1HNVA

Structure of hiv-1 rt(slash)tibo r 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
558
structure length
558
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of HIV-1 RT/TIBO R 86183 complex reveals similarity in the binding of diverse nonnucleoside inhibitors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Nucleotidyltransferase
molecule keywords HIV-1 REVERSE TRANSCRIPTASE (SUBUNIT P66)
total genus 137
structure length 558
sequence length 558
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1995-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 1hnvA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnvA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 1hnvA05
3K59A 2OPRA 5EDWA 1VRTA 3N6NA 5J1EA 2WOMB 3CJ0A 3KK3B 3V4IB 4BDPA 4DSIA 2R2TA 3OYAA 3TANA 1U48A 3SV3A 4O0JA 4I2PB 3C94A 2PYLA 1DTQB 4YR3A 3AA2A 4DSKA 3PR5B 4FK2A 4NCGA 4Q8EA 2KZZA 3M8SA 1IO2A 4K4XA 3QNOA 3IRXB 2P51A 2VG5A 4LH4A 5F8NA 3DRSB 4CJPA 2V4QA 4QWBA 3RAXA 1JXEA 5DQHA 4E7LA 2WRMA 2AX1A 3VQAA 3VQ5A 5KFRA 2FJWA 4DL6A 1U49A 4IRDA 3DMJA 1KLNA 3LZJA 3TR8A 4DTJA 3P5JA 1TK5A 1EETA 2RDIA 5J2MB 4CEFA 1LAVA 5J2PA 3PX0A 1KTQA 3IN5A 1FXXA 3DM2B 4O3NA 2IOCA 4CJTA 2HHQA 4ID5A 4LQ9A 1X9WA 2DFHA 4QWDA 5KFEA 1C1CB 3PW7A 2AQ4A 3L8BA 3NGYA 4CJVA 3I8DA 3NF7A 3DLKA 3D0PA 2BRLA 4DF4A 5KG6A 1HMVA 5DGBA 1XC9A 1BIZA 3TAEA 4DQIA 2VWKA 1NKEA 4FLXA 3CQ8A 2VA2A 1TGOA 1ZBLA 2WK4A 4WYLA 3VQEA 1BQMA 4K4WA 3BSOA 2FLPA 3V1OA 2VG7B 2GIRA 3WNGA 1S49A 1ZETA 5J2QA 4KAIA 4PY5A 1RBVA 4E7IA 4RW9A 4FM0A 1NJYA 3JYTB 4NRTA 2FLLA 3VQ9A 3KD5E 2AJQA 4PUOB 1VSLA 4IFVB 4DLEA 4O3RA 5KFGA 1S1TB 2IJFA 3UPFA 4CJUA 4HTUA 4DU3A 1TQLA 3F73A 3QEVA 5J2NB 4J9QA 3DLEB 3KHHA 4CE9A 1RDAA 5KG7A 2HHTA 4WZQA 3RR8A 3L2WA 4OLAA 3L2UA 1X1PA 4GC6A 2IMWP 4IG0A 3QESA 1S48A 4FZXC 4CJ3A 3L2QA 2E9ZA 2C2DA 4RUCA 4KHRA 4URGA 2Q3SA 4CESA 3OYGA 3TQ1A 4FXDA 2HB5A 2Y1JA 5DLGA 1S1XB 3I0RB 5KFKA 3H40A 3CFPA 4B9SA 3ALYA 1S9EB 4DF8A 4GVMA 1SL0A 2VG6B 2NUBA 3PW4A 4NYNA 3ZT3A 4M3ZA 3C6UB 4X2BA 2R2SA 4FK4A 3QGHA 2O4IA 4C8OA 4ZPAA 2JEGA 3VQ4A 1EKEA 4LQ3A 3ISNC 5I42A 2XY8A 1NOYA 4WE1B 2IM2A 3QO9B 4K4TA 3LPTA 3OJSA 1TKDA 2R7YA 2KFZA 2R8JA 5CY4A 2FVQA 4ECVA 1RA7A 3KLHA 4RW8B 2P5GA 4FJJA 4KTQA 2I5JB 5SWMA 1WNSA 3O3FA 3RR7A 2D3ZA 2ZE2A 5T14A 3LALA 3G0ZA 4W5TA 2OPSA 2WHOA 1HMVB 3VQ7A 4FVMA 2QE5A 1C0MA 2O4GA 1C0TB 1QAJA 3CJ2A 4IOBA 5KFAA 1SH3A 1TAQA 4LY7A 3MFIA 1VRUB 3T5LA 4JV1A 4CERA 2X74A 3IS9B 4IDKB 3KLFA 4KBIA 2V9WA 4MKAA 2G8VA 1S10A 2LSNA 3ITHA 4TY8B 4RNFA 4DU1A 2R2UA 4RW9B 4CJKA 5KI6A 3JYTA 2QXFA 4I9QA 4ECUA 3HP6A 1X9SA 3V9WA 2HNYB 3VQCA 3HXMA 3K57A 3LWLA 3Q8SB 3AVFA 2ETJA 4O3PA 1VSIA 3AVCA 4YQWA 3CVKA 3V6DA 1LW2B 4RNMA 1HPZB 1U4BA 1MMLA 4ICLB 4Y1DA 1YTUA 3JSMB 4KREA 3HVRA 3THVA 4ID5B 4FJXA 4JLHA 4CJRA 3OYJA 2G8FA 1ZBFA 5DQGA 4TQRA 2OH2A 3KMSA 3HVAA 4I7FB 3FRZA 3MF5A 4CGFA 2RKIB 1RTDB 3PR4A 4LSNB 5DGAA 4DTMA 1JLAA 3Q8QB 5HROB 5DG9A 3M8PA 5KFUA 1HYZA 4PQUB 2IGIA 1RCHA 1BQMB 3BSNA 4B8AB 2YKNB 3O3GA 2YNFB 1HQEB 3HK2A 4MK7A 4CF9A 4KV8A 5KT4A 3ZT4A 1U47A 3AA3A 3SV4A 4OKKA 4IR1A 2ASDA 4M3XA 2ZQBA 3SUOA 4HCCA 2W9AA 2FLNA 2IA6A 2ZKUA 1NK8A 2XRIA 1RT6B 1GX6A 4ZHRA 1ZTTA 2X6NA 3E01B 3KLIA 1KVCA 3UR0A 3OSPA 1BISA 4KI6A 4CK3A 1S1TA 1RAJA 1BI4B 1LWEB 2HVIA 3CJ5A 2OPSB 1VSHA 1RYSA 4C8KA 2Z1GA 1IKVA 4KKOA 4AHVA 4FLUA 1VRUA 3NAEA 4CFCA 4DTRA 3FFIB 2D7SA 1D5AA 1REVB 3FQLA 4XPEA 2BQ3A 3AVMA 4TYBA 4F2RA 5CYMA 4ZPBA 4O4GB 3V9SA 1KRPA 4FJMA 1FK9B 1L3UA 2FBYA 1S0OA 1NJZA 3S3OA 4FJIA 3GYNA 1Q9XA 4AHCA 4HUGA 1Y97A 1LAWA 3NL0A 4W5OA 1S1WA 2R8KA 1TKTB 3DLHA 1LWFB 4B3OA 2VG6A 5FDLB 5KFDA 4BDZA 4OPJA 1HNIB 5KGXA 2BQRA 3V6JA 2IDOA 4ZVGA 2WONB 3LAMA 4W5RA 4EO8A 1YVUA 3HHKA 1YTAA 1MU2A 1KFDA 4FLVA 4FM1A 3D28A 3DOLA 2DFFA 4CEAA 4E3SA 3BR9A 4CHQA 1RBRA 3VQ8A 4BDYA 3MXJA 2OA8A 2ZE2B 2R8HA 1J5OA 2XHBA 1ITGA 1IH7A 4F2SA 1DTTB 4Z4IA 1C0TA 4BWJA 2YHAA 3SJJA 1HYSB 3DRPB 1NHUA 1RT2B 1KHVA 3RRHA 1XI1A 3QYYA 5KFYA 1TK0A 2HVHA 1RT7A 4Q44A 3H5SA 3U6FA 4N5SA 1L3VA 3EY1A 4J9OA 4AILC 1YT3A 3KD1E 4K50A 1LWCA 1TL1A 1C6VA 2IAJA 1TKZB 3FQKA 4IRCA 2FC0A 4U6PA 1NJXA 4B9NA 4ECZA 1IKXA 4MKBA 1J54A 4ZVFA 1D0EA 3Q8PB 5KT5A 4E0DA 2B5JB 5DG8A 3SUQA 3V9UA 4I2QA 4IG3B 2C2RA 3V6KA 2YV0X 2YNIA 1D1UA 2FBTA 5DK5A 3BSCA 1JLEB 1JKHB 4Z4CA 3BREA 3F9KA 4TN2A 4E1MA 2KZMA 3DOKA 3LAKA 1RTIB 1BIUA 4DFKA 3B6PA 4H4MA 4Q0BA 2D3UA 4K4UA 1SH2A 1C1AA 3SFUA 2JEFA 1HQUA 4AHSA 1U04A 3U3YA 4BACA 1S1WB 1L3SA 4EP4A 1C2PA 3GIJA 3LP0B 4NLDA 5KFHA 3MEGB 4J2DA 2UVWA 4NLGA 1C1CA 1VSEA 2YNHA 5KG2A 3SQ1A 4RU9A 2E4LA 4Y1CA 3ASMA 2OPRB 3TAMB 3DLBA 1VSDA 1K1QA 1JL1A 5KG4A 1QSLA 4CIEA 2XI2A 2WB4A 5KFWA 3HVTB 2UVVA 5JS2A 5J1EB 1RT1B 5KT2A 5FRNA 3KK3A 3ZSQA 3PV8A 4KHMA 2ILYA 4O0IA 1N5YA 3QZ7A 2G8KA 4Y2AA 4W5QA 4CJLA 1RT5B 4B08A 4DL2A 1RBUA 4IKAA 4DQRA 3OY9A 4M42A 3TAGA 2W8LA 1KVAA 4KI4A 3SUNA 5KFBA 2IC3A 4JS5A 2G8IA 1WSIA 1NK0A 4CJ5A 1RT7B 4XPCA 5KFFA 5KFJA 3OHAA 3KNAA 3O3HA 4J2AA 4DQQA 3P1GA 4QAGA 1XR5A 3ULDA 4IRKA 4O4GA 3DMJB 2D0BA 1FK9A 5KFPA 5KFVA 1NKCA 1WNEA 1HRHA 1ASVA 2O5DA 3DLKB 2ITGA 4EYIB 3MR3A 3B6OA 2J6UA 5EWFA 3KOAA 4RW4A 5HLFB 3M8RA 3S3NA 5EUHA 1JLQB 2J6TA 3TI0A 1J5OB 4O3SA 4MK9A 3RMAA 4KHUA 1S97A 3QLHA 4NRUA 4DFMA 4WXWA 3KJVB 4DS5A 1SL1A 3DOLB 2G8WA 3V1QA 3TABA 4Q0BB 4CHZA 2QKBA 3BGRB 1ASUA 4KAZA 3BJYA 5I3UA 3AVBA 3PVXA 3FSIA 2ATLA 3OL8A 2GV9A 4NZ0A 2A1RA 3QEXA 2DPJA 3H4BA 3S3MA 4DL4A 4ZVHA 4RZRA 3CYMA 3AVNA 3KHGA 1LW0B 1S5JA 3RB3A 3A2FA 1ZBHA 4DQPA 3KLHB 3H4DA 4IFVA 3M9OB 1IKXB 4DSJA 4H8KA 4F3TA 3LP1A 2F96A 5C25A 3IGNA 1JLGA 4M41A 4CFDA 3BQ2A 3OYHA 3AVAA 1JLCA 4RW7A 1UOCA 3HP9A 3VQBA 1RT1A 4AHRA 3QIPB 2IS3A 3S9HA 3K5LA 4ED1A 1CXQA 3SQ4A 4B9MA 4E7JA 5KFMA 3DOKB 5HRRA 4HYKA 1BHLA 3WNHA 2HMIB 2HNYA 5C24A 3SPZA 1HQUB 1JKHA 4CEZA 4MK8A 3DI6A 1VSFA 5EWEA 2P5OA 4KTZA 1HARA 1HPZA 5CZ2A 3AO3A 4H4MB 3NF6A 3AVKA 3NGDA 3MECB 3C6UA 5DLFA 4E89A 4K4ZA 4EZ6A 2ASJA 4RW8A 4WFZA 5L1JA 4QPXA 4CJFA 2D0CA 4DTSA 3VQPA 1LV5A 4OKEA 2P1JA 3PZPA 4DTXA 1B9DA 4Z4EA 4FJKA 1S6PA 4IFYA 1CZ9A 2GIQA 3MXMA 4CK1A 5KFLA 4KHWA 3NE6A 2BGGA 3HPOA 1BCOA 1QSYA 1KFSA 1S6QA 4DEZA 3T5KA 5HP1A 1VK0A 1XWLA 3MR2A 1ZBIA 1QE1B 3I5BA 5EWGA 2RF2A 4NYFA 4ZTJA 2HAIA 4F4XA 4CEOA 2YNGB 3G6VA 3NAHA 1U45A 2E9RX 4CJEA 3BGRA 3BQ1A 3EPIA 1EP4A 2BE2A 4C8NA 1N5YB 2IM0A 4IH6A 3HKWA 3VN5A 1F21A 3AVJA 3VA3A 4AHTA 3SZ2A 2CKWA 4FLWA 4FBUA 1WAJA 2AU0A 2OYQA 4FJLA 1N48A 3OJUA 3H08A 4CEBA 2EC0A 1BI4A 1BGXT 3K5OA 3NAIA 1LW2A 3AO4A 4PA1A 3ZCMA 4ZPDA 1Z26A 2HWHA 5HROA 2Z1HA 4UQGA 2Z1JA 1IKVB 3V9XA 1TKXB 1S4FA 3CM5A 1T7PA 4FBTA 4PWDA 2D5RA 3K5NA 4QOZB 3RB6A 4HUEA 4I7FA 3VQDA 3UQSA 1TP7A 4ED8A 2OPPA 4F50A 4OKJA 4IH5A 4CEQA 4FJ8A 2HHVA 3OYLA 3AVGA 2XO7A 4GC7A 5L9XA 3M8QB 5CYMB 3CIZA 3OYNA 3KK2B 3OVNA 3ZSVA 4YMEA 1JLQA 3HL8A 1NK9A 1WAFA 2ZD1A 3QLHB 5KG3A 4ED0A 2XC9A 1SKWA 5F9LA 4L8RB 2JLEA 3G86A 3ZSOA 4CIFA 5HRPA 1LWFA 1NNDA 3HVWA 4KFBB 4K4YA 3QEPA 1QTMA 4HKQA 1SUQA 4E1NA 2FJVA 2WONA 4M3YA 4OJRA 1RYRA 4NLPA 3OS0A 4NLVA 4B9TA 1VRTB 4FJ5A 4ZHRB 4ELVA 4ED7A 4KSEB 4RW7B 3V4IA 3LP3A 3TAQA 1UWBA 3DDKA 3CJ4A 1XR6A 3FFIA 5HRSA 2G8UA 4I2PA 2C2EA 1T03A 2RF2B 3QIDA 1JLCB 4NLOA 5JXSA 1S1UA 3H59A 3SI8A 2CJQA 3KKSA 1W9HA 3LZIA 1ZBUA 2BRKA 4EBCA 3TVKA 5CYQA 4C8MA 1T05B 2RDJA 3LDSA 2Z1IA 4CK2A 1TKTA 2HHWA 4TXSA 1BQNB 2WTFA 1VSKA 1EETB 4M3WA 1FKOB 2C28A 1NKBA 4NLTA 1MU2B 2FJXA 2V4RA 1T94A 3DM2A 4ECWA 5KG1A 1IKWB 1KLMA 2IBKA 5DMRA 3GV8B 3PUFA 3OYIA 4B9UA 3DRRA 5KFZA 1JX4A 2HNDB 3IGVA 4RUAA 2ASLA 4HHTA 3OYCA 1QE1A 3BSAA 2OPPB 4M3UA 4FZZA 4IFYB 1WSEA 3RB0A 4DS4A 5FROA 2YNGA 1B9FA 4MIBA 4FZYA 3PO5A 4KB0A 4CGIA 3VQ6A 4DSLA 2BE2B 1HYVA 2W9CB 4B8CA 4NLWA 1RDDA 4FJHA 3ZSWA 3QGGA 1RT4B 5T7BA 2QK9A 4YFUA 3HT3A 4TLRA 4ECSA 1EP4B 1NOZA 3DRPA 3UIQA 2B6AA 4F3OA 4TY9A 3FDSA 4J9LA 4B9VA 3V81B 3O4QA 5KFTA 3ISND 5FRMA 3RTVA 3GILA 4DTNA 3I5AA 3AA4A 1TKZA 4B9LA 3DLEA 1TKXA 3HVTA 4CF2A 3NMAA 2UUTA 2YHBA 1Z4UA 4Z4HA 1QSSA 5KRTA 3KK1B 3KHRA 4DG1A 2E9TA 1RA6A 4CECA 2KQ2A 3LWMA 2DFEA 1S1VA 4ZP6A 3CG7A 4CJQA 4ZP7A 4O44B 5K14B 2UVUA 4FLTA 4N76A 3QNNA 4WXOA 4CGHA 1D8YA 3OLBA 4PWDB 1S0NA 1WSFA 4DSEA 4N56A 4ZMMA 1KSPA 2IC3B 3T1AA 1JLEA 4K4SA 3SQ2A 5CYQB 2AWZA 3DLRA 1DLOA 3PJWA 4G3IA 3OL6A 1NK4A 4AHUA 4LD0A 2D0AA 3LP2B 5F8HA 3KK2A 3HPGA 3NHGA 5KTQA 1RTIA 4URQU 1CXUA 4LSLB 1TL3B 4RW6A 3AO2A 1ZTWA 2HWIA 1JLFA 4JV2A 3OYDA 3CDUA 4O3OA 3CWJA 1FKOA 5F8IA 1N6QB 4ECQA 1J9AA 4K8ZA 5C42A 4WE1A 3P83D 4WYWA 3MEGA 1IKWA 1KLMB 2FVPA 1GOBA 3CFOA 1CLQA 3DYAB 1JXBA 4R0EA 3NKYA 2X6SA 3ZT2A 1S9GA 2I5JA 4U7CA 3QGIA 4KO0B 4GW6A 3N6LA 4CHPA 1O1WA 3SYZA 5D3GA 4J2EA 2ILZA 2IM3A 3RBDA 1JLBA 4DFJA 4M94A 3KHLA 4NLRA 2AGOA 4H4OA 3MTKA 2R2RA 2E6LA 3KIOA 4NLXA 4Y34A 4ECYA 1T05A 3MR6A 4FJNA 1RT5A 3KMQA 1S1UB 4Y3CA 2W9BA 2RPIA 2I1RA 1W25A 4FS2A 1WSHA 4CHYA 2F8TA 3V9ZA 4M3RA 1A5XA 4CF1A 1FKPB 3T19A 1CSJA 5C25B 2XY5A 2XGPA 1T8EA 3AO1A 2F8EX 1Q8IA 4BE2A 3AV9A 1SKRA 4Q43A 5JUMA 4EO6A 3OYBA 1UA1A 1RTDA 2JC1A 4YNQA 2QKKA 4M3TA 1QAIA 4LSNA 3L3UA 1WN7A 3SUPA 4O44A 4RW4B 1JL2A 3OYEA 5JS1A 3EZ5A 3ZSXA 2HMIA 4N41A 4F4ZA 4PQUA 4OL8A 3NGZA 4CJSA 3NH1A 4J9NA 2E6MA 4KV8B 2W8KA 4CCHA 4K8XA 3DLGB 2OZSA 3AA5X 1NHVA 3C6TA 2C22A 3KJVA 4BWMA 3KLGA 3VA0A 4IQXA 2BANB 5I3UB 1D9FA 4RNOA 4R5PB 4QW8A 3G6XA 3RMCA 4BE0A 3O4NA 3LP1B 4JRQA 1W0HA 4TSXA 2PZSA 4KHQA 4ZPCA 1LW0A 4CFAA 1VSJA 2JEJA 2FBVA 2V0NA 4E7HA 5HP1B 4KTWA 3SPYA 1JLGB 2XY6A 2YKMA 1DTQA 1C0UB 2X78A 3NCIA 5KGWA 4IR9A 3IG1A 2UUWA 5KFSA 5C24B 4ECRA 4KHYA 4OGEA 3UDLA 1SV5B 3QIPA 4DU4A 3DI6B 2KTQA 1RDBA 4KRFA 2JGUA 2OPQB 1K1SA 1G15A 3DRSA 4CJ4A 4JS4A 3MEEA 2G8HA 4OLBA 5KT7A 4DL7A 2B43A 2HHUA 3EPGA 3QINA 1IKYB 3L3VA 3ZSZA 1ASWA 4ECTA 2XI3A 3L2VA 1X9MA 4NCAA 5C42B 1TV6B 2W7PA 3T3FA 3HSTB 3LP2A 4CFBA 2RN2A 3MECA 5FDLA 3EYZA 1GX5A 4C8LA 4DMNA 5DQIA 1T3NA 4WZMA 1Q9YA 3GQCA 1TK8A 4KB7A 3RMDA 1IM4A 5L1KA 1I39A 4DWIA 3CDEA 4JRPA 4TYAA 4OGCA 3G6YA 3T5JA 3AVLA 4DTOA 4Z4FA 5F9NA 1UA0A 3PHEA 1DTTA 4Z4GA 3C6TB 3GIIA 4RG8A 3AVHA 4CGDA 1JLBB 1BL3A 2HNZB 4J2BA 4KE5A 1RT2A 4Q45A 4Q8FA 3WNEA 3QERA 2FVCA 1RT3A 3NF8A 5KG0A 1L3TA 4ELUA 3MXIA 3OL7A 2ALZA 5J2NA 5J2QB 4H54A 4TQSA 1RDRA 3GV5B 2W9BB 1BCMA 1C1BB 4QW9A 5L1LA 2EHGA 1N56A 4RNNA 1UWBB 2JEIA 1EX4A 1SL2A 1HNVB 3QEWA 2DY4A 2JC0A 3G10A 1RDCA 3NH2A 1S9FA 1C0UA 1QUVA 1T03B 2VWJA 3I0SA 2PY5A 4IG3A 1A5VA 1YVFA 4FLYA 3TWHA 3GIMA 3H2LA 2ZD1B 3MFHA 4ED6A 1RILA 3D45A 3IAYA 4ED2A 3PY8A 4F4YA 3KKRA 3QETA 4Y2CA 4QWEA 1I6JA 4O4RA 4ZP8A 4HVJA 3NGIA 4ID1A 1NK7A 1S0MA 1IKYA 4CEDA 4EP5A 3PO4A 4R5PA 2DTUA 2XCPA 4E7KA 3MEDA 3H98A 2VA3A 1TV6A 3TARA 4KFBA 3QO9A 5I42B 3OHBA 3EZUA 4MQ3A 3RRGA 3RB4A 3U3GA 2BANA 2GC8A 4DTPA 4ED3A 4JUZA 2FBXA 5KFOA 1SUQB 4CF8A 3BQ0A 4DL3A 2XGQA 4OPKA 4E19A 5HBMB 2HNDA 3HJFA 3PW0A 3WNFA 3TAMA 3TAFA 2XWYA 1KVBA 1QQCA 1RTJB 3I5CA 1KCFA 3NBPA 3IS9A 4IDKA 3KLFB 5F8GA 3VQSA 4F4WA 1RTHA 4BE1A 2OZMA 2YKMB 3ITHB 4TY8A 2AX0A 4NYZA 1R0AA 4DLGA 1XHXA 4OVLA 4HCBA 4FLZA 4XIUA 5F8JA 4J9RA 5KFNA 3HM9A 4CF0A 4FM2A 1SV5A 2XY7A 2B6AB 2IM1A 3NH0A 4ELTA 1JIHA 1RT3B 2XCAA 1B92A 2OPQA 2WCXA 3V6DB 3C95A 2GBZA 3AVIA 1QS4A 3OS2A 1BQNA 5HRNA 1TVRB 2AGPA 4KHSA 2B4JA 3QZ8A 1UAXA 4EZ9A 2BQUA 4FCYA 1Z25A 1D9DA 3HO1A 5F8LA 4DTUA 4ICLA 2ATQA 5DG7A 2HHSA 3JSMA 1A5WA 5HLFA 4EBDA 3KLEB 3I0SB 5L1IA 4R8UB 2J6SA 4ZVEA 4DFPA 1QHTA 4Z0UA 4IH7A 4Q5VA 2W9CA 3VQQA 3SQ0A 3DRRB 5KFQA 3T5HA 3L2RA 4KB1A 4FW2A 4J9KA 1IG9A 1HQEA 3MR5A 3Q8RB 4O5BA 1NK5A 3D5MA 4CGGA 4WFYA 4J9SA 5KFCA 3ZSYA 1TL3A 4RW6B 4HUFA 5F8MA 2YKNA 5KFXA 3QEIA 4MFBB 3LANA 3K2PA 3OSNA 4NLSA 1RT6A 1KHWA 1RT4A 1CZBA 2HNZA 4O3QA 4K4VA 3OYKA 2KW4A 3RAQA 2FVRA 5KT3A 4IKFA 3V81A 4DG1B 3KLVA 3LPUA 5HBMA 4CHOA 3CM6A 1LWEA 1EXQA 4LH5A 3KTQA 2QV6A 3GV7B 5K14A 5D3GB 4NLYA 1RTJA 4NCGB 1C1BA 4G1QA 3V6HA 1VSMA 3RWUA 4QWAA 4KHNA 3ZSRA 2WOMA 4FJGA 3KK1A 4H4OB 1HNVA 3NBPB 3E51A 4J9MA 1REVA 1RTHB 4EEYA 1WSGA 4CIGA 3PW5A 2RKIA 1XR7A 2VG5B 1S1VB 4IBNA 4FJ7A 4M95A 1JLAB 4DQSA 3OL9A 4F4KA 1HJRA 3H5YA 4MIAA 3SNNA 3M8PB 3K58A 4KPYA 1JLFB 1K6YA 5KFIA 2YNFA 5SZTA 5J2PB 1DLOB 3K5MA 2IJNA 3OYFA 4ZP9A 2W7OA 4YP3A 3CJ3A 4MH8A 1XHZA 4CJWA 4LSLA 2W42A 2UVRA 4NCBA 3DYAA 5KT6A 1S9GB 4FW1A 3MEDB 5J2MA 3H5UA 4FS1A 4CEEA 2BDPA 2FVSA 1N6QA 3QIOA 3PX6A 4I9LA 2F8SA 1SH0A 3RBEA 4B3OB 4FJ9A 3PJXA 5C5JA 1RBSA 1S6PB 3E01A 3KLIB 1HNIA 3KLEA 1J53A 3HPHA 1GOAA 4W5NA 2R8GA 3MAQA 1S6QB 3N6MA 4KO0A 2VG7A 2A1SA 4F8RA 1GOCA 2AGQA 4CHNA 1HYSA 4NLQA 1I3AA 1NJWA 4KKOB 3TAPA 3CDWA 1SKSA 2D41A 4FK0A 4JV0A 4PUOA 3IRXA 4N47A 4EYHB 1FKPA 5EU7A 1R0AB 3NF9A 4URSA 2IAJB 1OS5A 3OYMA 3SFGA 1LWCB 1TL1B 3NFAA 4QWCA 4J9PA 4QCLA 1ZYQA 3M9NB 5KG5A 2HHXA 3ZT0A 1JXLA 3PX4A 2Y1IA 3HYFA 3NDKA 1U09A 4IG0B 3CO9A 3OS1A 3AO5A 1TVRA 4I2QB 3IG1B 5CZ1A 4G1QB 1N4LA 4CGJA 1L5UA 4EBEA 4YR0A 2BR0A 2YNIB 4RNHA 4M45A 2EX3A 3CFRA 3DLGA 3BDPA 1S9EA 1RNHA 2B5JA 4AH9A 3MEEB 4O55A 3M8QA 2GUIA 1WLJA 4R8UA 4DSFA 2DPIA 4NLUA 2HW3A 2KFNA 4WFXA 3H5XA 4GMJB 3PW2A 4ZTFA 1S1XA 3I0RA 4MFBA 3SCXA 3SI6A 4FYDA 3ZT1A 1WSJA 4DL5A 2R8IA 3LP0A 3ICLA 4ECXA 3KLGB 3V1RA 2PYJA 4XO0A 5E41A 1NK6A 1RBTA 4YR2A 2YNHB 3OLAA 5KRSA 3RMBA 3M9MB 3GIKA 1TAUA
chains in the Genus database with same CATH superfamily
2OPRA 3O5TB 4K7QA 3A8IA 3NWGA 4PKHA 4CD1A 2AIRB 2LEAA 2QA2A 3V4IB 4DSIA 1ZPVA 3OYAA 2NQPA 3M2RB 8ATCB 2BEFA 3TANA 5JVGL 1R8AA 2PYLA 3FEYB 1OYEA 2K8GA 3AA2A 1SC6A 5CA5A 4OI4A 2M8DB 1IO2A 2DNQA 1J2VA 2CQBA 1F9HA 3IAS9 1WOOA 2CZVC 1KAZA 2JJ4D 2P51A 3K7RA 3DRSB 5DQHA 2AZ1A 1V3RA 5L46A 3VQAA 3VQ5A 5LJWA 4IRDA 5D4PA 3DMJA 2DJWA 2PMHA 3VMFB 4DTJA 1CJVB 3VAKA 2NUUG 1IQZA 2V8GA 1LAVA 2NZTA 3OBWA 3PX0A 4JYAK 3SMPA 2XSFA 4O3NA 2IOCA 2HHQA 1KQFB 1XMQJ 5KFEA 4FXVA 2E2OA 3C46A 3BZCA 2QL7B 3PW7A 3NGYA 1Q7LB 2H5EA 4NB4A 1VQ4N 2IYGA 4CRJA 4U7BA 1DQ9A 4C0OC 1NGEA 2ZGYA 4DQIA 1X4HA 4F9OA 1WI8A 3DU5A 1NKEA 1ZBLA 4RBTA 2RU9A 2OELA 2GIRA 3WNGA 2HBZB 1RAGB 4H4KC 1JJ2M 2VICA 2QWQA 4E7IA 3CJBA 3LDPA 3JYTB 4NRTA 1L3KA 4OHWA 1KTVA 4TU7A 4DHVA 4O3RA 5AE1A 4DV2J 2A0FB 2XQCA 1YUWA 2DNOA 2Y1LB 4ANEA 4HTUA 3BEXA 4USHA 2F65A 5HVFA 3UD5A 1YBAA 5GIOA 3OBIA 4RWXA 3L2WA 3QWPA 1X1PA 5ADXH 1HNZF 3EGZA 4IG0A 1RBLA 3VTHA 4CJ3A 1S99A 2C2DA 2EFQA 4KHRA 2M8HA 4CESA 4JD2B 1VQ7N 4YS2A 1Y64A 4CNZA 5KFKA 2VF3A 2MQPA 3CFPA 4WP9A 3ALYA 1Z1ZA 2DTJA 3CT9A 3ID8A 3ZT3A 4ZVTB 5AR0A 5ETSA 3C6UB 3ENOA 3Q2SC 2L41A 4Y28C 3QGHA 2O4IA 1XNRF 4C8OA 3R5CA 3DLLQ 2MB0B 4TVAB 4LQ3A 2BUPA 4WE1B 1HPMA 2IM2A 3CJRA 1A6LA 1O13A 2ZITA 2FVQA 3KLHA 4RW8B 3EGNA 2P5GA 3O3FA 3RR7A 2D3ZA 2IVNA 2ZE2A 4NI2B 3CDAA 1R8CA 3FR0A 3WQUA 2N7CA 3UKRB 3QT6A 1TMJA 2DGOA 1Q7YT 3A12A 4LY7A 3KHYA 1EQ0A 3I96A 1CLFA 4CERA 2G1DA 2XM3A 2LYVA 1FRMA 2V9WA 2ZWHA 1S10A 3EO3A 4DU1A 4RW9B 3JYTA 2NXJA 4DR6K 3HXMA 3LWLA 4DR3J 1HBNB 1CJVA 3AVFA 1RHMB 2Z57B 3AVCA 3V6DA 1LW2B 3MAAA 1U4BA 2ZBPA 1NNEA 2JVRA 3HVRA 3THVA 4FJXA 1Y4ZB 5H9EJ 3OYJA 2IDEA 4BLGA 1SBRA 2JFDA 1LK5A 5CZVA 3FRZA 2GAHC 3SSSA 1RTDB 1N54B 3VAFA 3NWRA 3Q8QB 1KQSM 4HTLA 3VR1A 3QFWA 1ULRA 1BOTO 5CE3A 3M8PA 3HCXA 2IGIA 1RCHA 2WTUA 3P49B 1UVJA 2K3IA 3CCUS 1IM6A 2V7ZA 3P8BB 3BYPA 1U47A 2NYHA 3BPDA 1WDDA 2ASDA 2PFDA 3MOZA 4Y2IA 5CQGA 1YJ7A 2MSSA 1YHQN 2E44A 2ZKUA 1RKJA 1GX6A 3PYGA 1GQEA 3ZZOA 2V2QA 3E01B 2VBZA 4PQAA 3UR0A 1BISA 5FPMA 1QVFM 4CDIA 4CK3A 1RAJA 1SPBP 1BI4B 1U6ZA 3ZX0A 1XIQA 1GLAG 1FJCA 2H5IB 3JTPA 1YITN 5DJBA 2MKCA 1LK7A 1DZ5A 2BTFA 1SQGA 2B0GA 4JK9A 3UR3C 1REVB 1D9AA 2VOOA 4ZS6A 4H03B 1HIYA 2WBMA 2BQ3A 1HKGA 4ZPBA 3CJ8A 3VCDA 2DVIA 4AL7A 3IP0A 3AHPA 1K0VA 1VLYA 3EWGA 2PBDA 1CC8A 1FRJA 4HUGA 1QQOA 1Y97A 1LAWA 4DUYF 3DLHA 3OW2R 5KFDA 1HNZK 5KGXA 4EAHD 2M9KA 4QR0A 4HHHA 4FWPA 4ZVGA 3E3XA 5E3PA 2Q0RA 3HHKA 5IM0B 2UXDF 4KHPK 3C14B 2YPZA 2JHEA 3OPKA 3OR2B 3GSDA 1M5VC 2EXUA 1KFDA 1N5QA 4HLBA 4PYDA 4R0JA 4CEAA 3BR9A 1V5VA 5AQFA 4JBCA 4E2FB 3J80Y 3SJJA 4CH1A 4F02A 1NHUA 4FWMA 5KFYA 4DR6J 2HVHA 4JI5K 1VQ8N 1YIJS 2IRXA 4AILC 2IBOA 1TL1A 2DIUA 3CJAA 3DCAA 1C6VA 2IAJA 1RAAB 5E0OA 4C3KA 3FQKA 1T11A 2FC0A 4JHDB 1N36K 4FP9A 2OEKA 3Q8PB 1ZS6A 3HTVA 4E0DA 3AGRA 4PKDB 4O0NA 3SUQA 5AQVA 4ZK7M 2YNIA 4DJBA 5DK5A 3WIUA 3BSCA 4WFAL 2HSEB 4BRQA 2MHNA 4MTPA 3LAKA 2F4VF 2JZ5A 4H4MA 2D3UA 4QIEA 3O08A 1SH2A 2XBPA 3SFUA 3CEDA 2JEFA 1HQUA 3BP8A 3D2EB 4AHSA 4BACA 3ZTPA 4F26A 4U9RA 2KM8C 1S1WB 3HSZA 4OHXA 3VEWA 4EP4A 3ILOA 1RABB 5KQDA 1GMVA 4DPXA 4M5LA 1RB0A 2KHOA 3HDSA 2YNHA 3IDHA 2GQQA 4Y1CA 2KKZA 3ASMA 2KRBA 3BF4A 3DLBA 2ZHAA 2DR8A 3MM5A 4JI8K 2QA1A 2KXHA 5THWA 4DV4K 2IFXA 4K0KF 2HBYB 1MMNA 3A1YG 5KT2A 1N5TA 3ZSQA 3OBYA 2V63A 4HDHA 4CZGA 2VONA 2G8KA 1UZDA 1FFSB 5JJBA 1QD1A 2AYMA 4DL2A 2X1GA 2KH9A 5AQSA 4DQRA 3OY9A 3TAGA 2W8LA 3WBZA 5KFBA 4JS5A 4QZVB 2WW8A 2NRVA 3HM8A 4CJ5A 1VC0A 4C0HA 4XPCA 2PSZA 4WYBA 5KFFA 4G65A 1H38A 3KNAA 4J2AA 4JKDA 3ULDA 4O4GA 2ASOA 5KFPA 1N5VA 1SQFA 5KFVA 1WNEA 1RLDA 3RVCA 4EYIB 3MR3A 3K89A 2J6UA 4P73A 4TU9A 2ZJPQ 2FGCA 3CCRS 3M8RA 4FNIA 1EZZB 4CW7B 1JB0C 1WEXA 2ITMA 5CD4H 3L4QA 2AW0A 3G82B 3PEJA 3RMAA 4JI0J 5B0DA 2RIJA 1S97A 3CPWR 4DV0J 4WXWA 2LECA 1VQMN 3KYLA 2G8WA 4CHZA 2QKBA 3BGRB 3BJYA 4JI3K 3GPAA 2J0SD 2GV9A 1ESVA 4USMA 1O51A 2AA4A 1LXNA 1BY9A 2H5JB 4I1TA 3QEXA 3M4XA 2B7CB 3S3MA 4X66J 3CYMA 3KHGA 5IZHA 3O9TA 4ZLLA 1LW0B 1S5JA 3A2FA 1AROP 1M5KC 2UXCK 3KLHB 3M9OB 1IJJA 2DXEA 2G0JA 2VZ9A 4X65K 3LP1A 1YAGA 4JB8B 4CFDA 4KY3A 2V8HA 5E3AA 2Y1RI 3VQBA 1RT1A 2XG8A 4I6MB 3VGMA 2NCKL 1H74A 2IS3A 1VQNN 1BUXA 3K5LA 4ED1A 1NGCA 3DOKB 1UCNA 4H5VA 4HYKA 1FD2A 2HVZA 4F0MA 4Q2MA 5C24A 3OTOK 5LMUK 3D2EA 4CEZA 3HZ6A 4KTZA 5BXIA 1HPZA 2RVJA 4CO2A 3PRVA 3AO3A 1FTRA 4FPAA 3AVKA 1NZAA 5DLFA 2DGTA 4EUVA 4RW8A 2HOEA 4AL5A 3H3NO 4WFZA 4CO1A 4MO4A 4DTSA 2AKWB 3VQPA 1LV5A 1YRXA 2E66A 2UXCF 1B9DA 1S6PA 4IFYA 1CZ9A 2BOPA 2CZ9A 2OAUA 4LFCJ 4RLEA 4O8KA 2ZVSA 2ZJRL 2R7RA 3WXMB 4I6AA 3NE6A 4DR4J 1GLJO 1QSYA 1KFSA 1T0TV 4ILMA 2F40A 4NA1A 3KXDA 2IRYA 4ZCMA 2R9LA 4NYFA 3HHLC 1S72N 2CQ0A 5DDRC 4CEOA 4DR1J 1U45A 2P9SA 2C2KB 1UVNA 3BGRA 3D4JA 3EPIA 1IJEB 4DMZA 2CH6A 2BE2A 4C8NA 3OUYB 4IFEA 2IM0A 2XLJA 1X3MA 1Y5IB 5A8KA 3AVJA 3VA3A 1SJQA 4AHTA 3UNGC 2CKWA 4FLWA 1YBTA 3H6EA 4FJLA 2RUSA 1FX2A 4OFZA 1NUEA 2I0XA 1N48A 4OX6A 1VBYA 4CEBA 3Q89A 4DR7K 3TTDA 1NJIO 1LW2A 5CXTA 3AO4A 3VENA 4BRCA 3ZCMA 3QMLA 3SBGA 2HWHA 4UQGA 1IKVB 2BE7D 2F63A 4RR5A 2ZF5O 2ZZMA 1FHTA 3VQDA 1TP7A 1P8ZA 1RZMA 4ED8A 2RQKA 3KK7A 4F50A 3CHWA 4IH5A 4PXBA 2KFYA 1X4FA 4N7TA 3C16A 3KK2B 1VQMS 4YMEA 4OHVA 1NK9A 3PKYA 2XC9A 1SKWA 3O6WA 3H20A 2JLEA 3CJSA 2HGLA 3HVWA 4KFBB 3UKUA 5CCMA 4A8SA 4IXCA 2Q1LA 4HKQA 4UZBA 1SUQA 3UCGA 2FD2A 3GWCA 2FJVA 4WPAA 3CJQA 4GY2B 4OJRA 4DHYA 2KJVA 4NLPA 4B9TA 4MLHA 1P90A 2QIFA 4CNYA 3TSPA 2FHOB 1IWAA 2XZDB 3DDKA 1VHXA 4QYZK 4AXJA 2HBMA 4P7VA 5HRSA 2QEXS 3M3ZA 4LBIA 4PXCA 3PKMA 4LJMA 1KDNA 5CZXA 1S1UA 2FHJD 3SI8A 2CJQA 3J7YP 3LZIA 3TTCA 1X60A 2BRKA 1VLOA 2P9NA 1T05B 5A0YB 3LDSA 1Q7YO 2Z1IA 5AQTA 3CO0P 3EN9A 4TXSA 2L08A 1UAWA 3A5NC 4OZ5A 1VSKA 2B4OA 3IM8A 1KWMA 3BZQA 1FKOB 2H65B 1NPRA 4NLTA 2FJXA 2V4RA 1YSJA 1PAUB 5KG1A 2IBKA 3SCJE 5H9FJ 1JCEA 3U1MA 2H1YA 1U2VB 4RUAA 4B3SJ 4I6YA 1QE1A 1RK8A 4BRFA 2ERRA 5LMUF 2RJZA 1WSEA 1B9FA 4MIBA 4FZYA 5A6WA 4X62F 3FZFA 2GIFA 5B0FA 3S01A 2BE2B 2O67A 4QIFA 1HYVA 4JI1J 1FRHA 3QGGA 4UOHA 4BVOA 1RT4B 1VGYA 3EEQA 4JI7F 1XNRK 5CHCB 4PPDA 2F8HA 3A8EA 5HMXA 2ZHBA 3DRPA 3EICA 4EK2A 1ITPA 4LRDA 2YWEA 4F3OA 2GHVC 5KFTA 3X3UA 1AUSL 1X5TA 2AJ2A 2QZ8A 1VQ9N 2IRUA 4DTNA 3I5AA 2FQQB 2BVZA 1VYAA 4B9LA 5GAHI 4PR6A 1Z4UA 2HIYA 1QSSA 3C6HA 2A2CA 1V4TA 4DG1A 1G1XA 2A41A 5DM6L 2KQ2A 4DR4K 4OZ0A 3CG7A 3IBCB 4P75A 2UVUA 4N76A 4BC5A 3QNNA 3VEVA 4PWDB 1S0NA 4K5SA 4ZMMA 2GUPA 3OVAA 4EFHA 3T1AA 3LW5C 3SQ2A 2N3LA 3FBFA 5JMNA 2AWZA 1R43A 4A61A 1C0FA 4NZ7A 4G3IA 1NK4A 4UTGA 4DN0A 5F8HA 4CH7A 4KH0B 2A6OA 2RRBA 4X4SA 3VVTA 2OMOA 3AA9A 2J8AA 4BRAA 5DO2A 3GJTB 4JV2A 2CVEA 2OKQA 4JI7K 1FKOA 1S57A 3L9ZA 5F8IA 2MKIA 2XO6A 4NYPA 1J9AA 5C42A 1VQKS 3DGPB 4C23A 3MEGA 5I9EB 2FVPA 2LEBA 4QQBA 2HEKA 3CCMS 5C2GA 4BQZA 4V19S 1S12A 3ZT2A 2UV8G 3QGIA 1U1MA 3N6LA 4CHPA 1O1WA 3SYZA 3HI0A 2JL9A 3G8QA 2JDJA 2R7WA 1CQMA 4NLRA 4H4OA 4JI3F 1ELOA 1WHVA 3MR6A 1H73A 4X4UA 2LEPA 4Y3CA 2W9BA 1WSHA 4WCEQ 2VH7A 3PTWA 1BA1A 3TSUA 4CF1A 1HBUA 2FJDB 3T19A 1CSJA 5C25B 4DXLA 3QFPA 2OHDA 2XGPA 3AO1A 1PBAA 1EKSA 3JQMA 2FHMA 4Q43A 5JUMA 2HFZA 3N5BA 2M3DA 4IWVA 2Q36A 1WN7A 4RBUA 4WIQA 4RW4B 1OO0B 3TSQA 4LC9B 4N41A 2DCUB 3OTOF 4OL8A 1J27A 5B8HA 1RCXB 3GYGA 3NH1A 3P6YC 4J9NA 3F56A 4KV8B 3O1WA 1P6TA 2OZSA 1NHVA 2K7JA 4A48A 1R8PA 3VA0A 3HLUA 2I7PA 5GADI 5AZIB 2BANB 4C8ZA 4QW8A 3RMCA 3RW7A 2I8EA 1YG0A 2IHR1 4I67A 1ZZNA 3LP1B 4JRQA 3VF2A 3O44A 3CIPA 3VAJA 3WT0A 3H7HB 1VQ6S 4YOWA 1LW0A 4CFAA 4OHZA 4UT4A 1VSJA 2VPWB 2JEJA 2E1CA 3E9LA 3M2RA 4E7HA 3C15B 1FNXH 4PAAA 2Z56B 1JLGB 2GMLA 2X78A 4C11A 3KWGA 3IG1A 3GDQA 3MM9A 4FOEA 2IVMA 1WORA 3SXLA 2F4FA 4JI8J 4KHYA 3GU0A 3SSRA 2NYIA 3UDLA 4B1XB 1RDBA 5EY4A 2OPQB 1G15A 3DRSA 4CJ4A 3DU6A 5JICA 1LQ9A 4HHJA 3JSRA 4OLBA 4M5GA 3RBZA 3CCWA 3CCLN 2A10A 3ZSZA 2Y0BB 2R7UA 5GIPA 4XDCA 1HBUB 2XI3A 4NCAA 1TV6B 5EOYA 4DV6K 3MECA 2Q3PA 3UN2A 2WW4A 2IJRA 3PEHA 3EYZA 1DBDA 2XSJA 2MGZA 4C8LA 2ROGA 1T3NA 4WZMA 4UZCA 1C0GA 3R5AA 4KB7A 3KUHA 1U2CA 4C8YA 1I39A 2YH0A 2NPIA 5LSLA 1VK3A 4MDAA 4JRPA 4MAKA 3H1VX 4YORA 4XEIA 4JI0F 5IWAK 3CC2S 1RWKB 3BN7A 2E1YA 2DRDA 5DETA 1DTTA 2JOQA 3RUBL 1VQPS 2LQ8A 1BL3A 1DARA 4Z37A 2VFTA 4JI2K 1SJFA 2BKPA 2OTJS 2QTWA 1OH7A 1RT3A 3MXIA 3MUMP 3OL7A 5GADP 5J2QB 4JI8F 3I4PA 1RDRA 2FC9A 3BBCA 3G96A 1BCMA 3D7SB 2ZM6F 2EHGA 4RNNA 3H1QA 4PZVA 1HNVB 4JHDA 2CVIA 2ZDPA 3DN9A 2UXBJ 1C0UA 1IR2A 2VWJA 5A2QY 4FLYA 3TWHA 3MUTP 3GIMA 2C3YA 4AQYF 2ZD1B 4MLEA 3D45A 3GL1A 3KDOA 4KPCA 4KHPJ 4ED2A 5A6PA 2CGKA 2QA4N 4F4YA 3KKRA 2K1RA 5IWAF 5IT4A 1ACMB 3BV8A 4OPAA 3KJQB 4ID1A 1JNZB 2KL8A 3KJNB 3AQOA 4B1UB 1BMQB 1M90O 2BUNA 5B09A 2O8EB 1UTAA 2IVPA 2E1MC 3U3GA 2GC8A 1NSAA 2FLOA 4FYVB 2XGQA 1OQ6A 5HBMB 1Q18A 3WNFA 3TAFA 2H54B 3IUCA 1VQSA 3PCOB 2QL9B 4FF1A 4X4VA 4IDKA 2ZDOA 4FKYA 2OZMA 1GLCG 5A0YA 2WB1D 4TY8A 2DRBA 2VGNA 2AX0A 4DLGA 4DPYA 3O4WA 4J8FA 4DR2F 3I31A 1FFWB 1LOUA 3CI5A 3TZWA 4CF0A 4FM2A 4NX9A 5IT0A 3C95A 3AVIA 3OS2A 1EJ7L 5EVZA 3NRBA 2AP6A 3W9JA 3HJVA 4IO9Q 1RP5A 3KZBA 3E9PA 4A47A 1DKGD 4ZVEA 1QHTA 3ULEB 5D4LA 3F41A 1TU0B 4IH7A 2W9CA 3FSYA 3T5HA 1B0VA 2HGMA 4LF9J 5M1FA 3ZZZA 2G2YA 5HVHA 4OJGA 2DT9A 3OT9A 1VQ9S 3VVUA 3G87A 4A8OA 2NRTA 4HUFA 2W41A 3QT8A 3K0JA 2YKPA 2X7IA 4MFBB 1VQ8S 4DU7A 4LBHA 1VQLS 3OSNA 4NLSA 1RT6A 3W9HA 3KUEA 4DR3K 1T3OA 1RT4A 4KHPF 2HNZA 2V52B 4K4VA 3U27A 2LCWA 3TP2A 4RWTA 3WXIA 3AGKA 1D3WA 2W24A 2HZCA 3UI3A 1EXQA 3WUHA 3THWA 4OZ1A 2V9KA 5HQ8A 3AARA 5D3GB 3K8VA 4G1QA 4JKAA 3CJKB 4QWAA 3VTIA 1YJWN 3ZSRA 3ATUA 4FJGA 4OZ2A 3MCSA 2BJ8A 3W9IA 3GCXP 3E51A 4J9MA 2UUCJ 1UL3A 4LF7F 3N5FA 3I55N 5LMUJ 2BE9B 4H0OA 2M52A 1FDNA 4MIAA 3SNNA 3C66A 4IJAA 4KPYA 1JLFB 5L39A 2J9CA 1DLOB 3UD3P 3AB2B 4JI4F 3MPWA 4X62J 4YP3A 3PXGa 3D2FB 4NCBA 1NCLA 4LSLA 2DKOB 5T41A 4CJWA 4B17A 3K9JA 5D15A 3FBBA 4FW1A 3MEDB 3CD6N 3H5UA 1RHRB 4CEEA 1VQNS 1FD8A 1RHJB 2FVSA 2DGWA 1N6QA 3QIOA 3M6WA 3WXKA 1OPIA 1SH0A 1KAXA 4B3OB 1HR0J 1RBOB 2RAQA 1S6PB 3FZBA 4FPIA 1J53A 3HPHA 4A46A 5GVQA 3MAQA 5JMVA 4KO0A 5ETQA 3A5LC 2A1SA 3DRYA 3IFEA 1HFEL 4E1JA 2V5HG 1HYSA 2HKEA 2CPDA 1NLVA 4NLQA 3LDNA 3BO4A 3CDWA 2DIVA 4OMFG 3SIPB 3IRXA 3DAWA 1TYQB 1FKPA 3O6QA 3K2YA 4FKXA 1P9YA 5EU7A 2MY7A 2F7TA 3D67A 2E8AA 2OSQA 1TL1B 3NFAA 3U1LA 1JWWA 1YJNS 5H9EK 4XH5A 1ZYQA 3H8YA 3ZT0A 2Z2MA 4EWTA 4A59A 1YZ7A 4FWRA 4RPFA 4J91A 1UFKA 4FXWA 3AY0A 4CGJA 3S8SA 4AT1B 3M1VA 3D0GE 4JD2A 2YNIB 3HSGA 5M1NA 1S0VA 5C7PA 1GXTA 4B3MF 1U25A 4DV1K 2HS0A 3SAFA 1HBMA 3TTFA 1WC6A 2DO0A 3J7AN 2OSRA 3PW2A 3SCXA 4JYAJ 3M05A 4JYAF 1TUWA 3ZT1A 1WSJA 1IXKA 3JSBA 1YLXA 2HQIA 2VC1A 2ZWOA 1PC5A 3ICLA 2QI2A 3V1RA 2OO4A 3OTOJ 2CFXA 1B7FA 3MHYA 3GIKA 4BRMA 1ZC6A 1E6VA 1E4FT 2ACYA 2DRAA 4FYYB 5LJ3Y 3WQPA 2I6WA 2AYBA 4O5FA 4NL5A 1SJ4P 2ZJQL 3KK3B 2R2TA 4B3SK 3ILIA 2YWKA 4ERDA 2RDDA 1E6YB 4AM6A 4O0JA 3C94A 3NVKA 3BBBA 4DSKA 3PR5B 3QQCD 2G9OA 4Q8EA 3NNAA 4C11B 2UUCF 4IO1A 3CPEA 2PO4A 1WSVA 1PJ5A 5HN0A 4K4XA 3WC2A 3IRXB 2VG5A 4QS7A 5F8NA 3UCUP 2Y9HA 1JXEA 3RAXA 1KAYA 4E7LA 2WRMA 2FB0A 1U49A 2GWKA 2O01C 3CCZA 3DXSX 2PA3A 4DDFA 1PJ7A 1TK5A 2FZCB 4CEFA 4P2XA 5J2PA 3CETA 1KTQA 4DR4F 2IVYA 4ID5A 4LQ9A 4B1ZA 3HZGA 3QSYB 1C1CB 2AQ4A 3L8BA 5G0RA 1PIEA 3I8DA 3DLKA 2BRLA 4DR5J 5DGBA 2V2ZA 2DYAA 1FESA 4FPBA 3TAEA 2KN4A 3QAEA 2NNWA 2V8DA 4LF8F 4OYZA 3CQ8A 2VA2A 2W40A 3MDQA 4WYLA 4WIIA 3BSOA 2FLPA 2AEFA 3V1OA 3P4UB 1RBVA 2Z2YB 3LDOA 3RJMB 2W6KA 2PFFB 2AJQA 1NGJA 1VSLA 5F41A 5KFGA 5GAGI 1M5HA 1I94F 1J5EF 3UPFA 2ATCB 1M5PC 2CWKA 2CJKA 3DLEB 2I38A 2NLWA 1RDAA 4WZQA 3ZNJ1 5FLXU 3L2UA 3M2UA 2RQCA 3G6EN 1S48A 1BWFO 4FWNA 2E9ZA 1GLEG 3POTA 2E2QA 1GLDG 2BJDA 3TQ1A 1U1LA 2HB5A 2Y1JA 2GMJA 2NZCA 3H40A 1UVIA 5C2DA 2MQNA 3ZTOA 3PW4A 5D78A 4DR7F 3K5PA 4M3ZA 3WDOA 3QFUA 3FVYA 5EXWA 3NMRA 5IM0A 1VIOA 2JEGA 1VFJA 1JCFA 1NOYA 3OJSA 1Q8BA 5CY4A 3FE1A 1RA7A 3R5DA 1KEKA 2CRLA 2B9EA 5K20B 2P5VA 2J7UA 2OPSA 2WHOA 1HMVB 2L3MA 2QSWA 4FSVA 1C0TB 1QAJA 4IOBA 5KFAA 1F9FA 4AQYJ 3FZKA 2H48B 4P71A 3MFIA 1VRUB 4JV1A 5M1OA 3IS9B 3KLFA 3JB9k 1YVNA 4TY8B 2QTDA 3AOAA 4RNFA 2R2UA 4CJKA 1GLBG 2QXFA 2GMHA 5KI6A 1X9SA 4HHUA 3K57A 2ZHOA 4YDUA 3T41A 5EX5A 3MX2A 3RBXA 1VSIA 3Q23A 4L73A 4YQWA 2YCHA 4A8MP 2V4JB 4KREA 3DOMA 2AV5A 1B0PA 2DB1A 3UD4P 3PSIA 3PSFA 2G8FA 1ICEB 1GMWD 4TQRA 3KMSA 1YI2N 1F2GA 3P39A 2RHQB 4W90B 4JN4A 5HOOA 5CAAA 5HROB 5DG9A 2VYPA 4FVCA 2ZNYA 2HHHF 4PQUB 5AQHA 1OKJA 4DR5F 2J8SA 2Q79A 2AD9A 3WEEB 2JLFA 3CQXA 3W8GA 1WSRA 4MK7A 1RU1A 3C7NA 4CF9A 5LMNJ 2YPYA 3ZT4A 1W26A 3VAMA 4M8LA 3SV4A 1NBEB 1MWKA 1JJ2R 1DRZA 2RE1A 2EPIA 3SUOA 3P96A 4Y2MA 1G3OA 2W9AA 4GKKJ 2YX6A 2XB2D 4DUYJ 4OX7A 1KD1O 4UOFA 4OO1J 5GINA 4DR6F 3TJ8A 2YQ3A 4JI0K 3QBWA 1S1TA 4F04B 3U9DA 3TW0A 3M2UB 3CJ5A 3FNNA 2OPSB 3OTBA 5B0BA 3THXA 3GR1A 2AYEA 4I68A 5C12A 4AHVA 3CMAN 4USKA 1AFIA 1G2EA 5AJ3F 4XH1A 3FFIB 2D7SA 3GMGA 5B0CA 1SS6A 2MZTA 4JI1K 3IR7B 3ULHA 2HS3A 3AVMA 2XS2A 2OTLN 2E5HA 2NXCA 4O4GB 3V9SA 5GMKa 1L3UA 2VFVA 2FBYA 4PKIA 3TUPA 3S3OA 4FJIA 3U4LA 1EHWA 2FC8A 3NL0A 4W5OA 2R8KA 2DD8S 3H25A 1TKTB 3IMQJ 1LWFB 2KT5A 4B3OA 4OQJA 1VQPN 5H9FK 2ROEA 4OPJA 4USUA 2GFFA 3MM6A 3LTOA 6FDRA 1FWPA 2WONB 3LAMA 1YHQS 4W5RA 4EO8A 4ANDA 4CO4A 4CZHA 2CJYB 1KVKA 4PYAA 3P45B 1MU2A 1IBMF 3R7BB 1RJJA 2ZBCA 4WF9Q 1HBMB 3TO8A 4FLVA 4B02A 4E3SA 4ZCIA 4FDFA 1SJ3P 1N52B 2DNKA 2DGSA 3VQ8A 4BDYA 2OA8A 1X4GA 1LXJA 2B8QA 5ETLA 1DTTB 3PHTA 4K0KJ 4Z4IA 2EWSA 2HQDA 4Z2XA 3D3CJ 5CYJA 2D0OA 3HX9A 1RT2B 2ADCA 1U1RA 1RT7A 4DBQA 4N5SA 3HOSA 4J9OA 2FY8A 3Q86A 2OUGA 1KVIA 5HI7A 2B4VA 3M1VB 4JAXA 1AZSB 2BKNA 3JXUA 4ECZA 3CC4N 1IKXA 4MKBA 1J54A 1QDUB 4ZVFA 4HL9A 1YJWS 3TX0A 3D54A 4ES3A 4IG3B 2C2RA 3V6KA 1UJ6A 4LBPA 3A0IX 2XYPB 1JLEB 5HO4A 3QRQA 1JKHB 4Z4CA 3J81j 5A8WB 2F9WA 3VGLA 2VQFJ 2KZMA 4CO3A 1RTIB 1PAEX 3L95X 4NO7A 2R7OA 4JK7A 1TUYA 1T9XA 3US5A 5HMZA 3JSYA 3MMCA 5E2QA 2UU9J 2CH5A 1U04A 3T9ZA 5AJ3J 4AFFA 3GIJA 3LP0B 4J2DA 4NLGA 2VU5A 2OANA 4AUKA 4RU9A 1B7YB 2E4LA 2RRNA 2IPOB 1R7IA 4DU8A 1JL1A 3AT1B 3T1HF 1QSLA 2XI2A 3MMBA 1R31A 1O6XA 5ETNA 2M2BA 3DKDA 2UVVA 4LF8K 1LFWA 4NEYA 5J1EB 3KK3A 3R6LB 1UPPA 2AJ0A 2ILYA 3CCSN 2YHXA 5I3QA 3VZHA 1WOSA 4GVLA 4W5QA 4CJLA 4YEAA 1MN9A 4M42A 1T9UA 3MWTA 3SQOP 2G8IA 3CXCR 1JCGA 3M32A 1I94K 5KFJA 1IJFB 4RKUC 3O3HA 4ISGA 4YDDB 1I94J 4QAGA 2X3GA 2D0BA 2QFIA 1VIXA 3AD7C 3D0IE 4P74A 1NKCA 4DUZJ 3AAQA 4B1WB 2O5DA 3DLKB 2QRRA 2ITGA 3VEXA 4Y0WA 2AJFE 3M1FA 2BOAA 3NCPA 2QLFB 3LOUA 5EWFA 3KOAA 3ZC4A 3POTB 3DXKA 3QBXA 1XMQK 4LF8J 9ATCB 1J5OB 1RACB 1EAYC 4KHUA 3QLHA 4BR9A 4HI2A 2O3DA 2RH3A 3KJVB 4RUBA 1SL1A 2CADA 1PGZA 2ZVIA 1ASUA 3JXOA 5AZIA 1CC7A 3PVXA 3C65A 2ATLA 3EL2A 1UPMB 2A1RA 2MQQA 1Q1KA 1Z6RA 2HSTA 1HHSA 1WDTA 2KB2A 1NSKL 3RB3A 4DV2F 1ZBHA 4DQPA 5DS7A 2F9TA 3H4DA 1FJGF 1IKXB 4DSJA 3B78A 3FCHA 3KFWX 2YJEA 3MWBA 2CJXB 3IGNA 2CNNB 4M41A 2KRRA 4RW7A 3CB4A 3ZZPA 3CJKA 1UOCA 2KO1A 3HP9A 1WUUA 2K06A 1OWXA 2VFRA 2UXBK 1U0HA 1HD0A 1R0CB 2HBJA 2P9NB 4DI6A 1NGIA 4OHYA 3S9HA 1K8AO 1UW9A 2GS8A 4E7JA 1V4SA 2DHXA 2BV3A 2PA8D 3VF4A 2J9DA 2HNYA 3SPZA 1W97L 3DI6A 1M0SA 3AQPA 5CABA 2E20A 5HAOA 3TJAA 4H4MB 2MJUA 3C6UA 4C1NK 1U2VA 4QPXA 2NSBA 1VK8A 5M1PA 5L38A 1QVFR 1A0OB 2P1JA 3PZPA 2BYCA 5D77A 3W2VB 4BR2A 3CCTA 4FJKA 2RUGA 2GIQA 1BQXA 4CK1A 1X3NA 2DHHA 3Q0AA 2J4RA 2FSNA 2BGGA 3QT7A 4DEZA 3T5KA 1OQ3A 1VK0A 3MR2A 4LRBA 4WFNQ 1ZBIA 1S5ZA 5EWGA 5DM6Q 3PFEA 3MN5A 5HSPA 3R5BA 3G6VA 4I69A 3L0QA 4A8XA 2E9RX 1EP4A 4FWOA 4OLPA 1N5YB 3TQEA 2JFKA 4IH6A 4GKJF 3TUIC 1F21A 3N4PA 1IBKF 3PACA 4CH0S 3Q22A 2VPXB 1FX4A 3SZ2A 2CUYA 5IT9O 2AU0A 1H72C 3HF5A 2EC0A 5FLXY 4BC7A 5DM7Q 3NAIA 1SKUB 4PA1A 4PHTX 3ONQA 1P1TA 3CCRN 5IWAJ 3CM5A 4I7FA 3VESA 4P2FA 3UQSA 3J7YU 4H0XB 4IEEA 5CHIA 2KYXA 2X1AA 3W5ZA 3OYNA 1VHIA 2LDIA 1Q79A 1SCJB 1VQYA 2X1BA 3ZX3A 5KG3A 3SLCA 2NRWA 3LGMA 4KGKA 2Y0SD 5F9LA 2KG0A 5HRPA 2LXUA 1LWFA 2QWMA 1NNDA 2ZNZA 4PG8A 2QEXN 4E1NA 3CNQP 4OX9J 4CYUB 3QT5A 1KQSR 4M3YA 2HF3A 2GTDA 4NLVA 4QBUA 1T9WA 4PG4A 4KSEB 3BKFA 4W98A 5ADZA 5AE3A 1H0HB 2ZWPA 3TA1A 2V69A 3FFIA 4PABA 1U0HB 1R6VA 2G8UA 3KG0A 2C3PA 2RF2B 3NP5A 3QIDA 2G2ZA 5JXSA 4USIA 3CCVS 2GA7A 1W9HA 2XS7A 1H98A 5CYQA 4C8MA 4CK2A 2HHWA 4RWWA 1FJGK 2KI2A 1WKLA 3GJRB 2WTFA 1J5EK 1AZSA 2HFVA 2PIIA 1F5CA 4ISFA 2XWXA 2MLXA 3DM2A 1EIYB 3W2VA 2FY1A 1IKWB 4HWIA 3PUFA 4P72A 1XERA 1FDAA 3L7UA 1NB2A 3DRRA 2R4FA 2ASLA 3IGVA 2B7BB 3OYCA 2OPPB 4IFYB 4DS4A 5DDOC 2YNGA 4U95A 1W7AA 1VDHA 1YJ9S 1UEVA 3R9PA 2VBWA 4CZFA 2CWXA 4CGIA 4DSLA 1EARA 4DZDA 3ID6A 2BJ7A 2ZH5A 1X0FA 3HT3A 2AP1A 4MO5A 3LDLA 3P5TL 1GLFO 2P9SB 1RCOB 1QQMA 1NOZA 2WVCA 4ZJLA 3R6GB 3J7Z5 4J9LA 1HD1A 1NMDA 1TFWA 4O23A 2W2MP 3ISND 2HAFA 4X66F 1KC8T 3GILA 1TKZA 3QICA 4WK1A 1QAYA 3W60A 3HVTA 3NMAA 4OIXA 3VGTA 2F4VJ 2KKHA 2E9TA 1RA6A 2ZKTA 4CJ7A 8RUCA 3R27A 4CJQA 4ZP7A 4O44B 5K14B 2U2FA 4FLTA 4PWUA 1RGIA 2RT3A 2HFUA 3OTEA 3J81Y 3OLBA 3BYRA 2KU7A 1TL7B 1WSFA 4USVA 2IC3B 3JAMU 3T1YJ 4K4SA 3DLRA 1DLOA 2K2PA 1HWLA 4CZEA 4LD0A 3GB0A 2D0AA 3KK2A 2A6AA 2OJ3A 3A5OC 5KTQA 1CPZA 4URQU 1CXUA 3N01A 4LSLB 1TL3B 4RW6A 1ZTWA 4A5BA 3BH7B 3CDUA 1NWKA 2QLXA 4H5RA 3PNIA 4WE1A 3ILLA 4G9ZA 3GBTA 1KLMB 1RUSA 1GOBA 3CFOA 4DV1F 3VF0B 2HZAA 1JXBA 2X6SA 2DR5A 1X5OA 4KO0B 3M6XA 1S22A 2YWWA 5F2RA 4Z94A 1CG2A 1UFWA 4DR5K 2PI5A 3D6MB 3SCKE 3U7JA 4DV3F 1N36F 2MPUA 2ILZA 2IM3A 3RBDA 3W61A 4M94A 1EQMA 3KHLA 1NJIT 1PBUA 2AGOA 2DNYA 2VCPA 3MMAB 2VQFK 4NLXA 4Y34A 5AQPA 4P10A 4FJNA 3UFCX 5FLXO 2ZJQQ 3CMAS 3KMQA 3SK3A 2XZTB 1S1UB 2I1RA 1W25A 4FS2A 4CHYA 1HBNA 2CPFA 5HANA 2F8TA 5I3PA 3L4BC 3G8TA 4M3RA 4CWBA 4CO5A 4MJKA 3KG4A 1SXLA 3HHLB 1Q8IA 4BE2A 3AV9A 2ZOFA 4OYOA 4F0HA 4E8UA 2GX8A 2JWKA 1UA1A 3DFEA 1RTDA 5HK4A 4M5IA 2PI4A 5F0WA 4O44A 2ASYA 3OYEA 1LCUA 4PXDA 2VJUA 3ZSXA 2HMIA 3M30A 1Y10A 1HWKA 2M4MA 4PQUA 3W63A 3LUYA 2M0GB 2E6MA 4CCHA 4K8XA 4EFAC 3VGSA 1S76D 3AA5X 3C6TA 2CPZA 2IY5B 3OD2A 2O8EA 4BWMA 3MX5A 4ILHA 6AT1B 3OR1B 4N8OA 2FHKA 5F3TA 5I3UB 1D9FA 3E8OA 3O8WA 2RE2A 4BE0A 2J0XA 1CS4B 2BA9A 1DJ0A 1W0HA 4BY9C 3M6GA 1UKUA 4KHQA 4ZPCA 2YHWA 1YJVA 2VC0A 2FBVA 2HQGA 2KT3A 4KTWA 3NCIA 2DNZA 2L48A 4IR9A 1FRXA 2VQEK 3MCAB 4ECRA 3UE2A 5DDQC 5LSOA 2EFOA 2KT2A 2D1CA 1PC4A 3LM9A 1HBOB 1K1SA 4WFNL 2W2OP 5KT7A 2Z2ZA 4WFBQ 1M90T 1WUAA 3LA0A 2P9EA 4NEZA 1IKYB 1GLLO 1OVYA 3QINA 5CD4A 3O5BA 4M7YA 3LL3A 1ASWA 1X9MA 4QPTA 3PJ9A 4CFBA 3HHLA 3P4IA 5FDLA 1NLKL 4LF6K 3UVJA 1GX5A 4GV6A 1F3FA 2GO8A 1VJQA 3PG9A 2AJ1A 1IM4A 5L1KA 4OZLA 3LF0A 2WBRA 4PL8A 2ZBQA 4YOVA 2V50A 3TX8A 4DZ6A 3AD8C 3J81O 4DV3J 3T5JA 3SMSA 4Z4FA 3FK4A 2ZOGA 1UA0A 5LMNK 2W7AA 4QR1A 3C6TB 2N4DA 4CGDA 1T95A 4DCPB 4CZCA 3LDQA 4ILGB 3EZOA 3BB5A 1EB0A 3QERA 2FVCA 4NXNJ 3A3PB 1L3TA 4ELUA 5IFMA 2V7YA 5BRHA 3GV5B 1XN9A 2RHKA 1K8KA 4DV5K 1RHQB 2MJNA 5L1LA 4QR2A 1N56A 2QMXA 1EX4A 3O2IA 2JEIA 3CDBA 4UUXA 2EG2A 3ZZ0A 2E7XA 1NDKA 3QEWA 3G10A 3AB4B 4GMKA 2V2VA 2UUCK 4BVPA 4IG3A 1YVFA 2Z8QA 3ADAC 1K47A 5GADU 5EN1A 1RILA 1U8SA 2ZBIA 5K8PA 4C97A 3UDCA 1NK7A 2DR9A 1S0MA 4K2XA 4GO5X 4EP5A 3KWIA 3SAHA 1BWVA 3MEDA 4KGZB 4AXIA 2Y3YA 1NGFA 1U1KA 3TEHB 3QO9A 2VASA 3RB4A 4UY85 2NRXA 4WCEL 4DTPA 4JUZA 2FBXA 4CF8A 4DL3A 3CMES 2HNDA 4YB7A 3TAMA 4GO7X 3OFHA 5AZJB 4CQ1A 1C4AA 2ZC4A 3IR6B 1QQCA 3W0LA 2R42A 1RTJB 3EVMA 1XMOK 1YKWA 4USWA 3NBPA 5F8GA 3VQSA 4Y0FA 1RTHA 4BE1A 3NGRA 1QM9A 1LOTB 2DHGA 1WC1A 3W7BA 4NYZA 1R0AA 1N33K 5B7WA 4WU2A 5F0UA 5F8JA 4QS8A 5KOWA 5L8RC 3SJHA 2B6AB 2IM1A 3DXBA 3NH0A 4DPOA 1B92A 2VKRA 2QWPA 2WCXA 1N32J 4L3QA 4X66K 2GAGC 2HPUA 5BPMA 1ZAWA 2IDLA 1H2UX 4PG7A 2GJFA 1MLAA 4CLTA 4U67L 2Y8WA 3QZ8A 2BQUA 1RDUA 3HO1A 5F8LA 1O5JA 1U7LA 4BRHA 4GNIA 5HLFA 3SAGA 3EXYA 3I0SB 4OYMA 2J6SA 4DFPA 1VQLN 3F0NA 4Q5VA 4GVEA 3VQQA 4LF5J 3SQ0A 5KFQA 4DV4F 1NPKA 4YDUC 4IEIA 1IG9A 4CZIA 2OCEA 3HHEA 2RRAA 4LF4F 3TR5A 5JLFA 2NSCA 5E3RA 2ZZNA 5KFXA 3QEIA 3LANA 4HEA9 4OX9K 2PD1A 5BJRA 3K2PA 2O8DB 1KHWA 4BREA 2Z30B 3S6EA 3LPYA 3DJCA 3OVBA 3BGLA 7AT1B 1PSDA 1T9TA 4O3QA 1X8DA 1HHTP 4CIOA 2FVRA 3BUZB 4I4BA 4JV5K 1NXIA 1LWEA 3MAAB 1HW9A 2QV6A 5K14A 1RTJA 3Q2TC 1GAOA 1X5SA 3RWUA 2GJ2A 2WOMA 2DITA 1HNVA 3NBPB 1WBBA 1REVA 2BACA 3MWPA 1WSGA 4CIGA 2RKIA 1XR7A 1S1VB 1VRQC 3F44A 4M95A 1JLAB 4DQSA 3OL9A 4ILLA 4JI4J 3H5YA 3CD0A 4K25A 3M8PB 1S79A 5J2PB 4Y2KA 2IIHA 3EM1A 2IJNA 2W7OA 1YK9A 1ATRA 1IR1A 3S41A 3MPUB 5GMEA 2FJAB 2KJWA 4BRDA 2VDHA 3DYAA 4LT6A 1KQGB 5KT6A 5J2MA 3LPEA 4FS1A 1VS3A 4ZVQB 4FJ9A 3E01A 4CM2A 2E1PA 4ED4A 3BF1A 4JKFA 5GAHU 3QMQA 1GOAA 5A76A 2C3MA 2VG7A 1CQNA 3UB5A 3CCLS 1GOCA 4CHNA 2BW2A 2V67A 1X4CA 4USJC 3K9KA 3ETOA 2DCLA 1NJWA 4X64F 2D41A 4JV0A 5KPZA 1Y11A 2X51A 1F5BA 2IIRA 4DV1J 3NF9A 1SI9A 2U1AA 3OYMA 1JJ4A 1WG4A 3HI9A 1NGBA 4J9PA 5IXUA 1HNWJ 3M9NB 5KG5A 1T6CA 2QLWA 1V3ZA 3HYFA 4ISEA 3DLLL 2MZJA 4ED5A 3CO9A 2E7WA 3OS1A 4BRKA 2MQOA 1TVRA 4I2QB 1CJUB 1XNQJ 1JNRB 3DXMB 2PFUA 1SC3B 2ROPA 5BR8F 3JS9A 3MGJA 4W92B 5IQ6A 2M5YA 2EX3A 3DLGA 1S9EA 4CLSA 2DR6A 4AH9A 3B8HA 1WLJA 3OR1A 4DSFA 2DPIA 2KFNA 1S4EA 2V8PA 4N8NA 2A18A 3SI6A 4MKYA 1T9YA 1KXPA 3NS5A 4UOCA 1F60B 4FNHA 3KLGB 5BYQA 5E41A 4P6QA 2YNHB 4AYBD 5AQQA 3AJ2A 3BKTA 2ZJRQ 2LU2A 5EDWA 2GELA 3C0BA 4DV7J 4DR7J 2KYZA 2CXEA 1VRTA 1M1GA 3ENBA 2E5LJ 3N6NA 2WOMB 1M1KO 3CJ0A 4HH1A 1N5SA 2C2OB 2R7XA 1IR0A 5HVGA 3SV3A 4DPTA 4I2PB 1YZ6A 3OA9A 1HNWF 4FK2A 1URRA 3M7VA 4FVUA 2GHWA 1GT8A 1RWUA 2E1AA 2ZH2A 1QY7A 2VPZB 3OFGA 1BXNA 4LH4A 4ZA1A 4B3MK 1Y7PA 2J76E 2V4QA 4QWBA 3MURP 2AX1A 5J1PA 5KFRA 4DL6A 1G4CA 3FCWA 3LO3A 1KLNA 2LLZA 3TR8A 4FWLA 3LZJA 3GTYX 3P5JA 1EETA 2O8FA 3T6JA 3PRBA 5J2MB 2HRTA 1NPPA 4JKGB 3IN5A 3ZTSA 1FXXA 3TZXA 4CJTA 3NLCA 3W66A 2UXBF 1X9WA 2DFHA 1X4DA 1FCAA 3NGKA 5FJ4A 4CJVA 5K5MA 1H7WA 2FGOA 1RBAA 3NGTA 3D0PA 4DF4A 5KG6A 2CA9A 1XC9A 1Z2LA 1BIZA 3HD1A 5KPRA 2VWKA 1U1OA 4FLXA 1ZH5A 4B3SF 1TGOA 3VQEA 1BQMA 2QLJB 4QIWD 4H5NA 1N34K 1S49A 2XZWA 1ZETA 2O66A 4KAIA 1Y3KA 2DEIA 5D8HB 4RW9A 2HMPA 5HJYA 3D6RA 1RAHB 4IFVB 1TYQA 4FYXB 2J9EA 2D4WA 1S1TB 2IJFA 3ZEUA 4CJUA 1TMMA 4DU3A 3QEVA 5J2NB 3P38A 1VQOS 2VUGA 3B54A 3P3DA 4CE9A 5KG7A 1HLUA 2HHTA 1XMOF 2VBXA 5BN8A 3RR8A 4L76A 4GC6A 3R9LA 3QESA 4FZXC 4UUWA 3FZHA 1IN0A 5AQJA 4RUCA 1VJWA 1Q86T 5AQGA 4GKJK 4URGA 2Q3SA 2ZH7A 5K9FA 4FXDA 2YWGA 1S1XB 4B9SA 4DF8A 3G8SA 3MN7A 4GVMA 2LA4A 9RUBA 4DX6A 3HBTA 2CQ2A 1VI7A 5C2CA 2LDYA 4KGVB 4M63A 1SL0A 4ENOA 2NUBA 4NYNA 3FC9A 2ZH8A 3T9NA 4X2BA 2R2SA 1BA0A 4FK4A 4ZVPB 2BMBA 4JKGA 5EHHA 4CD3A 4HTIA 4JKCA 3VQ4A 3GJSB 2YX1A 1Q82O 3QO9B 2KFZA 2B9XA 2R7YA 2NS1B 4ECVA 4U67Q 1XMQF 4FJJA 1LNQA 2I5JB 3M5RA 1WNSA 3EE8A 3W65A 5IOLA 5T14A 3LALA 4FOIA 1FE4A 2OEMA 2PE8A 3VQ7A 2QE5A 1N88A 1C0MA 3CJ2A 1SH3A 3QATA 2DHAA 2E5GA 4KBIA 5A8KB 4Y65A 4C4WA 2MTLA 2QJ3A 3CCQS 4R25A 2G8VA 2O8DA 2LSNA 3LGHA 4I9QA 4ECUA 3V9WA 1DY3A 3VQCA 4DV2K 4EHUA 2ETJA 2YHYA 4O3PA 3HD2A 3THPA 3TA0A 3VWSA 3R6MA 3CVKA 1HPZB 1MMLA 4ICLB 4IOCL 4EMDA 2ABYA 3G4SN 4FF3A 2HHPA 4JLHA 4CJRA 2UZAA 2VBYA 2OH2A 4ANCA 2XEXA 3TA2A 1NU0A 3HVAA 4I7FB 4X4RA 3MF5A 3OR2A 2RKIB 3PR4A 4JI1F 4LSNB 2HVDA 3O3LA 4CT8A 1TR0A 5DGAA 1JLAA 1HWIA 2HVEA 3C16B 3SDEB 1FI4A 4KRWA 2JWLA 2V8VA 2I7NA 1T6DA 1BQMB 3BSNA 3O3GA 2YNFB 4Y6IA 3HK2A 3M6VA 3FJ2A 4FPRA 1MN7A 5KT4A 2OFGX 4LIWA 1NU4A 3EXCX 3L4IA 4M3XA 1FNMA 3HHNB 1HJOA 1DEJA 1KP6A 2D9PA 2JWNA 1RAOA 1OIAA 2UP1A 3L7OA 1VC6A 1CEZA 1ZTTA 2LXFA 4DV5J 3ZTRA 3OSPA 4XTTA 3AFGA 1Q81T 2MXYA 4OV6A 2HVIA 3AODA 5LMNF 1VSHA 1UVMA 4FF2A 2Z1GA 1IKVA 4ATNA 4GVBA 2D3O1 2W25A 4KKOA 4LF9F 3NAEA 1B99A 4CFCA 2J0WA 1PG5B 1FT8A 1NGGA 4DTRA 2HBKA 1D5AA 2VPYB 2N4CA 3FQLA 4X84A 4XPEA 3MCNA 1GNKA 3MM7A 3ET6A 2O8BB 4TYBA 4F2RA 5CYMA 2DH8A 3PM9A 2ZOMA 4FL9A 1JQGA 1W7WA 1KRPA 3HHDA 4C3MA 1R59O 4A2BA 2PEBA 3GE9A 3GYNA 1Q9XA 2UUAK 5BRFA 1S1WA 3G71S 2CQGA 4OZ3A 4LF6J 2VG6A 3UKUB 4BDZA 1U1PA 2CQIA 2BQRA 5GAEI 3TUJC 3BR8A 1UJ5A 2EW9A 1ZA1B 3UKRA 2HFOA 2EKNA 4AD6A 3VV2B 1R89A 2W1BA 3HMJG 4FM1A 3WXLA 4YB1P 3B8AX 3D28A 3DOLA 2DFFA 4LFBK 1QVGR 4H5TA 4CHQA 1RBRA 3NY0A 4KH5A 2F4VK 2CYYA 1WG1A 2R8HA 4PRFA 1ITGA 2LA6A 3TVZA 3VGKA 1IH7A 4F2SA 2COLA 4YY3F 1C0TA 2YTCA 2YHAA 2XHWA 2UV8A 2DO4A 1VBKA 3VQTA 3DRPB 2LMIA 4IOXA 2P9GA 2ZFHA 1TK0A 3HFVA 4ZJQA 3U6FA 1L3VA 1XEZA 3EY1A 1YT3A 2BJ9A 4K50A 1LWCA 1WG5A 2DK2A 2W2QP 3CCJS 1TKZB 1HHQA 2OD4A 4IRCA 2UU9F 1NJXA 1YJRA 1WKJA 2DNHA 4LF2A 2F5GA 3KVGA 2VFSA 4C1NI 5KT5A 3Q7BA 1UVLA 2XMVA 2VQFF 1YITS 2YX4A 4I2QA 2A5XA 4EGLA 1D1UA 1PILA 2FBTA 1IG8A 3BDEA 3N79A 5B0GA 3BREA 3F9KA 4TN2A 4DX7A 1N33J 3EVWA 4OYAA 3DOKA 4DFKA 1QUPA 4N77A 1J6ZA 3B6PA 4Q0BA 4X62K 1C1AA 2UXCJ 1K73O 1HX1A 1M5OC 2XHCA 2BKOA 2EVZA 3U3YA 1J5EJ 3KG1A 2P9KB 1NBWA 1L3SA 2CPEA 2CG8A 2QA4G 4NLDA 3VAGA 2UVWA 2R7TA 4ZIWA 1OJ4A 1VSEA 1WC5A 2MQMA 3SQ1A 5LJVA 1E6VB 2HF4A 2I2YA 1RWNB 3NS6A 3WX8A 2NXEA 3JTNA 3P31A 2WB4A 2Z2LA 1WOPA 2MKJA 1RT1B 1D4XA 4UOGA 2QLBB 2J9DE 5D0GA 2XMWA 4KHMA 2ZUAA 1RWPB 3UWTA 4O0IA 1N5YA 4YHHJ 3QZ7A 4Y2AA 3THXB 1ZAXA 2B4PA 4B08A 2E5IA 1RBUA 3K8WA 4LUBA 3S7RA 1H2TZ 1KVAA 4KI4A 3SUNA 4L3KA 3ZO7A 4ID8A 3E1YA 1NGDA 2MY8A 4BHQA 2I9SA 1YJUA 1OMSA 4NA3A 4ER8A 5D4OA 1K44A 1S7IA 4DQQA 3P1GA 4M5KA 4X65F 3DMJB 2VDIA 1FK9A 5HMWA 2LP4A 3I33A 4WKRA 1KONA 4HVZA 4KYZA 1HRHA 1EWQA 1ASVA 5BR8J 1UJ4A 5E33A 5ETVA 1G7CB 1I5OB 3NOCA 4K43A 3B6OA 2MYFA 2W4DA 1RWXB 1XNQF 1PCAA 5HLFB 5EUHA 2OGUA 1S59A 3TI0A 4HT5A 4H5WA 4O3SA 4MK9A 3GFHA 2P6TA 4MT1A 4DFMA 3AH6A 4DS5A 2QYGA 2D3OR 3V1QA 1HQ2A 3TABA 4Q0BB 2GNKA 2GGPA 5LXYA 3T69A 2FXUA 4YN3B 4KAZA 3O8MA 4PKGA 5IC6B 3FSIA 1A7GE 1HKBA 3OL8A 3N0VA 3W5YA 2EBEA 3M6UA 3MK6A 2RU3A 3H4BA 3HSDA 4CLYA 2R7SA 2C3UA 2P9IA 1XK8A 2CPIA 3NG8A 4DX5A 2AYGA 3WQTA 4IFVA 1SZ2A 1UWAA 4FWSA 3GFZA 4JEPA 3QRRA 4H8KA 4UY8O 1MWYA 3R8YA 2F96A 1JMTA 5C25A 4WP8A 1MWZA 3G2XA 3BQ2A 1WF1A 1D8ZA 3AVAA 2LKZA 1HKAA 4KGMA 3T6BA 1DHMA 3PFOA 4XK8C 4OYIA 2PGCA 1JJHA 4I56A 1H6KX 3BBFA 3QIPB 3MDFA 3HSCA 3D3BJ 3C15A 3C3LA 4JKHA 4H0PA 3SQ4A 1Y9OA 3NGUA 2YWHA 1BHLA 2HHHK 2MQ8A 2GX9A 3OTCA 1HQUB 1JKHA 2DISA 1Q5YA 2CJBA 5AQRA 2HRUA 3P5BP 2P5OA 1HARA 5CZ2A 4DV7F 2J7WA 3BN4A 1GEHA 3D2FA 3ENAA 2P9LA 4E89A 4K4ZA 4AF1A 4G1PA 3NMUA 2XLIA 2XYGB 5L1JA 1RSCA 4CJFA 1GK8A 2D0CA 3A8YA 4IOCQ 2UUAJ 1PYTA 4OV1A 3V5RA 4DTXA 1IBMJ 1VC5A 1AYEA 2XMUA 1XMOJ 5GAEU 1BUPA 3GFYA 5H1SQ 3SDEA 3MXMA 1TELA 5KAKA 4CLWA 1OY9A 3ZNUA 2SXLA 4KHWA 2YQ1A 3HPOA 3OFEA 4V19J 1BCOA 1S6QA 3HHLD 5HP1A 2E29A 2HRYA 1FE0A 2ZEJA 1QE1B 5FPDA 3NAHA 1U0SA 2AHOB 4I64A 3UE5A 3R3TA 3HKWA 3PYDA 1RKIA 4WTYA 3VN5A 3QB0A 2NRZA 2DNLA 4IO9L 4ZCKA 2CQ1A 2RNEA 1WAJA 3IO1A 2PMWA 4DB3A 4B3TF 1IV0A 3H08A 1BI4A 2XMMA 3MUVP 5E26A 4GRSA 1RAFB 3K5OA 1MDUB 1Z26A 1A9NB 3FEZA 4QU6A 2Z1JA 4BQLA 3V9XA 3UDVA 1S4FA 2B9YA 1T7PA 4FBTA 4QOZB 3RB6A 4HUEA 5MLCV 2QFJA 2WVEA 3MZIA 1CJKA 4BC4A 3ET6B 2O8BA 3AVGA 3CF5L 2XNRA 2J0QD 3M8QB 5CYMB 3CIZA 1NO8A 2GGPB 3OVNA 4F7VA 1U6BA 1JLQA 2OLWA 3HL8A 3GFXA 3WEEA 4CLKA 1WAFA 4JI6J 2ZD1A 3QLHB 1UEUA 2Z0GA 3GCWP 1TL5A 4CIFA 2AEJA 3J7A1 4K4YA 2X1FA 5B0AA 3CJTA 4LF6F 1K0TA 3SQGA 1WHXA 3FRYA 1PJ6A 1RYRA 2MZRA 5M2UA 3OS0A 3MD3A 4ZHRB 4WP3A 3AXKA 3LP3A 3CSKA 4U8VA 3TAQA 1JK9B 1R8HA 2NRHA 3CJ4A 1XR6A 1BO5O 2DGQA 1SIZA 3HRGA 2J7KA 2CNLB 3MMAA 2XYHB 2BW7A 4I2PA 1ZM2A 2C2EA 3L09A 2LXIA 3BKUA 1T03A 1JLCB 4NLOA 2GHPA 2LQJA 2FSJA 2P9CA 2VGMA 4NWBA 1ZBUA 3T1YK 4U8YA 1S6OA 1V9OA 4EBCA 3TVKA 2J5AA 2XMAA 2FF3B 5AFUH 3PDNA 2DY1A 2Q2RA 1AFJA 1BQNB 3MM8B 1B3TA 2UU9K 4GV3A 1EETB 2P6SA 1YI2S 4HT7A 3U1NA 5IV3A 2C28A 1NKBA 1QAXA 3L6QA 6FD1A 1P9QC 1T94A 5AQLA 2VQEJ 5DMRA 4YHHK 4W4MA 4KH1B 3OYIA 1HNXJ 5B0EA 4HHTA 4RBVA 4LVOP 4M3UA 4B3TJ 4FZZA 3VALA 3RB0A 5FROA 1TUVA 3MAHA 5C10A 3NCRA 4WJBA 3IA0A 3RG6A 2W9CB 4FJHA 1U02A 2B4UA 3ZSWA 5JVHQ 5T7BA 1RDWX 3RSEA 1QTNB 5B08A 4ECSA 2OI2A 5I4MA 3THTA 2D9OA 2WSEC 4DOZA 5G4DA 1EP4B 1SAZA 4OYBA 3UIQA 1T02A 2WVDA 3EJMA 4LRFA 4TY9A 4B9VA 1CVJA 3V81B 2VWBA 4QYRA 2EG1A 1PKUA 3AA4A 1NSQA 4WQ4A 1YGYA 3Q8VA 4CF2A 2UUTA 2VODA 4Z4HA 4F3MA 3KK1B 3DHXA 3ZYYX 4CECA 3GP9A 1ZM9A 2F1FA 2DFEA 1S1VA 4ZP6A 5JVHL 1BWEA 3Q83A 4BG9A 3IBFB 2QSFA 4C0BA 2E1RA 2W2NP 4DSEA 2KDOA 4J7C<