMA 2HFSA 5DDOC 3IS9B 1VRUB 4FJHA 2KYZA 2VBWA 4CHNA 4JKGA 4CM2A 2HMIB 3IC1A 4DQQA 1VQ8S 3LPEA 4HI2A 2V4JB 1UAWA 2V51B 3OQ2A 4QPTA 3PRBA 4FCYA 1S12A 1C1BA 2YNGA 4DMNA 4FWQA 1N33J 4PXEA 4QS7A 1VLOA 1N33K 1TKXA 4Z7YA 1YDLA 3H20A 4ETZA 2HB5A 2F4FA 3PR5B 3KLFA 1R0BG 5KFZA 4RNOA 4CO0A 4I2QA 1IV0A 4JHDA 1JXLA 2HZCA 3T7ZA 5DK5A 2E9ZA 3QETA 4ZPTR 3GE1A 3L8BA 4M5DA 1TVRA 4RUBA 3DLLL 1ZC6A 4BR9A 4F4AA 7AT1B 2NZ4A 1DTTA 2RMLA 4DR1K 1YBAA 4MKBA 2QM1A 4DR7J 4NLSA 4KKOB 5LJVA 3GMGA 3A8YA 3HKZD 4DR2F 3OL6A 3BSNA 3HT3A 3JSRA 4O0JA 3GIMA 3CJCA 2ROGA 3AB4B 3AAPA 3AVKA 1N33F 2ZC4A 4YEAA 5IM0B 3W5XA 1LFWA 3AAQA 5AQLA 3CCES 3T1AA 1I94F 4K4TA 3TA2A 3UI3A 3CQYA 1OYEA 3BUZB 1VQLS 1HBNA 1DQ9A 1NSKL 4XH1A 1NBEB 4PL8A 2BUNA 2C3PA 3V6HA 1FJGF 1XQIA 1L5UA 1RACB 2XHWA 4C7QA 4ED2A 1BIUA 3TUPA 2HBZB 3NL0A 2ASLA 2XMVA 1HHTP 1H38A 4B3MF 2H1YA 4HEA9 2KN4A 3OFEA 2K2PA 3QEIA 1JLFB 3E66A 3QZ8A 4FZXC 2XWXA 2EXUA 3G10A 1J9AA 2WC9A 3DRXA 5AZJA 3ILLA 5T14A 3THWA 1UEKA 4KH6A 1HKGA 1WEXA 3QMLA 5J1EA 2OGUA 4ZVOB 3BGOP 4CIFA 3G6ES 3C95A 4IOCQ 2RQ4A 1DEJA 3SCJE 5JMNA 3HPGA 3BDEA 4FXVA 1VQ4S 1FXRA 4QZVB 1TYQB 2YJEA 1ZBTA 1URNA 2ZM6K 3DRYA 2DFFA 6AT1B 4L3QA 2M70A 4BDZA 3AGKA 2ZFHA 4LR8A 1UKUA 2B4VA 3L09A 3SQGA 4IFYB 1QTNB 4XIUA 4ZLLA 3A5OC 4PG5A 3CMES 4ED0A 3QRQA 3VQ4A 3V6DB 3PTWA 2OTLS 2ZBIA 3QIDA 3CJQA 2LFVA 3BPDA 1X5PA 4JS4A 3RR8A 3OTCA 3PW2A 5DO2A 5FLXY 2EHGA 2VONA 2B4PA 1EKSA 3ULHA 3DXKA 3OVSA 4K0KJ 4FJ8A 2YX1A 3G0ZA 2XHCA 4I4BA 1WNEA 2L9WA 3ENOA 5E3PA 4NXNJ 2O66A 4F0MA 4YOTA 1WTBA 2HHUA 2IAJA 1RQ0A 2P5VA 1RA6A 1UJ5A 2V34A 4FWPA 2X3GA 1KN6A 1UA0A 2H3GX 4PPZA 1C0UA 2UV8A 2B9XA 3DOLA 4I64A 1QVFM 2QA1A 1GMWA 3CJSA 4O0IA 4J9NA 3J81U 4CGHA 4BRQA 2XHBA 4GC6A 3VEZA 2GIFA 4HVJA 2UUTA 1EJ7L 1YSJA 4BC2A 1IG8A 2FPHX 3CJ7A 1P27B 2ABYA 3IR7B 2R9LA 1WOSA 2IJNA 4DFKA 1JLQB 3MCSA 1HJRA 2H5IB 3CCSS 2F40A 2GO8A 4HACA 4CTAB 4G3IA 3BR8A 2H4YB 4ECXA 2C3OA 4ZPBA 3I4PA 2E7WA 1N48A 1Y9OA 3C16B 1DT9A 3IFEA 1S1WA 2JLFA 1TL7B 4CIOA 4L3NA 1OQ3A 2BVZA 1RUSA 2XMJA 3JQMA 5K9FA 2YV0X 2O8DB 1CJTA 2ASMA 5HP1B 3LPYA 4DV1F 5KG3A 3IXQA 5CH7B 3D0HE 4DV0K 1RHKB 4E1NA 4A57A 5BPNA 3V81B 4ZPDA 2V0NA 1QSSA 4RUCA 3LOUA 4M5KA 4Z7CA 4WKRA 2VQFF 1QUPA 5HK4A 1ZBIA 1S3XA 2F3JA 4DX6A 3BEGB 3Q7BA 4RX6A 1S1XA 4BROA 5ADXA 4I2PA 5KOXA 4JI4F 2HNDA 1UVJA 3KFWX 5F2RA 3AVIA 3K8VA 4X66F 1F2HA 4CZGA 1NK8A 3I55S 3R97A 2B8PA 3H5SA 1SV5A 3MK6A 5GAEI 4F4ZA 2RJZA 3OUYA 2VPZB 2G0JA 3MAQA 3D0PA 2QA2A 3KLIB 1RBRA 2B5JA 3VEVA 1J5EJ 1BWEA 3CDUA 2BANA 2OMOA 1RT6B 2RRBA 5ETVA 3PR4A 4C0HA 5BR8F 5F8JA 1GLEG 2RE1A 3UD5A 5F0UA 1N88A 3VQBA 2R7RA 1K8AO 5D6GA 4F26A 2R7YA 3CDAA 4QW9A 1RADB 5C24B 2P9PB 4IO8A 1LWEA 2WHOA 4WKYA 2Z1IA 1LQ9A 4LVNP 5HANA 1RHJB 1LWEB 3CJBA 2ZZMA 4ZCIA 4U6PA 3BR9A 2H3EB 4LF6J 3TO8A 3MM5B 2OZMA 2OEMA 4TNOA 4RL1A 2P9UB 1Q0NA 3NHGA 4A4JA 1FTCA 1NK0A 2OEJA 2F63A 3LDQA 1D9DA 5BR8J 5M1KA 1WSVA 2AQ4A 3O5BA 1EARA 3ZSQA 3PYGA 4YB6A 3GIJA 3EDRB 3U1LA 1H73A 4TSXA 3U8XA 4QOTA 2YCHA 4HT7A 3PG9A 5DJBA 3D2EA 3CJ5A 2P5GA 2E5LF 4RBVA 1V3SA 2YWWA 3VQCA 3BGLA 2G8UA 4UY85 3B6BA 3VEXA 1AXQA 3FK4A 2IM2A 2MZTA 4PWDB 1JQGA 2V2ZA 4HCCA 4R5PB 2I8EA 2ZWOA 4JI6F 1JLBB 3B54A 3W1YC 3RVCA 2CADA 1HNWK 4DSIA 4FOEA 3V4MA 2ZZNA 4BR4A 1F5AA 1NK4A 2EFNA 2PY5A 1Y10A 2V2VA 4MTPA 2FQQB 1BG3A 2GGPA 3OFHA 3KK3B 2UXCF 4MKVA 4DV4K 3WX4A 2ZJQL 2VYPA 3MEGA 4B9UA 1QE1B 2OEKA 1FJCA 2E2PA 3H3OB 4CJ7A 2YHXA 2VHGA 2P8IA 3OTEA 5A6WA 2HBLA 3SJJA 3CJTA 5IC4B 1HD0A 4JV1A 1XNQK 5JVHQ 2M2BA 5M2PA 3FZFA 3MZIA 4HYKA 1RI7A 1XBWA 3IWNC 3U6FA 2VGMA 3R6LB 5I42B 2W9BA 3TAMA 2LECA 4QYZK 5AQXA 1UVNA 1W9HA 3TABA 4H4OB 1B64A 5KFAA 4GKKF 3KJNB 5CR4A 3P45B 2MKIA 1GLBG 1S48A 3JXOA 3QLHB 3UVJA 1DQ8A 1MLAA 2R8GA 3VQQA 4CZJA 3CHWA 4LF6F 1H72C 4IG3A 2KJVA 4OV6A 4ECZA 4ER8A 1OWXA 4W5TA 2PD1A 1NK6A 4ZK7M 3E9PA 4DR4K 2E1YA 4FVUA 1RTDB 3GE9A 4XPEA 1WC1A 4JOUA 1YQHA 2N7YA 2JLGA 2KRRA 3BQ0A 2RHKA 1Q5YA 3L3UA 4FPRA 2J9DA 1BXNA 1VC5A 4FYWB 3LAKA 2HVZA 1DZ5A 1FKOA 2ATCB 5DQIA 3X3UA 5EWGA 4DR4F 1LK7A 5HRRA 4ZS6A 1JLGA 1BUPA 3SCLE 4DR6K 1REVB 3ITHA 2ZOMA 3HJFA 3C6TA 3IWXA 5GAHU 3AJ1A 2GQQA 1RBOB 3RWUA 2ZJPQ 2COLA 3LTOA 4DR3F 4FO0A 3HVAA 3K89A 4WU3A 4PKIA 1JNRB 3J81j 4MYTA 1QY7A 4P6QA 3RW7A 2W42A 4LRAA 4NOHA 1Y4ZB 3I55N 3KD1E 1RBTA 2J7WA 3THYB 4KB1A 3HHKA 3DDIA 4A8OA 5FPDA 4BRIA 5CQGA 4X62F 3K0SA 3ISNC 2DR9A 1YI2N 2F9JA 3NKYA 2I38A 3IG1A 3E3XA 4FJMA 2MPUA 3AV9A 4QOZB 5HROB 3CI5A 1KHVA 5F8IA 1K44A 4F3TA 1BI4B 2P9EA 1WLJA 2VOPA 4B3SF 4EP5A 4IDKA 1LW0B 2QFJA 3NNHA 3KMSA 4CO1A 2HVDA 3OYKA 4USVA 3QRPA 2KTQA 1T02A 2MJUA 2C2EA 2HYIB 1UEUA 2HVIA 3OYAA 3HFVA 3RR7A 4DQ8A 2RRAA 3I5CA 1FW6A 3VF0B 5HMWA 3KHGA 1HBOA 1RKJA 4OI2A 3CF5Q 2KHCA 1GQEA 2P9IA 3HSDA 3IRWP 3J7YP 3F56A 4ZP8A 2HFNA 2I1RA 3SFGA 1OYDA 3PVXA 5M1NA 1IBMJ 2P9NA 4CZEA 3OUYB 3H1QA 2XYGB 2LSNA 3FR0A 4H5NA 2JJ4D 5D77A 2DY4A 4EMDA 4X62K 3MEKA 2PAVA 4DLGA 4AL5A 4M5LA 4QBUA 2AX1A 5LJ5Y 4B9VA 3KKRA 1XHZA 3S3MA 4KTQA 2B3TB 3RAMA 4IKFA 2J9DE 3TJ9A 3G6YA 2Y1JA 5DM7L 2OP5A 1RU1A 1W2IA 1Z4UA 4FLTA 3CJ3A 1NK7A 2R2UA 4OHVA 1GXUA 3NS6A 3ELHA 2WBNA 1TUUA 5GMKa 1WKKA 4E0DA 4WZQA 4QIGA 1RHUB 1FF2A 1FKOB 4ILJA 5EOYA 1JMTA 2WVBA 1LWCA 1F1BB 4CJFA 4UUWA 3VAKA 4FLXA 1VSKA 5ETOA 2XMWA 3ONQA 4QWDA 4OLBA 2O8CB 2VD3A 4PG4A 1B0PA 4ID5A 2V69A 3TJAA 2QZ8A 3MR7A 3AA5X 4LF2A 3GIIA 2V67A 4CGDA 4HI1A 4C1NK 1GLDG 3QNOA 3ZNUA 4DTMA 4IG0A 1ITPA 2AYGA 1TL4A 4KFBB 4PQUA 4LF8K 3BN7A 3CD6N 1DTQB 1U6BA 5AFUA 3E9LA 1A9NB 1KRPA 1JNZB 3FMBA 1WUAA 3I87A 3NCRA 2HBQB 3ATVA 3QWPA 3QO9A 2H5EA 3CJKB 2CGLA 2W01A 3ASMA 4M95A 2WVFA 2XI2A 3ZSRA 2Z57B 3DI6A 3CIMA 5DM7Q 1GX5A 5AZIB 4E2FB 1RWWB 2H4WB 3MECB 2XY7A 1LW2B 3L2QA 2RU9A 4KHYA 1C0UB 3HP6A 2CJ9A 4RR5A 1VSIA 3SCXA 1UP1A 5KFGA 2XCAA 1WC0A 1HJOA 2P5OA 1S9EB 4NMLA 2DY9A 3FZLA 1NJZA 4H4MB 4X4SA 2XCPA 3VAMA 2XGQA 1S1UB 2LDYA 3QINA 3R5AA 3NBPA 3G86A 1AW0A 2DPJA 3P5TL 4HWIA 1TQLA 3LP1B 4P9SA 4FM1A 3JTNA 3QATA 3PJXA 3LGNA 3QJLA 2E5GA 4MIAA 3KUHA 3QO9B 4OYZA 2UP1A 4CK2A 1KQFB 1S6QB 3D2WA 5HBMB 3LZIA 2QTWA 4DL0C 3AVLA 2LU1A 4LF7F 1IBCB 4E7IA 4IQMA 4FJXA 2MHEA 2YWEA 1K47A 2D1CA 3MM8A 4CLYA 4TLRA 3AARA 1NK5A 1HPZA 1ASUA 4YOYA 4NLCA 3CM5A 4FJ5A 1NSPA 2I5JA 3CMAS 3CXCR 1SJFA 1AYEA 5KOWA 5G4DA 4A8SA 2CJXB 4X64J 1B70B 4OGCA 3DMJA 5FRMA 2H48B 1NMEB 2Y0SD 2W4DA 4W90B 3CDBA 3PACA 2YQ0A 4CO5A 1PYTA 1UWBA 3GV5B 3O44A 1VK8A 3BREA 5HSPA 3ZTOA 4A8MP 1UVIA 2BKNA 5KPRA 1E6YB 4CH1A 3MPYA 5DDPC 2NSCA 2DFEA 4CERA 2ROEA 2Q0RA 2DGXA 5FPNA 2OD4A 3N28A 4CHPA 2RF2A 2BZ2A 5AQHA 2QLJB 3DDNA 3VEYA 2IJFA 1EHWA 2O4GA 4CBUA 2YKQA 3ILJA 3SSQA 1KVBA 3MD1A 2FC9A 2N3LA 4OYOA 4DF4A 3OBYA 4I6AA 3PO5A 5EWEA 2KI2A 1XHXA 2IIHA 4JI3J 1R27B 2VFSA 4A48A 1IO2A 1VYAA 5DLGA 3A5NC 3DI6B 2WVEA 1HLWA 1EKEA 2IA0A 2GAGC 4KPYA 2QK9A 4EZ6A 2DD8S 3O3HA 4MDAA 2QL5B 2FJBB 4CJPA 2WSFC 1IKVB 2IOCA 1HFEL 4L72B 5K14B 3CG7A 2ILZA 1DKGD 3UO0A 2HNDB 2M9KA 1EZZB 2WFBA 4CHOA 4XDCA 4DSFA 3VENA 3JXUA 2WSCC 1JLQA 4GKKK 4DF8A 4AL7A 2GVDB 1IG9A 4PZVA 4HUGA 2JFDA 1S0NA 1U1KA 2BXJA 1JKHA 3FFKB 4JV2A 5CYMB 2V8VA 3VVUA 2WB1D 4DV0F 1EP4A 4PHTX 5ETPA 2P9LA 2A6OA 1W2BM 1FDDA 1EP4B 2Q43A 2ETJA 1FDBA 2OPQA 1VLYA 2KXNB 3H4BA 5F8NA 4U95A 1SKRA 4HHUA 3RB0A 3QESA 1WJ9A 5CE3A 1KVAA 4P2SA 3P5JA 4YHHF 4DV5J 2KKZA 1TMJA 1RCOB 4LF9F 3EKSA 1VQYA 3T6BA 4ILMA 4WU2A 1MROB 5AZJB 1U26A 4RWTA 2ITMA 4IO1A 1IH7A 3C7NA 3SBGA 3PDNA 1JLFA 3UD3P 2RQKA 5B0DA 3HVRA 2LDIA 1NWKA 4LF4J 1SQGA 1XEZA 4O5BA 1N5YB 3TWZA 4MK9A 3OTOJ 1TL3B 5IT9O 2L9NA 3OY9A 4X4UA 2YKOA 3KVGA 2W9AA 4L75A 2DNMA 1FWPA 3F41A 1NJIT 3D68A 4DR5F 2OA8A 4NLQA 4ATNA 3HL8A 4M3TA 3ZEUA 1CXQA 1FRMA 2W6KA 4DCOB 4DPWA 1NSQA 4BWJA 4OZLA 1QZ5A 3ZTRA 2YNFA 1OIAA 3QGIA 1RT3B 2IA6A 4YNQA 1Y5IB 3AOBA 4B3TJ 2F9TA 2FF6A 2FB0A 1DTQA 4BRMA 2AHOB 3QIOA 2HNYB 4Q7AA 1KONA 3KK1A 4V19J 1F60B 3PEHA 4F0KA 3RMDA 4V19S 2GNKA 1ZAXA 4WYWA 1XMOJ 5HP1A 3CWJA 3GJTB 4ED3A 3DU6A 2W4PA 2MLXA 4KB0A 3THVA 4RNFA 1R6YA 2P2CB 1RTJA 2VQFK 3W9HA 1SKSA 2MGZB 3J80Y 4B3RJ 1RCXB 2YHYA 3KTQA 2GV1A 1K73T 2QMWA 3PX6A 2ZHOA 1T9UA 2JRSA 3C8YA 4YOXA 2MZJA 5JICA 1UZHA 3AD7C 4BQLA 1VQ9S 4LF6K 1KC8T 2C2DA 2VL1A 5J2NA 1WHWA 1KCFA 3VESA 3ENQA 1NHVA 2MQNA 2BX6A 2GX8A 1LOTB 3IP0A 3MWBA 1D4XA 3UE2A 1U1PA 1Q78A 5CZ1A 1HBNB 3DCAA 3M7VA 3FQLA 2GHVC 1R8HA 2DGWA 4BRPA 1C0TA 2AEJA 4EP4A 2CZ4A 3AFGA 3FZHA 1TUGB 4AHVA 3HZ6A 1HQUB 2MKHA 5ETNA 1VC0A 3GG0A 3THXB 2VICA 4EBDA 4FJJA 1K0TA 2F7TA 3EE8A 2KT2A 2X7IA 2RD5C 4F2RA 2NRVA 2AZ1A 1M0SA 4OPKA 2E2QA 1H7XA 2WW8A 3S3OA 2I5JB 4LUBA 4J2AA 4DR5K 1RT4A 3LQVA 4Z94A 4KV8A 2OFHX 3MMAA 1GOAA 2R7SA 3W9JA 3I5AA 2DNGA 1TUWA 1VQ6S 4J9RA 3VGSA 3N6LA 3LH2S 2R4FA 3BM7A 3BKFA 3OVAA 1R0CB 2ROPA 4IOAQ 1M5VC 4B3TF 2VA3A 4JI5F 3DC2A 4YN3B 1YIJN 3AVHA 5C25B 1NK9A 3C46A 5KFTA 2CXEA 1P9YA 2MTLA 1Q8LA 5HMXA 4DU4A 2F8HA 3KLGB 2DVIA 3CCUS 2BTFA 4LFBJ 3CFOA 3TAGA 1YVUA 3H42A 1BGXT 1S9GB 4USWA 3L3VA 4FNHA 2HQGA 2HS4A 2V8PA 2FZGB 4Q8FA 4JRPA 3J7ZT 4NLYA 1HQEA 2ZH9A 3M8QA 3LPTA 1GXLA 3MM6A 2OPRA 3CCEN 4C8MA 3OW2R 1ZA2B 2E4LA 2HK3A 3QFPA 1IKVA 1H1VA 1FRXA 5GADI 2ZNYA 2ZITA 4N8OA 3OL7A 1CJVB 2J0QD 2X1GA 1S1VA 2VCPA 3O80A 1Q8KA 3GBTA 2J76E 4H0YB 2ZHAA 3BGUA 3OTBA 4NLPA 4USHA 2GFFA 3EGWB 3R7SB 3NAEA 2DH8A 4KHUA 4OI0A 4CGGA 4X4NA 3OS2A 1G6BA 2DR5A 3R1HA 1ACMB 2IDOA 4JBCA 4YB1P 4DN0A 1R6VA 2EBEA 3VQTA 2OI2A 2Z1JA 2MZ1A 3H0PA 3ZT4A 1JJCB 2KG0A 3RRKA 4JI0K 4YFUA 1YI2S 2LXIA 4AHRA 1P8GA 2IBKA 1XN9A 1Y7PA 4I0WA 2W2OP 4FF1A 1RU2A 4MKYA 2JC0A 4NLRA 4XDDA 1BCMA 3AO4A 1VQ7S 4GVLA 1YJWS 3IGVA 4M41A 4OZ5A 3T5KA 4H4OA 2JH3A 1RGIA 5A8WA 2BANB 2R8KA 1WSFA 1QTMA 4DSKA 4JKHA 1VQ5N 4JI5J 4WWSA 2V8HA 2F1FA 2XYPB 4LRDA 4M5JA 2V4RA 5K20B 2VH7A 3GYGA 1LW0A 3TRGA 2KFYA 4CK3A 1JJ2R 3KOAA 1ZZNA 1HNXJ 3M32A 3AVAA 1ZETA 3LA0A 2W2QP 4EFHA 1RT5B 3MEGB 4X84A 1J54A 4PWUA 2YVSA 1BD6A 3S3NA 1BIZA 1CPZA 2KVQE 1SKWA 3H59A 1PILA 3KJVB 1ESVA 3AO3A 4QYZJ 1G4CA 3I56S 3VF4A 3ZEUB 2ATLA 4JNEA 5KG0A 1IWGA 4BRGA 2HS3A 3FEXB 2HHXA 1G15A 4O8KA 1EXQA 1RT6A 1SL1A 4H5TA 1RYSA 4YB7A 2M8HA 1GTEA 1XNRJ 4USKA 3ZX2A 1FRKA 2RUGA 2D5RA 4OJHA 2D3OR 2CA9A 1HYVA 2YH1A 4ZOSA 3NVMA 2YKAA 1LXJA 2GUPA 3GZ7A 3FQKA 4TYBA 1KVCA 3M4XA 4EHTA 4DCPB 1QAXA 2IYIA 1YRTA 2XQCA 2W7PA 3ISZA 4DPUA 4FXWA 4ZPAA 1MW7A 1HKAA 1RTJB 3OYIA 1V4TA 1FJ7A 2HZVA 1Q18A 1ASWA 1NLKL 1Y5LB 3H1VX 4B1YB 5JS1A 4CLWA 3ZTPA 1NGJA 2CJBA 1GXTA 4M94A 4WQ4C 3F2KA 4LFCJ 3WQUA 3FCWA 3TZZA 1S7IA 3VTIA 3ZCMA 4Y0WA 4K41A 1Z26A 3HT0A 2AEFA 5JVHL 2PFDA 4M5GA 4NWBA 5HLFA 4MJKA 4XK8C 4U7BA 3PEJA 3PJ9A 1BA0A 2DNZA 3O9SA 2CQ1A 2OH2A 2IRYA 3MXMA 2CH5A 4N47A 4IQXA 1VCTA 4CZMA 1RWOB 3MN5A 2NLXA 4GV3A 1NOZA 1H7WA 1KOOA 5CCMA 3W3SA 1G2EA 1BL3A 4WFBL 2BQ3A 4XTTA 1WKLA 1FNXH 2HHPA 4TY9A 1JWWA 2XULA 1MU2A 2HLUA 2EC0A 4R25A 4J9LA 3T1HJ 3D54A 4YY3K 4KV8B 3SAGA 4E3SA 4B3OB 3LGMA 3SDEA 1OH6A 3SYZA 2IJRA 3B4DA 4NI2A 3ZZTA 2DXFA 3P39A 4G1IA 2LLZA 2J8AA 3CNQP 2GMLA 3G25A 3A3NB 5AQZA 4NLWA 3VQ5A 3OHAA 4Z2XA 1TVRB 3MPUB 4MIWA 1D9AA 3O5TB 3T3FA 4DTNA 4QCLA 2HFUA 2FGCA 4AF1A 1N5TA 1EQMA 4K59A 1DTTB 2RKIA 4WP3A 3FEZA 2O8BB 2Y8WA 3J7AP 2XY6A 3VQ6A 5EY4A 4IYQA 4DB3A 1FNMA 1I51B 2UV8G 2YBVA 4N8NA 3WT0A 3VAJA 5HI7A 3HKWA 4YHHJ 4RU2A 2LXUA 4H4KA 1PKUA 4HACB 3UVJB 4A8QA 3RRHA 4X64F 1NBWA 3P4IA 3DAWA 1CULA 1WUUA 4WCEL 2QLFB 4F4KA 3NMRA 1CULB 3T69A 4FF4A 3JB9k 1BQXA 2CQ2A 1XMBA 1XMOK 3SUNA 4TQRA 5KT2A 4DV1K 5KFDA 3VQ8A 1VAZA 3OS0A 3OFGA 2KXFA 3I0RB 4Q43A 4K4WA 4OIXA 1NJYA 2AGQA 1ULRA 3UDCA 2PI4A 4UY8O 4NEYA 2EG2A 4DUTA 5A2QO 2ZQBA 4AXJA 4GVEA 1GLJO 4GY2B 2E1MC 1KLMB 2NRXA 3QMQA 2HKEA 4EBCA 1HI1A 3SBMA 3I82A 1JLCA 3NH2A 2G2YA 2LU2A 4IDHA 4ES2A 1RHQB 4DU8A 1E6YA 3QB0A 5HL7Q 5THWA 3HMJG 1DURA 2JNJA 3SQ4A 5HMYA 1VQ8N 4TVAB 4A46A 3C15A 3D2FB 2AP1A 2B4OA 4CLZA 5H9EJ 1YJNN 2DCUB 1QD1A 1TL1A 2YX6A 3D6TB 3KLVA 3KLIA 3P5BP 1CJUB 3J80U 1AFJA 2NS1B 2YHBA 3OYBA 2V2QA 2HRUA 5B0GA 2C3UA 4ANCA 4CEBA 5F8HA 1QM9A 5LMUJ 1HNIB 4IUFA 1KS2A 3AB2B 2BE7D 1SL2A 4RZRA 1UJ6A 3MMBB 2AX0A 1YBTA 2E6MA 4ED7A 4L6V3 3EVOA 5J2PB 2PA3A 4ISGA 5DGAA 4I67A 3GTYX 1S7HA 4ED5A 3D6RA 2DITA 5HRNA 2IPOB 2VPXB 5AJ3K 2F4VJ 1EB0A 2QW9A 5KFOA 1SUQB 3VEOA 4M63A 1BI4A 4YOUA 4K5RA 1DFDA 3SNNA 5D0EA 4UW2A 4U9RA 1LXNA 4MK7A 2I9SA 1GT8A 1WC4A 2QMXA 4LBIA 3I56N 3KG0A 4JI2F 2YNIB 3SK3A 4U7UD 1U8SA 1S97A 1U2VA 4MYUA 2UXDJ 3O4WA 1RTHB 2CG4A 5KRTA 3GJSB 3PW5A 3M9OB 3RJMB 4MK8A 2NXCA 4DMZA 4DHYA 1KAZA 1RWXB 3K59A 3RMBA 4KHSA 2HGMA 2AU0A 4PKHA 4PXBA 3W60A 1QQNA 1OJ4A 1U47A 3NBPB 2FYXA 4I1TA 3NLCA 2E1PA 1NKEA 1LOUA 1SC6A 2BOAA 4M3UA 4FLUA 4CTAA 4ZTJA 3M2UA 3R7BB 2R8HA 3DLRA 3I0SB 5TKWA 4NLUA 3I0SA 3R9LA 1CLFA 3O1LA 1M5SA 2D0CA 2RE2A 2Z2MA 1S9FA 1APSA 3NVKA 2DNNA 1RTIA 2D0PA 1QVFR 1GOBA 3NWGA 5KFUA 3EUNA 4CYUB 4BRDA 4K8RA 4UQTA 2CJKA 2E1RA 1I94K 2DR8A 4CFBA 4X66K 4QIEA 2XLIA 1FNOA 3SI8A 5HLFB 3RRGA 3D0GE 3VA3A 2RU3A 1A5VA 3LZJA 3DRRA 3MUVP 3P3DA 2FDNA 2B9EA 4K0KK 4X4TA 4JEPA 2PO4A 5LY3A 4NE9C 6FDRA 5J1PA 3TAMB 2RN2A 1PBUA 3A3PB 4KI6A 2YKMB 3ENHA 4EUVA 3EZOA 3MMVA 3WQTA 3NF9A 4RBUA 3LAMA 3G2XA 2GV9A 4IJNA 1VHIA 4CJUA 1YUWA 4CJLA 4ECUA 4A8WA 3RB4A 2ZD1A 5IQQA 3VTHA 4DKWA 3H45C 4KBIA 3PXGa 3KJQB 3FRZA 3P4UB 4B3TK 3HHDA 1BC6A 5T7LA 1Q9YA 5EUHA 2MSTA 3NGIA 3OR1A 3QT5A 2ZGYA 1U1QA 2DNKA 2GCFA 4OLOA 1LCUA 4FJ7A 4B8AB 5K8PA 3TZWA 3CFPA 1IR2A 1S9EA 4JI5K 2R7XA 3M3ZA 1K8AT 1GOCA 3CYMA 3GFYA 2J9EA 3IBWA 3KNGA 2AF6A 3I5BA 1VQMN 1NKBA 2BJEA 1FI4A 2VU5A 3FFIB 3PSIA 3FKBA 2PSZA 1V5VA 2DPNA 1HI0P 3HVTA 5C0YA 1REVA 3ITHB 1U25A 2N82B 1X9MA 2Z1HA 3SUPA 1V3ZA 1U0HA 3SCKE 3CJ9A 2JSXA 2PYJA 2KQ2A 1X60A 5TKYA 4LF5J 3U02A 3KHRA 3DLLQ 4ELTA 1N5QA 1ZPVA 3H2UB 2O8DA 2IFXA 5KQDA 1HUXA 3O9RA 4NASA 2XLJA 4RPFA 3NOCA 2HHTA 2GBZA 1VSLA 2L9DA 3P31A 2F7VA 1S0VA 3SMPA 4P75A 2IC3B 2LQBA 2RVJA 3NS7B 4LQ3A 2HRTA 3U27A 4BC5A 3MCAB 1VK3A 4CJVA 4JI8J 4KTZA 1LWCB 3JS6A 4JN4A 2A1BA 3SV3A 3O08A 1IUJA 1YJNS 1LK5A 4ZPWR 1CVJA 3MN6A 2Y1RI 5ETKA 2GELA 1TK8A 3VHQA 1PSDA 2V4QA 1J2VA 2A10A 2WOMA 4AH9A 1N6QB 5KFLA 1LAVA 1C2PA 2CNLB 1F9FA 5IQ6A 4F8RA 5D4OA 2FLOA 1RT3A 1TL1B 5GMDA 1XERA 4G6VB 5LL6Z 4R79A 3M8RA 4B1VA 3NCQA 2KH9A 1OKJA 3M8YA 2KG1A 3SV4A 3HFZB 4OZ1A 5HN0A 4FZVA 3FRYA 5DLFA 1N32J 3NGTA 4B1UB 1M1HA 3X1LB 2KKHA 2BGGA 4IH5A 1TUVA 5AQSA 3MPVA 4PAAA 2OPRB 4DFPA 5AZIA 4OPHA 4PPDA 3LDOA 1VQMS 3DN9A 4DWIA 1M1KO 1HL6A 2EFOA 4C9DA 3ZX3A 1Y3KA 1WG4A 2DEJA 1DRZA 4ZIWA 2FVQA 4KKOA 5F9LA 2ZGZA 1T95A 4FOIA 4W5OA 4HH1A 3DM2A 1RZMA 4BRLA 2VUGA 3CCVS 3MD3A 4H0XB 3A2FA 3Q23A 2HQCA 2QE5A 2XGPA 1TMMA 2DO4A 1TR0A 5F8MA 3NNCA 3KWIA 3I31A 4TN2A 4MO5A 1R0AA 3OTOF 1N34J 3NGZA 3FBCA 3D45A 1UEVA 1DGKN 2OELA 3VGVA 1HBMB 3IRXB 4R8UA 4Z4HA 4RO0A 1YTAA 4CLPA 1QQMA 4J9KA 4DR6F 2C2ZB 1X5OA 3CPWR 4OI6A 1B7YB 3M05A 4YHHK 1P1TA 4DV7J 4OHZA 1QAJA 1BOTO 2PE8A 3EE3A 5KG2A 3IDHA 4CRJA 1RTIB 1T0TV 4JRQA 1VGYA 4CEZA 2CQCA 3HSJA 4KYZA 5HVGA 4NCAA 4FN5A 1N5YA 4DL6A 4IO9L 1OY9A 1J5EF 2E1CA 3MDQA 3VMFB 1RWVB 3CB4A 2M3DA 4XPCA 3FLCO 4J37A 2CH6A 5H9EK 3AD9C 4X65J 3T1YJ 4J7CA 1BQMA 1CS4A 2ASPA 4A5AA 1RAFB 4BR2A 2WBMA 3H6EA 1MSWD 2IS3A 1PC5A 1M1KT 5ADXH 2GHWA 2M8DB 2RPIA 3QWUA 2P6SA 2MXYA 3DDKA 3OVNA 1T8EA 4DSEA 4C8ZA 4BDYA 2QFIA 3DLKB 1TK0A 2YKPA 2OHDA 1VOMA 3E9OA 3PFOA 1LWFA 3R5BA 2J9CA 4RW4A 2JWKA 4NRTA 3EKUA 4DR4J 2F4VK 2HNZB 1MWZA 3Q8SB 4H0TB 1D09B 3MX2A 5AJ3J 5A8KA 1SAZA 2B9WA 1RE1B 5JLFA 3LF0A 3BH7B 3DLHA 1JJ4A 4OZNA 4ERDA 1Q8BA 2ZVIA 4H0VB 1H3DA 1R8AA 5D4LA 4KE5A 4FLYA 3D4JA 1CC7A 5LMUK 5B7WA 2UXDK 1IM6A 1X9JA 3PSFA 3MCOA 3CD5A 4O3RA 4W4MA 4TYAA 4X65F 3W2VA 3T1YF 1CJKB 4F3MA 2HWTA 1KEKA 4J8FA 5KTQA 4BRKA 2QTDA 3PO4A 4DUYJ 3VAGA 2OPSB 3BF1A 3D6FB 3DRSA 1TZ0A 1U6FA 2CUYA 4KR0B 3CCJS 4FYDA 1S0MA 3E51A 4J5OA 3TVZA 1LFPA 3QDKA 1NH7A 1RDBA 4LFAK 5L46A 3CERA 3HHNB 4X4PA 1NO8A 5KT4A 4PCQA 2HWHA 4ECTA 2ATQA 3CTRA 2UXDF 4JI8K 1FRJA 2BM1A 4GMKA 4I7FB 3BJYA 5GINA 1GMVA 2LCWA 3I0RA 1FCAA 2DEIA 3CJ4A 3F9MA 3CUNA 3Q8RB 2NRTA 3DOKB 4ZN3A 2KT5A 4OLAA 5IC6B 5DQGA 3QZ7A 2KO1A 4RU9A 3EO3A 5C2FA 1RISA 4K42A 3CO9A 3V9UA 3D28A 3L2RA 1UJ4A 3N6MA 4O23A 2Q0UA 3SXLA 2O8FA 5A76A 2MY8A 3OYJA 2CYYA 2DNPA 4ECSA 1I5OB 3LDNA 1O0PA 4JD2B 3NMUA 1TFYA 2YX7A 4CF2A 2DXEA 4FS1A 4PABA 5T41A 2PIIA 2Q6CA 3CDEA 1RBLA 4XH4A 2DGSA 5D15A 5L1KA 1ZBLA 2QL9B 4CLTA 5LJWA 4ECYA 2E2OA 3VPZA 2FJAB 3ZZPA 4WTYA 5HJXA 2FHOB 2P9LB 3J7YI 2D69A 1YITS 3H4DA 4A8KA 4DUZF 4DV0J 3RU0A 1XMOF 5E7OB 3TAEA 4ZJOA 3OLAA 1Z2LA 3OYNA 4ZMMA 2M52A 4ISEA 4W5QA 4PG6A 3MXHP 2QLXA 3HDSA 3CGIA 2RILA 2F8MA 3IGNA 3FCHA 3TJ8A 4NL5A 2N7CA 4Y2MA 3DGPA 4PXDA 4J9SA 4PUOB 2ZJQQ 1WBDA 1X5TA 3MXJA 4FK2A 3DM2B 8AT1B 5CY4A 3R2CJ 2LQ9A 3GILA 2MKYA 2RS2A 4DZ6A 2E5IA 3C7NB 1CJKA 4MT1A 3Q2TC 4CIGA 3WXIA 3O8MA 2VFTA 1O5JA 2MZSA 3V9ZA 2KZZA 2GGPB 4AT1B 1OSDA 3CIPA 4FDFA 3BBBA 1GNKA 2V9WA 5B0BA 1X4BA 2OLWA 5AQUA 2OPPB 2BW7A 1WHVA 3AY9A 2HBRB 4TU8A 4GVBA 3RYLA 1UVMA 1QS4A 3C14A 3MOJB 1MWQA 3IA0A 1N5VA 1K9MO 5CXTA 2HHHJ 1XC3A 2DRDA 2HBMA 3NF8A 1QJHA 3KUEA 3TR5A 4B9MA 1FRLA 3TARA 4FYYB 3OYEA 2KHDA 4WF9Q 3NGUA 3R8YA 2UUBK 2MDAA 2HNYA 2IBOA 3TSUA 1SH0A 3UCUP 1NEEA 3QT8A 4AQYF 4JD2A 1J6ZA 5J2PA 1C0MA 4BDPA 1UFKA 4MQ3A 2G0IA 1LKZA 1I3AA 3ZT2A 3OS1A 2KHOA 2JVRA 5KFJA 3DYAA 2A3ZA 1PYOB 3S1TA 3WNHA 2NSBA 2HBJA 4G1QB 4WE1B 2XS7A 5BPMA 4WFAL 3PYEA 1JLCB 4CFDA 2HAIA 2C2KB 3RBDA 3CQ8A 1EX8A 3IBFB 3VAFA 1BU6O 2HQIA 1T11A 1VQNN 2V94A 3A8KA 2KU7A 3SUOA 4X65K 3T1YK 2HZAA 1T6CA 2KM8C 3OR2A 2JOQA 2LQ8A 2B51A 4LH5A 4CJ3A 3M9MB 4WFBQ 3BF3A 3BV8A 2BJ3A 3P96A 5AQRA 5K8NA 4DV2K 3A8EA 4ZLJA 3D6MB 4QIWD 4C23A 2JLEA 2ZWHA 1VMBA 1DHMA 2ZE2B 2Y8YA 2G1HA 3AVJA 4OGEA 2M0GB 1BDGA 4WF9L 5AQOA 1ZXOA 3SBTA 4PWDA 3W66A 1FFGB 3ULEB 2IHR1 3SPZA 1MU2B 2AGOA 5EU7A 3SQOP 1N32F 4HTLA 1OSCA 2CRLA 2D1KA 2R7QA 2RDDA 4M45A 3MMCB 2M88A 4M7YA 2ASYA 1XUPO 3AODA 1SBRA 1N34K 3FZBA 4J90A 1TUYA 3A13A 3BSCA 4PYDA 1U48A 3R3TA 2UUBJ 4ID5B 3GR1A 4KHPF 4YORA 3H90A 3J81Y 1HHQA 2WUSA 3VOVA 4ILHA 2XMUA 1CC8A 4FVMA 4JAXA 3HXMA 4NLBA 3HZEA 1SJRA 3TU5A 4CJSA 5H1SQ 4K2JA 4KPCA 2R3VA 1IBLJ 1HNVB 4FSVA 4DV6J 4KHNA 3O3LA 4LF8F 2ZC3A 3D2EB 1HQEB 2GC8A 2LYVA 4E98A 3OL9A 3UR0A 1B4SA 3QT6A 3RB6A 3K5MA 1O13A 3V4IB 5K5MA 4LSZB 3EN9A 4OHXA 4J9UE 2KLAA 2ZJRL 2E5HA 1RDUA 4Y2KA 3ATUA 1AROP 3W2WB 3BO3A 4Y2AA 4OO1J 5E41A 2P9UA 4P73A 5I4MA 4EO8A 3WQPA 4ZCKA 4KO0B 2V7ZA 2EWSA 3OVBA 3BKTA 3CFRA 1QAYA 2B7CB 2G0CA 4DPTA 4DV4F 1WSGA 1R0AB 5C5JA 2V8GA 1F2GA 2Q36A 4ZJLA 4JKAA 4PEOA 2P9KA 3H2LA 3L4IA 1T9VA 3O9UA 2H65B 1K1SA 3HRGA 4ECWA 3KK7A 1LAWA 1VS3A 2A1RA 1MWMA 1U1LA 4AD6A 2W9BB 1L3TA 4M3WA 4BVOA 1RHMB 2B9YA 1U2CA 2KW4A 1LWXA 4FLWA 4ZN1A 5E3AA 2OSQA 3F9KA 4AM6A 3GLJA 2GZOA 3FEYB 5AXNA 5AQVA 5BREA 2ZM6F 1KD1T 5ELZA 3MF5A 1IBLK 2FUG9 3O8WA 4DL2A 3DOKA 5H9FK 2EC2A 2ACYA 4C0BA 4ZDNA 4X66J 5H9FJ 4G1PA 3FMWA 1AFIA 3WIUA 3AA8A 3ZSOA 1Q16B 5ETSA 2CQIA 4WJBA 2OCEA 4P52A 1CS4B 2R7TA 3C6UA 4H4MA 1T44A 2WOMB 3U9ZA 2AEMA 2AP6A 2V9KA 1SC1B 1A7GE 1VQPS 4X4VA 1FK9B 4QWAA 1MG7A 3T9ZA 2DKOB 4DV2J 2XWYA 1IQZA 4DJBA 1J5OA 1Y0HA 1HWLA 1UWAA 5AXMA 1S1UA 4JI0F 1NM2A 4FW1A 4CW7B 3T5LA 1SXLA 3QLHA 4E1MA 3G4SS 3ZT0A 2R7UA 3NEKA 2V2KA 4K4ZA 3W5ZA 4WIIA 5H1SV 1B7FA 3VF2A 2EFGA 2WZ1A 5L9NA 2FHJA 1GK8A 2KYXA 5U47A 5HMZA 2QJ3A 2D3UA 3M2VB 3LP0B 4KHWA 4E7HA 2QC3A 3HSTB 1RAOA 2H54B 4CECA 2DFHA 3JSBA 4C0OC 4L3KA 1XQSC 2EEYA 4H0PA 2WVCA 2XM3A 2HQDA 1P90A 1YJ7A 3WC2A 4U7UK 2APOA 5SUHA 5CZVA 4RUHA 4P71A 4AHSA 1HI8A 4AILC 1RTZA 4GV9A 3RAXA 3N4WA 1ZBUA 3GYNA 2LMIA 2DYAA 2BRKA 5DQHA 3IAS9 3KNAA 3DLBA 2W2MP 3C16A 3SAFA 3VA0A 2ZUGA 1NB7A 1NU0A 1IQTA 1P1LA 3LWMA 5C2DA 2QWMA 1N6QA 1RDAA 3W7BA 1WF1A 1UPPA 2DBBA 2A3JA 1RXOB 4DQIA 1IBLF 4DR1F 4JI8F 1B3TA 2W41A 3UDLA 2V5HG 3UKUB 1Y11A 1YJRA 1VQ6N 1W26A 4NCGA 1HNVA 4CZLA 4JI7K 5M1FA 5F3TA 1QLNA 2OYQA 4Z0UA 2XRIA 3PIOL 5JMVA 1RT2A 5GMEA 1R43A 4CGIA 4WBFA 4DU3A 2VC1A 2CNOB 4CJKA 3SZ2A 5D3GB 3SMZA 2CQDA 1RFQA 2B6AA 3GWCA 2X74A 1S4FA 1M90T 1BLUA 4KAZA 3C3LA 1RCHA 1VBKA 3KJVA 4DV3K 4KHQA 4DFMA 4DV3J 4A8FA 2B0GA 3CCUN 4KSEB 4KGXB 2ZH3A 4FNIA 4K5SA 1YLXA 1UZDA 5C25A 2QXFA 1IBKF 2YWGA 3ZZ0A 1NGGA 2VFVA 1A5WA 2FBVA 2OANA 2F4VF 1VQPN 3OLBA 1VSFA 2HF4A 4LFCK 5BYRA 2ZH2A 3CCTA 2UUCF 2QEXN 5KFNA 5KI6A 1HW9A 3WHIA 5DRKA 2O5DA 4OYIA 2ZH7A 4LVOP 4O4GB 1N34F 4BBYA 1N52B 2U1AA 4Q8EA 1TKZB 4RW7A 2PFUA 2NUBA 2BJ1A 4A59A 1G3OA 1VBZA 3KIOA 2QO3A 3LP3A 2D9OA 2QSWA 5CYQA 4JK9A 3LDSA 2NRRA 1ZBHA 2FVRA 1K6YA 3HD1A 3M2RA 4LF9J 2WRMA 4PQAA 4EIAA 3FZMA 3HOTA 2DT9A 4ZVSB 1TV6A 2E7XA 2LQJA 2IAJB 3MEDB 4IH7A 2DGOA 3VVTA 2ZNZA 2YY3A 4LT6A 3SEOA 1PJ7A 3U1MA 4JI4K 2D0AA 2UVWA 1PAEX 4J9QA 3DOMA 4DTXA 3ZXWA 2GIQA 3DFEA 4WYLA 3BO4A 2VQFJ 2LQ5A 2ITGA 2XYHB 1C1AA 4DCHA 1NMDA 5IT9Y 3MTKA 5D0HA 1Q5VA 3O9TA 2YHAA 3C66A 3PV8A 1OVQA 4OHYA 2O1PA 3RTVA 1BE4A 3I8BA 1LWFB 4YP3A 2MQOA 3OW2M 3TSPA 4NYZA 2BMBA 3P49B 3BGFA 5KFYA 5DG9A 1WI6A 4OPAA 4KREA 3CJKA 3T9NA 4OLPA 3W63A 4WFYA 1BY9A 3DKDA 2ZD1B 2BW2A 4RUAA 3F73A 4AHUA 1D8ZA 2MZQA 4LIRA 4USMA 1Y5NB 3CXCM 2CQ4A 1RDWX 1QZ6A 1VISA 1Q81T 3TEHB 3AY0A 1X4DA 4B1XB 2P9SA 4IOCL 2RDIA 4BR5A 1X4CA 2CPXA 2VFRA 3IAM9 1ZTTA 4LF1A 2YH0A 3AA9A 4IRCA 3RSEA 3AO1A 3CT9A 4N56A 4I2PB 4H54A 1NRKA 1O8BA 1GLFO 3OHRA 3C6TB 5M1QA 1PJ6A 4I6WA 1R89A 3ADAC 4MLHA 4KHRA 4PKGA 2LA6A 9ATCB 4M5IA 4ID8A 2F8TA 3EZUA 2D9PA 2OPQB 4F67A 1AZSA 3EWGA 4EZ9A 1KFDA 3PRDA 2XSFA 3POTB 2AV5A 2V63A 3N5BA 1NUEA 3WZ0A 4WFXA 2GAHC 2HVHA 1U49A 2RNEA 2ZH4A 2VWJA 2Q3PA 3B6PA 2HVEA 4CEFA 3V5RA 1KR4A 3IM9A 3M32B 3GJQB 1OPIA 1PG5B 2HOEA 2AKWB 2QI2A 4BGBA 4CD3A 2AJ0A 3W5YA 5L8RC 3BQ1A 4U8YA 3H5XA 2F9DA 4B9LA 2HPUA 2R2TA 1JXVA 2CQ3A 1XR7A 3EVWA 3SAHA 2J0WA 3GB0A 5E5NA 5JUMA 5CZ2A 1TP7A 1TK5A 2Q1LA 4ZHRA 4LRCA 5L1LA 3V6DA 1K9MT 2Y1LB 2FZCB 1IJJA 2R2SA 4DUZK 1ZH5A 4DXLA 1EO1A 3HFKA 2BQRA 4F3OA 4O4RA 2HFZA 2JZ5A 2V8DA 2XMKA 4JV5F 3KDOA 3HM8A 2WBRA 3ZETA 1OS5A 2WCXA 5KFSA 1Q81O 3KK1B 4M5HA 2IIRA 4OMFG 4K50A 5M1PA 1K0VA 1TFWA 4JKFA 3AXMA 1X4EA 4KRFA 4DL5A 1WHYA 5HVHA 3PNIA 5HJYA 2VASA 4NXMK 2EX3A 2VDIA 1G1XA 2L08A 5F0WA 3ZTQA 3QAEA 4WP8A 4FP9A 4MFBB 2JDJA 2KL8A 3KK2B 1U1NA 2GA7A 3FVYA 5AJ3F 3M1VB 2QWPA 2ZH1A 3MM7B 4ZLPA 3W2VB 4NA3A 2WK4A 3ETMA 2CQ0A 3UQSA 4LFCF 4YB5A 2QRRA 2VPYB 1FESA 3MDFA 3VGLA 2DTJA 3CW2C 2P9IB 5E33A 4QU7A 2A6MA 3PHTA 3H8YA 3EPIA 4H5WA 4A47A 1YVFA 2E9TA 1N54B 1NGIA 4IOAL 2F8EX 1WAFA 5F8GA 3TYTA 5FDLB 1VHXA 2UXCJ 2W9CB 1CQNA 4MAKA 2VKZG 4W98A 3VQSA 4WFNL 3MPWA 1BHLA 2RQMA 2W1BA 3M8ZA 1O1WA 3MURP 4F25A 3QFHA 1Q53A 4DPYA 5CABA 2EG1A 1R59O 3MX5A 4RW7B 4UOHA 5B0CA 2HW3A 3Q7CA 3KLFB 3VZHA 1VQ4N 4A62A 4H5VA 3FBBA 4LRFA 3MWTA 3TSQA 1M1GA 4QR0A 4HUEA 2CPYA 3DLGA 4Q0BA 4OI4A 5MLCV 3KHLA 4I6MA 3ZFVA 3MXIA 2K3IA 5DGBA 1FKPA 3DRPB 1GH8A 1Z05A 1RAEB 3AJ2A 3IAYA 4JI1K 3PUFA 5FRNA 5KT3A 1ZYQA 1EQ0A 4ZVGA 1REGX 5F8LA 2C2NA 3ZLJA 1UVLA 1TKDA 4K4VA 2IVNA 1WSRA 4OZJA 1HKBA 2O8BA 4Z4CA 2E7VA 3ZZZA 1WB9A 2ADBA 3JAMY 4JKBA 4ZCMA 2QWQA 1E3MA 4KT0C 1R8BA 3UN3A 1FX4A 4LSNA 1EETB 1XIQA 3CC2N 2O4IA 1HARA 5DM6L 2JEJA 2W7AA 2A40A 2VQEJ 2D3ZA 3CIZA 4UOGA 3NGKA 3NAHA 3OSNA 5IXUA 4DQPA 2IM3A 4BRHA 4IRKA 3KUGA 3G71N 1CJTB 3I8DA 1U02A 4ECQA 1QQOA 3HD2A 4CZKA 1L3VA 3MN7A 3QGHA 2AYMA 3GDQA 3R27A 1UMJA 2CQBA 4DX8H 2KFZA 2CDRB 2K1RA 2EWHA 3QEXA 3PM9A 5KAKA 1TYQA 5EX5A 3ZZRA 2VBYA 2HURA 4ZP6A 2JGUA 5JVGQ 4YDUA 2DH9A 1C4AA 2XEXA 1C0TB 4Z4IA 4OVLA 3MCNA 1QAIA 2CJQA 2ZKTA 4TXSA 4FJGA 4FWNA 4EAHD 1CSJA 3U7JA 4JI1J 1UL3A 4NA1A 1K8KA 1FKAF 2RB7A 1TAUA 3PFEA 1NPKA 3QQCD 3E8OA 3MMBA 3QGGA 2WW4A 1E4FT 5AQWA 1M5KC 2FBYA 1Q95G 2QA4G 4ZPVR 4CEEA 5M2RA 4NCBA 1KTVA 3B6OA 4WFAQ 1XR6A 4DUZJ 2PMWA 4LSLB 1L3KA 1WC6A 1NH8A 4PKDB 1IKXB 4RWXA 4A61A 3OR1B 4JLHA 4A8YA 4LY7A 2CJAA 4UZBA 1T9WA 2POKA 3MUTP 2NXUA 4X2BA 2AYEA 2J6TA 2UYTA 2WTFA 4MO4A 4C8KA 3AOCA 1NCLA 3KDNA 3UN2A 5M2UA 3T1HF 1FD8A 3Q22A 2DHHA 5JVGL 2P9KB 3M8PB 2Q2RA 3JSMB 1PO6A 2Z1GA 2G8IA 2ZH8A 3M8PA 4FK4A 5GADP 4AQYK 4MDBA 2XNRA 1ZS6A 2GVZA 4WXWA 2FSKA 2Q79A 3UKRA 5FDLA 3ISND 1N0VC 4OX8A 1NGBA 4KBOA 3MUMP 2GWKA 4BE1A 1T3OA 3IBCB 3UKRB 1S1WB 2PDAA 5G0RB 1XJWB 2HNZA 2HK2A 1X9SA 3VAIA 1N8RO 1Y3JA 1A5XA 4C1NI 3MI7X 2CPEA 3R6MA 1HYZA 1ZOTA 1IKXA 4Z4EA 5HO4A 3B78A 1SJ4P 3VEWA 1RWMB 1KXPA 3WXLA 2KXHA 4QAGA 1EWQA 1KNZA 1DLOB 1Q82T 2HHSA 4CLKA 2HQ3A 3AHPA 5A6PA 1Z2ZA 4H5RA 3SCIE 4KHPJ 1NZAA 5D0RA 5F0XA 2DCLA 4DTPA 3WNFA 1FHTA 4QR2A 3M8WA 4FVCA 4E89A 4HDHA 2FIUA 1HR0F 1T94A 2FBXA 3TTCA 2RDJA 2QEXS 2ZOGA 2MB0B 4FWOA 3GIRA 2CNK<