1HNWF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnwF00
4LF8F 4DV3F 1F60B 2HHHF 3ZZPA 4DR6F 4LF5F 4LFAF 2B7CB 1J5EF 1HNXF 2YY3A 4JI4F 4JI8F 1FJGF 4KHPF 4LF6F 1IBKF 4YHHF 4X66F 4OX9F 3T1HF 3T1YF 1N36F 4DR5F 1B64A 4JYAF 4X65F 5BR8F 2UXBF 4DV6F 4AQYF 1XMOF 1CQMA 4DR2F 1CQNA 2E5LF 4B3TF 2B7BB 4LFCF 1HNZF 4LF7F 4K0KF 5LMNF 2BXJA 1IJEB 1IBMF 5AJ3F 4DV1F 4DV4F 2ZM6F 2VQEF 1N34F 1RISA 4LF9F 2UU9F 4X62F 4JI6F 1VMBA 4LF4F 2UUBF 1XNRF 2BVZA 3R3TA 2J5AA 4DR4F 4NXNF 4DUZF 4JI1F 4JV5F 2UUAF 4DV7F 4B3SF 4YY3F 1N32F 1FKAF 1HR0F 4JI3F 1LOUA 4B3MF 4X64F 4JI5F 5LMUF 1XMQF 4NXMF 1QJHA 1G7CB 4DV5F 3OTOF 4B3RF 4LFBF 4GKKF 4DR7F 1HNWF 1I94F 4JI2F 1XNQF 2KJVA 2KJWA 1IJFB 4JI7F 4DV0F 1N33F 2UUCF 4DR3F 4DUYF 5IWAF 2UXCF 4JI0F 2VQFF 1GH8A 2UXDF 4DV2F 1IBLF 1G1XA 2F4VF 2RJZA 4GKJF 4DR1F
chains in the Genus database with same CATH superfamily
1VQOS 2YNFB 5D3GA 2QA4G 1WSRA 3CD0A 1UTAA 3LP1B 2QL5B 3GZ7A 2W01A 3IR6B 3KLFB 2HVEA 2Z4PA 2I5JA 4MK7A 1XIQA 4NMXA 4NLXA 2VQEJ 4DL3A 1NJZA 1CJUA 4X62J 2FHKA 4NI2A 3Q8PB 2HGMA 4HLBA 1SJ1A 3DN9A 3G6VA 3DXBA 1EQMA 4AFFA 1HR0J 1RDRA 1B99A 1DTQB 4WFZA 4DX6A 3GIKA 5LSOA 4F26A 2OFHX 4P6QA 1UFLA 3JSMB 3OXFA 2R2RA 4GKKJ 1RSCA 3HSJA 1FKAF 3RBXA 2KXHA 3M4XA 3BSCA 3DM2B 4F3MA 2PGCA 2WAQD 2CPFA 3PYFA 3K17A 1XJWB 2QLFB 1WF1A 1JLEA 2ACYA 1RLDA 3CIMA 3UO0A 3SI8A 2CG8A 2K06A 4DR6J 4I0WA 4JI7F 1HQEA 4RZRA 2LQBA 4DUTA 1SKRA 4J9KA 1IBLF 1U1MA 2RJZA 1J27A 4ZVHA 1D1UA 5AE1A 4BC7A 4LFAF 1VIOA 4J9PA 5KFOA 5IQ6A 1Q79A 5CCLA 5J2PB 1NZ8A 3C6UB 4IG3B 2RH3A 3W63A 2QA4S 2AV5A 3FVYA 4X65F 1IKWB 1YLXA 1UETA 1F3VA 2PE8A 2WHOA 4ZN1A 2F9DA 3NCPA 2DJWA 4MTPA 1MMNA 1RQ0A 6AT1B 4UQGA 2NSBA 1Q7LB 2DHAA 2HNYA 1D9AA 1FCAA 4MFBA 2IM3A 2I6WA 1ZA1B 4U96A 3DOMB 4HTIA 1FX2A 3V6HA 1HBOA 5IQQA 1OQ6A 5LL6d 1RA6A 4QU6A 3KNAA 2QA2A 2K1RB 4C8MA 4G1QB 1H38A 2BKNA 3I56S 4I2QB 3D0IE 3BGRA 3KG0A 2UVRA 3QO9A 4N5SA 4LF6J 3KUEA 2FPHX 3MM7A 1X5PA 1RHMB 2MZSA 5HROA 2VD3A 1GT8A 1IR1A 5J2MA 1FRLA 2AJFE 2I0XA 2CNKB 2AJ0A 2VKZG 5F0WA 4UZBA 3HJFA 1DARA 3FCWA 4OX9F 3LPEA 1FERA 2KDOA 4JYAF 4L74A 2BRKA 3G87A 4MMOA 4O44A 1NK6A 3MM9B 1YJVA 1CQMA 4B08A 2ZEJA 1YWXA 4KHMA 3CF5Q 2FY1A 3OUYB 4URGA 1VR6A 3A8KA 4DZ6A 4QR0A 3GQCA 3OT9A 1RWXB 3OTOJ 4USTA 4M5DB 4M5HA 1TMMA 2QL9B 4LUBA 3J7YU 4GC7A 1BWVA 2DNZA 1RTJB 4WYLA 3Q89A 4E98A 4HR2A 3D6HB 4ERDA 3ZZYA 2UVVA 4M5NA 4NZ7A 4ITSA 1T9VA 4CO1A 3VR1A 3QIPA 2IVFB 1T9YA 1JXVA 3TUPA 1H2UX 2HQGA 2MSSA 2KT5A 2E5LJ 3G6YA 3QYYA 1KNZA 5HJXA 3HLUA 5DQHA 2JFDA 3CJ3A 4TN2A 2DNLA 2X3GA 2AQ4A 2YKQA 5KOXA 4C0BA 2E1CA 2CJ9A 3W62A 1RADB 1D0EA 4I4BA 4KSEB 2Z2MA 3DLEA 3KJVA 9ATCB 4C2MA 4ZP6A 4NYZA 5GMDA 3NMAA 2BJ8A 4J9VA 1WDDA 4BBYA 2CRLA 3ZZUA 1W25A 2RD5C 3SQOP 2E9ZA 4JBCA 2HNZA 5HO4A 1FK9A 3M32B 4JI7J 2G9OA 3AB4B 2PMZD 4PUOA 1JJCB 3C16B 1X4BA 2EXUA 2HLTA 4PYDA 3H20A 2B7CB 2W9BB 2E66A 1YVFA 4LFAJ 3RYLA 3D3BJ 5IC6B 4MKVA 3CMES 4M5MA 4Z7YA 1H2VZ 3V6KA 3KWMA 3M8PB 2DISA 1FX4A 2G13A 2NUHA 2OHDA 5DDPC 3GV5B 3RUBL 1RP5A 3SFUA 4DLEA 4DFPA 2C2KB 4YB6A 3KOAA 2VOPA 2XY7A 1HMVA 1FNMA 3R5CA 3W65A 3T9ZA 2R2UA 2R7RA 4IOCQ 2RHSB 1IBCB 2U2FA 2W2PP 2IMWP 3UI3A 2AEJA 2IM0A 1U09A 2JEFA 1RCOB 1VBYA 2B5JA 1TP7A 4ZPCA 1T3OA 1RACB 3NS7B 3WX8A 2DR7A 5H9EK 1SQGA 2VIHA 2IM1A 4J9UE 2ZKTA 4W92B 3W8PA 2VFTA 2ZZNA 4KGZB 4DSKA 3BYRA 2V34A 3JSYA 1H73A 3SSQA 4J90A 1F9FA 5FIIA 2HVHA 3ULHA 1S7IA 1SXLA 3NOGA 4OX9J 4Y0FA 3QJPA 4JYAJ 2OFGX 3IWLA 3BDPA 3R2DJ 1C1BB 3PX6A 1KLMB 1L3UA 2G2YA 4OYOA 2W7AA 2J6TA 2V2ZA 3I5AA 1N48A 4KPCA 2DNOA 2A6OA 1LWXA 3PO4A 3OSNA 3AXKA 1T05B 2W25A 3VQSA 2RDIA 2G2OA 3DRPB 5C25B 4LR7A 2KH9A 2RU3A 2QV6A 2HHUA 4QPTA 2J0WA 1I6JA 2GVZA 2W2NP 4AT1B 5H9FJ 4WE1A 1IQZA 2XO7A 4X4OA 4ECXA 3J7AN 4ANEA 4N8NA 4KHPJ 1QD1A 3H2VE 1NSAA 4LVOP 2HQCA 1RT2B 4P2XA 4J37A 3RU0A 2RVJA 2UXBJ 2B6AB 4OX8A 4CLLA 1RT4A 3N6LA 3MR5A 4JB8B 1S6QA 3CJ8A 2M4MA 1VOMA 4P10A 3OR1B 2BJ7A 2XC9A 4DPTA 1UWAA 1S77D 4Y65A 4MIBA 3WC0A 1NHKL 5KFLA 2UUBJ 3CUNA 1Y00A 2JJ4D 2AHOB 2YNGB 5AJ3F 3OL7A 1FXLA 1N34F 1LWFA 2KFNA 2GMLA 1FRKA 4K5RA 1S1XA 1PSDA 1IWAA 2R7OA 5KFSA 1ZA2B 2RQ4A 4R0JA 5FD1A 5LMUF 5EDWA 4N76A 4IH5A 3VAGA 4U8YA 5DO2A 3MR7A 2HRUA 3TVZA 2NPIA 3TQ1A 1IJFB 3HKWA 4V1Ak 4QZVB 4OYAA 1KBRA 4JI0F 3W2WB 1RU1A 4KGMA 4WTYA 4QWAA 1Z2LA 1SJRA 1SKSA 1X60A 4EU0A 2GNKA 1EP4B 4RNFA 4KIAA 5KFXA 1GEHA 5KG7A 2XG8A 2XMAA 3RBEA 4NLDA 5D0HA 4EGLA 3TWZA 5BJRA 1X4EA 4P72A 3QAUA 1XNRJ 1URNA 1HD1A 3KG1A 2BW7A 4B3OB 3I0RA 5AE2A 2OTJS 5IOLA 1UFWA 2CJQA 4B3SJ 1X9WA 3KKFA 3L3CA 4HACA 4X64J 3KUHA 3IBFB 4CCHA 3W2VA 1S6OA 1YX2A 2FJVA 3CDEA 1SB6A 2JSXA 2HFUA 1V5VA 4QW9A 1WTBA 3DCAA 3BH7B 1UJ4A 3JTNA 1W2BR 2PFFB 2ALZA 4OIXA 3I4PA 1FKOA 2LU1A 3QGHA 1X4HA 2HRYA 3FZBA 2E1RA 4FKYA 3PRBA 3DOKB 2KM8B 4NEYA 1VIXA 2YWHA 5CYQA 1S6PA 4ZCIA 1B7YB 2XSFA 3CCSS 2VDIA 3FRYA 3GV7B 2BJ3A 1BHNA 3V6JA 2DT9A 2KVIA 4DU7A 3D1QA 4ZP7A 5D6GA 2K7JA 2IRYA 1NDCA 1YJNS 3H5XA 1XMOJ 2GS8A 2H3EB 2IM2A 1WJ9A 2OPPB 1GXLA 3BKFA 1GTEA 2HQFA 2CQ0A 1IBMJ 3H0PA 3H5UA 4EZ9A 4QWEA 3JTOA 3DMJB 1E6VA 5KG2A 3A3PB 3CDUA 4O4GB 4PQAA 2V68A 1SV5B 5HQMA 3PXGa 2ZNYA 3C19A 4RLEA 2CPXA 4FVCA 2PSZA 3K59A 3HHEA 1UFKA 2RMLA 3HM9A 3IP0A 3KK3B 4ZP8A 3WX4A 4DPXA 8RUCA 4X2BA 4DV2J 4BHQA 2O1PA 3BH6B 2M8HA 3HHKA 3NGKA 5E3CA 1S76D 5MLCV 4DWIA 3EGNA 4L3KA 2AF6A 2BX6A 2YH0A 4PPZA 3DLKA 2M5YA 1NKCA 1PCAA 4XTTA 4KO0B 3KLHB 4WCEQ 1ZM3A 3HD1A 4MAKA 1JKHA 1VC6A 3P49B 1FT8A 2VFRA 3F44A 2V63A 2I38A 3GYXB 1RA7A 2EFVA 5JVHQ 3M30A 4I1TA 4U9RA 1S4FA 3LGHA 3Q8QB 4J7CA 1DAXA 1NO8A 4H4OB 3D67A 1I3OB 3MMAB 2IBKA 5B09A 1TFWA 5IZHA 2EKYA 1Q95G 3HZEA 1VQSA 4YEAA 4WFBQ 1HPZA 2CFXA 1VMBA 4ELTA 1N34J 2BVZA 5D0GA 2WSEC 3MCSA 5LOQA 2KRRA 3ENWA 4UOFA 1VK8A 5KT5A 2CQ2A 1APSA 3SQGB 1YRXA 3GMGA 3GFYA 5LJ3Y 3LP0A 4PXDA 1YHQS 4OFZA 3MEEA 2W8LA 3FJ2A 2FJAB 4ED6A 4YDXA 4FVMA 3KDNA 4CO0A 3AT1B 3MMCA 4ZCKA 2JL9A 3IC1A 1SC4B 1UVMA 1ZAXA 2H9ZA 1PAUB 3G86A 2R9LA 1RAHB 1MN9A 2QYCA 4NL5A 2W9CB 2FJDB 2M3DA 3D1HA 2GIFA 2HVDA 4ID5A 1RTDB 2Y0BB 4UZCA 4FNIA 2XMJA 3GV8B 4ZLNA 4PG8A 4RW4A 5K14B 5CCMA 1J5OA 2ZOGA 2X51A 2V2KA 2CWXA 2E29A 3OL9A 2VG6A 3GIRA 4ZLJA 1GFWB 1JNRB 3HFZB 4LF9F 3SV3A 4EK2A 1H7WA 4OZJA 3SSRA 4MJKA 1RT1B 1BGXT 2VA2A 1CJTB 4B3MF 3QRQA 1P1LA 4DR3J 1KDNA 1T9WA 3PKYA 4I7FA 5ETRA 1N5QA 5E41A 4MYTA 3GLJA 2HSEB 1QTMA 1LKZA 3QMQA 1WEYA 2OMLA 2EFPA 3BSOA 3OFGA 1L3SA 2JNJA 4LR8A 5A2QU 1MG7A 5J1EB 4KTQA 3CJKB 3TZXA 3GCWP 1NB2A 2N82B 3IS9B 2GGPA 4XIUA 1YJ7A 1NKBA 3QGGA 5CYMA 1XR7A 4RU2A 3C15B 2HVIA 4K4TA 4EZ6A 5EHHA 1XQIA 1FNXH 1U7LA 1PYOB 2PA8D 4A8FA 4YN3B 4O3PA 2R8HA 1IKXA 4NYOA 1NXIA 1CULB 1FRMA 1K1SA 3GE9A 4ZPWR 1RT5A 2FQQB 1AUDA 1N8RT 1X5SA 4LFBJ 1P6TA 2HK3A 2L3MA 3KMQA 3QT8A 2K2PA 3CNQP 4AL7A 4JI3F 2IC3A 3K7RA 2CJKA 2MHNA 1RT7A 1JLGB 4ED8A 4FP9A 1Q5YA 4NLVA 2CQHA 1FDDA 1RHRB 3NEKA 4C8OA 3KLEB 4F3OA 2NZCA 2AGPA 5T14A 4QYZJ 5D77A 4FYDA 4CH7A 1NPPA 1TUGB 4R5PA 2C2DA 4NYPA 1PKUA 3BGUA 2H5IB 3FCHA 3VCDA 1AYEA 3N6NA 3D4JA 2MLZA 2VODA 2X7IA 1RCXB 2RRNA 1BWEA 4CYUA 1RUSA 1F3FA 1U4BA 5LT5A 2AMCB 3JAMY 2RNEA 3Q2SC 1PO6A 2CQGA 2ILYA 4FXDA 2CYYA 1SQFA 2FGOA 2ZNZA 3P45B 3OR2B 4QWBA 4WYWA 2ZFHA 2MZTA 6FD1A 5J2NA 2KG0A 2UU9F 5KFCA 3DDIA 3M2RA 4LF4F 3OFHA 2PT0A 3W5ZA 1FD8A 3DI6A 1HBUB 1RB0A 4OJ3A 3PJWA 1YGYA 3TX8A 2BKOA 3QGIA 3M6VA 1NH7A 5A6PA 1SH3A 1C0TB 2FLOA 1XNQF 3GIJA 2QMUB 2HS0A 5A8WB 1T03A 2GO9A 1DRZA 3OXGA 2Z30B 2XI3A 3F73A 2VONA 4QR2A 1RTZA 3CVKA 2F65A 4EEYA 5L1JA 3ZTOA 1JLFA 4USIA 2DGQA 3L9ZA 3K58A 4IFYA 3DHWC 1SJFA 1RT3B 2XS7A 1VRTA 3K5NA 4DF8A 4OMFG 5CABA 2R8JA 3CIZA 3NBPA 4F4AA 2KFZA 1HYSB 1EJ7L 3RW7A 5DDRC 3EPIA 3AJDA 3RAQA 2PEHA 1FWPA 4QIGA 1KQGB 3KLFA 3DDKA 4IH7A 1LW2B 4URQU 2WVDA 3D1OA 3CCLS 1ROFA 1PIEA 3VAFA 3HCXA 1N5VA 3QT7A 2ZBQA 1F9EB 4B3MJ 1NSPA 1TQLA 1G4CA 1S1VA 1YJUA 4GKJJ 5J1NA 3UDVA 9RUBA 3NWRA 3VVUA 1RKJA 1N88A 1HNWF 4GVLA 5KAKA 5H9EJ 2WONB 2ZZTA 1SBRA 3H40A 4R8UB 4EBEA 2OI2A 4OJHA 5IS2A 2AEMA 3ZNUA 1FFSB 2XGQA 1HBMA 3NY0A 1X4CA 4I2PA 1N4LA 1KTQA 3MTKA 2XM3A 2YKAA 2AJ1A 4LFCJ 4OYBA 4O0IA 3TRGA 2DGXA 4OZ3A 2W7PA 1F1BB 3US5A 3FFIA 1JJ2R 3UN2A 1RT6B 2C2NA 4X4QA 2XSJA 3BN4A 1UKUA 2POKA 1QVFR 1VQ9S 1CS4B 3RGIA 1VRQC 1KONA 1N6QA 1IKWA 2K3IA 3BEGB 2IAJB 3V81B 3MAHA 2HNDB 1NUEA 4DV7F 3DKDA 2CQIA 2HIYA 2EK6A 2D74B 1TTHB 3SCKE 1BY9A 4WWSA 4MK8A 4DV5F 1HWUA 4DPOA 1RZMA 4B9TA 3DOMA 1S10A 4ZP9A 3KLIA 2E5HA 5D78A 1RBLA 2MZQA 1PC4A 1IKYB 4PG5A 4MKBA 1JIHA 1Y0HA 2QSWA 1RWMB 5DDQC 2K1RA 3T1YJ 4USJC 3OSPA 3KHLA 1HBNB 4PWDB 2EEYA 1RHKB 3TAMA 3OPKA 4RU9A 2XULA 2JC1A 1X5TA 3MFHA 2DNPA 2LU2A 1S59A 4ZLPA 5DDOC 1RABB 1D8YA 3CD5A 1WHYA 3NAHA 2ZH4A 4KV8A 2JEIA 2OKQA 4M5KA 1TELA 1SJ3P 4ZVGA 5GADU 5KFUA 1XMQJ 5KFAA 4KE5A 2VV5A 4CO4A 1TL3A 2R2SA 4F4YA 1ZETA 3R3TA 1BQXA 3N01A 4DQIA 3MM9A 3MZIA 4DUZF 2GHPA 5G0RB 3A8EA 3ENVA 5I3PA 4ILMA 3C6TB 3BYPA 3J81Y 3DRXA 4ZLLA 4F2RA 4ZCLA 4LRFA 5BXIA 1RWNB 2HHQA 2KI2A 5EN1A 2W7OA 3KUGA 1UMJA 1XNQJ 3NCQA 2UXDF 3DYAB 1RTJA 1XTZA 3FQKA 3CCJS 3CWJA 3JYTA 3CXCR 4F8RA 4OI2A 3DLHA 2BOPA 3ISZA 3PEHA 2LLZA 4TQSA 3RB0A 2KU7A 4ZVSB 4I64A 2D9PA 2M88A 1S48A 2FB0A 1R0CB 2BJ9A 3GSDA 4NRUA 1DBDA 2RKIA 4QIEA 1RWOB 5DM6Q 2DNNA 1ZH5A 3HVTB 1N32F 1C0UB 5MAOA 5KFHA 1JK9B 2ZDPA 3W60A 4M94A 5A8KB 2RHQB 2KZZA 3ZC4A 3CMAS 1YJTA 3MECB 3BR9A 3L7UA 1LV5A 2LXFA 2YVSA 1HNWJ 4DQPA 4WZQA 1RHJB 5C2CA 3NWGA 2X1GA 3U1NA 5AXMA 1FJGJ 1G1XA 1F0XA 4DPWA 5CAAA 1XWLA 4LF8F 4F0HA 2XGPA 1NHUA 2SXLA 4Z2XA 5BR8J 5EWFA 1Y3KA 2N3OA 3CCWA 3M32A 1S0OA 2MHEA 1TKDA 1KEKA 2HZCA 1WD6A 2ZWPA 2MYFA 3JQJA 4ZJOA 3QLHB 4UUXA 2Z2LA 2RAQA 4K5SA 4ED0A 3WHIA 2V8HA 2IMOA 1CQNA 3ILJA 4FZVA 4CLKA 1FJEB 3CJ4A 1UVIA 3M8QA 2V8PA 5CZVA 4JI6F 2E9TA 4ELVA 1WC0A 4E2FB 4IRKA 3GPAA 2GIQA 2HBZB 3CJRA 4DV7J 3CT9A 4WXWA 4FF3A 4EI2A 4B3RF 2XMUA 2RIJA 2ZUGA 1MW7A 2PD1A 4E0DA 3IG1A 1LWEA 3EZ5A 1QUVA 4DU8A 2XO6A 3UD4P 3M2UA 4DR1F 2HFOA 4QU7A 2VF3A 2Z2YB 3MAAB 4DN9A 1Q8KA 4ETZA 1FJ7A 1DLOB 5E5NA 1LFPA 2OO4A 3I82A 8ATCB 4ZVTB 4XPCA 3NG8A 4YDDB 3LAMA 1QTNB 1HNZJ 3CCQS 1QSYA 2VUGA 3PG9A 4YR2A 4KC5A 4EYIB 1M5KC 3LP2A 1SUQA 4DL6A 2CQCA 2C3YA 1AROP 4ILRA 3K8VA 5HI7A 1S0MA 4JOUA 2ZUAA 2HZAA 2UUWA 1DTTA 3B54A 5H1SV 5AXKA 2ZH1A 2BZ2A 3M8WA 3UVJB 1TV6A 2V8DA 2YWEA 4YR0A 3PKMA 5HATA 3ZZZA 3MPYA 4ZN3A 1R0BG 5KT7A 2YKMA 1YZ6A 1T05A 2IBOA 2OPSB 1OWXA 2VG7B 1VQ5S 3DRPA 5C25A 3RBDA 4C9DA 2IVYA 4KGKA 5IT9Y 1EKSA 1OIAA 2BDPA 1R6YA 1DY3A 1HNIA 2V6AA 3LGNA 4M5GA 1PBUA 2JVRA 4DL4A 2Y8YA 3E51A 3G8TA 1OSDA 1HW8A 2HQ3A 5I3UB 3M6UA 4PQUA 2F9JA 2KRBA 4QW8A 1CPZA 3EICA 4OX7A 1Q8BA 3GJQB 4P71A 1GXUA 1UWBB 4OLPA 3OR1A 2ZM6F 1K0TA 2HWTA 2EG2A 4IR1A 2CVEA 3FBFA 4BWJA 4YUDA 2V2QA 1CG2A 2QX0A 1Z2ZA 4G6VB 4JV5F 4KGXB 5KFTA 4BS2A 2DXDA 2DY9A 1NCLA 4KJIA 4DG1A 5HLFB 3HF5A 2VBZA 3GR0A 3IO1A 2B9YA 3UD5A 3LWMA 4OI3A 1NKEA 4NPOA 2K7KA 5LXYA 4KGVB 2LA6A 2YWKA 3OJSA 2A3JA 2D3UA 1E6YA 1Y5LB 2N4DA 2XWXA 2H1YA 3NS6A 2PA3A 2J7UA 2HPUA 1G6BA 4A8MP 4A8YA 4LF8J 1WG4A 4HKQA 2OD6A 5HVFA 1QDUB 4X66F 2O67A 1JMTA 5A8RB 4GMKA 4DV1J 3Q8SB 1Y5NB 2DR9A 2GMJA 3DOLB 5CZXA 3T5LA 2A2DA 1S1UA 4A46A 2GCFA 4K4UA 4P52A 2GQQA 4FN5A 4HI1A 4B3TF 3H59A 1EP4A 4DV4F 3SBMA 3CC7S 3UCGA 2NYIA 1URRA 2I1RA 2BRLA 3G82B 3BS9A 2XY5A 4Y6IA 5KG3A 2VU5A 3HMJG 1P9QC 3D0GE 4KFBA 1TKTB 1NZAA 3KYLA 2UUCJ 5C24A 3KK2B 1QSSA 3EGWB 7FD1A 3UNGC 1S1WB 1HQUB 3MMJA 1KQSR 3M05A 3A13A 3AODA 4CLPA 1HL6A 3MEGB 3CE8A 4QWDA 2XCAA 3V4IB 3FEYB 2GC8A 2YNIB 5GAHU 2LQ5A 3V4MA 1R8PA 1TL1B 4DL7A 1BQMB 1NK8A 2P6TA 3GJSB 4M8LA 5F8NA 2IA6A 2HHHF 1O6XA 1LK5A 4CLUA 3TUIC 3G96A 2CQBA 1NK0A 1UVKA 1N5YB 4DEZA 1S1TB 1BXNA 2V4JA 2MKIA 4CLZA 5KG0A 3ITHA 1O5JA 3QGPA 2V8GA 1RWWB 4L76A 1HA1A 1M5HA 2UVWA 1BQNB 1MROB 2LEAA 2BABA 1JLQA 2D3O1 2JC0A 4IDKB 3E3XA 1RYSA 2ZE2B 1WHXA 1CLFA 3DGPA 2F1FA 2DKOB 5DGAA 3O44A 1S6UA 2XLJA 2VICA 2JDJA 3RR8A 2J7WA 4NLUA 3CCES 3GG0A 1J2VA 4DUYF 1WWHA 2EK1A 3ZTRA 3CCUS 4YHHJ 2HMIA 2JWNA 2MTLA 3MD3A 4RJVA 3OL6A 2W4CA 4LT6A 5JXSA 4RX6A 3BZQA 4Q7AA 5F8LA 3KG4A 2PEBA 3JS9A 1NM2A 3QFHA 2FLLA 3M8RA 3OVBA 4NOHA 2YQ1A 3BN7A 3I0SB 1JLCB 2FVRA 2FVPA 4Y2AA 4IRDA 2MY7A 1NJYA 2Y9HA 4YY3J 2WVCA 1W2IA 1GAOA 3WIVA 4LBIA 2RT3A 1R8HA 2XLKA 2ZM6J 2G2ZA 4FF4A 4UOGA 2VPWB 4Y34A 1S99A 4H4OA 2HIQA 3I5CA 4TY9A 3LF0A 5D4NA 3LQVA 5T7LA 1U1QA 3AD8C 2MEWA 1SIWB 2U1AA 5DLGA 2DIVA 2EKNA 5KT3A 3IN5A 4CTAA 2KYXA 5KFIA 4Q0BB 1CJVA 1A9NB 2HFVA 3DLGA 1S57A 2A0FB 2CVIA 3HO1A 1JQGA 2K3KA 4TU9A 2LEBA 2FVQA 4ETXA 1PYSB 1VCTA 5C2GA 1VQPS 2DPJA 2H4YB 3EGVA 5EGYA 3K5OA 2V4RA 3ZZRA 3BDEA 3DC2A 3TQEA 3E01B 2B43A 1VQKS 4RW8B 1JWWA 4IOAQ 3TARA 4MIWA 1RTDA 4TVAB 4DV4J 1XEZA 1R43A 2PI4A 1NAQA 1FXDA 2BR0A 3PRDA 3TZYA 2GAHC 2DNQA 2GVDB 4KYZA 4X84A 3MR2A 4O23A 3GJTB 3JSRA 3C2PA 2MGZA 4LF1A 2W1BA 3BPDA 1N33F 2ERRA 4PXCA 4L3NA 5CD4A 3PM9A 4M5LA 2R7VA 2YWGA 4FYYB 4I69A 2BOAA 4A47A 2AYBA 4YMEA 1BE4A 5AXNA 3ETMA 2I2YA 5D3GB 1FDNA 4W4MA 4ALZA 3PVXA 4ZS6A 3PX0A 1HNXF 3GJRB 3W5YA 1SKWA 2EWHA 5BYSA 2EVZA 3O8WA 2OAUA 4OV1A 2I5JB 1VQ4S 3CJKA 3ZFVA 1CJUB 4USVA 2ZZMA 3O5TB 4NI2B 3HSDA 3BSAA 4WTOB 3RTVA 1OSCA 4USMA 3R1HA 2MQPA 4WK1A 4L75A 5HJYA 2BE7D 1VJQA 3G2XA 2Y1LB 1N56A 4CLTA 1PILA 1HKAA 4F67A 2E1AA 1X31C 2KKHA 4JI5F 2GX8A 1JLBA 4RNHA 1H2TZ 1T3NA 1G7CB 3NRBA 2J0QD 2RS2A 5AT1B 1JLEB 3I9ZA 3H7HB 3PW2A 4IG0B 3UQSA 2GA7A 1YI2S 3A8IA 1TL4A 4DSLA 4ZVOB 5ETLA 4J9QA 2GQCA 4B02A 2AIRB 1ZBTA 4DUYJ 3RRGA 4QOTA 2WZ1A 1FTRA 2YKNA 3VALA 3RJMB 3PCOB 4ECWA 3G4SS 2OELA 4EUVA 4PABA 1ITPA 4NLSA 2GAGC 4LR9A 2R8GA 3RZAA 4DSIA 4DR2J 2JLGA 5CYJA 2QA1A 1CJKB 4AE5A 2EG1A 3RG6A 2MZ1A 4PKDB 4HEA9 2BW2A 1NNDA 3M8SA 2KYZA 4ZPVR 3GP9A 3P6YC 1S9EA 4DOZA 2V94A 2DR8A 2ASLA 4N41A 4LMZA 5A6WA 1RBAA 2AX0A 2HBRB 3PRVA 3X3UA 1WC1A 1VI7A 4NXMJ 1WC4A 4MFBB 4FYXB 1GQEA 2E5IA 2XZTB 3A1YG 4O3SA 4JV0A 4ZK7M 5F3ZA 2D3ZA 4FXVA 3HP6A 2Y1RI 2DCUB 3ONQA 2MQ8A 3OBIA 2AKWB 4OHVA 4LQ9A 4OI1A 5KG4A 4K8RA 4CQ1A 3MAQA 1IXKA 2E7VA 1R7IA 3BGRB 1WELA 2VQFF 4OV6A 4DCOB 4ES2A 3NGSA 3QO9B 4F4WA 2FJXA 3T1HJ 4M5IA 1TU0B 1N0UA 5HROB 4X4RA 5J2MB 3TZZA 1I5OB 3HT0A 4DQRA 2WB4A 5F41A 1B4SA 1Y9OA 3SIPB 3R7BB 3GILA 4GO7X 2BJEA 2X3DA 2KHCA 4O44B 5F9NA 3PYDA 1RAFB 1YK9A 2M7SA 4WXOA 2C1EB 4ZHRA 5GAGU 3SV4A 2P8IA 1IKVA 4MT1A 2QLBB 3TA0A 4DHVA 1M90T 2MXYA 4C8YA 4L6V3 1U0HA 1G2EA 7AT1B 1IUJA 2OPRA 3D66A 2NXEA 3BQ0A 1FI4A 1DURA 1K0VA 1KFDA 4Q45A 4ZA1A 4I68A 1TAUA 4G1IA 1R8BA 3B6BA 2C2EA 4ANCA 1T9TA 2QEXS 1R3NA 2CPIA 2W2QP 5IWAF 5EX3A 4PZVA 1NRKA 4ZVPB 2HHSA 3QIPB 3TX0A 3CPWR 1NEEA 4Q43A 5IT0A 3FK4A 3BBCA 5F8HA 3BGLA 1HNXJ 2D69A 5A76A 5LMNJ 5CA5A 2GJIA 1YBUA 1FWLA 4OZNA 3PIOQ 3M2VB 4CH1A 2HFZA 5HVGA 1KN6A 4WIIA 5LSLA 3T6JA 1RWUA 1EIYB 3HHLB 3L7PA 3CJTA 3UDEA 2BV3A 2R2TA 1WKKA 2DEJA 2ZVSA 1FFWB 3R1LA 1ZTWA 3DLEB 3KJVB 1R0AA 4KB7A 3MR3A 4TYAA 4WFYA 1V3ZA 4XDDA 4DX5A 3EMTA 1WHVA 3RRKA 2HVZA 4UY8T 4F0KA 1SQEA 3V81A 2MJUA 2N7YA 5D0RA 4X4UA 2LCWA 2YQ0A 2HNZB 1FK9B 2D3OR 4PUOB 1IN0A 3FNNA 5E0OA 5BYQA 4AYBD 1RAJA 4IOBA 2A2CA 5LM7E 3CW2C 1TK0A 2IDEA 3LH2S 4AUKA 3SCJE 2LMIA 1KWMA 3QQCD 5HP1A 4DR5F 3CDAA 2MMYA 3TNVA 2QO3A 2UV8A 3M1VA 3I55S 4O3OA 2HHPA 2DYAA 3AOBA 1MN7A 1B0VA 2NXCA 1IM6A 2HZVA 4G65A 2G0CA 2FLPA 4ILLA 4DQQA 2JRSA 1WOSA 5EWEA 1U1PA 2DNYA 4NXNF 4ED4A 1WTFA 2GQ2A 2ZJPQ 4HT5A 3QATA 1M5PC 2JOQA 4WP3A 3GYGA 3J7ZT 4FXWA 3Q2TC 2P2CB 4DSJA 4NRTA 4O3RA 4YOEA 2ZBCA 3DRYA 5L1LA 4ZPBA 1NJXA 1QE1B 2B5JB 5E3AA 3FDSA 3BKTA 1I51B 2MB0B 2LQ8A 4OYXA 4PR6A 3KXDA 5GAEU 1R8AA 4O3NA 2NPFA 5HBMA 4DF4A 2OEJA 1V6HA 3A12A 1S79A 1SC1B 3BR8A 1ZPWX 1JJHA 4X4NA 4WIQA 4KRWA 4LRCA 3PW7A 4C3LA 4K4WA 2MQOA 1OYEA 2KN4A 4LF7F 5CH7B 4ICLA 5D15A 4Q8FA 1S9GA 2QRRA 2V9WA 2W4PA 2BQ3A 4G3IA 2ZHOA 2ATLA 3S01A 3T3FA 5ETKA 3H90A 2PDAA 3BO4A 4C6AA 3WDOA 2OPQA 2J0XA 2F8HA 4QYZK 3K5LA 3CDBA 1PYTA 2UXCJ 1H3DA 3B78A 3GTYX 4Z37A 1FRHA 4GC6A 2VC0A 4DX8H 3O1LA 2IVMA 5IM0A 2CUYA 1Y11A 2GVZB 2ACMA 4NLWA 5C5JA 4WE1B 5L9XA 4M5JA 5A8KA 2MY8A 1GH8A 3HHNB 4F50A 3S6EA 3AH6A 4FNHA 2XZDB 1Q7YT 1WOPA 2FJBB 3V6DA 1NPKA 4WP8A 4EYHB 1RT4B 3KHHA 2C2MB 2EFOA 1RKIA 2QSFA 1S6QB 3N9UC 3M9MB 2AZ1A 5KFDA 1OPZA 3P3DA 4NWBA 5JUMA 2I9SA 3CJQA 1M1GA 3OD2A 1TL7A 4K0KF 5DLFA 2DO4A 4ZJLA 3R5DA 3MPDA 4QCLA 5HQLA 2P9GA 2W24A 3M7VA 4TLRA 4HH0A 2XZWA 4CLFA 2B8PA 3KFWX 1U49A 1SIZA 2M52A 2AD9A 1KP6A 3D3CJ 4RUBA 2DR5A 5KFRA 1IBLJ 2DPIA 3ZTQA 4X4SA 1UZDA 3H4DA 1ZPVA 4EBDA 2B9XA 3MM6A 1X4GA 3EYZA 3ZNJ1 3FUYA 1JXEA 3HJVA 1RAAB 2XBPA 1P1TA 5HMXA 3AOAA 4Y2CA 2MQQA 4X65J 2W2MP 1AUSL 3B4MA 3H5YA 4PPDA 1P27B 2HQIA 3OHBA 3H42A 2DEIA 1Q81T 4J91A 3E2EA 4IO1A 5KFNA 3Q8VA 4YB7A 4RR5A 4AQYF 3D6TB 1Y4ZB 3CCVS 2E44A 2B7BB 4CH0S 1D3WA 3KJNB 2VBXA 4HACB 4KQZA 1D9DA 3G9CA 3W2VB 3FBBA 2AGOA 3K8WA 2XY6A 4K59A 2IYIA 2BQUA 1LOUA 1NH8A 2FUG9 5L46A 4NEZA 1QJHA 4ECUA 3TEHB 3WIUA 1YTYA 4OJ1A 2OJ3A 3VVTA 4DR7F 2HK2A 1I94F 4XPEA 1FKOB 5B7WA 2ROEA 2DHSA 5I42A 1EHWA 5CYQB 1S6PB 3SDEA 4NLPA 3KLGA 1RWKB 2C3UA 4EO8A 2J7KA 4C11A 2BANA 3NNHA 2UVUA 3SCIE 3JAMU 5E33A 4C8ZA 2CQ1A 3Q23A 4P2FA 2HHTA 4DS5A 3T5JA 2DGVA 4ZPTR 2BYCA 2QJ3A 4X4PA 1PG5B 2HEKA 5I3UA 1F5CA 2EC2A 3AJ2A 3SXLA 2FHMA 3CSKA 1FNOA 4ENOA 3A3OB 1ULRA 2B4OA 4TQRA 3EXCX 3D28A 1TUWA 2P5VA 4CM2A 4WK3A 1UWBA 2QFJA 3I87A 1SC3B 2MKJA 2O5DA 2YNHA 4OYMA 1RK8A 2FIUA 4TY8A 3DNCA 2YH1A 4NLYA 4UF4A 4RWXA 2CPHA 1R31A 4JI2F 1A0OB 3JQMA 3W9IA 3PYEA 3BKUA 4KKOA 3DLKB 5HLFA 2CPJA 4DL5A 1QAJA 2H54B 2GW8A 3CCRS 2Q66A 2H5JB 3UDLA 1H72C 4DI6A 2QGFB 2HGNA 4EMDA 1K1QA 2ZH9A 4RO0A 1JKHB 2XCPA 4JI8F 1IM4A 4LSLA 1IBKF 5A0YA 1KTVA 2IIHA 1RGVA 1C4CA 1EETA 3M30B 4CLYA 2N4CA 1NJIT 3G6ES 1RAIB 1UZHA 4CM0A 4U7UD 2BACA 5A8RA 4XAKA 2OUGA 1T11A 2ZITA 4DXLA 4J9MA 1RE1B 3G8SA 3W8GA 2CPYA 3C14A 4A48A 4Y2KA 3RAMA 1FDBA 4EO6A 3M6XA 3TVYA 3D6MB 4YQWA 3LA0A 1AB8A 3LP0B 5L38A 1T94A 4BC9A 3MEEB 4F02A 3F56A 4OLOA 2ZC4A 3MMCB 1KSPA 2B4PA 3B8HA 4LSNA 1GX6A 4WU2A 1HQUA 1TKZA 2P9EA 3NGRA 3C46A 2W8KA 3MEGA 3CC4S 1IR0A 1WI8A 1UAWA 4P7TA 4FPIA 3P96A 3MMBA 2R8IA 2G1HA 2L9DA 2NQPA 4ID5B 2L48A 2V0NA 1FRIA 2HG4A 5IFMA 4CNYA 2DH9A 3D7SB 3FKBA 3HT3A 1UL3A 1J5OB 3DU5A 3UE2A 3QPIA 2DY1A 2J9CA 2VQEF 4CO5A 2VG6B 4X62F 2OIHA 5ETTA 1REGX 5JMNA 3SEOA 2UUAF 4JV2A 2PFDA 1HR0F 3OXLA 2R42A 2L9WA 4I6AA 4TXSA 3UPFA 4OHXA 4YP3A 4ECQA 4I7FB 3EE3A 5AXLA 3MM5A 1PGZA 2DITA 4GKKF 4OZ0A 2DGWA 3JB9k 3GB0A 3AQPA 4K4VA 4F04B 1I94J 2IJFA 1U1KA 4ZCMA 3QJLA 4PG7A 3POTA 2E9RX 2HAIA 3L4BC 3VGSA 3QRPA 2HFSA 1WACA 4RNOA 4DR6F 1HI0P 2RSQA 1F6TA 3FBEA 5F8IA 4WKYA 2R7WA 2GGPB 2MQLA 2QLJB 2GHVC 2J0SD 3J7YI 1B64A 2LQ9A 2ZH6A 3TW0A 2HW3A 5CYMB 4K2XA 3H4BA 3HKZD 3X1LB 1VQ6S 4C4WA 3Q0AA 4IFVA 4CO3A 2R7XA 1IKXB 3IAM9 2ZDOA 4CO2A 1RU2A 3MOZA 3MURP 2ZH5A 2KG1A 2B9EA 5HAOA 2C2RA 1ICEB 1FEEA 4DX7A 4C8LA 3I0SA 1JLCA 3J81U 4DFJA 4RW7A 2EPIA 1T8EA 2IC3B 5DJBA 1RT7B 2DNMA 4NCGA 3HDSA 2IA0A 1TKXA 3NGTA 4JI2J 2Y1IA 2ZD1B 3PW5A 4CNZA 4R5PB 1V9OA 4UW2A 4NE9C 2F8MA 1TUVA 1W26A 4LBHA 3BPSP 3MXHP 1UVLA 1Q16B 2VFUA 4LIRA 3IA0A 4LF6F 2H48B 3UW1A 4JI8J 2RF2A 3V2UC 4CYUB 5AJ3J 2KTQA 2E1PA 5J2QB 3W3SA 3AXMA 4ID8A 4DV6F 2QMWA 3OTCA 4ES3A 2O66A 2OP5A 1KRPA 1CBKA 4F4XA 2ZH2A 4NMLA 5LMUJ 3TEGA 2VFSA 1SKUB 4WFAQ 3M2RB 3HSZA 1KOHA 3QAEA 2VG5A 2PO4A 3BSNA 3DI6B 4P75A 3PACA 4JP8A 2J8SA 2VH7A 4RW8A 2BA9A 3JTPA 3OHAA 5F8JA 4JI0J 2MKSA 2BBEA 5DZ6A 4IO9Q 3OTOF 3OFEA 1Q0NA 2XMTA 5E3QA 1U02A 2DXEA 1X9MA 5KG6A 3GIMA 1EARA 2GIRA 4B17A 3DU6A 2WBRA 1T03B 3HXMA 2COLA 1GX5A 2GVDA 2OH2A 3J81j 3TANA 4ZJQA 1JLFB 3QJJA 4IFYB 5IV3A 5ADZA 4DBQA 1O51A 4J9OA 1ZTTA 1XK8A 5RUBA 4CZCA 1FVQA 1RTHA 4N47A 2FZGB 4OI0A 4GO5X 2B9WA 3HVRA 1L3KA 3NBPB 1HIYA 4LREA 2QT7A 1LQ9A 3THVA 2E5LF 4MKAA 2BXJA 4K4XA 3R7NB 4YR3A 1GMUA 1OQ3A 4NCAA 4DSFA 2GJFA 5KFZA 2EBEA 2VJUA 2NYHA 2Y0SD 2UUAJ 4MK9A 1IWGA 1IR2A 3Q8RB 2UZAA 1HFEL 2V67A 1S1VB 1DQAA 1WC6A 3NCRA 4NA3A 2JEGA 2IJRA 3AY0A 4KY3A 2EW9A 3HI9A 3HZGA 3AD9C 5E3RA 3M8YA 4DCPB 4LRDA 1SJQA 2KB2A 1S72S 3THTA 1JXLA 4DFMA 3MM8A 3IR7B 1YG0A 4D3GA 1C1CA 4IG0A 4WPAA 5KT6A 1HBMB 4QQBA 4IH6A 5L39A 4I2PB 3ZTSA 2ASDA 2VPXB 3VQTA 2XQCA 5M2PA 4F36A 3GFHA 3PJ9A 2CZ9A 3I9V9 3R5JB 1U8WA 4IYQA 4OQJA 3FFIB 2XSJB 3TA1A 1REVB 4OYZA 4B9NA 1CJKA 2LVWA 2CQ4A 4HHHA 1N6QB 3ILLA 3KHRA 3I31A 3WBZA 3W64A 3TYTA 3DRRA 3KJQB 3TZWA 2E7XA 2MLXA 4ECVA 2DNRA 4ZVQB 1FRJA 2F7VA 5IT9U 3IRXA 2HGLA 2FJWA 3KLIB 2ZBRA 5T41A 4KAIA 3UR3C 4CIOA 3MFIA 2CPZA 1H98A 3M8ZA 4C3KA 2FC9A 4FDFA 3H2LA 2C22A 1LW0B 3TAMB 1MMLA 1QUPA 1WG5A 1TVRB 4KH0B 5HMWA 3L09A 5F8GA 2BUNA 2UUTA 1LEOA 3KK1A 2GO8A 2MQNA 3FEZA 3SZ2A 1T9XA 4DV6J 3CD6S 4KV8B 2LEPA 2C3PA 3TJ8A 3THPA 3PHTA 2CPEA 3N28A 1TAQA 3MUVP 4RUCA 3VZIA 2L08A 1HLWA 5HANA 4PEOA 2FVSA 3TAPA 1TL3B 2F8EX 2IRUA 3IM9A 1H6KX 1N0VC 2WTFA 1VDHA 3MOJB 1LXNA 3LALA 4MH8A 2AT1B 2C2ZB 1FEHA 1KQFB 5THWA 3W7BA 4UQTA 1L3TA 3PFEA 1FKPB 3IBWA 4OL8A 2RB7A 3JXOA 1UEKA 4ES1A 3A4TA 1AXQA 3UCUP 4U6PA 2YNFA 4F4KA 4DV3F 1WDTA 1AT1B 2WB1D 4K2JA 3BO3A 3LP1A 3OV7A 3JYTB 4NLQA 3QFWA 3O2IA 5F0UA 3HSGA 5ITHA 4KHPF 2OEKA 3VAIA 1VQ7S 4LF9J 2UXBF 2WK4A 4ZMMA 2FZCB 2ZOFA 3PTWA 5HN0A 1DTQA 1V3SA 1XBWA 1K9MT 5JJBA 4WKRA 3M2VA 3DLJA 2EFGA 2UUBF 3JSMA 3MGJA 2VPYB 4N56A 1QVGR 2RKIB 1AFJA 3D68A 3HHLA 3DM2A 2YTCA 2EFQA 4XO0A 3AJ1A 4FPRA 1HARA 1TFYA 3DRSB 5M2UA 1U6FA 4RW6B 2KJVA 3C66A 3UDCA 3T6BA 2XHWA 4OZLA 3QIDA 2Q43A 1TL5A 3PV8A 3S8SA 4YB5A 4DDFA 3IWNC 4PXBA 4C0OC 4C3MA 1WHWA 5FLXY 2CWKA 2RDDA 4OYPA 2Z57B 3CC2S 5J2PA 3C6UA 3SCLE 4IG3A 5K5MA 4M1KA 2OSQA 2DIUA 3OL8A 3EVOA 2PC6A 2BE9B 3LO3A 2CKWA 2LXIA 1R8CA 1OMSA 5F3TA 4DN0A 4UUWA 2QLXA 3CCMS 1FTCA 1Y10A 4DFKA 4JI3J 3M8QB 2G0IA 4NLGA 2BKPA 1BD6A 3J80Y 3RW6A 3Q8YA 3W9HA 1Q8IA 1XNRF 3MWBA 3FSXA 4B3SF 2HS3A 4X64F 1AZSB 1WORA 2AW0A 2XEXA 5I3QA 4F25A 5KFVA 4G1QA 2V8VA 4PCQA 1LWCB 4I2QA 1VBZA 1U45A 1OYDA 1NHVA 3IG1B 1WSVA 3R5BA 1LWEB 4KH1B 5FDLB 4KT0C 1U6BA 2VA3A 4I67A 3M2UB 4HT7A 1S9FA 4QPXA 3EGZA 1QE1A 1J5EF 2GV1A 3MF5A 1NU4A 3QBCA 2ZHAA 5K8OA 3AAWB 5B0CA 1Q82T 3TUZC 4OYIA 3U27A 4U95A 1AW0A 2UU9J 3LP2B 1NJWA 1QAXA 1DQ9A 4LF4J 1SUQB 1XMOF 4J9LA 1BUXA 5IT4A 2NR0A 5HK4A 2R7SA 3OUYA 5ETNA 1RHUB 2VJVA 1YITS 5F8MA 2NLWA 4HL9A 1IBMF 3D2WA 2NXNA 2Q1LA 2B8QA 2HQDA 2XYPB 3QZ8A 4IRCA 1P8GA 3I6PA 4M5DA 4WFXA 1DTTB 2MZJA 2H4WB 4HHUA 4E8UA 1TV6B 1SH0A 2X1AA 2FC8A 4I56A 2QN6B 2ROPA 2Z0GA 1PJ7A 2YKMB 4USWA 4ZKAA 4PG6A 2XNRA 2ASYA 3ZTPA 3MCMA 5K9FA 5DZ7A 4DV2F 2IJNA 2OGUA 1TR0A 5GMKa 2F4VF 2Q3PA 4ECTA 4P2SA 4FBTA 3PJXA 3KTQA 4AXIA 2RUSA 2FTRA 1HNIB 2A18A 4DV3J 1U1NA 4C8NA 3RB3A 4B9SA 2YY3A 1H0HB 5JVGQ 4HDHA 2E7WA 2KXNB 4RUAA 3MEDB 1V5IB 3QRRA 2D7SA 3IRWP 1ZZFA 3G6XA 4PQUB 3R6GB 1KVJA 1NK4A 1CC8A 6FDRA 2GHWA 4K4SA 4EBCA 3NKYA 2PN6A 1U2CA 1N5TA 2H5EA 1CVJA 2OEMA 2M2BA 1GK8A 1M5SA 4XK8C 2WOMB 3ISND 2Q6BA 1RJJA 1BC6A 4Q2MA 5DS7A 2QE5A 4DG1B 5J1PA 2V9KA 3R5AA 1MWYA 2CIMA 1SL2A 1A7GE 4ZITA 3ILOA 5LSRA 3C16A 3ELHA 4WFNQ 1RTIB 3PDNA 3DFEA 3M6WA 3OTEA 1E6YB 2VFVA 2DHHA 4O4RA 2ZOMA 1VS3A 5B0EA 2W9BA 2RRAA 2WVEA 1NK7A 3CTRA 5SZTA 2Y1JA 3IWXA 2KT2A 2RQKA 2XTJP 1EQ0A 2CXEA 3CULA 3M8PA 2JLEA 3PR4A 2B56A 3D0HE 2NXJA 2CNNB 1RLCL 4CLWA 3NMRA 1S1UB 2PMHA 2X1BA 2WW4A 2CQDA 2VASA 4TNOA 1PC5A 2LXUA 4HYKA 1MWQA 4DV5J 2FZKB 3EJMA 3VWSA 3RB4A 4KFBB 3DLLQ 5IV4A 4XDCA 5C24B 2OLWA 1GXTA 3C3LA 2JEJA 4NLOA 5E7OB 1R27B 3B4DA 1MMDA 2FLNA 3M9NB 4ZOSA 2G1DA 3TR5A 4DR3F 1U0SA 2MKYA 1D09B 2F4FA 5KOWA 4EWTA 1U25A 1F5BA 1VRUB 3OLBA 1FRXA 4LSZB 3BB5A 4AXJA 1O0PA 3FQLA 4JI4F 2VBYA 1J5EJ 2YBVA 2FYXA 2QG9B 1VHIA 5BYRA 3GIIA 2YQ3A 4FYWB 2V4JB 1XC9A 3VF0B 4BWMA 3G8QA 3ITHB 1AA1B 1C1BA 5HMZA 3OVSA 4DUZJ 1KLMA 3GWCA 4NCBA 1MNEA 2LDYA 2J76E 2XMVA 1RI7A 3HHDA 2Z58B 3R97A 1JLQB 2VHGA 3Q24A 2GZOA 1UVNA 2GJ2A 1B0TA 3AHPA 1RWVB 3HK2A 4GRSA 3BJYA 2A6MA 3DGPB 2EFNA 2JHEA 2UXDJ 1KR4A 4LFBF 4ED5A 1KFSA 4DL0C 3TJ9A 4IQXA 1GTHA 2RUGA 5EWGA 3DDNA 1HHSA 2AZ3A 3KJFB 4H4MB 2KL8A 2A1BA 5DGBA 1RT2A 1FVSA 1G3OA 2HMIB 3TP2A 2ZJQQ 1NDPA 2F4VJ 3JQKA 2B6AA 2NUUG 3U1LA 5CXTA 3KNGA 2M70A 1CEZA 4A8OA 1RYRA 1EAYC 4I6WA 4AD6A 4DMZA 3AA9A 1VQ8S 1JLAB 2N7CA 2YNGA 1N32J 1OY9A 3LUYA 2HWHA 1U8SA 4A8XA 4LJMA 3TUJC 1MLAA 3EVWA 1MWZA 1UA0A 4Z7CA 3BGOP 1VQYA 5HMYA 3N79A 3PNIA 1Q8LA 3UN3A 5I4MA 4K4ZA 3N5FA 3VGTA 1X5OA 5T7LB 4J9RA 4EFAC 2YX1A 5LXRA 2BMBA 3ET6B 3W2WA 4OHZA 4CTAB 1V3RA 1CJVB 1HNVB 3ZO7A 3VV2B 3V5RA 3HHLD 2MSTA 1ZZNA 1VFJA 3EPGA 3DLGB 2MKKA 4HDGA 2NS1B 3IBCB 5DG8A 3W1YC 4TU7A 1KQKA 1NBEB 5HL7Q 3NL0A 1NSKL 2AU0A 4JI6J 3K2YA 1FDAA 3ISNC 4B3OA 3EXYA 2DH8A 1YKWA 2W9AA 2JH3A 1L3VA 3W9JA 4ED3A 4LF2A 1Y5IB 2HURA 1S4EA 4DPUA 2DGUA 2UP1A 4F3QA 4B3RJ 1EKRA 1Q5VA 2MJNA 2QIFA 1KOOA 3TOQA 4RBTA 2RQCA 1PAEX 1KC8T 2B51A 3LW5C 3VAMA 1VYAA 2CA9A 3P5TL 4K50A 1FWKA 2FJEB 4H54A 1SL1A 2LECA 2PI5A 4DR1J 2F3JA 3DOKA 4YFUA 2KJWA 2MGZB 1VQLS 1VHFA 1KHWA 2DD8S 5KFMA 2XMMA 3TJAA 4UOCA 4GKJF 5GMEA 1S0NA 3FMBA 2FHJA 5GADI 2QMXA 1NK9A 3EX7B 3BBFA 1B70B 2CNLB 5ETSA 2OPPA 4TU8A 4FS2A 3EZOA 4M95A 1S0VA 4JI4J 3RB6A 4DLGA 3DMJA 2FVCA 1U26A 3TI0A 5KFPA 4O4GA 2ZH8A 3MDFA 1WEZA 4LFCF 1SV5A 1LFWA 2BE2B 2J9DE 1IJEB 4MYUA 2ROGA 4ZVEA 2D9OA 5B0AA 3HPOA 3P8BB 2CQPA 2UV8G 3Q86A 1X0FA 2VZ9A 3KK3A 1YZ7A 2DK2A 4RW9B 1JLBB 5KT4A 3KDOA 2ZBIA 5C42B 1KVKA 2F63A 3R9LA 1S12A 4RNMA 4P9SA 4KO0A 2VL1A 1U24A 3KLHA 1UPMB 3W61A 3FEXB 2YKNB 1RXOB 2M8DB 3I96A 4K7QA 2ZD1A 3R27A 2RDJA 4URSA 5KG5A 3T1YF 3IM8A 2HLUA 4ED7A 4NZ6A 1Z4UA 3LANA 4JV5J 2IHR1 4UTGA 1M5OC 3MMAA 1QSLA 1S9EB 1NB7A 2DRAA 2DNHA 2JX2A 5J2QA 4ECZA 2HYIB 4RPFA 1LXJA 2C3MA 2DVIA 3ADAC 1QAYA 3T5HA 4V19J 4CI0B 1DHMA 1ZYQA 1H7XA 3QZ7A 1YJ9S 3R7SB 3SQGA 1DJ0A 1XMQF 3MUTP 1T02A 5KFYA 3MHYA 3QT6A 2C2OB 1GMVA 2DGTA 2WVBA 1F9HA 3OQ2A 3UR0A 3OJUA 1WNEA 2EC0A 1T7PA 4IQMA 2F5GA 2KXFA 4K4YA 2WW8A 8AT1B 4X66J 3IGVA 1Q4RA 1UJ6A 1FO1A 1MU2B 4GVBB 1VLYA 4LF5F 5K8NA 3NOCA 2WSCC 2O3DA 1YIJS 2W9CA 2HHXA 1DQ8A 4B3TJ 2NCKL 1N36F 1VJWA 2YWWA 3PW0A 1X7VA 4OYWA 2DB1A 5K14A 3VHQA 3RRHA 4IR9A 3NAIA 1HQ2A 4CRJA 1XR6A 1VLOA 2YPZA 4QJVA 4USHA 3QWUA 4ZHRB 4N8OA 2MPUA 3N4WA 1IKVB 3IR5B 3T9NA 1U0HB 1KD1T 4JI1F 1RT1A 1CJTA 2OPRB 3CD7A 2DH7A 2E5JA 4Y28C 5AE3A 4HI2A 3FMWA 1VK3A 2R3VA 1U1OA 2HKEA 3HHLC 4OI4A 2HHHJ 3CMQA 1S5ZA 2HBQB 4WJBA 2KO1A 1FE0A 4X4VA 4PYAA 4ZVRB 2OSRA 1TMJA 5J1EA 3DXSX 3K57A 4X4TA 1SH2A 2QYGA 3GONA 1WEXA 1WOOA 3IS9A 5B0FA 4CDIA 2E1MC 1FJGF 4CT9A 1FE4A 3EDRB 3C15A 2WCXA 4C97A 2CQ3A 1KLNA 4ZVUB 5BR8F 4OZ5A 3VAKA 4IKAA 4HVZA 1LNQA 3G71S 1CULA 2DXFA 2VBWA 3R6LB 4DSEA 2R7TA 2MQMA 2QC3A 2ZHBA 4FKXA 1UCNA 3HVAA 2VPZB 3NXZA 3QNWB 1FHTA 1REVA 2D41A 1R0AB 1HQEB 1VBKA 2XNQA 3LOUA 1JLGA 1YSJA 2R7UA 2YXLA 5FJ4A 3KLEA 1Q53A 2R4FA 1HW9A 1W7WA 3GFXA 3GCXP 1VBXA 4UOHA 5ETOA 4RL1A 1I1GA 2LDIA 4FBUA 3MR6A 1U1LA 1Y7PA 4RBUA 4J9SA 3HFVA 2Z56B 4PXEA 2IRXA 1VISA 5M2RA 1YBAA 3PFOA 4DL2A 4CT8A 2HBYB 3BM7A 5K8PA 2HNYB 5HP1B 4TYBA 4AL6A 3M1VB 2HS4A 3OR2A 4J9NA 1LW0A 1EB0A 2J9DA 1HNZF 1TVRA 1HBOB 4C98A 1UA1A 4DZDA 5D4LA 3M9OB 3IMQJ 3K0JA 1HBUA 3UD3P 5KFGA 4V19X 3HULA 2XMKA 3MCNA 4UT4A 2PMWA 4Q8EA 3MM7B 2RRBA 4A8QA 1C0TA 3D54A 2L9NA 4ER8A 1TK5A 1HI8A 4NLRA 1GMWA 2QTWA 5A8WA 3CDWA 3NS5A 2RQMA 4YS2A 4OZ2A 4QIFA 3FSYA 2DCLA 2XI2A 1WF0A 3BQ2A 3W66A 2HAFA 2BM1A 4N77A 3ZZPA 3MCOA 4NA2A 1FKPA 1RT3A 2Q79A 2ZJRQ 5HBMB 4LF5J 2L41A 1C4AA 4RUHA 2XYHB 3R8YA 1UEVA 1HYSA 5SUHA 3H25A 2IDLA 1N36J 1DFDA 5EUHA 5IC4B 2DGOA 4R0EA 4TKTA 2XMWA 4RBVA 1KKHA 4ICLB 3KHGA 3KLVA 2MKHA 3BGFA 1S9GB 5GAHI 1LW2A 4DR4F 5E3PA 1EZZB 3UWTA 1PJ6A 5ETQA 3EM1A 4H4KA 3R2CJ 5LJ5Y 2BQRA 4JI1J 2CZ4A 2ZH3A 1QAIA 2OPQB 4QYRA 3AD7C 5D4OA 1N33J 4W98A 5KFQA 3LPYA 5CQGA 2DHGA 2AWZA 2DBBA 2WONA 3CJ0A 4FF2A 2J8AA 3BV8A 5IM0B 2QLWA 2ZKUA 4R8UA 3K5MA 3ZZ0A 5HQ8A 3PY8A 5CHCB 3VTIA 2MKCA 2APOA 3DRSA 1HHQA 2DNGA 4RW6A 3CJ5A 4IUFA 3V6DB 2CJXB 3CO0P 4F0MA 2O01C 5K20B 2JFKA 1RT6A 2F40A 3UNYA 5B0GA 1EX8A 3WC2A 2CJBA 2DGSA 1CC7A 1CS4A 4CLSA 2FHJD 1HWKA 4OJGA 1TL7B 1UPPA 4DV1F 4JI5J 3T1AA 2VOOA 2BEFA 1ZAVA 4O0NA 2IAJA 3T41A 1F2GA 4U7UK 1T9UA 2HNDA 4Q2LA 1XN9A 1K47A 2FGCA 3OTDA 1OO0B 1H74A 2GMHA 2XS2A 1AFIA 2VC1A 3VZHA 4ED1A 3EUNA 4HH1A 5KFJA 4U7CA 1KVIA 4DV0F 1OPIA 1IKYA 1ZM9A 2DRBA 2UUCF 1AZSA 3MM6B 3U7JA 4KHRA 3I4HX 3EVMA 1WC5A 1FXRA 1NLKL 1P9YA 4JV1A 2FHOB 1Q86T 3CJ2A 2A10A 1LWCA 4LIWA 3UCZP 3IXQA 3HVWA 1HBNA 3TAQA 4PWDA 1FFGB 5A2QY 3O3LA 2I8EA 2OMOA 3A8JA 5FDLA 3QT5A 4OI6A 2D1CA 3A3NB 3AB2B 1HMVB 2CJAA 3MPWA 4M63A 2J6UA 2DR6A 1BLUA 2Y8WA 1KHVA 4DQSA 2IPOB 4ECSA 3LGMA 1DZ5A 3QSIA 3VAJA 3S7RA 5G0RA 2V5HG 2OTLS 3CJSA 3C6TA 3HX9A 3ZZTA 2HHWA 5DM7Q 1N5SA 1WKJA 2VQFJ 3WZ0A 2Q6CA 4F4ZA 4ED2A 4LRBA 4Y2MA 3UFCX 3CO9A 4ZIVA 5GVQA 3AOCA 1FF2A 3DYAA 2LQJA 5I42B 4L72B 2C3OA 2RU9A 3SDEB 4D3HA 3KLGB 1YBTA 2C42A 1SJ4P 1IVZA 4C11B 3VAHA 1TZ0A 2BANB 3SYZA 1U48A 3MD1A 1F2HA 4NX9A 4YHHF 3TA2A 4RWWA 3NNAA 2DTJA 3PX4A 2PIIA 4ECRA 3D5MA 4S0MA 1HWLA 2RS8A 5KFWA 3CEDA 3MEDA 4AL5A 3Q8UA 3MEKA 2N3LA 3GYNA 2MDAA 3L7OA 1BMQB 1CSJA 3CCZA 2K8GA 3HVTA 4OX6A 3S1TA 1FD2A 1C0UA 4DR4J 4YY3F 1D9FA 3MTJA 2WBMA 1HWIA 1FJCA 2W4DA 5IWAJ 3ICLA 4B9VA 3MECA 2YNHB 3FBCA 2DHXA 2LFVA 2CPDA 4TY8B 2V69A 2WOMA 5K8MA 1UW9A 2ZH7A 4PWWA 3PO5A 3MUMP 1Y3JA 3BO2A 2AYMA 4KKOB 3P5BP 1ZAWA 1F60B 1SI9A 3AA8A 3PYGA 1NMEB 1WG1A 1X0PA 1RTIA 3TVKA 4LSLB 5KFBA 3L95X 3QLHA 5A0YB 3J7A1 5KTQA 1LWFB 4A8KA 3FC9A 2VDHA 1EETB 1S1XB 4Q44A 1VQNS 4Q5VA 3FGVA 4R25A 3W5XA 1WKLA 1NSQA 1M0SA 1WF2A 3T5KA 2YX4A 4A8SA 3D6FB 3ENQA 3I32A 2XLIA 4B9MA 1C2PA 3C14B 4OZ1A 4MKYA 2B4UA 4NASA 3ZXWA 1HHTP 1T95A 3MPVA 4DCJB 3SSSA 2FD2A 3H98A 1OY8A 5B08A 1U2FA 2P6SA 3WQPA 2JZ5A 1ZM2A 3ILIA 2ASJA 1JX4A 2KVQE 2HWIA 1KS2A 2ADCA 4DV0J 2XB2D 2H51B 4ANDA 5DRKA 2KM8C 4WZMA 1MSWD 4DR5J 3MAAA 4OHWA 4LSNB 1R89A 1TKZB 1DLOA 3LTOA 4ZDNA 2G4BA 3U1MA 3I0RB 5EX0A 4USKA 4PAAA 5DQIA 3OW2R 3EZUA 4LQ3A 3MMBB 2ZBPA 1VRUA 3Q22A 4HHJA 1X4AA 4NXNJ 1YJRA 1NDKA 3AQOA 5L1IA 1UW4A 1RISA 4O3QA 5CD4H 4NA1A 5D0EA 1S7HA 4MIAA 3UVJA 5IXUA 2ALYB 3PR5B 2KZMA 3NGDA 4NLTA 3OFFA 1K8AT 4F2SA 1U1RA 2RE1A 4C0HA 3KMSA 3D9BA 3CB4A 1RHQB 3MM5B 3Q83A 3RR7A 2OPSA 2VG7A 4Y00A 3E8OA 2M9KA 4ECYA 3IGNA 3PZPA 4CP5A 4N7TA 5GAGI 3POTB 2AJQA 1X4DA 3B82A 1E6VB 3IFEA 2V50A 3ENAA 4CWBA 4WBFA 1NK5A 2CZVC 2CAJA 2ZC3A 2IYGA 4KPYA 4G1PA 4H4MA 4LF7J 4TLQA 1GMWD 1SCJB 5L9NA 4B9UA 4ZPDA 4U8VA 3VGVA 4DR2F 2J6SA 2NREA 1A6LA 4IFVB 4LVNP 1Q78A 3P4UB 4P73A 5ETVA 5E2QA 1VC0A 1QLNA 3QSYB 3OLAA 2CG4A 4FS1A 1JLAA 1RAGB 4A4JA 4RW7B 3NGUA 4NXMF 1RAEB 5DETA 3HFKA 1RWPB 1UEUA 4RNNA 3BREA 1FA0A 4NCGB 1S97A 2JVOA 1TKXB 1U2RA 2MLYA 4LRAA 2QL7B 3O6QA 1QY7A 1IQTA 1B7FA 1SL0A 3ET6A 1XR5A 4P2MA 2AYGA 1OY6A 2B3TB 2YKPA 3IAS9 3FRZA 4USUA 4K0KJ 5HSPA 3T1HF 1B3TA 1HNVA 1SPBP 3DOLA 5D4PA 2RF2B 3H5SA 1JNZB 2B0GA 1HWJA 2CJYB 1HPZB 3FCVA 3AFGA 1XERA 3PIPQ 3MI7X 3QWPA 2WSFC 2AJ4A 2DRDA 1U6ZA 2J9EA 2XHCA 1X9SA 2ZVIA 2YX7A 1R6VA 1K73T 1XMBA 5KT2A 2LA4A 3LWLA 1RBOB 1UP1A 2IFXA 3G82A 1F5AA 3PW4A 4I6YA 4ZIWA 2XWYA 4JUZA 3GR1A 2RILA 3SFGA 3T19A 1L5UA 1WI6A 1TKTA 2OD4A 2VG5B 3NNCA 1YDLA 3SMZA 3KK2A 2BM0A 1S1WA 5L8RC 3GFZA 3HD2A 3U02A 2FDNA 4L73A 1WUUA 3MPUB 1VGYA 4QWCA 4NZ0A 3V4IA 1S49A 1QM9A 1ACMB 4PWUA 2YNIA 5F9LA 5H9FK 2BJDA 1TL1A 2VB6A 4BDPA 2JLFA 1BQMA 2H65B 5B0DA 4QBUA 2CNOB 5FLXU 4FYVB 4RW4B 4AQYJ 1N5YA 3C8YA 1WC3A 5L1KA 1S1TA 4OHYA 2LKZA 4P74A 4QR1A 5ETPA 1K44A 1RTHB 2CDQA 2CDRB 3JSBA 3UN5A 5C7PA 1B0PA 1O8BA 2HHVA 2KHDA 1GNKA 3BF4A 1M5VC 1BQNA 1SC6A 3J80U 2NXUA 4KR0B 1VC5A 5LMNF 4Y3CA 1MROA 4QIVA 2AGQA 1X8DA 5KFFA 2DO0A 3FZ2A 4IDKA 1PJ5A 2ZE2A 4DR7J 5GAEI 1ZOTA 1OJ4A 3GU0A 2BE2A 2X1FA 3F0NA 3OTBA 2WVFA 2HFNA 3K5PA 3K89A 4ATNA 1ZS6A 1X4FA 2R7QA 1HD0A 3BQ1A 3NLCA 2Z8QA 4DS4A 1ZM4A 2XS5A 3EWGA 4RKUC 4DPYA 1N54B 2HRTA 4C7QA 2V4QA 4RW9A 3I5BA 2YKOA 1YJWS 2V2VA 1TK8A 5C42A 3PEJA 1JB0C 4B9LA 5DG9A 3MM8B 4BLGA 1UVJA 3CGIA 2VKRA 1C1CB 4C8KA 4PRFA 1RAOA 2EI5A 2AYEA 4A8WA 2FY8A 2G0JA 1OS5A 1Z1ZA 1RT5B 2EBGA 1LK7A 4WP9A 4ELUA 2GFFA 1T0TV 2C28A 2LYVA 4BCAA 5KFEA 2KT3A 1U47A 1UJ5A 4W90B 5HVHA 2XYGB 2ADBA 1M1HA 4DJBA 3DLBA 3NP5A 2AJ2A 3DGVA 4ZPAA 2YWFA 2CADA 3OVAA 4UY85 1VQMS 4ZVFA 2AP6A 4LBPA 3RBZA 4J5OA 4PG4A 3DRRB 3GG1A 3TO8A 5KFKA 3N0VA 1FESA 1NPRA 2W2OP 2KFYA 3F41A 1JJ4A 3IRXB 3H8YA 4Y2IA 4Q0BA 1ELOA 5ETMA 1M1KT 3RAXA 1YRUA 1IBKJ 4WF9Q 1N52B 3LAKA 2ABYA 1PBAA 5DQGA 1HI1A 2ILZA 2B4VA 2QFIA 2IY5B 3N5BA 3N6MA 4WU3A 2P9CA 2BJ1A 3CCTA 3GSIA 4QIWD 3VGUA 5J2NB 3PHEA 1MU2A 4GVBA 3ZZOA 3KK1B 3E01A 4KBIA 4HTJA 2NSCA 1SVDA 2ATCB 1Q1KA 3H2UB 4P7VA 2NZ4A 4C48A 2AX1A 2J5AA 2M0GB 3J7Z5 2Z2ZA 3R5GA 5KG1A 1YQHA 2DNKA 2QZ8A 2YPYA 5B0BA 2ZWOA 3DHXA 1YRTA 5D8HB 4FF1A 4U67Q 4YB1P 2R8KA 4H4KC 3FSIA 2AEFA 7FDRA 1NDLA 1D8ZA 3ETOA 3EDQB 3BBBA 5G4DA 2E5GA 2UXCF 2MZRA 5U47A 4F7VA 2Y3YA 2WRMA 5DG7A 1VRTB 2LP4A
chains in the Genus database with same CATH topology
2FHJA 3FQKA 3CCJS 4EO8A 2J7KA 5GADI 3CWJA 1VQOS 2QMXA 1NK9A 2YNFB 3EX7B 5D3GA 3JYTA 4C11A 2QA4G 3CXCR 4F8RA 2BANA 3CD0A 3LP1B 3NNHA 2OPPA 2UVUA 4TU8A 4FS2A 3SCIE 3GZ7A 3IR6B 4OI2A 3KLFB 4M95A 1S0VA 5E33A 4C8ZA 2Z4PA 2CQ1A 2I5JA 4MK7A 3Q23A 3DLHA 3RB6A 4DLGA 3DMJA 2FVCA 4NLXA 4DL3A 1NJZA 2BOPA 3ISZA 1U26A 2HHTA 3PEHA 2FHKA 4DS5A 3Q8PB 3T5JA 2DGVA 3TI0A 2HGMA 2LLZA 4HLBA 4TQSA 3RB0A 4ZPTR 1SJ1A 3DN9A 5KFPA 3G6VA 2BYCA 4X4PA 4O4GA 2ZH8A 3MDFA 2KU7A 1WEZA 4LFCF 1SV5A 3DXBA 1LFWA 2BE2B 5I3UA 4AFFA 1F5CA 2J9DE 1IJEB 1RDRA 4WFZA 1DTQB 3GIKA 4MYUA 3AJ2A 4I64A 2D9PA 2ROGA 2FHMA 2M88A 3CSKA 1S48A 2FB0A 4ZVEA 3SXLA 1FNOA 5LSOA 4F26A 2OFHX 4P6QA 1ULRA 2B4OA 4TQRA 1UFLA 2D9OA 3GSDA 1DBDA 4NRUA 2RKIA 3JSMB 3EXCX 4QIEA 3D28A 3OXFA 5DM6Q 2P5VA 5B0AA 3HPOA 2R2RA 2DNNA 1ZH5A 2CQPA 3HVTB 2UV8G 1N32F 1FKAF 1C0UB 1X0FA 4WK3A 5MAOA 5KFHA 1JK9B 1UWBA 2VZ9A 3KK3A 2QFJA 2KXHA 3CULA 2ZDPA 3I87A 3M4XA 3BSCA 3DM2B 4M94A 2MKJA 4F3MA 2DK2A 2PGCA 5A8KB 2WAQD 4RW9B 2O5DA 2KZZA 1JLBB 2YNHA 3ZC4A 2CPFA 3CMAS 1RK8A 5KT4A 1YJTA 2ZBIA 2FIUA 4TY8A 5C42B 1WF1A 1JLEA 3MECB 2ACYA 3DNCA 2YH1A 4NLYA 3CIMA 3SI8A 4RWXA 2CPHA 3BR9A 1R31A 4JI2F 1LV5A 2LXFA 2YVSA 4I0WA 4JI7F 1HQEA 4DQPA 4WZQA 4KKOA 4RZRA 2LQBA 3DLKB 4RNMA 3NWGA 2X1GA 3U1NA 2CPJA 4J9KA 5HLFA 1SKRA 5AXMA 4KO0A 4DL5A 2VL1A 1IBLF 1F0XA 1U24A 3KLHA 2RJZA 1U1MA 1QAJA 4ZVHA 2GW8A 1D1UA 3CCRS 5AE1A 2Q66A 3UDLA 1XWLA 4LF8F 2XGPA 3FEXB 2HGNA 1NHUA 2YKNB 1K1QA 2SXLA 4BC7A 4Z2XA 2ZH9A 5EWFA 2M8DB 3I96A 1Y3KA 2N3OA 4LFAF 1VIOA 1JKHB 3CCWA 4J9PA 2XCPA 2ZD1A 3M32A 3R27A 1S0OA 4JI8F 2RDJA 2MHEA 4URSA 5KFOA 5IQ6A 1Q79A 1IM4A 4LSLA 1TKDA 1KEKA 1IBKF 2HZCA 5A0YA 5CCLA 1WD6A 5J2PB 3C6UB 5KG5A 4IG3B 2MYFA 1KTVA 3T1YF 2RH3A 2QA4S 1RGVA 3QLHB 1C4CA 4UUXA 1EETA 2AV5A 3FVYA 3M30B 2Z2LA 4K5SA 4X65F 1IKWB 2HLUA 1UETA 4ED7A 2N4CA 4NZ6A 2PE8A 1Z4UA 2WHOA 4ED0A 2F9DA 3NCPA 3LANA 2DJWA 4MTPA 1NJIT 1MMNA 3G6ES 2V8HA 2IMOA 1CQNA 1RQ0A 2IHR1 1M5OC 3MMAA 4FZVA 1QSLA 1S9EB 1FJEB 3CJ4A 1NB7A 3M8QA 4UQGA 1UVIA 2NSBA 2BACA 5A8RA 4XAKA 1Q7LB 2DHAA 2DRAA 5CZVA 2ZITA 2DNHA 2HNYA 1D9AA 1FCAA 4MFBA 2JX2A 4JI6F 4J9MA 5J2QA 2IM3A 4ECZA 2HYIB 1LXJA 2E9TA 2C3MA 4ELVA 2DVIA 1QAYA 3T5HA 3G8SA 4HTIA 2CPYA 4CI0B 4V19J 1DHMA 4A48A 1ZYQA 4IRKA 1H7XA 2GIQA 4Y2KA 3RAMA 1FDBA 3QZ7A 4EO6A 3M6XA 3V6HA 1HBOA 1YJ9S 3TVYA 3SQGA 3CT9A 1DJ0A 5IQQA 3MUTP 1XMQF 1OQ6A 4WXWA 4FF3A 5LL6d 1RA6A 4QU6A 1T02A 5KFYA 3KNAA 3MHYA 4YQWA 2QA2A 2K1RB 4C8MA 4B3RF 4G1QB 3LP0B 2DGTA 5L38A 1H38A 2XMUA 2RIJA 2ZUGA 3OQ2A 1MW7A 2PD1A 1T94A 3UR0A 4E0DA 3IG1A 4BC9A 3MEEB 3I56S 4F02A 4I2QB 3OJUA 1LWEA 3EZ5A 1WNEA 2EC0A 1QUVA 3F56A 3D0IE 3BGRA 1T7PA 4IQMA 3KG0A 4OLOA 2UVRA 2ZC4A 3MMCB 3UD4P 2KXFA 3QO9A 4K4YA 1KSPA 4N5SA 3M2UA 2WW8A 2FPHX 4DR1F 3MM7A 2B4PA 2HFOA 1X5PA 3B8HA 3IGVA 4LSNA 4QU7A 1GX6A 4WU2A 1HQUA 1TKZA 2MZSA 5HROA 2P9EA 2VD3A 1GT8A 1Q4RA 1UJ6A 5J2MA 4DN9A 3C46A 1FO1A 1FRLA 1MU2B 2W8KA 4ETZA 1FJ7A 1VLYA 4LF5F 5K8NA 3MEGA 1DLOB 5E5NA 2AJFE 3CC4S 2I0XA 1IR0A 1LFPA 2OO4A 2WSCC 3I82A 1WI8A 1UAWA 2AJ0A 2VKZG 4P7TA 3NG8A 4XPCA 2O3DA 5F0WA 1YIJS 2W9CA 2HHXA 1DQ8A 4YDDB 3LAMA 3P96A 3MMBA 3HJFA 3CCQS 1DARA 4OX9F 1QSYA 2VUGA 2R8IA 1N36F 1VJWA 2L9DA 4KC5A 4YR2A 4EYIB 3PW0A 1M5KC 1X7VA 1FERA 2KDOA 4JYAF 3LP2A 2NQPA 4ID5B 1SUQA 4DL6A 2DB1A 2BRKA 2CQCA 5K14A 2L48A 2C3YA 2V0NA 4MMOA 1AROP 4O44A 3NAIA 3RRHA 1NK6A 1FRIA 3MM9B 4IR9A 4ILRA 2HG4A 5IFMA 1YJVA 4CNYA 2DH9A 1CQMA 4B08A 1XR6A 1YWXA 3HT3A 1UL3A 4KHMA 1J5OB 3K8VA 4QJVA 3DU5A 3CF5Q 2FY1A 5HI7A 3UE2A 4USHA 3QWUA 3QPIA 1S0MA 3OUYB 4JOUA 2J9CA 4N8OA 4ZHRB 4URGA 2MPUA 4ERDA 2VQEF 4CO5A 3N4WA 1IKVB 4QR0A 3IR5B 2VG6B 4X62F 2UUWA 3GQCA 2OIHA 1DTTA 3T9NA 5H1SV 5AXKA 2ZH1A 3SEOA 4M5DB 2BZ2A 1KD1T 4JI1F 1RT1A 1TV6A 2UUAF 4JV2A 2V8DA 2YWEA 4LUBA 2OPRB 3CD7A 1HR0F 2DH7A 3OXLA 4YR0A 3J7YU 4GC7A 2L9WA 4I6AA 4TXSA 2E5JA 4Y28C 3UPFA 3PKMA 4OHXA 3ZZZA 4YP3A 5AE3A 3MPYA 4HI2A 3FMWA 4I7FB 2DNZA 5AXLA 1VK3A 1RTJB 4ECQA 5KT7A 4WYLA 3MM5A 1U1OA 1PGZA 3HHLC 2DITA 2YKMA 4OZ0A 4GKKF 4OI4A 4E98A 2DGWA 1T05A 2IBOA 3JB9k 3GB0A 3AQPA 4K4VA 2OPSB 1OWXA 2IJFA 2VG7B 3ZZYA 1U1KA 1VQ5S 3DRPA 5C25A 3RBDA 4C9DA 2IVYA 4KGKA 4ZCMA 5IT9Y 4WJBA 2UVVA 1OIAA 2KO1A 1FE0A 3QJLA 4NZ7A 4PG7A 4X4VA 4ITSA 2BDPA 3POTA 4CO1A 3VR1A 1R6YA 2OSRA 3QIPA 5J1EA 2E9RX 2HAIA 3DXSX 3K57A 2IVFB 4X4TA 1WACA 1HNIA 1SH2A 4RNOA 3LGNA 4DR6F 1HI0P 1WEXA 2RSQA 3IS9A 2JVRA 4DL4A 3E51A 1H2UX 5B0FA 5F8IA 3G8TA 1OSDA 2E1MC 1HW8A 2MSSA 4WKYA 2R7WA 2KT5A 2HQ3A 1FJGF 2GGPB 2MQLA 5I3UB 4CT9A 1FE4A 2GHVC 3G6YA 2J0SD 3M6UA 3QYYA 1KNZA 4PQUA 2WCXA 3HLUA 5DQHA 3J7YI 2LQ9A 2F9JA 3TW0A 2KRBA 4C97A 2JFDA 2CQ3A 4QW8A 2ZH6A 1KLNA 2HW3A 3CJ3A 5CYMB 4K2XA 4TN2A 1CPZA 2DNLA 3H4BA 5BR8F 4OX7A 2X3GA 4OZ5A 1Q8BA 3HKZD 3VAKA 2AQ4A 3X1LB 4IKAA 2YKQA 1GXUA 1VQ6S 4C4WA 3Q0AA 4HVZA 4IFVA 5KOXA 4CO3A 3G71S 2R7XA 1UWBB 2VBWA 4C0BA 4OLPA 3OR1A 1IKXB 2E1CA 2ZM6F 4DSEA 3IAM9 2R7TA 2CJ9A 2MQMA 2ZDOA 1K0TA 2HWTA 2EG2A 2ZHBA 2CVEA 4CO2A 4IR1A 3MOZA 3MURP 1D0EA 2ZH5A 4I4BA 4BWJA 4KSEB 2KG1A 4YUDA 2Z2MA 2C2RA 3HVAA 2VPZB 1CG2A 1FEEA 3DLEA 3KJVA 4C8LA 1Z2ZA 3I0SA 1JLCA 4G6VB 4JV5F 4C2MA 1FHTA 4DFJA 4ZP6A 1REVA 2D41A 5KFTA 4NYZA 1R0AB 1HQEB 4RW7A 4BS2A 3NMAA 4KJIA 2EPIA 2XNQA 1T8EA 4DG1A 2IC3B 4BBYA 5HLFB 2CRLA 3ZZUA 3LOUA 1JLGA 3HF5A 1YSJA 2VBZA 3GR0A 2R7UA 1W25A 5DJBA 2RD5C 5FJ4A 3IO1A 1RT7B 2DNMA 2E9ZA 3KLEA 4NCGA 3HDSA 1Q53A 2R4FA 2B9YA 4JBCA 1HW9A 2IA0A 4OI3A 3LWMA 1NKEA 1TKXA 4FXDA 3GFXA 2HNZA 2Y1IA 5HO4A 4NPOA 1VBXA 2ZD1B 1FK9A 3M32B 3PW5A 2K7KA 2G9OA 3AB4B 2PMZD 4CNZA 5LXYA 2LA6A 2YWKA 3OJSA 2A3JA 2D3UA 4PUOA 1I1GA 2LDIA 1V9OA 4R5PB 4UW2A 4FBUA 2N4DA 1E6YA 1Y5LB 2XWXA 2F8MA 3NS6A 1TUVA 2PA3A 2J7UA 2HPUA 1X4BA 2HLTA 3MR6A 1G6BA 1U1LA 1Y7PA 4RBUA 4J9SA 4A8MP 3H20A 4A8YA 3MXHP 1UVLA 1Q16B 2B7CB 2W9BB 4PXEA 2IRXA 5M2RA 2E66A 1WG4A 1YBAA 1YVFA 2OD6A 2VFUA 3PFOA 4LIRA 3IA0A 4DL2A 4LF6F 4HKQA 3RYLA 4CT8A 4X66F 2O67A 1JMTA 3UW1A 2RF2A 3V2UC 5A8RB 3BM7A 4GMKA 2DR9A 3Q8SB 1Y5NB 5K8PA 2GMJA 3CMES 3DOLB 5CZXA 2HNYB 3T5LA 5HP1B 2KTQA 1H2VZ 3V6KA 5J2QB 3KWMA 3M8PB 3W3SA 2A2DA 4ID8A 4DV6F 4TYBA 1S1UA 4A46A 2QMWA 2DISA 2G13A 2GCFA 3M1VB 2NUHA 4AL6A 4K4UA 5DDPC 2HS4A 3OTCA 4ES3A 2GQQA 3OR2A 3GV5B 4FN5A 4HI1A 4J9NA 4B3TF 1LW0A 3H59A 2J9DA 1HNZF 2O66A 1RP5A 3SFUA 1EP4A 1TVRA 2OP5A 1HBOB 4C98A 4DLEA 4DFPA 1KRPA 1UA1A 4DV4F 4F4XA 5D4LA 3M9OB 2ZH2A 4NMLA 4YB6A 3KOAA 3CC7S 3UCGA 2NYIA 2VOPA 1URRA 2I1RA 2VFSA 2XY7A 1HMVA 2BRLA 3BS9A 4WFAQ 1FNMA 3R5CA 3M2RB 2XY5A 4Y6IA 3K0JA 5KG3A 1HBUA 3T9ZA 3HMJG 1KOHA 1P9QC 3QAEA 3D0GE 3UD3P 2VG5A 2PO4A 4KFBA 2R2UA 3BSNA 5KFGA 2R7RA 3DI6B 4V19X 1TKTB 1NZAA 3PACA 4IOCQ 2VH7A 4RW8A 2U2FA 2BA9A 3KYLA 3JTPA 3OHAA 5C24A 5F8JA 2MKSA 2XMKA 2BBEA 3KK2B 3EGWB 1QSSA 2IMWP 3UI3A 7FD1A 4IO9Q 4Q8EA 3MM7B 3OTOF 3UNGC 3OFEA 1S1WB 2XMTA 2IM0A 1U09A 2RRBA 5E3QA 4A8QA 1C0TA 2JEFA 1HQUB 3MMJA 3D54A 2L9NA 1KQSR 3M05A 1VBYA 2B5JA 1X9MA 1HI8A 1TP7A 5KG6A 4ZPCA 4NLRA 1TK5A 3GIMA 5A8WA 1HL6A 1T3OA 3CDWA 3NS5A 2RQMA 3MEGB 3CE8A 4QWDA 2XCAA 2GIRA 3V4IB 4QIFA 4B17A 3FEYB 2DR7A 3DU6A 2GC8A 2WBRA 3FSYA 1T03B 2DCLA 2YNIB 3HXMA 5GAHU 2COLA 2LQ5A 3V4MA 1R8PA 2XI2A 1GX5A 1WF0A 3BQ2A 1TL1B 2OH2A 2IM1A 4DL7A 2ZKTA 4W92B 1BQMB 3TANA 1NK8A 2VFTA 2ZZNA 2P6TA 2BM1A 4M8LA 5F8NA 2IA6A 4DSKA 2HHHF 4N77A 3ZZPA 1JLFB 1LK5A 4NA2A 3TUIC 3G96A 3QJJA 3JSYA 1FKPA 1RT3A 4IFYB 2Q79A 2CQBA 2ZJRQ 3SSQA 5HBMB 5ADZA 4DBQA 1NK0A 1O51A 1UVKA 2L41A 1C4AA 1F9FA 4J9OA 1ZTTA 1XK8A 1N5YB 4CZCA 4DEZA 4RUHA 1FVQA 5FIIA 2HVHA 1RTHA 1S1TB 3ULHA 4N47A 4OI0A 1SXLA 1UEVA 4GO5X 2V4JA 1HYSA 1B64A 4Y0FA 5SUHA 2B9WA 5KG0A 2MKIA 3H25A 3QJPA 1DFDA 3HVRA 1L3KA 3NBPB 3ITHA 2OFGX 3IWLA 5EUHA 1O5JA 3QGPA 2QT7A 1LQ9A 3THVA 2V8GA 1HA1A 1G1XA 3BDPA 2DGOA 1M5HA 4R0EA 1C1BB 4TKTA 3PX6A 2E5LF 2XMWA 4MKAA 2UVWA 1BQNB 1KLMB 4RBVA 1L3UA 2BXJA 4K4XA 2W7AA 4ICLB 2J6TA 3KHGA 1MROB 3KLVA 2LEAA 2MKHA 4YR3A 3BGFA 2BABA 3I5AA 1N48A 1OQ3A 4NCAA 2DNOA 1S9GB 1JLQA 5GAHI 3PO4A 1LW2A 4DSFA 4DR4F 5E3PA 2JC0A 4IDKB 3OSNA