1HNXI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnxI00
1IBLE 4GKJI 2UXBI 1IBKE 4FW9A 2V34A 2VQEE 4JV5E 4UTGA 1Z5CA 1PVGA 4I3HA 4JYAE 3OTOI 1Z0VA 1MG7A 1NZ0A 4DPXA 2UUAI 4WUBA 1N0UA 2R3VA 1FJGE 4DV1I 2A2CA 4X65E 4JI5I 4YHHI 5LMUE 1FWLA 4DV6I 2R42A 4DV4I 4LF7E 4HXZA 4PRXA 1ELOA 2VQEI 1IBMI 4PRVA 3F0NA 4HACB 4ZVIA 4X66I 4DU7A 4FWGA 4PU9A 4DR1E 2UUBE 4JI3I 5A2QQ 4XTJA 1QZRA 1N33I 4DV4E 1XNQI 4DUZE 1K47A 4JI4E 1J5EI 1N0VC 2ZM6I 3GONA 5LMUI 1NHHA 4DV1E 1BKNA 3ZZ0A 3ZZTA 1XMQE 4RPFA 1IBME 4YY3I 2A2DA 3QT8A 4JG4A 4DV2E 4USMA 1ZXNA 1Z0CA 4JI6E 1Z5AA 2HKEA 4B3MI 4OX9E 4Z7CA 2XEXA 5IT9C 2J7KA 4DR5E 4DR5I 2NPFA 1DARA 1IBLI 4K0KE 3T1YE 2ZM6E 1UEKA 3HULA 4DUZI 4GKKE 4DUYE 4B3SE 4DV2I 1ZXMA 2BV3A 1NHIA 3J81C 1Z0WA 4DR3E 4DV5E 1D6TA 1HNXE 3ZKDA 1H72C 2F4VE 4DU8A 1MX0A 2HFSA 1FWKA 4NXME 3J80C 2UUBI 4JI8I 2LJPA 1HR0I 4AQYE 2E1RA 2ZITA 1KIJA 2VF3A 5IWAE 2CZ9A 1Z59A 4LFAI 4KHPE 2F4VI 2VQFI 1VISA 3WU4A 2HK2A 3PYEA 4DR3I 1HNWI 5BR8E 2BM0A 4MYUA 5IT9Q 5A2QC 2V8PA 4GKJE 4MYTA 2HK3A 1WUUA 3T1YI 1HR0E 2GS8A 1J5EE 4JI6I 2X7IA 4JI7I 4DR7I 5LMNI 4JV5I 5IWAI 1KTVA 2UUCE 4M1KA 3PYFA 1HNWE 1H7SA 4NXNI 4URLA 4X66E 1HNXI 2HHHE 4HYMA 3B8HA 4DV5I 1XNQE 4LF4I 2UXDE 4NXMI 1N33E 1KVKA 3LPSA 1I94E 4AQYI 4EMDA 4DV6E 4X62E 3JAMQ 1Z0BA 4X65I 4DXLA 4JI5E 1N34E 4LF9E 4LFCI 1N36E 4FN5A 4Z7YA 4HACA 3OTOE 4DPYA 4DV3I 4X64E 3QT5A 2HFUA 4NXNE 3J80Q 1MU5A 2ZBKB 4JI0E 3PYGA 4DV0E 2UUAE 4LF6I 3J7AM 1B63A 3Q1QA 4JI4I 4DR2I 3J81Q 4R1FA 4B3TI 4B3RI 3V2UC 4LFBI 1FI4A 4DPUA 2UXCI 4WUCA 4LF8I 4OX9I 4B3ME 1NHJA 4DPWA 1HNZE 2BM1A 4X64I 4DV3E 1U2RA 2VQFE 4JI1E 4ED4A 3M6AA 3T1HI 3T1HE 3WU3A 4UT4A 4YHHE 1S4EA 3ZZUA 4DUYI 2V2VA 4FWHA 4LFBE 4LF7I 5LMNE 4LF4E 1N34I 4FWDA 4DR6I 4P7AA 2HKJA 1Z5BA 2UXCE 4LF6E 1FJGI 1FKAE 5GMDA 4JI0I 3LNUA 1ZM4A 4DR2E 3B82A 4GKKI 2UU9I 3CWVA 2UU9E 4JI2E 1OJ4A 3QT7A 4LF9I 3H4LA 4DR7E 4B3TE 3PYDA 2WW4A 4DV7I 2V2ZA 1XNRI 4HY1A 4USKA 5FLXQ 4DR1I 1XHKA 3B78A 4DPTA 1XMQI 1XMOI 4KQVA 3K1JA 1ZM2A 4DR6E 2DEIA 4LFAE 1S16A 1RREA 3WU5A 4JI1I 1ZM3A 4JI7E 5LL6R 1RR9A 1HNZI 1N32E 3WU6A 1Z0EA 4LF8E 4DV7E 4LF5I 1KKHA 2X36A 1Z0GA 4B3RE 3ZM7A 1EI1A 4JYAI 1FNMA 1Z0TA 1XMOE 2EFGA 2Q2EB 1H73A 3ZKBA 4DR4I 4K0KI 1H7UA 2UUCI 4KHPI 5GMEA 1IBKI 4LF5E 4DR4E 1ZM9A 1B62A 2E5LE 2E5LI 1PIEA 1N36I 3V5RA 3QT6A 3D4JA 4DV0I 5L3JA 5BR8I 2DEJA 4P52A 3LTOA 4X62I 3K17A 2V2QA 2UXBE 4JI8E 2AJ4A 1PKPA 4LFCE 3J7AG 4B3SI 4YY3E 1EA6A 3JAMC 2HHHI 1XNRE 1N32I 2OI2A 1H74A 1I94I 1A6FA 4JI3E 5FLXC 2UXDI 4JI2I 4WUDA
chains in the Genus database with same CATH superfamily
4QNKA 1IBLE 4GKJI 2UXBI 4IS9A 2PO0A 4FW9A 1IBKE 5K36E 2V34A 3PS2A 2VQEE 4JV5E 4UTGA 2IESA 4OO1F 1Z5CA 1PVGA 1Y5YA 4I3HA 4JYAE 3OTOI 1Z0VA 4BA2A 1MG7A 1NZ0A 4DPXA 2VESA 2UUAI 4WUBA 1N0UA 2O1VA 2R3VA 1FJGE 5EKWA 4DV1I 2A2CA 4MU3A 4X65E 4JI5I 4YHHI 5LMUE 1FWLA 4DV6I 4IFDB 2R42A 4DV4I 4LF7E 4HXZA 4PRXA 1ELOA 2VQEI 1IBMI 2NN6A 3NZKA 4U3DA 4PRVA 2Z5CB 3F0NA 3B4TA 4HACB 2O3ZA 1USVA 4ZVIA 4BA1B 4X66I 4DU7A 4FWGA 4PU9A 4DR1E 2UUBE 4JI3I 5A2QQ 4XTJA 1QZRA 1N33I 4DV4E 1XNQI 4DUZE 1K47A 5FWKA 4JI4E 3L7ZB 1J5EI 1N0VC 2ZM6I 3GONA 5JEAE 4MU4A 5LMUI 3H1CA 1E3HA 1NHHA 4DV1E 1BKNA 1USUA 3ZZ0A 3ZZTA 1XMQE 4RPFA 5JEAD 1IBME 4YY3I 5DRRA 2A2DA 3QT8A 4JG4A 1Y4SA 4DV2E 4USMA 2PO1B 1ZXNA 1Z0CA 2PNLA 4JI6E 1Z5AA 2HKEA 1XXEA 4B3MI 4OX9E 4Z7CA 3UHMA 2O1WA 2WP8B 4NBQA 3GCMA 5ELWA 2XEXA 5IT9C 2J7KA 4DR5E 4DR5I 4IFDA 4BA2B 2NPFA 2BA0D 1DARA 1IBLI 4K0KE 3T1YE 2ZM6E 1UEKA 3HULA 4DUZI 1OYSA 2GQ0A 2JEAB 4GKKE 4FW6A 5C0XA 4DUYE 4B3SE 4DV2I 5DRQA 1ZXMA 2BV3A 1NHIA 2BA1D 3J81C 5JEAC 2NN6B 1Z0WA 4DR3E 4DV5E 1D6TA 1HNXE 3ZKDA 3CDIA 1H72C 2F4VE 4DU8A 1MX0A 2HFSA 1FWKA 4NXME 2CG9A 3J80C 2UUBI 4JI8I 5C0XD 3KRNA 2LJPA 1HR0I 4MDTA 5K36F 4AQYE 2E1RA 2ZITA 1R6LA 1KIJA 2VF3A 5IWAE 2CZ9A 1Z59A 4LFAI 4KHPE 2C37B 4IFDD 2F4VI 2PO1A 2JT2A 2VQFI 3HJCA 2GO3A 5DNXA 1VISA 4IZKA 1Y6ZA 3WU4A 2GO4A 2HK2A 3PYEA 4DR3I 1HNWI 5BR8E 3L7ZA 2BM0A 4MYUA 5IT9Q 5A2QC 4GQUA 5K36B 2V8PA 4GKJE 4MYTA 2HK3A 3Q6NA 5JEAA 1WUUA 3T1YI 1HR0E 2GS8A 1J5EE 4JI6I 2X7IA 1OYRA 4JI7I 4DR7I 5LMNI 4JV5I 2CGEA 5IWAI 1KTVA 2UUCE 4M1KA 3PYFA 4OKGA 1HNWE 4FW5A 1H7SA 4NXNI 4URLA 4X66E 1HNXI 2HHHE 4HYMA 3B8HA 4LPFA 4DV5I 2JE6A 1XNQE 4LF4I 2UXDE 4NXMI 1N33E 1KVKA 2J65A 2Z5BA 4OO1A 3LPSA 5JEAF 1I94E 4J3DA 4AQYI 4EMDA 4DV6E 4X62E 3JAMQ 1Z0BA 4X65I 4DXLA 4JI5E 1N34E 2C38B 4IZJA 1P42A 4LCHA 4MU0A 4LF9E 1UDNA 4LFCI 1R6MA 4FN5A 1N36E 4IFDC 4Z7YA 4HACA 3OTOE 4DPYA 3PRYA 4DV3I 4X64E 3QT5A 4AIMA 2HFUA 4NXNE 3J80Q 2JE6B 1MU5A 1HK7A 2ZBKB 4JI0E 3PYGA 4DV0E 2UUAE 4LF6I 3J7AM 1B63A 4MU1A 3P76A 4AIDA 3Q1QA 3K85A 4DR2I 3J81Q 1YH8A 4R1FA 3U1YA 1YHCA 3PS3A 2BR2A 4B3TI 4B3RI 3V2UC 4FW4A 2JEAA 4LFBI 1FI4A 5C0XE 4DPUA 2UXCI 4IZJB 4WUCA 4LF8I 4B3ME 4OX9I 5K36C 1NHJA 2JEBB 4LCGA 4DPWA 1HNZE 2BM1A 4X64I 4DV3E 1U2RA 2VQFE 4JI1E 4ED4A 3M6AA 3T1HI 3T1HE 3M85G 2PNZB 3WU3A 1Y60A 2NN6C 4LCFA 1VI7A 4IFDF 3M85D 4UT4A 3GLLA 2NN6E 4YHHE 1S4EA 4QNJA 3ZZUA 1UDOA 4DUYI 2C38A 2V2VA 4FWHA 4LFBE 4LF7I 2WNRB 4MQYA 5LMNE 4LF4E 1N34I 4FWDA 4N3OA 4DR6I 4P7AA 2HKJA 2PNMA 1OYPA 2Z5CA 2WP8A 1Z5BA 4OO1D 2UXCE 1RHYA 4LF6E 1FJGI 3HKMA 4IZKB 1FKAE 5GMDA 4JI0I 5C0XF 4OO1E 3LNUA 1ZM4A 4DR2E 2C39A 3B82A 3CDJA 4FW3A 4GKKI 2UU9I 3CWVA 2UU9E 4IFDE 2NN6D 4JI2E 1OJ4A 4FW7A 3QT7A 4LF9I 2BR2B 1E3PA 3H4LA 4DR7E 2WNRA 4B3TE 2JEBA 4OO1C 3PYDA 2WW4A 4DV7I 2V2ZA 3Q6MA 1XNRI 4HY1A 4BA1A 4USKA 5DRPA 3P3GA 2BA1G 2PO2B 5FLXQ 2IOQA 1Y4UA 4JI4I 5C0XC 2Z5BB 4DR1I 4LOMA 2PNZA 4U3BA 1XHKA 3B78A 4DPTA 1XMQI 1XMOI 4KQVA 3K1JA 1UDQA 2C37A 1ZM2A 4DR6E 2DEIA 4LFAE 1S16A 1RREA 3WU5A 4JI1I 1ZM3A 4JI7E 5LL6R 1RR9A 1HNZI 1N32E 1UDSA 3WU6A 1Z0EA 4LF8E 4DV7E 4LF5I 3M7ND 4IZJD 1KKHA 2X36A 1Z0GA 3GMEA 2C39B 4B3RE 3ZM7A 3P3EA 1EI1A 2O1TA 3M7NG 2IERA 4JYAI 1FNMA 1Z0TA 1XMOE 2EFGA 2Q2EB 1H73A 3ZKBA 4DR4I 4K0KI 2Z5EA 1H7UA 5C0XB 2UUCI 4KHPI 5GMEA 1IBKI 4LF5E 4DR4E 1ZM9A 2IOPA 4AM3A 1B62A 4OZEA 2E5LE 2E5LI 1PIEA 1N36I 2AE8A 3P06A 3V5RA 3QT6A 3D4JA 3P3CA 4DV0I 5L3JA 5BR8I 4P52A 2DEJA 3LTOA 4OO1B 5JEAB 4X62I 3K17A 3DD6A 5EL9A 5K36A 4ISAA 2V2QA 2UXBE 2CVEA 4JI8E 2BA0G 5K36D 2AJ4A 1PKPA 4LFCE 3J7AG 2PO0B 4B3SI 4YY3E 1EA6A 3JAMC 2F1DA 5DROA 2O1UA 2PO2A 2HHHI 1XNRE 1N32I 2OI2A 1H74A 3PS1A 3U1KA 1I94I 1A6FA 2NN6F 5DNLA 4JI3E 5FLXC 2UXDI 4JI2I 4WUDA
chains in the Genus database with same CATH topology
1IBLE 4GKJI 2UXBI 1IBKE 4FW9A 2V34A 2VQEE 4JV5E 4UTGA 1Z5CA 1PVGA 4I3HA 4JYAE 3OTOI 1Z0VA 1MG7A 1NZ0A 4DPXA 2UUAI 4WUBA 1N0UA 2O1VA 2R3VA 1FJGE 4DV1I 2A2CA 4X65E 4JI5I 4YHHI 5LMUE 1FWLA 4DV6I 2R42A 4DV4I 4LF7E 4HXZA 4PRXA 1ELOA 2VQEI 1IBMI 4PRVA 2Z5CB 3F0NA 4HACB 1USVA 4ZVIA 4X66I 4DU7A 4FWGA 4PU9A 4DR1E 2UUBE 4JI3I 5A2QQ 4XTJA 1QZRA 1N33I 4DV4E 1XNQI 4DUZE 1K47A 5FWKA 4JI4E 1J5EI 1N0VC 2ZM6I 3GONA 5LMUI 1NHHA 4DV1E 1BKNA 1USUA 3ZZ0A 3ZZTA 1XMQE 4RPFA 1IBME 4YY3I 2A2DA 3QT8A 4JG4A 1Y4SA 4DV2E 4USMA 1ZXNA 1Z0CA 2PNLA 4JI6E 1Z5AA 2HKEA 4B3MI 4OX9E 4Z7CA 2O1WA 2XEXA 5IT9C 2J7KA 4DR5E 4DR5I 2NPFA 1DARA 1IBLI 4K0KE 3T1YE 2ZM6E 1UEKA 3HULA 4DUZI 4GKKE 2GQ0A 4DUYE 4B3SE 4DV2I 1ZXMA 2BV3A 1NHIA 3J81C 1Z0WA 4DR3E 4DV5E 1D6TA 1HNXE 3ZKDA 1H72C 2F4VE 4DU8A 1MX0A 2HFSA 1FWKA 4NXME 2CG9A 3J80C 2UUBI 4JI8I 2LJPA 1HR0I 4AQYE 2E1RA 2ZITA 1KIJA 2VF3A 5IWAE 2CZ9A 1Z59A 4LFAI 4KHPE 2F4VI 2VQFI 3HJCA 1VISA 4IZKA 1Y6ZA 3WU4A 2HK2A 3PYEA 4DR3I 1HNWI 5BR8E 2BM0A 4MYUA 5IT9Q 5A2QC 2V8PA 4GKJE 4MYTA 2HK3A 3Q6NA 1WUUA 3T1YI 1HR0E 2GS8A 1J5EE 4JI6I 2X7IA 4JI7I 4DR7I 5LMNI 4JV5I 2CGEA 5IWAI 1KTVA 2UUCE 4M1KA 3PYFA 1HNWE 1H7SA 4NXNI 4URLA 4X66E 1HNXI 2HHHE 4HYMA 3B8HA 4DV5I 1XNQE 4LF4I 2UXDE 4NXMI 1N33E 1KVKA 2Z5BA 3LPSA 1I94E 4AQYI 4EMDA 4DV6E 4X62E 3JAMQ 1Z0BA 4X65I 4DXLA 4JI5E 1N34E 4IZJA 4LF9E 4LFCI 1N36E 4FN5A 4Z7YA 4HACA 3OTOE 4DPYA 3PRYA 4DV3I 4X64E 3QT5A 2HFUA 4NXNE 3J80Q 1MU5A 1HK7A 2ZBKB 4JI0E 3PYGA 4DV0E 2UUAE 4LF6I 3J7AM 1B63A 3Q1QA 3K85A 4DR2I 3J81Q 4JI4I 4R1FA 4B3TI 4B3RI 3V2UC 4LFBI 1FI4A 4DPUA 2UXCI 4IZJB 4WUCA 4LF8I 4B3ME 4OX9I 1NHJA 4DPWA 1HNZE 2BM1A 4X64I 4DV3E 1U2RA 2VQFE 4JI1E 4ED4A 3M6AA 3T1HI 3T1HE 3WU3A 4UT4A 4YHHE 1S4EA 3ZZUA 4DUYI 2V2VA 4FWHA 4LFBE 4LF7I 5LMNE 4LF4E 1N34I 4FWDA 4N3OA 4DR6I 4P7AA 2HKJA 2PNMA 2Z5CA 1Z5BA 2UXCE 4LF6E 1FJGI 4IZKB 1FKAE 5GMDA 4JI0I 3LNUA 1ZM4A 4DR2E 3B82A 4GKKI 2UU9I 3CWVA 2UU9E 4JI2E 1OJ4A 3QT7A 4LF9I 3H4LA 4DR7E 4B3TE 3PYDA 2WW4A 4DV7I 2V2ZA 3Q6MA 1XNRI 4HY1A 4USKA 5FLXQ 2IOQA 1Y4UA 2Z5BB 4DR1I 1XHKA 3B78A 4DPTA 1XMQI 1XMOI 4KQVA 3K1JA 1ZM2A 4DR6E 2DEIA 4LFAE 1S16A 1RREA 3WU5A 4JI1I 1ZM3A 4JI7E 5LL6R 1RR9A 1HNZI 1N32E 3WU6A 1Z0EA 4LF8E 4DV7E 4LF5I 4IZJD 1KKHA 2X36A 1Z0GA 4B3RE 3ZM7A 1EI1A 2O1TA 4JYAI 1FNMA 1Z0TA 1XMOE 2EFGA 2Q2EB 1H73A 3ZKBA 4DR4I 4K0KI 2Z5EA 1H7UA 2UUCI 4KHPI 5GMEA 1IBKI 4LF5E 4DR4E 1ZM9A 2IOPA 1B62A 2E5LE 2E5LI 1PIEA 1N36I 3P06A 3V5RA 3QT6A 3D4JA 4DV0I 5L3JA 5BR8I 2DEJA 4P52A 3LTOA 4X62I 3K17A 2V2QA 2UXBE 4JI8E 2AJ4A 1PKPA 4LFCE 3J7AG 4B3SI 4YY3E 1EA6A 3JAMC 2O1UA 2HHHI 1XNRE 1N32I 2OI2A 1H74A 1I94I 1A6FA 4JI3E 5FLXC 2UXDI 4JI2I 4WUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL E;  4GKJ I;  2UXB I;  1IBK E;  4FW9 A;  2V34 A;  2VQE E;  4JV5 E;  4UTG A;  1Z5C A;  1PVG A;  4I3H A;  4JYA E;  3OTO I;  1Z0V A;  1MG7 A;  1NZ0 A;  4DPX A;  2UUA I;  4WUB A;  1N0U A;  2R3V A;  1FJG E;  4DV1 I;  2A2C A;  4X65 E;  4JI5 I;  4YHH I;  5LMU E;  1FWL A;  4DV6 I;  2R42 A;  4DV4 I;  4LF7 E;  4HXZ A;  4PRX A;  1ELO A;  2VQE I;  1IBM I;  4PRV A;  3F0N A;  4HAC B;  4ZVI A;  4X66 I;  4DU7 A;  4FWG A;  4PU9 A;  4DR1 E;  2UUB E;  4JI3 I;  5A2Q Q;  4XTJ A;  1QZR A;  1N33 I;  4DV4 E;  1XNQ I;  4DUZ E;  1K47 A;  4JI4 E;  1J5E I;  1N0V C;  2ZM6 I;  3GON A;  5LMU I;  1NHH A;  4DV1 E;  1BKN A;  3ZZ0 A;  3ZZT A;  1XMQ E;  4RPF A;  1IBM E;  4YY3 I;  2A2D A;  3QT8 A;  4JG4 A;  4DV2 E;  4USM A;  1ZXN A;  1Z0C A;  4JI6 E;  1Z5A A;  2HKE A;  4B3M I;  4OX9 E;  4Z7C A;  2XEX A;  5IT9 C;  2J7K A;  4DR5 E;  4DR5 I;  2NPF A;  1DAR A;  1IBL I;  4K0K E;  3T1Y E;  2ZM6 E;  1UEK A;  3HUL A;  4DUZ I;  4GKK E;  4DUY E;  4B3S E;  4DV2 I;  1ZXM A;  2BV3 A;  1NHI A;  3J81 C;  1Z0W A;  4DR3 E;  4DV5 E;  1D6T A;  1HNX E;  3ZKD A;  1H72 C;  2F4V E;  4DU8 A;  1MX0 A;  2HFS A;  1FWK A;  4NXM E;  3J80 C;  2UUB I;  4JI8 I;  2LJP A;  1HR0 I;  4AQY E;  2E1R A;  2ZIT A;  1KIJ A;  2VF3 A;  5IWA E;  2CZ9 A;  1Z59 A;  4LFA I;  4KHP E;  2F4V I;  2VQF I;  1VIS A;  3WU4 A;  2HK2 A;  3PYE A;  4DR3 I;  1HNW I;  5BR8 E;  2BM0 A;  4MYU A;  5IT9 Q;  5A2Q C;  2V8P A;  4GKJ E;  4MYT A;  2HK3 A;  1WUU A;  3T1Y I;  1HR0 E;  2GS8 A;  1J5E E;  4JI6 I;  2X7I A;  4JI7 I;  4DR7 I;  5LMN I;  4JV5 I;  5IWA I;  1KTV A;  2UUC E;  4M1K A;  3PYF A;  1HNW E;  1H7S A;  4NXN I;  4URL A;  4X66 E;  1HNX I;  2HHH E;  4HYM A;  3B8H A;  4DV5 I;  1XNQ E;  4LF4 I;  2UXD E;  4NXM I;  1N33 E;  1KVK A;  3LPS A;  1I94 E;  4AQY I;  4EMD A;  4DV6 E;  4X62 E;  3JAM Q;  1Z0B A;  4X65 I;  4DXL A;  4JI5 E;  1N34 E;  4LF9 E;  4LFC I;  1N36 E;  4FN5 A;  4Z7Y A;  4HAC A;  3OTO E;  4DPY A;  4DV3 I;  4X64 E;  3QT5 A;  2HFU A;  4NXN E;  3J80 Q;  1MU5 A;  2ZBK B;  4JI0 E;  3PYG A;  4DV0 E;  2UUA E;  4LF6 I;  3J7A M;  1B63 A;  3Q1Q A;  4JI4 I;  4DR2 I;  3J81 Q;  4R1F A;  4B3T I;  4B3R I;  3V2U C;  4LFB I;  1FI4 A;  4DPU A;  2UXC I;  4WUC A;  4LF8 I;  4OX9 I;  4B3M E;  1NHJ A;  4DPW A;  1HNZ E;  2BM1 A;  4X64 I;  4DV3 E;  1U2R A;  2VQF E;  4JI1 E;  4ED4 A;  3M6A A;  3T1H I;  3T1H E;  3WU3 A;  4UT4 A;  4YHH E;  1S4E A;  3ZZU A;  4DUY I;  2V2V A;  4FWH A;  4LFB E;  4LF7 I;  5LMN E;  4LF4 E;  1N34 I;  4FWD A;  4DR6 I;  4P7A A;  2HKJ A;  1Z5B A;  2UXC E;  4LF6 E;  1FJG I;  1FKA E;  5GMD A;  4JI0 I;  3LNU A;  1ZM4 A;  4DR2 E;  3B82 A;  4GKK I;  2UU9 I;  3CWV A;  2UU9 E;  4JI2 E;  1OJ4 A;  3QT7 A;  4LF9 I;  3H4L A;  4DR7 E;  4B3T E;  3PYD A;  2WW4 A;  4DV7 I;  2V2Z A;  1XNR I;  4HY1 A;  4USK A;  5FLX Q;  4DR1 I;  1XHK A;  3B78 A;  4DPT A;  1XMQ I;  1XMO I;  4KQV A;  3K1J A;  1ZM2 A;  4DR6 E;  2DEI A;  4LFA E;  1S16 A;  1RRE A;  3WU5 A;  4JI1 I;  1ZM3 A;  4JI7 E;  5LL6 R;  1RR9 A;  1HNZ I;  1N32 E;  3WU6 A;  1Z0E A;  4LF8 E;  4DV7 E;  4LF5 I;  1KKH A;  2X36 A;  1Z0G A;  4B3R E;  3ZM7 A;  1EI1 A;  4JYA I;  1FNM A;  1Z0T A;  1XMO E;  2EFG A;  2Q2E B;  1H73 A;  3ZKB A;  4DR4 I;  4K0K I;  1H7U A;  2UUC I;  4KHP I;  5GME A;  1IBK I;  4LF5 E;  4DR4 E;  1ZM9 A;  1B62 A;  2E5L E;  2E5L I;  1PIE A;  1N36 I;  3V5R A;  3QT6 A;  3D4J A;  4DV0 I;  5L3J A;  5BR8 I;  2DEJ A;  4P52 A;  3LTO A;  4X62 I;  3K17 A;  2V2Q A;  2UXB E;  4JI8 E;  2AJ4 A;  1PKP A;  4LFC E;  3J7A G;  4B3S I;  4YY3 E;  1EA6 A;  3JAM C;  2HHH I;  1XNR E;  1N32 I;  2OI2 A;  1H74 A;  1I94 I;  1A6F A;  4JI3 E;  5FLX C;  2UXD I;  4JI2 I;  4WUD A; 
#chains in the Genus database with same CATH topology
 4QNK A;  1IBL E;  4GKJ I;  2UXB I;  4IS9 A;  2PO0 A;  4FW9 A;  1IBK E;  5K36 E;  2V34 A;  3PS2 A;  2VQE E;  4JV5 E;  4UTG A;  2IES A;  4OO1 F;  1Z5C A;  1PVG A;  1Y5Y A;  4I3H A;  4JYA E;  3OTO I;  1Z0V A;  4BA2 A;  1MG7 A;  1NZ0 A;  4DPX A;  2VES A;  2UUA I;  4WUB A;  1N0U A;  2O1V A;  2R3V A;  1FJG E;  5EKW A;  4DV1 I;  2A2C A;  4MU3 A;  4X65 E;  4JI5 I;  4YHH I;  5LMU E;  1FWL A;  4DV6 I;  4IFD B;  2R42 A;  4DV4 I;  4LF7 E;  4HXZ A;  4PRX A;  1ELO A;  2VQE I;  1IBM I;  2NN6 A;  3NZK A;  4U3D A;  4PRV A;  2Z5C B;  3F0N A;  3B4T A;  4HAC B;  2O3Z A;  1USV A;  4ZVI A;  4BA1 B;  4X66 I;  4DU7 A;  4FWG A;  4PU9 A;  4DR1 E;  2UUB E;  4JI3 I;  5A2Q Q;  4XTJ A;  1QZR A;  1N33 I;  4DV4 E;  1XNQ I;  4DUZ E;  1K47 A;  5FWK A;  4JI4 E;  3L7Z B;  1J5E I;  1N0V C;  2ZM6 I;  3GON A;  5JEA E;  4MU4 A;  5LMU I;  3H1C A;  1E3H A;  1NHH A;  4DV1 E;  1BKN A;  1USU A;  3ZZ0 A;  3ZZT A;  1XMQ E;  4RPF A;  5JEA D;  1IBM E;  4YY3 I;  5DRR A;  2A2D A;  3QT8 A;  4JG4 A;  1Y4S A;  4DV2 E;  4USM A;  2PO1 B;  1ZXN A;  1Z0C A;  2PNL A;  4JI6 E;  1Z5A A;  2HKE A;  1XXE A;  4B3M I;  4OX9 E;  4Z7C A;  3UHM A;  2O1W A;  2WP8 B;  4NBQ A;  3GCM A;  5ELW A;  2XEX A;  5IT9 C;  2J7K A;  4DR5 E;  4DR5 I;  4IFD A;  4BA2 B;  2NPF A;  2BA0 D;  1DAR A;  1IBL I;  4K0K E;  3T1Y E;  2ZM6 E;  1UEK A;  3HUL A;  4DUZ I;  1OYS A;  2GQ0 A;  2JEA B;  4GKK E;  4FW6 A;  5C0X A;  4DUY E;  4B3S E;  4DV2 I;  5DRQ A;  1ZXM A;  2BV3 A;  1NHI A;  2BA1 D;  3J81 C;  5JEA C;  2NN6 B;  1Z0W A;  4DR3 E;  4DV5 E;  1D6T A;  1HNX E;  3ZKD A;  3CDI A;  1H72 C;  2F4V E;  4DU8 A;  1MX0 A;  2HFS A;  1FWK A;  4NXM E;  2CG9 A;  3J80 C;  2UUB I;  4JI8 I;  5C0X D;  3KRN A;  2LJP A;  1HR0 I;  4MDT A;  5K36 F;  4AQY E;  2E1R A;  2ZIT A;  1R6L A;  1KIJ A;  2VF3 A;  5IWA E;  2CZ9 A;  1Z59 A;  4LFA I;  4KHP E;  2C37 B;  4IFD D;  2F4V I;  2PO1 A;  2JT2 A;  2VQF I;  3HJC A;  2GO3 A;  5DNX A;  1VIS A;  4IZK A;  1Y6Z A;  3WU4 A;  2GO4 A;  2HK2 A;  3PYE A;  4DR3 I;  1HNW I;  5BR8 E;  3L7Z A;  2BM0 A;  4MYU A;  5IT9 Q;  5A2Q C;  4GQU A;  5K36 B;  2V8P A;  4GKJ E;  4MYT A;  2HK3 A;  3Q6N A;  5JEA A;  1WUU A;  3T1Y I;  1HR0 E;  2GS8 A;  1J5E E;  4JI6 I;  2X7I A;  1OYR A;  4JI7 I;  4DR7 I;  5LMN I;  4JV5 I;  2CGE A;  5IWA I;  1KTV A;  2UUC E;  4M1K A;  3PYF A;  4OKG A;  1HNW E;  4FW5 A;  1H7S A;  4NXN I;  4URL A;  4X66 E;  1HNX I;  2HHH E;  4HYM A;  3B8H A;  4LPF A;  4DV5 I;  2JE6 A;  1XNQ E;  4LF4 I;  2UXD E;  4NXM I;  1N33 E;  1KVK A;  2J65 A;  2Z5B A;  4OO1 A;  3LPS A;  5JEA F;  1I94 E;  4J3D A;  4AQY I;  4EMD A;  4DV6 E;  4X62 E;  3JAM Q;  1Z0B A;  4X65 I;  4DXL A;  4JI5 E;  1N34 E;  2C38 B;  4IZJ A;  1P42 A;  4LCH A;  4MU0 A;  4LF9 E;  1UDN A;  4LFC I;  1R6M A;  4FN5 A;  1N36 E;  4IFD C;  4Z7Y A;  4HAC A;  3OTO E;  4DPY A;  3PRY A;  4DV3 I;  4X64 E;  3QT5 A;  4AIM A;  2HFU A;  4NXN E;  3J80 Q;  2JE6 B;  1MU5 A;  1HK7 A;  2ZBK B;  4JI0 E;  3PYG A;  4DV0 E;  2UUA E;  4LF6 I;  3J7A M;  1B63 A;  4MU1 A;  3P76 A;  4AID A;  3Q1Q A;  3K85 A;  4DR2 I;  3J81 Q;  1YH8 A;  4R1F A;  3U1Y A;  1YHC A;  3PS3 A;  2BR2 A;  4B3T I;  4B3R I;  3V2U C;  4FW4 A;  2JEA A;  4LFB I;  1FI4 A;  5C0X E;  4DPU A;  2UXC I;  4IZJ B;  4WUC A;  4LF8 I;  4B3M E;  4OX9 I;  5K36 C;  1NHJ A;  2JEB B;  4LCG A;  4DPW A;  1HNZ E;  2BM1 A;  4X64 I;  4DV3 E;  1U2R A;  2VQF E;  4JI1 E;  4ED4 A;  3M6A A;  3T1H I;  3T1H E;  3M85 G;  2PNZ B;  3WU3 A;  1Y60 A;  2NN6 C;  4LCF A;  1VI7 A;  4IFD F;  3M85 D;  4UT4 A;  3GLL A;  2NN6 E;  4YHH E;  1S4E A;  4QNJ A;  3ZZU A;  1UDO A;  4DUY I;  2C38 A;  2V2V A;  4FWH A;  4LFB E;  4LF7 I;  2WNR B;  4MQY A;  5LMN E;  4LF4 E;  1N34 I;  4FWD A;  4N3O A;  4DR6 I;  4P7A A;  2HKJ A;  2PNM A;  1OYP A;  2Z5C A;  2WP8 A;  1Z5B A;  4OO1 D;  2UXC E;  1RHY A;  4LF6 E;  1FJG I;  3HKM A;  4IZK B;  1FKA E;  5GMD A;  4JI0 I;  5C0X F;  4OO1 E;  3LNU A;  1ZM4 A;  4DR2 E;  2C39 A;  3B82 A;  3CDJ A;  4FW3 A;  4GKK I;  2UU9 I;  3CWV A;  2UU9 E;  4IFD E;  2NN6 D;  4JI2 E;  1OJ4 A;  4FW7 A;  3QT7 A;  4LF9 I;  2BR2 B;  1E3P A;  3H4L A;  4DR7 E;  2WNR A;  4B3T E;  2JEB A;  4OO1 C;  3PYD A;  2WW4 A;  4DV7 I;  2V2Z A;  3Q6M A;  1XNR I;  4HY1 A;  4BA1 A;  4USK A;  5DRP A;  3P3G A;  2BA1 G;  2PO2 B;  5FLX Q;  2IOQ A;  1Y4U A;  4JI4 I;  5C0X C;  2Z5B B;  4DR1 I;  4LOM A;  2PNZ A;  4U3B A;  1XHK A;  3B78 A;  4DPT A;  1XMQ I;  1XMO I;  4KQV A;  3K1J A;  1UDQ A;  2C37 A;  1ZM2 A;  4DR6 E;  2DEI A;  4LFA E;  1S16 A;  1RRE A;  3WU5 A;  4JI1 I;  1ZM3 A;  4JI7 E;  5LL6 R;  1RR9 A;  1HNZ I;  1N32 E;  1UDS A;  3WU6 A;  1Z0E A;  4LF8 E;  4DV7 E;  4LF5 I;  3M7N D;  4IZJ D;  1KKH A;  2X36 A;  1Z0G A;  3GME A;  2C39 B;  4B3R E;  3ZM7 A;  3P3E A;  1EI1 A;  2O1T A;  3M7N G;  2IER A;  4JYA I;  1FNM A;  1Z0T A;  1XMO E;  2EFG A;  2Q2E B;  1H73 A;  3ZKB A;  4DR4 I;  4K0K I;  2Z5E A;  1H7U A;  5C0X B;  2UUC I;  4KHP I;  5GME A;  1IBK I;  4LF5 E;  4DR4 E;  1ZM9 A;  2IOP A;  4AM3 A;  1B62 A;  4OZE A;  2E5L E;  2E5L I;  1PIE A;  1N36 I;  2AE8 A;  3P06 A;  3V5R A;  3QT6 A;  3D4J A;  3P3C A;  4DV0 I;  5L3J A;  5BR8 I;  4P52 A;  2DEJ A;  3LTO A;  4OO1 B;  5JEA B;  4X62 I;  3K17 A;  3DD6 A;  5EL9 A;  5K36 A;  4ISA A;  2V2Q A;  2UXB E;  2CVE A;  4JI8 E;  2BA0 G;  5K36 D;  2AJ4 A;  1PKP A;  4LFC E;  3J7A G;  2PO0 B;  4B3S I;  4YY3 E;  1EA6 A;  3JAM C;  2F1D A;  5DRO A;  2O1U A;  2PO2 A;  2HHH I;  1XNR E;  1N32 I;  2OI2 A;  1H74 A;  3PS1 A;  3U1K A;  1I94 I;  1A6F A;  2NN6 F;  5DNL A;  4JI3 E;  5FLX C;  2UXD I;  4JI2 I;  4WUD A; 
#chains in the Genus database with same CATH homology
 1IBL E;  4GKJ I;  2UXB I;  1IBK E;  4FW9 A;  2V34 A;  2VQE E;  4JV5 E;  4UTG A;  1Z5C A;  1PVG A;  4I3H A;  4JYA E;  3OTO I;  1Z0V A;  1MG7 A;  1NZ0 A;  4DPX A;  2UUA I;  4WUB A;  1N0U A;  2O1V A;  2R3V A;  1FJG E;  4DV1 I;  2A2C A;  4X65 E;  4JI5 I;  4YHH I;  5LMU E;  1FWL A;  4DV6 I;  2R42 A;  4DV4 I;  4LF7 E;  4HXZ A;  4PRX A;  1ELO A;  2VQE I;  1IBM I;  4PRV A;  2Z5C B;  3F0N A;  4HAC B;  1USV A;  4ZVI A;  4X66 I;  4DU7 A;  4FWG A;  4PU9 A;  4DR1 E;  2UUB E;  4JI3 I;  5A2Q Q;  4XTJ A;  1QZR A;  1N33 I;  4DV4 E;  1XNQ I;  4DUZ E;  1K47 A;  5FWK A;  4JI4 E;  1J5E I;  1N0V C;  2ZM6 I;  3GON A;  5LMU I;  1NHH A;  4DV1 E;  1BKN A;  1USU A;  3ZZ0 A;  3ZZT A;  1XMQ E;  4RPF A;  1IBM E;  4YY3 I;  2A2D A;  3QT8 A;  4JG4 A;  1Y4S A;  4DV2 E;  4USM A;  1ZXN A;  1Z0C A;  2PNL A;  4JI6 E;  1Z5A A;  2HKE A;  4B3M I;  4OX9 E;  4Z7C A;  2O1W A;  2XEX A;  5IT9 C;  2J7K A;  4DR5 E;  4DR5 I;  2NPF A;  1DAR A;  1IBL I;  4K0K E;  3T1Y E;  2ZM6 E;  1UEK A;  3HUL A;  4DUZ I;  4GKK E;  2GQ0 A;  4DUY E;  4B3S E;  4DV2 I;  1ZXM A;  2BV3 A;  1NHI A;  3J81 C;  1Z0W A;  4DR3 E;  4DV5 E;  1D6T A;  1HNX E;  3ZKD A;  1H72 C;  2F4V E;  4DU8 A;  1MX0 A;  2HFS A;  1FWK A;  4NXM E;  2CG9 A;  3J80 C;  2UUB I;  4JI8 I;  2LJP A;  1HR0 I;  4AQY E;  2E1R A;  2ZIT A;  1KIJ A;  2VF3 A;  5IWA E;  2CZ9 A;  1Z59 A;  4LFA I;  4KHP E;  2F4V I;  2VQF I;  3HJC A;  1VIS A;  4IZK A;  1Y6Z A;  3WU4 A;  2HK2 A;  3PYE A;  4DR3 I;  1HNW I;  5BR8 E;  2BM0 A;  4MYU A;  5IT9 Q;  5A2Q C;  2V8P A;  4GKJ E;  4MYT A;  2HK3 A;  3Q6N A;  1WUU A;  3T1Y I;  1HR0 E;  2GS8 A;  1J5E E;  4JI6 I;  2X7I A;  4JI7 I;  4DR7 I;  5LMN I;  4JV5 I;  2CGE A;  5IWA I;  1KTV A;  2UUC E;  4M1K A;  3PYF A;  1HNW E;  1H7S A;  4NXN I;  4URL A;  4X66 E;  1HNX I;  2HHH E;  4HYM A;  3B8H A;  4DV5 I;  1XNQ E;  4LF4 I;  2UXD E;  4NXM I;  1N33 E;  1KVK A;  2Z5B A;  3LPS A;  1I94 E;  4AQY I;  4EMD A;  4DV6 E;  4X62 E;  3JAM Q;  1Z0B A;  4X65 I;  4DXL A;  4JI5 E;  1N34 E;  4IZJ A;  4LF9 E;  4LFC I;  1N36 E;  4FN5 A;  4Z7Y A;  4HAC A;  3OTO E;  4DPY A;  3PRY A;  4DV3 I;  4X64 E;  3QT5 A;  2HFU A;  4NXN E;  3J80 Q;  1MU5 A;  1HK7 A;  2ZBK B;  4JI0 E;  3PYG A;  4DV0 E;  2UUA E;  4LF6 I;  3J7A M;  1B63 A;  3Q1Q A;  3K85 A;  4DR2 I;  3J81 Q;  4JI4 I;  4R1F A;  4B3T I;  4B3R I;  3V2U C;  4LFB I;  1FI4 A;  4DPU A;  2UXC I;  4IZJ B;  4WUC A;  4LF8 I;  4B3M E;  4OX9 I;  1NHJ A;  4DPW A;  1HNZ E;  2BM1 A;  4X64 I;  4DV3 E;  1U2R A;  2VQF E;  4JI1 E;  4ED4 A;  3M6A A;  3T1H I;  3T1H E;  3WU3 A;  4UT4 A;  4YHH E;  1S4E A;  3ZZU A;  4DUY I;  2V2V A;  4FWH A;  4LFB E;  4LF7 I;  5LMN E;  4LF4 E;  1N34 I;  4FWD A;  4N3O A;  4DR6 I;  4P7A A;  2HKJ A;  2PNM A;  2Z5C A;  1Z5B A;  2UXC E;  4LF6 E;  1FJG I;  4IZK B;  1FKA E;  5GMD A;  4JI0 I;  3LNU A;  1ZM4 A;  4DR2 E;  3B82 A;  4GKK I;  2UU9 I;  3CWV A;  2UU9 E;  4JI2 E;  1OJ4 A;  3QT7 A;  4LF9 I;  3H4L A;  4DR7 E;  4B3T E;  3PYD A;  2WW4 A;  4DV7 I;  2V2Z A;  3Q6M A;  1XNR I;  4HY1 A;  4USK A;  5FLX Q;  2IOQ A;  1Y4U A;  2Z5B B;  4DR1 I;  1XHK A;  3B78 A;  4DPT A;  1XMQ I;  1XMO I;  4KQV A;  3K1J A;  1ZM2 A;  4DR6 E;  2DEI A;  4LFA E;  1S16 A;  1RRE A;  3WU5 A;  4JI1 I;  1ZM3 A;  4JI7 E;  5LL6 R;  1RR9 A;  1HNZ I;  1N32 E;  3WU6 A;  1Z0E A;  4LF8 E;  4DV7 E;  4LF5 I;  4IZJ D;  1KKH A;  2X36 A;  1Z0G A;  4B3R E;  3ZM7 A;  1EI1 A;  2O1T A;  4JYA I;  1FNM A;  1Z0T A;  1XMO E;  2EFG A;  2Q2E B;  1H73 A;  3ZKB A;  4DR4 I;  4K0K I;  2Z5E A;  1H7U A;  2UUC I;  4KHP I;  5GME A;  1IBK I;  4LF5 E;  4DR4 E;  1ZM9 A;  2IOP A;  1B62 A;  2E5L E;  2E5L I;  1PIE A;  1N36 I;  3P06 A;  3V5R A;  3QT6 A;  3D4J A;  4DV0 I;  5L3J A;  5BR8 I;  2DEJ A;  4P52 A;  3LTO A;  4X62 I;  3K17 A;  2V2Q A;  2UXB E;  4JI8 E;  2AJ4 A;  1PKP A;  4LFC E;  3J7A G;  4B3S I;  4YY3 E;  1EA6 A;  3JAM C;  2O1U A;  2HHH I;  1XNR E;  1N32 I;  2OI2 A;  1H74 A;  1I94 I;  1A6F A;  4JI3 E;  5FLX C;  2UXD I;  4JI2 I;  4WUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...