1HNWF

Structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
101
structure length
101
Chain Sequence
MRRYEVNIVLNPNLDQSQLALEKEIIQRALENYGARVEKVEELGLRRLAYPIAKDPQGYFLWYQVEMPEDRVNDLARELRIRDNVRRVMVVKSQEPFLANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF01250 Ribosomal_S6 Ribosomal protein S6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.60 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1hnwF00
4DUZF 4DR5F 1N33F 4K0KF 4DR4F 1N34F 4X66F 4JI3F 1IBLF 1G7CB 2UUCF 4JV5F 4JI4F 2VQEF 3ZZPA 4GKJF 2B7CB 1XMOF 1HR0F 2J5AA 1F60B 1XNRF 4LFBF 4LF7F 1N36F 4JI2F 1B64A 2KJWA 1IBKF 4X62F 1CQMA 4B3SF 1IJFB 4DV1F 1QJHA 3T1HF 2BXJA 4DV4F 4LF4F 4LFAF 4JI0F 4X65F 1FKAF 1XMQF 4JI8F 1FJGF 4AQYF 1G1XA 2YY3A 4B3TF 4LF5F 4NXMF 4DV5F 5LMUF 4B3RF 4DV2F 4DR1F 2UXBF 4DR3F 1HNWF 4DR7F 4KHPF 4YHHF 4GKKF 1IBMF 3OTOF 2KJVA 2VQFF 1LOUA 5IWAF 2UU9F 4DV0F 4NXNF 5AJ3F 5LMNF 2HHHF 4LF6F 4LF9F 4DUYF 4DV6F 4YY3F 2ZM6F 3R3TA 4OX9F 1N32F 2UXDF 2F4VF 2UUBF 4JYAF 2B7BB 1I94F 1HNZF 4JI6F 1RISA 2BVZA 4JI5F 5BR8F 1HNXF 1IJEB 4X64F 4DV3F 4LFCF 1J5EF 4DR6F 1GH8A 4LF8F 2UXCF 1XNQF 4DV7F 2UUAF 2E5LF 1CQNA 2RJZA 3T1YF 4B3MF 1VMBA 4DR2F 4JI7F 4JI1F
chains in the Genus database with same CATH superfamily
2BBEA 2VG5B 2VIHA 4I6AA 3DNCA 3HHLC 4NZ7A 2BR0A 3G82B 3HZGA 4ALZA 3K5PA 2JRSA 4DX7A 5SUHA 3W3SA 2J0XA 3MMBB 1YJNS 5JUMA 3D28A 3W64A 2W7OA 1S77D 1W2IA 3IWNC 2MQLA 1F3VA 4LSNB 3ITHA 5IC4B 3ICLA 5MAOA 2B9WA 3FCWA 4ZP7A 5B08A 2ZVIA 2XY7A 3B6BA 1NJWA 2UUAJ 2XNRA 4GKJF 3UI3A 1UZDA 4RO0A 2FVCA 4AD6A 2B7CB 2ROPA 1L3KA 3EJMA 5B0FA 2FTRA 5KFSA 1R0AA 3SCKE 4XIUA 1H2UX 1WF1A 3DCAA 3TA0A 1X8DA 2QMUB 2M4MA 1NHUA 4A8WA 2HNYA 3CCTA 2YQ0A 1S57A 3AA9A 3HJFA 3ENQA 2JLFA 3I0SA 4ICLA 2KU7A 4ZVUB 2UXCJ 1JXVA 2LQBA 2XLJA 3C3LA 1Q78A 3Q23A 1OQ3A 3ILOA 2GW8A 4YQWA 2OJ3A 1FJ7A 1MG7A 5HI7A 4F3QA 1LWEA 2HLUA 1HD1A 3FEXB 4NRTA 2AD9A 4FBUA 4BLGA 3TOQA 5F8IA 4QWDA 2PMWA 4H4MB 4CLUA 4C8YA 4LBIA 4HH0A 3CIZA 4IOAQ 5IT4A 4JB8B 4UQGA 1IUJA 1OYEA 1W25A 3DDKA 2HHSA 4N8OA 1HHQA 5BYSA 4IG3B 2EC2A 4F25A 4LF2A 1YI2S 3THPA 3NGTA 2DNYA 3WX8A 1N5YA 1HWKA 1MN9A 3W9IA 4DR1J 3V4IB 5D0EA 3P49B 1EZZB 1RDRA 1V6HA 2CNOB 1R6YA 2RSQA 2YKOA 3HO1A 2I8EA 1B70B 2CG4A 4NLUA 3T41A 5KFPA 4FVCA 4OFZA 1OSDA 3LPEA 4C8MA 2GQ2A 3GSIA 4RNNA 2FY8A 2J6UA 1FFSB 5J1EA 1WHXA 3MF5A 1YITS 2KFNA 4MIBA 2VHGA 5DQHA 2ILZA 1RTJA 4KAIA 1O8BA 2YPZA 4DN0A 3OTOF 2KJVA 3PZPA 4GKKF 1FEHA 1APSA 3MMAB 2R3VA 2JHEA 4KC5A 2BW2A 1ZAVA 3OPKA 5AT1B 5C24A 1FD8A 1TL3A 2CYYA 4LREA 1A7GE 4UOFA 4DV0F 3OT9A 3JYTB 3SCIE 4YY3F 1QE1B 1JJ4A 1WC3A 3FEYB 3MXHP 1YRUA 5ETRA 2KRRA 2ZBQA 4C7QA 5KFYA 3I55S 3T1HJ 4DSEA 3HK2A 1SH0A 3VQTA 1N5YB 2ZEJA 3IM9A 3V4IA 1OSCA 2B7BB 4ZVOB 3EPGA 2WW4A 2NYHA 1HNZF 1C1BB 2Q3PA 4F50A 4X4NA 3V6HA 2WRMA 3G8SA 4FYWB 2H3EB 4YP3A 3BQ2A 1KLMA 2IHR1 3FUYA 2R8JA 2ZNYA 3CJTA 1GTHA 3GJRB 2NCKL 4TN2A 4DPUA 2W2QP 4I6WA 4CRJA 3BS9A 2ADCA 1CC8A 2FJAB 4M1KA 2XI2A 3DHWC 4TYBA 5L9NA 2E66A 3TRGA 1U25A 2W4DA 4RWXA 2OPSA 3KLEB 3KUHA 1HR0J 1R6VA 1VQ9S 2K7JA 3K8VA 3LP1B 3W7BA 1VLYA 1TP7A 2ZVSA 3DRSA 1TL3B 4OYOA 4UW2A 3W61A 5C7PA 2MKIA 2DH9A 4WP9A 1U47A 3SFUA 3EX7B 5H9EJ 2AKWB 4J37A 1E6VB 4DR2F 1JLAB 4HTJA 4KH0B 1CULB 1R27B 3ZZTA 2FJEB 4TU9A 1U0HB 5KFVA 1DTTA 3DLBA 4YDDB 2WHOA 1N33J 2HBZB 2QYCA 1TKZA 2F65A 1NK5A 1MROA 1C1BA 3QT5A 4HR2A 2OTLS 1GX6A 1C4CA 4W98A 4DI6A 5B0AA 5HLFA 3HHLA 2OPPB 1D9AA 1WF2A 4J9OA 1N5SA 3IMQJ 3PW4A 4OZ2A 2UV8A 2DR6A 1K9MT 1XR7A 2E1CA 4I2PA 2LA4A 4Q2LA 8ATCB 1BUXA 2D9OA 5I42B 3H8YA 1RAJA 1KFDA 2QLXA 2XHWA 3BH7B 2DO0A 3FMWA 3GFXA 5KT5A 4JI1J 2VG6B 4GO7X 1J5EF 4WZMA 4I7FB 3I4HX 3SXLA 1F6TA 3UO0A 3NGSA 1YQHA 4RW9A 1NSPA 2NYIA 3FRYA 4LRAA 1DTQB 3IAM9 3CCSS 4Y65A 2AGPA 3HSDA 2XG8A 3P8BB 4RJVA 3MD1A 1NDCA 2VV5A 2WVDA 1WJ9A 5DDQC 3U02A 4DPXA 1JLAA 4J9PA 2PSZA 5E3CA 3D1OA 2AWZA 2KJWA 4X62F 5CCLA 2DTJA 3C14B 3DOMA 3HFKA 4C9DA 3MEGA 4X4PA 2RQCA 1JJHA 2BXJA 4C98A 3LTOA 4DG1A 3NS7B 4JI7J 1PCAA 1NNDA 2J7WA 4WU3A 5HK4A 2MZTA 2QMXA 4OX7A 2IM3A 5CYQB 2K7KA 2Z2LA 1WKKA 5HVHA 4EWTA 2XEXA 4A47A 9ATCB 3VGSA 4LBHA 3VR1A 4ZVGA 2IA0A 1TVRB 5ETQA 5EX3A 2G4BA 2VODA 2RAQA 5G0RA 3GV8B 2W8LA 2XMKA 3G2XA 4IOBA 1REVB 1AROP 1S9GB 3K5OA 5K8MA 2MY7A 2LEBA 2BKOA 2O67A 3NLCA 4NLSA 3W1YC 3D5MA 4DPWA 3HVRA 2CJXB 2DO4A 4CIOA 1VQOS 2ZZNA 3E51A 3G96A 4NLPA 1AFJA 1UJ4A 2FHMA 3PKMA 3K5MA 3W2WA 4O3QA 2YQ1A 3QIDA 1KN6A 4RPFA 1JLGB 2XHCA 2NUHA 3AB4B 1YIJS 1VQ8S 3KOAA 5CYMA 2XS2A 1BXNA 3BGOP 1WEXA 3M2VA 4G1IA 5C5JA 1B0VA 4Y2IA 3O3LA 3C14A 3DOMB 4CT9A 1RTIB 1VQMS 3FMBA 3L7PA 3K58A 3F44A 4DMZA 4RUHA 2J6SA 1VISA 2GVDB 4DG1B 2R9LA 1JLBB 1PC4A 1XR5A 3T6BA 4LSLA 3TZZA 2MZJA 3CCMS 5HQ8A 1YTYA 1LOUA 2V6AA 1S1TB 3H2UB 4CH7A 3SYZA 1HYSB 1CSJA 2MLZA 2DGXA 4F7VA 2OMLA 3NGDA 3HKZD 1BC6A 3NRBA 4LR9A 1HBOA 3RAXA 4NLDA 3TQ1A 2N4CA 3UDLA 2AMCB 3CMES 3CJ0A 3OL6A 1RWUA 3HD1A 5H9FJ 1GMWD 4ES1A 1HBNB 3RBEA 3Q8PB 2CVIA 2BJ3A 1Y3JA 3CCZA 1WC5A 4PXCA 4DL3A 4OLOA 5IFMA 1AUDA 4WJBA 1YJUA 2ATLA 1T3OA 2CPJA 2XYHB 3H20A 2B4VA 5CYMB 5L38A 3KK1B 2MKCA 4PAAA 5CD4A 4DFMA 4DF4A 4JI8J 4B3TJ 3I9V9 4USVA 5B0GA 2AZ1A 3IS9A 2GNKA 1WOSA 4DEZA 2J9EA 3HP6A 3MM6B 1LK7A 2IJFA 4Y34A 1FE4A 4NYOA 3ZZYA 3KJFB 1D0EA 4B9UA 3MHYA 4LF8F 2K8GA 1GK8A 4WK1A 1S1TA 4TLQA 2CQ4A 1LW2B 2DR5A 3M8QB 4O4GB 1BQNA 5KFWA 2UVUA 1WDTA 1DLOA 2YPYA 3KTQA 4IR9A 4WF9Q 3NNAA 5KG5A 3WX4A 4JI2J 5AE2A 3T5KA 1JKHB 1EETB 1DARA 2Q79A 1N34J 4GKJJ 1ZM9A 3U1MA 2RHSB 2JEJA 2K3IA 4NZ6A 3AB2B 3RYLA 1TL5A 1QAJA 1QSYA 4UZCA 3Q0AA 3IP0A 5IM0B 3Q8YA 2W9CA 3KWMA 4YR0A 1HD0A 4GVBA 4HDGA 3GE9A 3Q8UA 1MWYA 3LH2S 4HHJA 4BWJA 3JQJA 4WFBQ 3EICA 3P4UB 1D1UA 2HAFA 3K7RA 4N76A 4EBDA 1BWVA 2F7VA 2V50A 5A8KA 2XMAA 4MH8A 1N6QB 4ZN3A 2J9CA 3C8YA 1HLWA 4C3MA 2DISA 2JVRA 4K5SA 4KQZA 4O4GA 2I6WA 3ZTPA 1BQNB 3W63A 2VBXA 3TEGA 1KVJA 5K20B 2UUCJ 2Q1LA 1DAXA 4K4ZA 4P7TA 5LJ3Y 1X9MA 1UEVA 3KYLA 2PFDA 3KJVB 2DNQA 3JTOA 1EJ7L 4ECYA 3DRPA 2LP4A 5T7LB 1S6QB 1DRZA 3TYTA 1QJHA 4NOHA 2BOAA 2CNLB 3M6XA 3RG6A 4B17A 2W9CB 3CCRS 3SV3A 4DU7A 2HK3A 4IFVB 1PBAA 5I3UB 4B9VA 4RUBA 1RXOB 1N88A 3VTIA 5GMKa 3DLEA 5AXNA 3BZQA 3KLVA 1NPRA 2M2BA 2HFZA 4LQ9A 4C11A 2ZC4A 3O2IA 1TMMA 1XC9A 4KV8B 1NK8A 1O51A 3KXDA 2Z30B 3UVJA 1NZAA 4NLYA 2QRRA 5D4NA 1RCXB 2A10A 2E1AA 4G1QA 3SV4A 2VA3A 2MGZB 3OLBA 4OHWA 1VLOA 1URRA 3I82A 3NAHA 2B9EA 4BCAA 2WK4A 4MIAA 2FVPA 3ZZUA 3M4XA 3H5YA 3N9UC 1BHNA 3D68A 3P5BP 2GHVC 4HHUA 1YJ7A 4LIWA 1M0SA 2EW9A 3L7UA 4CZCA 3BQ1A 2MQNA 3FVYA 2WTFA 1GEHA 2P9GA 3NG8A 4XO0A 3MUMP 5K5MA 1U1MA 3ISZA 4KHPF 1OO0B 1YSJA 2HVDA 2PA8D 3PV8A 4KJIA 4IFVA 5J2QB 2R8KA 2E1RA 2C3MA 2L3MA 4FDFA 1Y5NB 2M0GB 3WIUA 4WK3A 3DLGB 3QSYB 4ZJOA 1Q95G 1RWMB 4DUYF 1UFWA 4YEAA 3RR8A 1UPPA 4WE1B 4DQPA 3HMJG 2FGOA 2YKAA 1LWFB 3CJ8A 1UZHA 2F40A 3FNNA 2HQCA 2E7WA 2LU1A 1HI0P 5ITHA 1CJTA 1HKAA 3R5DA 3KKFA 4EO6A 1WI6A 2GHPA 1N36J 1U24A 1VJQA 2NXNA 4ECQA 4QPXA 1CS4B 1GXTA 1OMSA 3AOAA 3VGTA 4JI5F 2DBBA 5ETOA 2XBPA 4OL8A 3UN5A 4LFBJ 2R8IA 2IPOB 1QDUB 1U2RA 3IRXA 5DLFA 1X4EA 3S7RA 1KNZA 1TAUA 3GWCA 4KYZA 5J2QA 1V3ZA 2NXUA 3B4DA 2ZC3A 1LXNA 4H54A 5KFUA 2XCPA 3KLHB 1RT1B 2MZRA 4CLPA 3GILA 4B3MF 1VCTA 5AXKA 1SC3B 3PACA 5IZHA 3DHXA 3M2RB 3L3CA 3TJ8A 2HHXA 2FD2A 3I87A 1X5PA 3CMAS 3NMAA 3KDOA 2RH3A 4DV1J 2FHOB 3D7SB 1YG0A 3SCJE 4DR4F 1LWEB 1NK9A 4X62J 2KXNB 3CGIA 4UTGA 4OZ0A 3TAQA 2FJWA 3HVAA 2B8QA 4PCQA 3R5GA 2OSRA 3DLJA 4RUAA 2G9OA 4FYYB 5KFIA 3ZZ0A 2V68A 4N56A 5ETVA 3BPDA 1FO1A 4IG3A 3CJ3A 1KQKA 2V4QA 3IO1A 1KEKA 1TL7B 3Q8QB 1R43A 2DGVA 1YZ7A 4YFUA 3G6YA 1J5EJ 2Y8YA 1FT8A 1SJ1A 2EFNA 3LP0A 1V3RA 2F63A 2W7AA 4OIXA 3KLHA 2FVSA 2WONB 2XSJA 2W9AA 1H3DA 4WFNQ 3GR0A 3MAQA 1BGXT 1PO6A 1IBLJ 1UTAA 3S6EA 4UY85 2Y9HA 4K50A 3D67A 4JI2F 1K0TA 2QYGA 3MM5A 3J81U 1HWUA 3LGNA 1B64A 2NQPA 3VWSA 4E8UA 5HMWA 1WKJA 3MM9B 2B4OA 2Z0GA 2IDEA 4OYAA 5BR8J 3SSSA 1T9WA 4DV1F 4FVMA 4Y2AA 5HANA 3BKTA 5DDRC 4MKVA 3AXKA 1RTJB 3MURP 1DJ0A 2LEPA 2YNFA 5K8PA 3KK2A 3MMBA 5AE3A 1V5IB 4DR2J 2BKNA 2CJQA 4RU9A 2BOPA 3FJ2A 4LSNA 4N47A 4CO4A 4DCJB 4L72B 1TK0A 2IA6A 3DGVA 3JYTA 2E44A 3PYEA 2HWHA 4OQJA 1HMVB 5F9NA 1NXIA 2BM1A 2K1RB 2MKJA 1FJGF 1XR6A 3C15A 1U6ZA 2VOPA 3TX0A 2CPZA 2EKNA 2Z57B 4DV3J 4X64J 2XSJB 3PO4A 2VPWB 4PABA 4HL9A 4M5DA 2CZ9A 4A8SA 2J7UA 3HXMA 1CPZA 4HACA 1PKUA 1SQGA 4AXJA 1SBRA 4OZJA 1DBDA 4GC6A 5L9XA 1KBRA 3HZEA 3FFIA 1VDHA 4YHHF 1WOPA 1VIOA 2NSCA 4ZVTB 1JLEB 1LQ9A 2DD8S 3GG0A 5KFGA 1G4CA 1H0HB 3CDAA 1H73A 2XULA 5LMNF 2F9JA 4DHVA 3J81Y 3W65A 1RABB 4NXNJ 2LXIA 3RJMB 3MM8B 1WACA 2EK1A 3KLGA 5BXIA 4CO0A 4M5KA 4DV4J 4C2MA 1KD1T 2K1RA 1X60A 3MEKA 1VYAA 1Q86T 1F2GA 2C2NA 3T9ZA 1SUQA 4DU8A 1UJ6A 2JLEA 2ROEA 2ZNZA 3S1TA 4FN5A 4B02A 3CWJA 3N01A 4ECZA 2YX7A 3ZNUA 2CUYA 1UCNA 2IJNA 1S0NA 4B9MA 2DY9A 2HBQB 5A2QY 2QJ3A 4ZP8A 4IRDA 2O5DA 3UD3P 1UEKA 4ECWA 2DNNA 4LFCF 1IJEB 2JJ4D 5HJXA 4IQXA 2Z58B 4QPTA 5DLGA 5I42A 1FX2A 2Z2ZA 2HZAA 4FKXA 3M2UB 1HARA 3OVAA 4U7UK 4P7VA 5B0BA 4XTTA 3BYRA 1IKYB 3DI6B 4WTOB 1UW9A 5J2PB 3MUVP 3MMAA 3OL7A 1FDDA 2BKPA 1RT3A 1XWLA 3GSDA 3OTEA 4RW9B 4X4UA 2JWNA 1Y00A 4OV6A 2MMYA 3H5SA 4UF4A 3UR3C 2L9DA 2FJBB 2QL5B 1TL4A 2RNEA 2VASA 2WBRA 2E7XA 4YB7A 3US5A 5FIIA 1FVQA 5DETA 1XMOJ 4NCAA 4R5PB 1Y4ZB 2E7VA 3KG4A 1Q8LA 3Q2TC 2ALYB 2I1RA 3IM8A 1N5QA 2VFUA 2EFVA 2ALZA 1RK8A 3PDNA 2Y1RI 1FXLA 3OW2R 2D1CA 3J81j 1RB0A 2EFGA 4IRKA 4JI3F 5ETMA 4AUKA 5E33A 2GJ2A 3P96A 2VU5A 2UUCF 1UKUA 4LQ3A 1FERA 4HKQA 5KFZA 5ADZA 4X4QA 3R5JB 1NKEA 3QNWB 4IDKA 4EO8A 2VQEF 1FJEB 4JI4J 1UVIA 3OTBA 3WC0A 4DF8A 2J7KA 3M2UA 4ZLNA 2HKEA 4OI0A 4QW9A 1NHKL 2E9RX 2VFSA 5J1NA 2YKMB 3CC7S 2ZUGA 4I69A 2DY1A 4OYMA 3BR8A 1SKRA 4ILLA 2VDIA 2Y1IA 1JLQA 2FVRA 2W7PA 2QG9B 5F8JA 2QT7A 1OJ4A 1UVJA 4LF7F 3IXQA 5KT4A 3OR2A 3Q22A 4ZA1A 4B9SA 1DTTB 2NXJA 1SJRA 1RTIA 3MR5A 1UMJA 1TKZB 2W25A 4NA1A 2R4FA 3I5AA 2V67A 3GYXB 1JLBA 4JBCA 1DHMA 2ZM6J 2OAUA 1VK3A 1TZ0A 2BQRA 1T7PA 4LF4F 3NGKA 4I68A 1U6BA 2GMHA 1VHFA 2V63A 5EWFA 4L76A 1HFEL 2D74B 1SI9A 3K17A 1RAIB 2CJYB 3LOUA 4ZIVA 1FKAF 1L3UA 5A6WA 2GS8A 2PEHA 1WSVA 3MPUB 2Z4PA 1PJ6A 1IR0A 1JXEA 2H5IB 3FRZA 4NLQA 4R8UA 1JJCB 6FDRA 3T6JA 1T11A 1TR0A 4FS1A 1U7LA 4WFAQ 5EDWA 1B99A 3M6VA 3J7A1 3WC2A 3Q8SB 4ZPWR 1WC6A 3A4TA 2Y0SD 2V8PA 3IR5B 1U2FA 2VDHA 3LGMA 3JSBA 1RBAA 2WVBA 4CM0A 2QSWA 4XK8C 3L9ZA 5A6PA 1C0UB 4F04B 1KR4A 1I6JA 4DL5A 3EVWA 3LGHA 1S1XA 3ZZZA 1FJCA 2CPHA 3TP2A 2RUSA 2RT3A 2ZHBA 4XDCA 1F5BA 2M88A 3FK4A 3MWBA 1NJIT 4LF5J 1VQ6S 4N8NA 3MEDA 3M8QA 2KG1A 1ZYQA 3V6JA 1MMDA 4LF9J 4P73A 3UCZP 1NAQA 1TKTB 1Y3KA 1SH3A 3CD7A 3TARA 2CDRB 2XS7A 1REVA 2A2DA 2LDIA 2QA1A 2QLFB 3B54A 1QAIA 2F5GA 2FYXA 3UW1A 4URGA 1RA6A 4IR1A 5KOWA 2JLGA 4JYAF 1H2TZ 1VIXA 3FGVA 1SC1B 1GXUA 1YRTA 2IAJB 2IM2A 1I94F 3W2WB 4A8QA 2V4JB 4WFYA 2KYXA 5DG7A 4URSA 3D6TB 3SMZA 1S5ZA 4GVBB 4CP5A 3H7HB 3M2VB 5F0WA 5E3RA 5LOQA 5C25A 3PRDA 2DXDA 1IM6A 2ZOMA 2IVFB 3HLUA 4QR0A 1U1KA 2KN4A 4QWCA 1WELA 2G1DA 3IGVA 2HSEB 4U96A 3HI9A 3S8SA 2GVDA 2MKKA 2HMIA 4OHVA 1RLCL 5H9EK 1IWGA 3DM2B 3HKWA 5D0HA 4ZCIA 1XNQF 1P1LA 3EZOA 2ERRA 3VVUA 1LXJA 5G4DA 2FY1A 3PY8A 2DCLA 2HQGA 2OFHX 2VBYA 3M9OB 5DG8A 2ASJA 2W2PP 4ZITA 1J2VA 1TELA 1FX4A 4JI1F 1KVIA 2RQMA 2ZHOA 4ID8A 2OLWA 4WBFA 2MQ8A 1NCLA 3BF4A 4G65A 3CJ2A 2GAGC 4F3OA 1TL1B 2ZBPA 4F4WA 2YWHA 5DM6Q 2IAJA 1N34F 1RU1A 1TK8A 4Q7AA 4PQUB 3CCLS 1RAOA 1UPMB 2VOOA 4O4RA 3KK1A 2JEGA 2LLZA 1ZAWA 3GYGA 1K1QA 2C3OA 3EXCX 1FRMA 1PC5A 3NEKA 2DYAA 3CIMA 4EBCA 1NUEA 4KV8A 4CO2A 1SL2A 3MM6A 1AYEA 1LWCB 2OFGX 4KGXB 4LF1A 3D66A 3OR1B 2W8KA 4B3MJ 3P6YC 3QGGA 2R7WA 4FYVB 1LW2A 4C3LA 4N77A 4Y2KA 4CQ1A 4EGLA 4ZVFA 1JIHA 3QGHA 2QE5A 4NLWA 1ZM3A 4ES2A 3DYAA 4N7TA 2P6SA 1C0TB 2GJIA 2WOMA 3ILJA 4KGKA 3HM9A 1RAFB 3LP2A 4TQRA 2NS1B 3PJXA 1Q4RA 1RGVA 2MQOA 1TL1A 3CXCR 1WG1A 1B0TA 2M8HA 2ZH7A 2O1PA 2A1BA 2CZ4A 1U8SA 2B4PA 3K5LA 2B6AA 2NPIA 3M32B 1FRJA 4K4VA 3ILLA 2IRYA 4DX5A 1R7IA 1WTBA 5DGBA 1YGYA 2X1GA 1DURA 2AEJA 2KZMA 1CC7A 3SQOP 5A8KB 1TUGB 4ZS6A 3OBIA 5L8RC 4DV7J 4IH5A 4RLEA 4X65F 1AW0A 1RAHB 4DBQA 2KFZA 1RT4B 3ELHA 4CTAA 1GXLA 1H6KX 1RAAB 2XMWA 5CYJA 1ULRA 4Z7CA 4CCHA 1WF0A 3K5NA 3QFHA 3VAJA 5CZVA 1U02A 2MKYA 3CCJS 4DV0J 4F4XA 2HGNA 3RGIA 4PWUA 3DYAB 2DNMA 1HNIB 2JX2A 3D0IE 4LUBA 3T5JA 4DR3J 3BBCA 4LR7A 1RWPB 2YKQA 2L08A 2YNHA 2Z56B 4GC7A 1D09B 3CE8A 1H7XA 3CJQA 4FF1A 1QAXA 2APOA 2GJFA 2GFFA 2B6AB 2VQFF 5LJ5Y 5IWAF 1DQ9A 2O3DA 2OEMA 4XDDA 1FKPB 4NZ0A 2YKNB 5AJ3J 5HQLA 2VPYB 1HQ2A 2CWXA 3VV2B 5EGYA 4PYAA 3UD4P 4ATNA 3X1LB 1NDKA 5HJYA 4K4WA 2U1AA 2ATCB 5HROB 2UVVA 3FZ2A 1BWEA 3UVJB 5CAAA 2XWYA 2P5VA 3V6KA 1GMWA 2C3PA 3PJWA 4DX6A 2MGZA 2V4RA 1M5OC 1WG4A 3QO9B 4MK8A 5M2UA 2OIHA 3RB0A 3WZ0A 1RWVB 2BJ9A 5D8HB 2NXCA 4GMKA 2RKIA 4UQTA 3K89A 1UFLA 4X65J 2MQPA 2BVZA 3B4MA 1S59A 2KM8C 2YTCA 2ROGA 2WZ1A 3KJQB 5B0EA 4H4KA 3UDVA 3NMRA 4I64A 1MN7A 2DNKA 2UV8G 1LFWA 3I96A 4MJKA 5KFQA 3R97A 3AJ2A 3I0RA 1G2EA 2DEJA 2ZKTA 3HT0A 3K2YA 2HHQA 3QBCA 1RACB 4M5GA 3MR6A 2VA2A 3H40A 3T1YF 4EYIB 2HZVA 2EFPA 4DSFA 3I0SB 2M70A 5DQGA 5KT7A 2XM3A 2HQIA 4WE1A 1QAYA 2KT5A 2PEBA 2E5HA 3HD2A 1HL6A 1VS3A 3A12A 4CO1A 1FNOA 3MM9A 4ED7A 1CJTB 2A3JA 4TY8B 5F3ZA 1RU2A 4PXEA 4JV2A 2X1FA 2QZ8A 4OJGA 2FIUA 3RU0A 4CO5A 3AQOA 3PHTA 2AV5A 3CJSA 1YHQS 5L1JA 4H4MA 3AAWB 2UUTA 1CS4A 3BKUA 4U95A 4AL6A 1U8WA 3Q89A 3C66A 4DFPA 2OMOA 1URNA 5LSRA 4FYXB 4K4XA 4FF4A 3NKYA 2DVIA 3UNYA 2UVWA 2Y1LB 1ZA2B 1VHIA 2DGTA 2LQJA 3TZXA 1PBUA 2J76E 1U45A 1QLNA 4QU6A 3MUTP 4K59A 2I0XA 3B82A 2CFXA 4H4OB 4Z2XA 4L6V3 4PWDA 3C15B 3QIPA 4OI2A 3RR7A 1HA1A 5A2QU 3G6ES 3TJ9A 4OJ3A 1RT1A 4J9RA 3PX6A 1RLDA 5IQ6A 2ILYA 2GMLA 5KG0A 2DHSA 4R0EA 3HHNB 3PFEA 3MI7X 1PYTA 4I4BA 3NAIA 2CDQA 2J9DE 3PFOA 3RTVA 3HDSA 3KFWX 3J80Y 4RL1A 4TLRA 3EZ5A 3TWZA 3E01A 1W2BR 3A3OB 3GLJA 1Z2ZA 3GJTB 2D9PA 3W5ZA 1BQMB 3F41A 1RHRB 2R2UA 2XNQA 1KKHA 3OTCA 1NRKA 4WIIA 5C24B 3PW0A 1P8GA 3RB3A 3K59A 2UUBJ 4WZQA 5F8NA 2HNZA 4XPEA 3MEEA 1ZTTA 2AGOA 1D9FA 1DY3A 1I3OB 4EU0A 4M95A 4CM2A 2R8GA 4FKYA 4O44B 1X9WA 4JI6J 3OL9A 2MLXA 3UN3A 1SUQB 2XQCA 3H5XA 1YX2A 4Y6IA 3I6PA 4G6VB 3LP0B 4HT5A 2R7XA 3CCES 2HBRB 2YY3A 3VZIA 3UNGC 3GR1A 4K4TA 1UA1A 4ZJLA 2VFRA 3VGUA 3TAPA 3CT9A 5HL7Q 4EEYA 1KLMB 1VC6A 4MMOA 2RRNA 1FXRA 4YY3J 3DGPA 2CQ0A 4YUDA 4OZNA 4PPZA 1PSDA 1ZPVA 3MCMA 3OJUA 3PYDA 5F3TA 2W9BA 3E01B 3D4JA 4MK9A 2DHXA 5HVFA 1IBMF 2GX8A 5EHHA 1NJYA 2G2OA 1NSKL 1BQMA 2C3UA 3LO3A 3IC1A 1SL1A 3DOKB 5E3AA 4C8OA 1IKVA 3HX9A 4LF6F 4PXDA 3PRBA 1DZ5A 2HHHJ 3ULHA 3G9CA 3W60A 3N28A 4LR8A 2Q6CA 3EZUA 2W2OP 2FJVA 1Z4UA 5JJBA 4FF2A 4J9NA 2E9ZA 1F9EB 3CJ4A 3EYZA 1RHMB 1TQLA 2PMHA 4Q8FA 2JDJA 3A13A 1SV5B 4ELVA 2HGMA 4V1Ak 3HFZB 4C3KA 2BABA 3BDEA 5HLFB 4IRCA 4B3OA 3POTA 2OPPA 5BJRA 2L9WA 1T94A 3R7NB 2V0NA 4HACB 1EQ0A 3C16B 2KXFA 1RTDA 2P9EA 1RHQB 4JP8A 3D0GE 4DR6F 2CWKA 2RF2B 2DIVA 4IDKB 1NB2A 3QPIA 3FFIB 4ZCMA 3BSNA 2W9BB 1OY6A 2CNNB 1N5VA 3Q24A 3NWGA 5E0OA 5L39A 2BRLA 1UVNA 3OV7A 3DDIA 3GPAA 3HHEA 4G1PA 2J6TA 1ZPWX 1UETA 2FJDB 3MCOA 2CRLA 3BN4A 4M94A 1CQNA 4C8KA 2BE7D 3BKFA 1WEYA 4I6YA 5DQIA 1JLQB 1L3VA 4DSJA 3MM8A 2DHHA 2CQHA 4DS5A 2ZZTA 5D77A 2IYIA 1G6BA 3D1QA 4F26A 3L7OA 5GAEU 2YBVA 4Q8EA 2RQKA 4ZHRA 2HURA 1X9SA 5ETTA 2DPIA 1R0BG 3R7SB 5HVGA 4C8NA 3EMTA 1FHTA 2VB6A 4ED0A 1SJ3P 3CO0P 2GQQA 2JL9A 3M8WA 5KTQA 4Y2MA 4B3OB 3SDEB 1IBLF 2DR7A 4ANCA 1NK0A 2RB7A 2BYCA 5GAGU 1BD6A 2RF2A 4GRSA 4IG0A 1OY8A 1QUPA 1VOMA 3PTWA 1SQEA 4W4MA 2CIMA 3VALA 5K14B 2C2RA 4UY8T 3IR6B 3TVKA 1S9GA 4QOTA 1ZS6A 3KHRA 4TY9A 4CT8A 3DRRA 3ISND 4Y28C 1YK9A 1N56A 2PFFB 1FTRA 2HK2A 2OI2A 2VPXB 2K3KA 2QMWA 2XTJP 3D54A 3FCHA 4ITSA 4A48A 5K8OA 2FLNA 3C19A 3D9BA 4R5PA 1F3FA 3QYYA 1GQEA 1U09A 3EVMA 4DSKA 2XCAA 4F8RA 3PJ9A 1S0VA 3DU5A 3OTDA 2YX4A 4OI4A 1N5TA 2B4UA 2ZWPA 4U9RA 5RUBA 4Y3CA 3Q86A 1O5JA 3SDEA 3ZTOA 3AOCA 4LFAF 2PO4A 2V2QA 3W2VA 3MPVA 6FD1A 4IG0B 3TR5A 5LM7E 1R8CA 4JI0F 1TKTA 4FXVA 1S0OA 3ONQA 2AJ0A 3KG0A 1RHUB 4BHQA 4ECTA 5FD1A 3C2PA 2OTJS 3KUEA 1REGX 3LW5C 4RNMA 4O3OA 2G1HA 2JFKA 3AT1B 2A0FB 3VAIA 4MAKA 1FRIA 3FQLA 3PM9A 4S0MA 5C25B 1HBUB 3OQ2A 3CVKA 4ZCKA 3BR9A 1NH7A 3JQMA 4RW8A 3TUPA 3HF5A 5D4LA 5IS2A 1VGYA 2H4WB 4USUA 5KFEA 2Q43A 2AU0A 2ZDPA 3U27A 2BQUA 1SKWA 3SQGA 4NXMJ 3CDBA 5HBMB 4YHHJ 2DNOA 2XYPB 2ZBCA 1EKSA 1Y5IB 4KHRA 4TKTA 3W2VB 5KG1A 3IN5A 3T19A 3GV5B 1HI8A 3JXOA 5GAHU 3H25A 2OEJA 2J0SD 1FDNA 1RZMA 1SC4B 4KGVB 4KIAA 4DPTA 4B9LA 5IT9U 2P8IA 3LWMA 1S4FA 1V9OA 4ZDNA 2VBZA 3RAMA 1F2HA 3IBCB 1HQEB 2H54B 1M90T 4IUFA 2F4VF 1ZM2A 4DSIA 4YMEA 4UUWA 5A8WB 3E8OA 4LF4J 2YQ3A 1CVJA 3DXBA 4DJBA 4DL2A 4PQUA 2C42A 1S10A 1T9UA 5J2NA 2XMTA 2V8HA 4P74A 1YJTA 1U48A 3MOZA 1YKWA 2RIJA 1R3NA 3R7BB 2JSXA 1Y5LB 4KFBA 4RW8B 1MWQA 1PG5B 2KT3A 1SVDA 1Q8IA 4DSLA 2CKWA 2UXCF 7AT1B 5HBMA 2HHVA 2P6TA 2XZWA 3P5TL 1VFJA 2IVYA 1JQGA 2Z2YB 1SKUB 1FD2A 3FZBA 4ID5A 3SSRA 2JZ5A 3JB9k 5IV3A 5GAGI 3TUZC 4QBUA 3CD5A 2MZSA 1UWAA 2RDIA 4RW6B 2DXEA 1BQXA 2E5IA 1IKXA 2VBWA 3LP2B 4QR1A 3S01A 2XZTB 3O5TB 5EWGA 1EQMA 4F0MA 1X0FA 1H38A 1N33F 2EWHA 3RB6A 3CDEA 3CD6S 2KO1A 3A8JA 1RTZA 2X51A 3IRWP 2PI5A 1KTVA 5DZ6A 2YVSA 3QRQA 4USMA 5E2QA 2HPUA 2DHAA 4QYZK 4X4OA 3DLKB 2RVJA 3R6GB 5HO4A 1KS2A 2C3YA 1XNQJ 2F8HA 1PIEA 1Y11A 4FNHA 4PG5A 5DZ7A 1RHJB 4B08A 3A1YG 4C97A 4CTAB 2HMIB 2CPDA 2DB1A 2J5AA 2CQ2A 4CNZA 5D3GA 2MEWA 1M5KC 4LFBF 2A6MA 5KG6A 2DNLA 2FC8A 2RS8A 3TA2A 2A6OA 1PYOB 1F9FA 2GIQA 5KT6A 4PYDA 4LRCA 5GAHI 1WHWA 2I5JA 2O66A 3IAS9 4RW6A 1QD1A 3TVYA 3H4DA 4EZ6A 2DRAA 2XS5A 3ZZRA 4QR2A 3CW2C 4FNIA 3M9MB 2AJQA 1CQMA 2D41A 4ZPCA 1IJFB 1HNXJ 4B3SF 3OD2A 4CH0S 5FDLA 4CYUA 1ZTWA 2CNKB 2EC0A 4NA2A 1IVZA 1R8HA 5LSOA 3DLHA 2CQPA 4WFXA 2GIRA 5IOLA 2NPFA 3ETMA 5DDPC 3BO2A 1S0MA 1S1WA 2YWGA 2VJUA 3NNCA 4MTPA 2GO8A 2VC1A 2DKOB 1TMJA 3MM7B 1WI8A 2DNGA 2ZH9A 3GCXP 1LWXA 3V2UC 3THVA 2OO4A 3ENVA 2DGUA 1LWFA 4KKOA 1H98A 2AJFE 2LVWA 2KG0A 3M6WA 3PX0A 3OSPA 2KXHA 3JSMB 2EPIA 3OFFA 4X4SA 2HFOA 5IC6B 4DV5F 1Q8BA 1IKWB 2KHDA 2FQQB 2RKIB 2AQ4A 3TAMA 1HNWJ 1RT6A 3EGWB 3CF5Q 4LF6J 4ILMA 5B09A 4XAKA 2UXBF 3GCWP 4USWA 4CLSA 5F8LA 4K2JA 4CYUB 5AE1A 5FDLB 4ED3A 2KDOA 1N8RT 4V19X 1IM4A 1GMUA 3V5RA 2R7UA 4YB6A 2VJVA 3QRRA 3GIRA 3I32A 4EMDA 4KHPJ 1Q5VA 3PO5A 1QM9A 1JX4A 1FXDA 2B56A 2RD5C 2M3DA 3DDNA 4LSZB 2XB2D 2OPQA 3J7AN 3G8QA 5HMZA 4F2RA 3BSOA 1PILA 2QFJA 1RT4A 2F8MA 1NMEB 4V19J 1T95A 2EI5A 1NZ8A 1N32F 1HWIA 5DRKA 3GONA 2UXDF 3TZWA 2RRBA 2OSQA 1VRQC 2WSCC 4O0NA 2LECA 4ED6A 1Y10A 1N48A 5KFDA 4HHHA 3A8IA 4ANDA 3TQEA 3G6XA 4QWEA 2V34A 4M5MA 4F3MA 2E9TA 5BR8F 1GAOA 1A6LA 2YNHB 4MKAA 4BC7A 4YOEA 4RBTA 4IKAA 1TUWA 3MECA 1MSWD 2POKA 3R8YA 1K73T 4O3RA 1TL7A 2YH0A 4H4OA 2ZOGA 2FC9A 3DOLA 1KTQA 2YKNA 3QWPA 3T3FA 1HQUA 4TU7A 3NL0A 4KY3A 1SIZA 1KFSA 1B7FA 2ZKUA 3O6QA 4JI7F 4HDHA 1D8ZA 3CCWA 1YBTA 3DKDA 2MHEA 4ZPVR 1FF2A 2AEFA 4ZPDA 4CO3A 5FLXY 2JEFA 3L4BC 2XO6A 4ZPTR 1Q79A 5F41A 3QO9A 1T9TA 2AEMA 1MU2A 4DL4A 2IIHA 3BBBA 2B3TB 4ED2A 2YNFB 3KK2B 3M8SA 4X66F 4WKYA 2KL8A 4ZPAA 5LT5A 1KQGB 3LAKA 3T5HA 4JV5F 2I9SA 3OLAA 1HBMB 1WWHA 2XC9A 2AGQA 5E41A 3MCNA 3BM7A 3OL8A 1AT1B 3GFYA 1HW8A 3VAHA 4N41A 1U26A 1OPZA 3IR7B 3I31A 3KNGA 3AOBA 2CQGA 1WHVA 2GVZA 2H65B 5KFRA 4HH1A 1UJ5A 2HHUA 5E5NA 3DOLB 1Y0HA 4WU2A 1X4BA 2XGQA 2GC8A 1GNKA 4NL5A 2KTQA 3SEOA 2EVZA 3FSXA 4YS2A 4NLVA 1X5TA 5JXSA 2C22A 2BDPA 2DGSA 1SH2A 5DS7A 4QYZJ 3DU6A 1ACMB 1X5SA 4K0KJ 3MTJA 3LPYA 4TY8A 1RAGB 1X5OA 4JI5J 3M8YA 2HYIB 4J9VA 5ETLA 5F0UA 3ETOA 1K47A 2M9KA 2OP5A 4EFAC 3BEGB 1OWXA 2MKHA 1FKOA 4OZLA 3CJKA 4NLRA 5GAEI 1HBMA 3FC9A 4WP3A 4TU8A 1P9YA 2HHPA 1R8AA 3L09A 4JOUA 4A46A 1XMQF 4KPYA 3DRXA 3MR3A 4LT6A 3EPIA 4PPDA 1NLKL 2DH8A 1RTHA 4UZBA 4PWDB 5T14A 2GVZB 4OI1A 3VF0B 1W7WA 3ZXWA 1Q16B 5AXLA 1T0TV 5DDOC 2OGUA 1ZETA 1CEZA 2P9CA 4OX6A 2XLKA 1RT5B 1RT7A 2ZH4A 2HQDA 3GV7B 1K8AT 4OX9J 4DPYA 1DFDA 1R89A 2CJ9A 3ZO7A 5IXUA 3POTB 3F0NA 4FS2A 1U1NA 2PI4A 4BS2A 2DEIA 3QAUA 2R2SA 4ECVA 1UWBB 3HPOA 1NK7A 2DIUA 2V2ZA 2VFVA 3TEHB 4DR7J 1VQSA 4HEA9 3BO3A 3PYFA 4JYAJ 1QY7A 1TKDA 1QSLA 4J7CA 4NLXA 2F4FA 1BE4A 3BH6B 1RBLA 4E98A 1WUUA 2W24A 5J2PA 3DMJB 3VZHA 1RJJA 2G0CA 1VR6A 4WYWA 4CWBA 2MSTA 2D3UA 2N7YA 4W90B 2HNZB 1WD6A 2K2PA 3MEEB 4USTA 1HNVB 1RQ0A 1T9VA 5ETNA 3PW7A 3AHPA 4NASA 4CDIA 2RRAA 7FDRA 4O44A 4BC9A 4F36A 3MZIA 3G8TA 2C1EB 2H5JB 2JOQA 2GV1A 4ZHRB 4OYIA 1QUVA 3G87A 2EFOA 5BYQA 1OQ6A 1EAYC 3I5CA 1WG5A 1KOOA 2W1BA 5DGAA 1VBYA 1FJGJ 1RBOB 1Z1ZA 3T9NA 3TUJC 4DV5J 2FPHX 1MMLA 4ZCLA 2WSFC 3DGPB 2YH1A 1VQ7S 4A4JA 5GMEA 1PJ7A 1U1PA 3M1VA 4RW7B 1IWAA 4DUTA 4J9MA 3PCOB 2FZGB 2YX1A 4ECXA 1K0VA 2QA4G 2YKMA 2NZ4A 3IWLA 2BJ1A 4YB1P 3CCVS 1EKRA 2BV3A 4NI2B 4NA3A 3TJAA 1S4EA 4LBPA 3UR0A 3KLGB 1ZH5A 2IDLA 3HSJA 1IKVB 3FEZA 4OZ1A 3KLFA 1FA0A 1OYDA 2UP1A 3K0JA 4QYRA 4F4AA 1HNVA 1RP5A 3R5AA 2VG7B 4OLPA 3CJ5A 2RQ4A 1C2PA 3OR2B 5A76A 1S76D 3AH6A 1C1CA 2DNRA 4M8LA 3CPWR 2D3ZA 2J0WA 1FI4A 3H42A 3N4WA 3Q8VA 5K9FA 1S97A 1B3TA 4USKA 4EUVA 1AFIA 2QEXS 2MY8A 3C16A 4PQAA 1X4AA 1U1LA 3NGUA 4DZDA 2FHKA 1RTDB 1VQ5S 3MMCA 2CJKA 2ZH5A 2HHTA 5IT9Y 2D7SA 1CJUB 3PKYA 1S49A 1U1QA 1ZZFA 4OYZA 2ZBIA 4URQU 1VBKA 2VL1A 1IQZA 2CZVC 2QTWA 4C6AA 4WCEQ 2R2TA 4CLYA 3HULA 1MNEA 1FRKA 1VBZA 1RE1B 2WB4A 3GB0A 1Q82T 2KVQE 5KFTA 2VH7A 3DC2A 3ENAA 4QZVB 4MKYA 2EBGA 5B7WA 4RNOA 1JB0C 2IM0A 4KPCA 4R0JA 2HWTA 4ILRA 1V3SA 1RKIA 1SJ4P 1OIAA 2W2NP 1UFKA 5H9FK 2B9YA 2MSSA 5KFBA 2QL7B 4DPOA 4HLBA 2YXLA 4MYTA 4PR6A 2K06A 4QIGA 1HPZB 3M30B 5BYRA 4A8YA 3ZTSA 1S1XB 2FB0A 3V6DA 2QLBB 5D0RA 4K7QA 2AT1B 3MAAA 3KK3A 3MEDB 3TNVA 3EXYA 2X3DA 2HQFA 2JVOA 2ZH1A 2UUWA 4I0WA 3HHKA 3NNHA 2ZJPQ 2DRBA 4Z7YA 4FF3A 2L9NA 3QAEA 5KOXA 1R8PA 1NB7A 4TQSA 4PUOA 1SB6A 2IMOA 3BDPA 1BY9A 1AXQA 3DRRB 2VKRA 1KQFB 1VBXA 3OUYB 4CLTA 2UXBJ 2DCUB 5A8WA 4DWIA 1UVLA 4PXBA 4DOZA 2GO9A 1RWWB 4ICLB 4OZ5A 5KFAA 5LSLA 3W5XA 5B0CA 2X1AA 2HS4A 3BBFA 3N6MA 4FPRA 3ADAC 2DGOA 2MYFA 3D6FB 4CLWA 4ES3A 4TXSA 2NR0A 4B3RF 5D4PA 4K2XA 1OPIA 1VQ4S 2BE2A 4M5HA 4ECRA 3UFCX 1RYRA 4DR3F 1FVSA 1HPZA 3M30A 4NMXA 4Y2CA 5CCMA 4FPIA 2LMIA 3W9HA 1O6XA 3LA0A 3OTOJ 4ZN1A 5KT3A 1N54B 4RBVA 4B9NA 1FWKA 3RW7A 3V6DB 1LV5A 3GYNA 1CG2A 4UT4A 1E6YB 5CABA 3BGUA 2QX0A 2XWXA 3QQCD 4RR5A 5I3PA 3UWTA 1YJWS 2ZM6F 1FK9B 4UUXA 3D3CJ 1NK4A 2Z8QA 1NJZA 4TVAB 8RUCA 1WHYA 3C6TA 4Q43A 1IKXB 3A8KA 4Q45A 4F4ZA 1JXLA 3ET6B 3ISNC 2LCWA 3AODA 4OMFG 5CA5A 4YR2A 4DFJA 4JI0J 4OHYA 4QCLA 2UVRA 1WNEA 1RCOB 1B0PA 2HRUA 3LWLA 2V9WA 1RA7A 2W01A 1IR2A 1Z2LA 1B7YB 1X4DA 2PDAA 2IFXA 3BN7A 4LRFA 4OI6A 4WFZA 2OPRA 4QIWD 2V69A 5J1EB 4X64F 4DV3F 4LIRA 2YWWA 3P45B 3PIOQ 3R1LA 3DFEA 3QJJA 2IM1A 5LXRA 4G3IA 3SQGB 1S79A 4JUZA 3OR1A 2J9DA 4NLTA 5D3GB 4ZVQB 1L3SA 1E6YA 4A8OA 2OHDA 3CSKA 3OXGA 1HHSA 2GMJA 4QIVA 1NSQA 3LAMA 5KG7A 1QE1A 1FK9A 2IRXA 4IH6A 1VMBA 2WOMB 1C4AA 4IYQA 3TUIC 2AYGA 2I5JB 2WVEA 4NYPA 4OYWA 3R27A 1MLAA 4PG7A 3C6TB 4P2XA 2IMWP 1VC0A 4C4WA 3MPDA 1RUSA 4DUZF 4X4VA 1SJFA 3CTRA 3NGRA 1S6UA 4HYKA 3U7JA 2BANA 4L73A 1NH8A 2EG1A 4ANEA 5J2NB 4BDPA 2LYVA 1YBUA 2IJRA 4KE5A 4A8XA 3QJPA 1S1WB 2QO3A 3WQPA 4KFBB 2DGQA 2DXFA 1P6TA 3MM7A 2VPZB 2Y0BB 3PNIA 2BUNA 1WTFA 4I2QA 4KT0C 4WYLA 4DZ6A 5KFJA 1SC6A 1SIWB 3MOJB 4F02A 4YN3B 1AZSA 2LFVA 3TA1A 4C48A 2AHOB 5HQMA 3BSCA 3LP1A 4KKOB 3QGIA 3EGVA 1VQNS 3GFZA 5CZXA 4MYUA 3W8PA 1LNQA 3HHDA 4U8VA 2D3O1 2Y3YA 3OFHA 4ID5B 4I67A 3HFVA 5KAKA 5J1PA 1E6VA 1BMQB 2D69A 2X3GA 4ED4A 1IKWA 2RU9A 4IFYB 3T1AA 4KO0B 2KRBA 4MKBA 2AX1A 1S48A 1RT6B 1U0HA 1UL3A 3PG9A 1RHKB 1M5PC 1ELOA 2UZAA 1S99A 4WTYA 4PRFA 2RU3A 2YNIB 2AJ4A 2NZCA 3TO8A 3JAMY 4OJHA 4LRBA 4QJVA 3EUNA 1MW7A 2FZKB 4C8ZA 1YBAA 3QLHA 4A8FA 3DLKA 4A8MP 1FRHA 3H59A 2WB1D 4O0IA 2GGPA 3BYPA 2JFDA 4DQQA 3GIKA 2MJNA 2ZDOA 2EFQA 3ZFVA 5HROA 1PGZA 3QT7A 2LQ8A 4I7FA 2Y8WA 3JTPA 2AX0A 1X4FA 1WDDA 2E1PA 3IBFB 3VAGA 1WOOA 3UDCA 2ZZMA 4J9SA 2MPUA 1DTQA 1K44A 1RI7A 2KYZA 5KFMA 1SKSA 4ELTA 2N82B 4LF5F 4J91A 4ENOA 4M63A 2IRUA 3MFHA 2DNZA 2ZUAA 1IBMJ 2GAHC 1M5SA 4P10A 2IYGA 2NLWA 4IFYA 2H1YA 1JMTA 2R7VA 4WPAA 2HWIA 1J27A 1J5OB 4LVNP 4ER8A 5ETSA 4CNYA 4R25A 3GJQB 4K4SA 3CO9A 3MEGB 5HMYA 1N32J 1FRXA 4X4TA 1X4HA 2HLTA 2B8PA 3I0RB 3EWGA 1TAQA 2QIFA 4ED1A 4KR0B 2UU9F 4USJC 2CQ1A 2XMUA 4DUYJ 2I2YA 3QWUA 3BB5A 3EE3A 1I1GA 1SPBP 1X4GA 3GP9A 2L41A 1HQUB 2LU2A 2DR9A 3IG1A 4LF9F 1S6PA 2GHWA 4DV2J 2KFYA 2WW8A 2IBOA 3H90A 3MR7A 3R3TA 3GJSB 4NYZA 4PZVA 2BJDA 1R31A 9RUBA 1KC8T 4GKKJ 4YR3A 3N79A 4OX9F 2FHJA 3BGRA 2XY5A 1CJKA 3VCDA 3JSMA 4IO1A 3UPFA 2VD3A 4K4YA 4PG6A 4JV1A 1JLGA 1KVKA 3Q83A 3UN2A 1H7WA 3W8GA 2MXYA 3GIJA 3PVXA 3J7YI 2AIRB 2JH3A 3PYGA 4RBUA 1HIYA 3TAMB 4E2FB 1J5OA 1NEEA 2XYGB 1R8BA 3FCVA 2R7TA 3OHBA 3BO4A 1VRUA 4BBYA 3R2CJ 4USIA 4F4YA 4NLGA 4ZK7M 2PD1A 5A8RB 2M7SA 3MGJA 3UDEA 4LSLB 3IWXA 2R7RA 5C2CA 5T41A 3ZTRA 1RWKB 2RS2A 3QIPB 5C42A 2IC3A 2DGWA 4NRUA 2OPQB 2RJZA 1IBKJ 3IBWA 1S6PB 2HW3A 2JC0A 3U1LA 5HN0A 2B9XA 2QL9B 1A0OB 4OYBA 4QW8A 1L5UA 3I4PA 1FNMA 4GVLA 4KTQA 4JV0A 2GQCA 5AXMA 1YRXA 5HP1A 2M52A 4RW4B 5I3QA 3T5LA 4M5JA 2CPYA 3OFEA 4AE5A 4K4UA 5HSPA 4JI3J 2IVMA 2WVFA 4MK7A 3KNAA 1S1UA 3O44A 5E3QA 3A3PB 2E1MC 4AYBD 1G7CB 3NBPA 3AJDA 3O1LA 1PAEX 2N4DA 4OYPA 4U7CA 4F4KA 3IS9B 1X31C 5KFKA 3GIMA 3G6VA 5EN1A 1VRUB 2GZOA 4OHZA 3NXZA 3BSAA 3FBCA 3FBBA 3R5CA 1XMOF 3OXLA 2PN6A 3BGLA 4RX6A 3ZC4A 1S72S 4HI2A 4EYHB 1T02A 2YNGB 2ZHAA 5MLCV 1M1KT 4C8LA 5KG3A 2IC3B 4DUZJ 1RT7B 1RT5A 2EBEA 1VI7A 1DLOB 2KKHA 1XIQA 3DXSX 4LJMA 5DM7Q 1H72C 4DL0C 1OS5A 4ZIWA 1D9DA 1EETA 1JKHA 4DQIA 2RHQB 1UWBA 3JTNA 3CCUS 5GVQA 1FCAA 3IA0A 5HP1B 4P52A 3R2DJ 4LFCJ 4L75A 3FBEA 1RWNB 1MU2B 3T1HF 4PG8A 3KUGA 3ZTQA 1GMVA 3IGNA 2CXEA 2C2MB 1NSAA 3NOCA 5GADI 3QSIA 1U1OA 1YJ9S 1XQIA 1KOHA 3NBPB 1M1HA 1YJRA 2B5JB 1Q7LB 2MQMA 3DOKA 1IQTA 4J9KA 1O0PA 1YVFA 1NDLA 4L3KA 1WORA 2H4YB 4AXIA 4RNFA 2LA6A 4F0HA 5IT0A 3LANA 3LF0A 2JEIA 1RKJA 4P75A 1SQFA 3BV8A 4AT1B 1UVMA 4P2SA 1FWLA 3CDWA 4EK2A 3J80U 1HHTP 4B3TF 1SV5A 4RZRA 2AYBA 2MJUA 5JVHQ 2FVQA 3OSNA 4NXMF 2FJXA 4MT1A 3CNQP 2ZITA 1N52B 3QATA 5U47A 2DHGA 1EARA 5D15A 2NXEA 5CD4H 2R2RA 3DRPB 1U4BA 3M1VB 1S6QA 2P2CB 2AJ2A 2VKZG 1ZA1B 1XN9A 2KB2A 3P3DA 4RW7A 3MPYA 2F4VJ 4DR7F 2RDJA 3AJ1A 2IY5B 1HWLA 1RT2A 2DRDA 2MB0B 1FEEA 1S1VA 4EI2A 3C46A 2XLIA 5AJ3F 1SJQA 2QFIA 5LMNJ 4DFKA 3M7VA 3KLFB 3V81A 2ZE2A 1NO8A 4DV6F 1UP1A 3FSIA 4P9SA 4D3GA 3VAFA 1QSSA 1X4CA 1WC1A 4RWWA 1ZAXA 1PYSB 4P71A 2VG5A 1ZZNA 4F2SA 5DJBA 1C1CB 2CADA 2G2YA 3QGPA 4LFAJ 1XTZA 5THWA 3CC2S 2ZBRA 4HI1A 2RMLA 4ZOSA 1KHVA 2BE9B 1RISA 3MMJA 4Q0BA 3UE2A 4OV1A 5KG4A 3RW6A 4CLZA 3ITHB 1U49A 3MMCB 2BJEA 2MTLA 2R7QA 3RRGA 2BEFA 2DITA 2QLJB 5K14A 4M5IA 2F9DA 2CVEA 3BPSP 5EX0A 3J7ZT 4M5NA 1RT2B 2E29A 4Y0FA 3NY0A 4FBTA 4DV7F 3NS6A 2U2FA 4QQBA 5IV4A 5GADU 1TV6A 3EDQB 1NJXA 1VQKS 1XNRJ 5KFOA 1OY9A 2PE8A 4FXDA 4WWSA 3AXMA 4DCOB 2V2VA 4DR5F 1ZBTA 2V94A 2QC3A 4ZLPA 4K0KF 3R5BA 5ETPA 3GZ7A 3TI0A 4QU7A 3HVTA 3NWRA 3QZ7A 3HHLD 5LL6d 2LKZA 1NBEB 2E5GA 3PX4A 4DCPB 4Q0BB 4ED8A 3EGZA 2YWFA 4X2BA 2GA7A 3MAAB 3MTKA 3KK3B 2GIFA 4QIEA 5A0YB 2ZH2A 2CPXA 2NREA 2ASYA 3IRXB 3AD9C 5FJ4A 5C2GA 2BMBA 5B0DA 2G2ZA 2A2CA 1NKCA 2WVCA 3ILIA 4Q44A 4PUOB 4NI2A 3KG1A 2HS0A 1XK8A 3CD0A 2FDNA 1IN0A 3VQSA 4FXWA 3OUYA 4KH1B 4O3PA 5J2MA 3N6NA 3OVSA 4U7UD 1EP4B 3WIVA 2LQ5A 3M2RA 4DS4A 3F56A 3CULA 2HFUA 1R0CB 3FSYA 1Q8KA 2HVHA 1JWWA 3J7Z5 3FDSA 5D6GA 1HBUA 1M5VC 1VQYA 2KZZA 1X7VA 3NCQA 4UOCA 2KHCA 2R42A 4Q5VA 1JNZB 3QT8A 2OEKA 3HJVA 1S7HA 3TX8A 3KHLA 2LDYA 4LF8J 3HCXA 2G0JA 4UOHA 5KFLA 4U67Q 2HRTA 3KMQA 5F8GA 3NP5A 2V8VA 5A0YA 5JMNA 3QJLA 4C0BA 5D4OA 2W4CA 3CMQA 3CJRA 4D3HA 4ETZA 3B78A 1NHVA 1FDBA 2VF3A 2H48B 2HNDB 3G86A 4ZPBA 2KVIA 2RUGA 5KG2A 2QA4S 4ERDA 3PIPQ 1R0AB 2QV6A 3H5UA 4DV6J 1XERA 3BGFA 4WKRA 1HQEA 4KRWA 2HNYB 1VRTA 1XMBA 5LXYA 3RBXA 4KGZB 5J2MB 3CCQS 3K57A 1KDNA 1FFWB 2QSFA 4DN9A 5L46A 1JK9B 2OPRB 3PEHA 3VHQA 4DV2F 1N0UA 4NWBA 3UD5A 1LW0A 3VVTA 2MQQA 3MR2A 3R1HA 4B3RJ 2OKQA 2G0IA 2C2KB 2OPSB 5EUHA 2CAJA 2E5JA 3KLEA 2VQFJ 4KBIA 1F0XA 2KI2A 3JSYA 3WBZA 5KT2A 5SZTA 3RB4A 3PRVA 5DG9A 1Q7YT 3G71S 4OX8A 3DRSB 4FYDA 4ZVHA 2HHHF 3R6LB 2WCXA 1U2CA 2FGCA 2HFSA 2HNDA 4WXOA 1F5CA 1M1GA 1S6OA 2FLLA 1HMVA 4L74A 4O3SA 1Y7PA 2KM8B 3C6UB 3PEJA 1P27B 4PWWA 1CULA 3N5FA 3MFIA 3D2WA 3AQPA 2UUBF 1XJWB 1VRTB 2L48A 3HSGA 4ELUA 1JJ2R 1M5HA 1MROB 1YDLA 4QIFA 4X4RA 1SL0A 5LMUJ 1FTCA 2FLPA 3MCSA 4ED5A 4M5DB 2MZQA 1GT8A 2HAIA 2VC0A 1GFWB 2N3LA 2WAQD 2XMMA 3HHLB 3QRPA 2CQ3A 1XMQJ 3GFHA 3H2VE 5KFCA 1QTNB 2H51B 2LXFA 7FD1A 3EDRB 5HMXA 2BE2B 2FUG9 5KFHA 1LW0B 3KJNB 4I2PB 4ZVEA 4ZVRB 1KP6A 2COLA 3LUYA 2HIQA 2YWEA 3D0HE 4I2QB 3WDOA 2YKPA 1UAWA 3QFWA 4O3NA 1S7IA 1PAUB 4AQYJ 2VG6A 2BACA 2R8HA 1S12A 3RUBL 3TZYA 2MZ1A 1T05B 1TFWA 1JLEA 2EXUA 1EB0A 3KMSA 1ROFA 2XMVA 2A18A 3RBZA 3ZNJ1 1NK6A 3MPWA 4MFBB 2AF6A 2CA9A 4TYAA 3TVZA 2QLWA 4ZVSB 3UQSA 2CJAA 3AA8A 4X66J 1NPPA 3C6UA 2HVEA 1T3NA 2RE1A 4NLOA 2PA3A 3ET6A 4M5LA 2MDAA 4CH1A 3PW2A 3TW0A 4DR4J 2HRYA 2C2ZB 2C28A 1QVGR 2YNIA 2CPFA 1TU0B 3SSQA 2ACMA 3I9ZA 2CJBA 2CQCA 2CPEA 2M8DB 3DLLQ 2KH9A 1FRLA 1Q1KA 3M6UA 3QLHB 5KFNA 2AW0A 5L1LA 4W92B 2HBYB 5H1SV 3CDUA 8AT1B 3K8WA 1KQSR 4ECSA 2DPJA 3QT6A 1AA1B 3PHEA 2BRKA 2GGPB 3GU0A 4I1TA 1VJWA 5G0RB 2XGPA 2H5EA 1HR0F 3E2EA 1WKLA 4AFFA 1RYSA 1IKYA 1I51B 3DI6A 3H98A 5IQQA 1T05A 4QWBA 2OELA 1RT3B 2M5YA 2PT0A 3JS9A 2Q66A 2PGCA 1TFYA 2XY6A 1SCJB 1X0PA 4MFBA 4DR5J 3B8HA 1KWMA 2SXLA 1Q81T 2HQ3A 3H2LA 4PKDB 1MWZA 3H0PA 3N0VA 1TTHB 3KHHA 1N36F 3CUNA 1EIYB 1N4LA 1XEZA 2ACYA 3LALA 1UW4A 3E3XA 4RKUC 2AYEA 4CLLA 4DL6A 3ZZOA 1K1SA 2J8SA 4DDFA 4J9LA 3EGNA 2XMJA 2BANB 1AUSL 2ADBA 1UEUA 3HVWA 3I56S 2LXUA 2OUGA 4NPOA 1RADB 3W5YA 1JLCA 1LFPA 2V9KA 3OHAA 4J9UE 4EBEA 2W2MP 5CH7B 3I5BA 3SBMA 1HYSA 1CLFA 4U6PA 3M8ZA 1IBCB 2HS3A 2HVIA 3O8WA 4ZP9A 1HBOB 1GTEA 1LKZA 1Q0NA 4OYXA 1ITPA 1CBKA 2ZJRQ 1WSRA 2ASDA 1AZSB 1JLFA 1TKXA 3M8RA 4ETXA 2ZWOA 2VUGA 4AQYF 2V8DA 3BGRB 1QVFR 1G1XA 3M8PB 2V2KA 1CJKB 1HBNA 3AD8C 2ZD1A 3Q8RB 1VC5A 4IQMA 4ZJQA 3PR4A 1YLXA 3NS5A 1EHWA 2HVZA 5D0GA 3W62A 2CQIA 4K8RA 1H74A 2DNPA 2HZCA 2BX6A 5DO2A 2CG8A 4KO0A 5LMUF 2B51A 1RSCA 3L95X 1NDPA 4DR1F 3AD7C 3W9JA 4XPCA 1KHWA 1SXLA 5I4MA 3Q2SC 3KHGA 2BW7A 4ZP6A 4AL5A 3MECB 1CJVB 1JLCB 2Z2MA 4H4KC 4O23A 4QWAA 3GQCA 4ECUA 5CYQA 2ABYA 2BM0A 4NXNF 3VAMA 3THTA 1Q5YA 3EVOA 1TVRA 2ZH6A 4FP9A 1U6FA 3BREA 2ZOFA 2UU9J 3M05A 1YJVA 3GMGA 3MDFA 4F67A 3VAKA 1JLFB 1TKXB 4KB7A 1D3WA 2BZ2A 2XO7A 2F8EX 3SFGA 5F8MA 3M8PA 3GIIA 1S9FA 2HG4A 5CXTA 2ZD1B 1BLUA 2KT2A 2VFTA 4NMLA 5F9LA 3OJSA 3HT3A 2XI3A 4R8UB 3GTYX 1WC0A 4TNOA 1Y9OA 4JI6F 1TUVA 2CPIA 2JNJA 4LMZA 3BQ0A 3N5BA 2HFNA 5E7OB 3HSZA 2O01C 4WP8A 1GH8A 2DNHA 2I38A 1NPKA 1C0UA 3D6HB 1DQAA 4NCBA 1CJVA 2F3JA 3QMQA 4OJ1A 4C0HA 4PG4A 1KSPA 2IBKA 3PR5B 3GG1A 1VK8A 2UUAF 2QGFB 2YNGA 3D6MB 5E3PA 5KFXA 2E5LF 3R9LA 2J8AA 2F1FA 2B43A 3IG1B 3N6LA 4IOCQ 3KLIB 2FLOA 2VZ9A 4ZKAA 2OD4A 2EKYA 3CEDA 2AJ1A 2DJWA 4LRDA 4EZ9A 4DQRA 1W26A 1YZ6A 4PEOA 2WBMA 2Q6BA 3NCPA 3NCRA 4MIWA 4P2MA 4P6QA 2WSEC 3PXGa 2CQBA 4E0DA 2ZH3A 2V4JA 5L1IA 3D3BJ 2C2EA 4WIQA 2ZFHA 2XZDB 1FFGB 5I3UA 2GCFA 1FKOB 2B5JA 4KSEB 3CJKB 3T1YJ 1T9XA 2VQEJ 3G4SS 3RAQA 2AP6A 4JI4F 4WXWA 3D1HA 2Y1JA 2VICA 1V5VA 4NE9C 2FZCB 3ZZPA 4ZVPB 2J0QD 2AZ3A 3MD3A 5GMDA 1T8EA 4B9TA 4X84A 5A8RA 2MLYA 4ZLLA 1RTHB 1KRPA 1F60B 3DM2A 1T9YA 1XNRF 4GO5X 4A8KA 5CQGA 2DR8A 5C42B 4AL7A 1TK5A 4HTIA 5FLXU 2E5LJ 2ZH8A 3RBDA 1ICEB 3KLIA 4UOGA 2B0GA 5M2PA 1FNXH 4NEZA 2MKSA 2BJ8A 1KONA 1IBKF 1LK5A 3M9NB 4RW4A 2PIIA 3RZAA 4IO9Q 1NKBA 3AY0A 1T03A 1EX8A 4DR6J 3H4BA 1HWJA 5IM0A 1MMNA 1YWXA 3SZ2A 2BJ7A 1U0SA 1F9HA 4USHA 3RRHA 2EK6A 2C2DA 1S1UB 4J90A 2X7IA 4RNHA 4CLFA 4U8YA 4CI0B 3DMJA 4DV4F 2CQDA 2W4PA 3TANA 1S1VB 3W66A 1F1BB 1I94J 5D78A 4RU2A 1D8YA 4P72A 2N3OA 4ZMMA 2HIYA 4K5RA 2ZE2B 3A3NB 3AFGA 3V81B 4LVOP 3V4MA 2BQ3A 3JQKA 4KGMA 4JI8F 4OHXA 2HEKA 4Q2MA 3BJYA 1UA0A 1N6QA 1FESA 1LWCA 4HVZA 1RAEB 1UVKA 4NX9A 5ETKA 3WHIA 4F0KA 1KLNA 2OH2A 2PC6A 2YWKA 3FKBA 1PJ5A 2MHNA 2OD6A 4N5SA 2BA9A 4DQSA 2JC1A 2DH7A 3PW5A 2VONA 4DXLA 3VGVA 2EEYA 4CLKA 2N7CA 2AYMA 1C0TA 1F5AA 2X1BA 1DQ8A 4Y00A 3CC4S 1QTMA 3ENWA 1HI1A 2DK2A 4OZ3A 3X3UA 3JAMU 3KJVA 2QA2A 1B4SA 4BWMA 1HNZJ 5T7LA 2V8GA 2PMZD 1T03B 1NU4A 2V5HG 1HNWF 4NEYA 2QN6B 2R7OA 3OVBA 5IWAJ 2UXDJ 4YB5A 1GX5A 3EM1A 4J9QA 5K8NA 3M32A 1S9EB 4DLEA 3MAHA 2D3OR 3DLEB 3UCGA 4C11B 1TV6B 4L3NA 2G13A 2C2OB 3OXFA 5CHCB 3SI8A 1JNRB 1N0VC 2VG7A 1FDAA 5HATA 4NCGB 2H9ZA 4G1QB 2FHJD 4I56A 1IR1A 2RDDA 5KFFA 4RUCA 4C0OC 1WC4A 2HHWA 5JVGQ 4FZVA 3G82A 3JSRA 4IH7A 1ZM4A 3FBFA 3HVTB 1FWPA 1VQLS 4DLGA 1Q53A 4ZLJA 3FQKA 2NUUG 1FE0A 1HNIA 1NM2A 1RWXB 4KHMA 1H2VZ 1G3OA 1WEZA 2XSFA 4P2FA 3LQVA 5HAOA 3U1NA 1HNXF 1CJUA 4OI3A 4B3SJ 1P1TA 3NOGA 5F8HA 1A9NB 2DT9A 3IFEA 2HFVA 2NSBA 3A8EA 4HT7A 1P9QC 3KDNA 4DL7A 2R7SA 4LF7J 3CB4A 4J5OA 1IXKA 1I5OB 1S9EA 4YDXA 1LEOA 2HGLA 5M2RA 3SCLE 3SIPB 4Z37A 6AT1B 2LEAA 1L3TA 1AB8A 1FKPA 2LQ9A 3DLGA 3OFGA 1HW9A 3DRYA 3J7YU 3F73A 2RILA 3DN9A 3QZ8A 2ASLA 1XBWA 2WONA 4JV5J 1VQPS 1EP4A 1ZOTA 5EWEA 5L1KA 4DX8H 2ZJQQ 3UCUP 1U1RA 3RRKA 3MM5B 4NCGA 1RWOB 2EG2A
chains in the Genus database with same CATH topology
2BBEA 2VG5B 4I6AA 3DNCA 3HHLC 4NZ7A 2BR0A 3HZGA 4ALZA 3K5PA 2JRSA 5SUHA 3W3SA 2J0XA 3MMBB 1YJNS 5JUMA 3D28A 2W7OA 1S77D 1W2IA 2MQLA 4LSNB 3ITHA 3ICLA 5MAOA 2B9WA 5B08A 4ZP7A 2XY7A 1NJWA 2XNRA 4GKJF 3UI3A 2FVCA 2B7CB 2ROPA 1L3KA 5B0FA 2FTRA 5KFSA 1R0AA 3SCKE 4XIUA 1H2UX 1WF1A 3DCAA 3TA0A 1X8DA 2M4MA 1NHUA 4A8WA 2HNYA 3CCTA 3HJFA 3AA9A 3ENQA 2JLFA 3I0SA 4ICLA 2KU7A 2XLJA 2LQBA 3C3LA 1Q78A 3Q23A 1OQ3A 2GW8A 4YQWA 2OJ3A 1FJ7A 5HI7A 4F3QA 1LWEA 2HLUA 1HD1A 3FEXB 4NRTA 2AD9A 3TOQA 5F8IA 4QWDA 4H4MB 4C8YA 4HH0A 3CIZA 4IOAQ 5IT4A 4UQGA 1IUJA 1W25A 3DDKA 4N8OA 5BYSA 4IG3B 4F25A 1YI2S 3THPA 2DNYA 1N5YA 1HWKA 3P49B 3V4IB 1RDRA 1V6HA 1R6YA 2RSQA 2YKOA 3HO1A 2I8EA 2CG4A 4NLUA 5KFPA 4FVCA 4OFZA 1OSDA 4C8MA 2GQ2A 4RNNA 2J6UA 2KFNA 5J1EA 1YITS 1WHXA 3MF5A 4MIBA 5DQHA 2ILZA 1RTJA 4KAIA 1O8BA 4DN0A 4GKKF 3OTOF 2KJVA 3PZPA 1FEHA 1APSA 3MMAB 2JHEA 4KC5A 2BW2A 1ZAVA 3OPKA 5C24A 4DV0F 1FD8A 1TL3A 2CYYA 2AGPA 1A7GE 3JYTB 3SCIE 4YY3F 1QE1B 1JJ4A 3FEYB 3MXHP 1YRUA 2KRRA 3I55S 4C7QA 5KFYA 4DSEA 3HK2A 1SH0A 3VQTA 1N5YB 3V4IA 1OSCA 2B7BB 3EPGA 1HNZF 1C1BB 2Q3PA 4F50A 4X4NA 3V6HA 2WRMA 3G8SA 2R8JA 4YP3A 3BQ2A 1KLMA 2IHR1 2ZNYA 1GTHA 1NJYA 4TN2A 2ADCA 4I6WA 3BS9A 1CC8A 2FJAB 4M1KA 2XI2A 3DHWC 4TYBA 5L9NA 2E66A 3TRGA 1U25A 2W4DA 4RWXA 2OPSA 3KLEB 1VQ9S 2K7JA 3K8VA 3LP1B 3W7BA 1VLYA 1TP7A 2ZVSA 3DRSA 1TL3B 4UW2A 2MKIA 2DH9A 1U47A 3SFUA 3EX7B 5H9EJ 4J37A 1E6VB 4DR2F 1JLAB 4HTJA 1R27B 3ZZTA 2FJEB 4TU9A 5KFVA 3DLBA 1DTTA 4YDDB 2WHOA 2QYCA 1TKZA 1NK5A 1MROA 1C1BA 2OTLS 1GX6A 1C4CA 5B0AA 5HLFA 3HHLA 2OPPB 1D9AA 1WF2A 4J9OA 1N5SA 3PW4A 2UV8A 1K9MT 1XR7A 2E1CA 4I2PA 2LA4A 4Q2LA 2D9OA 5I42B 3H8YA 1RAJA 1KFDA 2QLXA 2XHWA 5KT5A 2DO0A 3FMWA 3GFXA 2VG6B 4GO7X 4WZMA 4I7FB 3I4HX 3SXLA 1YQHA 4RW9A 2NYIA 3FRYA 1DTQB 3IAM9 3CCSS 4Y65A 2XG8A 3MD1A 2VV5A 5DDQC 4J9PA 3U02A 1JLAA 2PSZA 5E3CA 3D1OA 2AWZA 2KJWA 4X62F 5CCLA 2DTJA 3DOMA 3HFKA 4C9DA 3MEGA 4X4PA 2RQCA 1JJHA 2BXJA 4C98A 4DG1A 4WU3A 1NNDA 2J7WA 2MZTA 2QMXA 4OX7A 2IM3A 5CYQB 2K7KA 2Z2LA 3UD3P 4EWTA 2XEXA 4A47A 3VR1A 4ZVGA 2IA0A 1TVRB 5EX3A 2G4BA 2VODA 5G0RA 2W8LA 2XMKA 4IOBA 1REVB 1AROP 1S9GB 3K5OA 5K8MA 2MY7A 2LEBA 2O67A 3RAXA 3NLCA 4NLSA 3D5MA 3HVRA 2DO4A 4CIOA 1VQOS 2ZZNA 3E51A 3G96A 4NLPA 1AFJA 1UJ4A 2FHMA 3PKMA 3K5MA 3W2WA 4O3QA 3QIDA 1KN6A 1JLGB 1YIJS 2NUHA 3AB4B 1VQ8S 3KOAA 5CYMA 2XS2A 3M2VA 1WEXA 4G1IA 5C5JA 1B0VA 4Y2IA 3O3LA 4CT9A 1VQMS 1RTIB 3FMBA 3L7PA 3F44A 4DMZA 4RUHA 2J6SA 4DG1B 2R9LA 1JLBB 1PC4A 1XR5A 3T6BA 4LSLA 3CCMS 2MZJA 1YTYA 5HQ8A 1LOUA 3H2UB 1S1TB 4CH7A 3SYZA 1HYSB 1CSJA 2DGXA 3NGDA 2OMLA 1BC6A 3HKZD 3NRBA 1HBOA 4NLDA 3TQ1A 2N4CA 3UDLA 3CMES 3CJ0A 3OL6A 1RWUA 5H9FJ 4ES1A 1HBNB 3RBEA 3Q8PB 2CVIA 3CCZA 1Y3JA 4PXCA 4DL3A 4OLOA 5IFMA 1AUDA 4WJBA 1YJUA 2ATLA 1T3OA 2CPJA 3H20A 5L38A 2B4VA 5CYMB 3KK1B 4DFMA 2MKCA 4DF4A 1TK8A 3KNAA 3I9V9 5B0GA 3IS9A 2GNKA 4DEZA 2J9EA 3HP6A 3MM6B 1LK7A 2IJFA 4Y34A 1FE4A 4NYOA 3ZZYA 1D0EA 4B9UA 4LF8F 3MHYA 2K8GA 4WK1A 1S1TA 4TLQA 2CQ4A 1LW2B 2DR5A 3M8QB 4O4GB 1BQNA 5KFWA 2UVUA 1DLOA 3KTQA 4IR9A 3NNAA 5KG5A 3WX4A 5AE2A 3T5KA 1JKHB 1EETB 1DARA 2Q79A 1ZM9A 3U1MA 2JEJA 2K3IA 4NZ6A 3AB2B 3RYLA 1TL5A 1QAJA 1QSYA 3Q0AA 5IM0B 2W9CA 3KWMA 4YR0A 1HD0A 4HDGA 3GE9A 1MWYA 3LH2S 4HHJA 4BWJA 1D1UA 3K7RA 4N76A 4EBDA 2F7VA 5A8KA 4MH8A 1N6QB 2J9CA 3C8YA 4C3MA 2DISA 2JVRA 4K5SA 4KQZA 4O4GA 2M8DB 1BQNB 2VBXA 1KVJA 2Q1LA 1DAXA 4K4ZA 4P7TA 5LJ3Y 1X9MA 1UEVA 3KYLA 3KJVB 2DNQA 3JTOA 4ECYA 3DRPA 5T7LB 1DRZA 1S6QB 3TYTA 1QJHA 4NOHA 3M6XA 2W9CB 4B17A 3CCRS 3SV3A 4IFVB 5I3UB 4B9VA 3VTIA 3KLVA 1N88A 3GV8B 5GMKa 3DLEA 5AXNA 3BZQA 2KG0A 4LQ9A 2M2BA 2HFZA 4C11A 3SV4A 2ZC4A 3O2IA 1XC9A 4KV8B 1NK8A 1O51A 1NZAA 4NLYA 2QRRA 5D4NA 2A10A 2E1AA 4G1QA 2VA3A 2MGZB 3OLBA 4OHWA 3I82A 1URRA 3NAHA 4BCAA 2WK4A 4MIAA 2FVPA 3ZZUA 3M4XA 3H5YA 3N9UC 2GHVC 4LIWA 3BQ1A 1M0SA 2EW9A 4CZCA 2MQNA 3FVYA 2WTFA 2P9GA 3NG8A 4XO0A 3MUMP 5K5MA 1U1MA 3ISZA 4KHPF 1OO0B 1YSJA 2PA8D 3PV8A 4KJIA 4IFVA 5J2QB 2R8KA 2E1RA 2C3MA 2L3MA 1Y5NB 2M0GB 4WK3A 3DLGB 4DUYF 1UFWA 4YEAA 3RR8A 4WE1B 4DQPA 3HMJG 2FGOA 2YKAA 1LWFB 2F40A 3FNNA 2E7WA 2LU1A 1HI0P 5ITHA 3R5DA 3KKFA 4EO6A 1WI6A 2GHPA 1U24A 4ECQA 4QPXA 1GXTA 4JI5F 2DBBA 2XBPA 4OL8A 2R8IA 1U2RA 3IRXA 5DLFA 1X4EA 3S7RA 1KNZA 3GWCA 5J2QA 1V3ZA 2NXUA 3B4DA 2ZC3A 1LXNA 4H54A 5KFUA 2XCPA 3KLHB 1RT1B 2MZRA 3GILA 4B3MF 5AXKA 5IZHA 3PACA 3DHXA 3M2RB 3L3CA 2HHXA 2FD2A 3I87A 1X5PA 3CMAS 3NMAA 2RH3A 2FHOB 1YG0A 3SCJE 4DR4F 1LWEB 1NK9A 2KXNB 3CGIA 4OZ0A 3TAQA 2FJWA 3HVAA 4PCQA 2OSRA 3DLJA 4RUAA 2G9OA 5KFIA 3ZZ0A 4N56A 1FO1A 4IG3A 3CJ3A 1KQKA 2V4QA 3IO1A 1KEKA 3Q8QB 1R43A 2DGVA 3G6YA 4YFUA 1FT8A 1SJ1A 2EFNA 3LP0A 1V3RA 2W7AA 4OIXA 3KLHA 2FVSA 2WONB 2XSJA 2W9AA 1H3DA 4WFNQ 3GR0A 3MAQA 1BGXT 1PO6A 4K50A 3S6EA 4UY85 4JI2F 3MM5A 1HWUA 3LGNA 1B64A 2NQPA 3VWSA 4E8UA 5HMWA 3MM9B 2B4OA 2Z0GA 3SSSA 4DV1F 4FVMA 4Y2AA 5DDRC 3MURP 1RTJB 1DJ0A 2LEPA 2YNFA 5K8PA 3KK2A 3MMBA 5AE3A 2CJQA 4RU9A 2BOPA 3FJ2A 4LSNA 4N47A 4CO4A 4L72B 1TK0A 2IA6A 3JYTA 2E44A 2HWHA 4OQJA 1HMVB 5F9NA 2BM1A 2K1RB 2MKJA 1FJGF 1XR6A 2VOPA 1U6ZA 2CPZA 2XSJB 3PO4A 2VPWB 4HL9A 4M5DA 4A8SA 2J7UA 3HXMA 1CPZA 4AXJA 1SBRA 4OZJA 1DBDA 4GC6A 5L9XA 3HZEA 3FFIA 4YHHF 1VIOA 2NSCA 1JLEB 1LQ9A 2DD8S 3GG0A 5KFGA 1H0HB 3CDAA 2XULA 5LMNF 2F9JA 4DHVA 3J81Y 2LXIA 3MM8B 1WACA 2EK1A 3KLGA 4CO0A 1KD1T 2K1RA 3MEKA 1F2GA 3T9ZA 1SUQA 1UJ6A 2JLEA 2ROEA 2ZNZA 3S1TA 4FN5A 4B02A 3CWJA 3N01A 4ECZA 2YX7A 2IJNA 1S0NA 4B9MA 5A2QY 4ZP8A 4IRDA 2O5DA 4ECWA 2DNNA 4LFCF 1IJEB 2JJ4D 4IQXA 4QPTA 5DLGA 5I42A 3M2UB 1HARA 3OVAA 4U7UK 4P7VA 5B0BA 1IKYB 3DI6B 5J2PB 3MUVP 3MMAA 3OL7A 1FDDA 1RT3A 1XWLA 3GSDA 3OTEA 4RW9B 4X4UA 2JWNA 1Y00A 2MMYA 3H5SA 3UR3C 2L9DA 2FJBB 2VASA 1TL4A 2RNEA 3US5A 2WBRA 2E7XA 4YB7A 5DETA 5FIIA 1FVQA 4NCAA 4WF9Q 4R5PB 1Y4ZB 3KG4A 1Q8LA 3Q2TC 2I1RA 1N5QA 2VFUA 2EFVA 2ALZA 1RK8A 3PDNA 2Y1RI 1FXLA 3OW2R 2D1CA 2EFGA 4IRKA 4JI3F 4AUKA 5E33A 2GJ2A 3P96A 2UUCF 4LQ3A 1UKUA 1FERA 4HKQA 5KFZA 5ADZA 4X4QA 1NKEA 4IDKA 4EO8A 2VQEF 1FJEB 1UVIA 3OTBA 3WC0A 4DF8A 2J7KA 3M2UA 4OI0A 4QW9A 2E9RX 2VFSA 5J1NA 2YKMB 3CC7S 2ZUGA 4I69A 3BR8A 1SKRA 4ILLA 2Y1IA 1JLQA 2FVRA 2W7PA 5F8JA 2QT7A 1UVJA 4LF7F 3IXQA 5KT4A 3OR2A 3Q22A 4ZA1A 4B9SA 1DTTB 1SJRA 1RTIA 3MR5A 1UMJA 1TKZB 2W25A 4NA1A 2R4FA 3I5AA 3GYXB 1JLBA 4JBCA 1DHMA 2OAUA 1VK3A 1TZ0A 2BQRA 1T7PA 4LF4F 3NGKA 4I68A 1U6BA 2GMHA 1VHFA 5EWFA 1HFEL 2D74B 1SI9A 3LOUA 1FKAF 1L3UA 5A6WA 2PEHA 2Z4PA 1IR0A 1JXEA 3FRZA 4NLQA 4R8UA 6FDRA 3T6JA 1TR0A 4FS1A 1U7LA 4WFAQ 5EDWA 3M6VA 3J7A1 3WC2A 3Q8SB 4ZPWR 2Y0SD 3IR5B 1U2FA 3LGMA 3JSBA 5A6PA 2QSWA 4XK8C 1C0UB 1KR4A 1I6JA 4DL5A 1FJCA 1S1XA 3ZZZA 2CPHA 3TP2A 2ZHBA 2RT3A 1NJIT 4XDCA 1F5BA 2M88A 3MWBA 1VQ6S 1TAUA 4N8NA 3MEDA 3M8QA 2KG1A 1ZYQA 3V6JA 1MMDA 3UCZP 1NAQA 1TKTB 1Y3KA 1SH3A 3CD7A 3TARA 2XS7A 1REVA 2A2DA 2LDIA 2QA1A 1QAIA 3UW1A 4URGA 1RA6A 4IR1A 5KOWA 2JLGA 4JYAF 1H2TZ 1VIXA 3FGVA 1I94F 1GXUA 1YRTA 2IAJB 2IM2A 3W2WB 4A8QA 2V4JB 4WFYA 2KYXA 5DG7A 4URSA 3SMZA 5F0WA 3M2VB 5E3RA 5C25A 3PRDA 2ZOMA 2IVFB 3HLUA 4QR0A 1U1KA 2KN4A 4QWCA 1WELA 2G1DA 3IGVA 3HI9A 3S8SA 2MKKA 2HMIA 4OHVA 3DM2B 3HKWA 4ZCIA 1XNQF 1P1LA 2ERRA 1LXJA 5G4DA 2FY1A 3PY8A 2DCLA 2OFHX 2VBYA 3M9OB 5DG8A 2ASJA 1J2VA 4JI1F 1KVIA 2RQMA 2ZHOA 4ID8A 2OLWA 3BF4A 3CJ2A 4F3OA 1TL1B 4F4WA 2YWHA 5DM6Q 2IAJA 1N34F 4Q7AA 4PQUB 3CCLS 2VOOA 4O4RA 3KK1A 2JEGA 2LLZA 1ZAWA 1K1QA 2C3OA 3EXCX 1FRMA 1PC5A 4EBCA 3CIMA 4KV8A 4CO2A 1SL2A 3MM6A 1LWCB 2OFGX 3P6YC 3OR1B 2W8KA 3QGGA 2R7WA 1LW2A 4C3LA 4N77A 4Y2KA 4CQ1A 4EGLA 4ZVFA 1JIHA 3QGHA 2QE5A 4NLWA 1ZM3A 4ES2A 3DYAA 2P6SA 1C0TB 2GJIA 2WOMA 4KGKA 3HM9A 3LP2A 4TQRA 2NS1B 3PJXA 1Q4RA 1RGVA 2MQOA 1TL1A 3CXCR 1WG1A 1B0TA 2M8HA 2ZH7A 2O1PA 2A1BA 2CZ4A 1U8SA 2B4PA 3K5LA 2B6AA 2NPIA 3M32B 1FRJA 4K4VA 1WTBA 2IRYA 1R7IA 5DGBA 1YGYA 2X1GA 1DURA 2KZMA 1CC7A 5A8KB 4ZS6A 3OBIA 5L8RC 4IH5A 4RLEA 4X65F 1AW0A 4DBQA 2KFZA 1RT4B 4CTAA 1GXLA 1H6KX 2XMWA 5CYJA 1ULRA 4CCHA 1WF0A 3K5NA 3VAJA 5CZVA 3CCJS 4F4XA 2HGNA 4PWUA 3DYAB 2DNMA