1HNXI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnxI00
3ZZUA 4MYTA 2EFGA 4DR2I 2UXBE 4K0KE 1FI4A 2AJ4A 2F4VI 1U2RA 1H73A 4JV5E 1IBKE 4B3RE 4Z7YA 1K47A 4AQYI 1HNWE 4DR4E 4HY1A 3QT6A 1EA6A 4DPWA 2HK3A 2V34A 1HNXI 4YHHI 1H74A 3F0NA 2UUBE 2HHHI 1FNMA 4DV6I 1FWLA 2WW4A 2J7KA 5IT9C 1UEKA 4DV5E 4B3SE 2V2VA 2HFUA 4LF7I 4LF6I 4DR5I 4GKJE 4HACB 4DR7I 4LFBI 3WU5A 4GKKE 3J80C 2UUCI 1XMOI 1J5EI 1Z0BA 1HNZI 1B63A 1IBME 1Z5CA 5BR8I 4DV2I 1KTVA 3J81C 4DUYE 2VQFI 4B3TI 1H72C 4JI7E 2DEIA 4DPXA 1OJ4A 2ZM6E 1ZXMA 4X65I 4LF4I 1MU5A 4USKA 1XNQI 1XHKA 3JAMQ 4WUDA 4KQVA 2UXBI 4K0KI 4DR6E 4HACA 3J7AG 4DV1I 2VF3A 4JV5I 4B3RI 4I3HA 1Z5BA 4UTGA 4DUZE 2UXCE 1HNWI 4DR4I 1N36E 4JI0I 3LPSA 4DV4E 4X62E 3B8HA 4FWDA 1N32E 1MX0A 4FN5A 2UUBI 4Z7CA 3Q1QA 3B82A 1XMQI 2BM1A 4OX9E 1ZM3A 4X64E 4EMDA 3T1YE 1RR9A 3OTOI 1NHIA 4GKJI 4FWHA 4ED4A 4GKKI 2UUAE 1I94E 1MG7A 4R1FA 1IBMI 2ZITA 3V2UC 4DR3E 1PVGA 4JI8E 4DR1E 4JI7I 4PRXA 4LF9E 1NZ0A 1H7UA 3T1HE 5GMDA 3ZZ0A 3ZM7A 5GMEA 2UU9I 1Z0CA 3ZKBA 3J80Q 1DARA 4JG4A 5LMNE 4LF8E 4NXNE 4M1KA 3H4LA 1B62A 3D4JA 4DR6I 1KVKA 1Z0VA 2UXCI 4PRVA 4LFAE 4YY3E 1N33E 3QT5A 4DV4I 4JYAE 4X62I 4JI5E 4X66E 2X7IA 3WU6A 1N32I 5LL6R 1NHHA 1ELOA 4USMA 3M6AA 4OX9I 5FLXQ 1Z0WA 4JI3E 1S16A 4DV3I 3QT8A 4NXME 1EI1A 4JI6E 4DV0E 1S4EA 1XNRE 2GS8A 1I94I 1NHJA 3PYGA 4LF5E 4WUCA 4FWGA 1IBKI 2V2ZA 1HNXE 3PYDA 2E5LE 5A2QQ 4LF9I 4DPTA 4UT4A 1Z59A 1KKHA 1N34E 3T1HI 3HULA 1QZRA 1KIJA 2HKEA 1ZM2A 3JAMC 4LF8I 4NXNI 4B3ME 1XMOE 4DV5I 4B3SI 2HK2A 4P7AA 4DV2E 2DEJA 3LNUA 4DV7E 4B3TE 4URLA 4DU7A 4HXZA 1WUUA 4MYUA 2OI2A 4YY3I 2UXDE 5IWAE 5L3JA 4JYAI 1VISA 4X66I 1H7SA 4DUYI 4DU8A 1HR0E 4DPUA 4JI2E 4HYMA 1IBLE 5IT9Q 2ZM6I 2VQEE 4PU9A 1ZM4A 4RPFA 1Z0TA 4JI3I 5LMUE 4DV1E 1ZM9A 4NXMI 4JI1E 2V8PA 4JI6I 4DV0I 1XNRI 3K17A 1N0UA 1PIEA 4JI0E 4LF5I 3J81Q 2XEXA 2ZBKB 3B78A 1A6FA 2E5LI 4LFCE 4DUZI 2E1RA 4JI4E 1N36I 1Z5AA 3ZKDA 1Z0GA 1D6TA 1XMQE 4XTJA 1FJGE 4KHPE 4ZVIA 1N34I 2R3VA 3QT7A 3OTOE 2BV3A 1PKPA 3J7AM 2BM0A 4B3MI 4X64I 4DR2E 3GONA 1RREA 2X36A 3T1YI 2F4VE 2HFSA 2HKJA 4P52A 4DV7I 4AQYE 1N0VC 2A2DA 2UUAI 4DPYA 2V2QA 2R42A 1ZXNA 2UXDI 1BKNA 5IWAI 4DR3I 3V5RA 4YHHE 4JI8I 3WU4A 1HR0I 2UU9E 4DR1I 4DV6E 2HHHE 4JI2I 4FW9A 1IBLI 2CZ9A 1FWKA 2VQEI 4LF7E 5FLXC 5LMUI 4LF6E 4DR5E 4DR7E 4LFBE 2Q2EB 5LMNI 4JI1I 3ZZTA 1Z0EA 2UUCE 1J5EE 1HNZE 4DXLA 4WUBA 2NPFA 5BR8E 3PYFA 4LFCI 2VQFE 3LTOA 3K1JA 4JI4I 4LFAI 1N33I 2A2CA 3CWVA 5A2QC 1FJGI 4KHPI 4JI5I 4X65E 3PYEA 4LF4E 3WU3A 1FKAE 1XNQE 4DV3E 2LJPA
chains in the Genus database with same CATH superfamily
3ZZUA 1UDSA 4MYTA 2EFGA 4DR2I 2UXBE 4IFDB 4K0KE 1FI4A 2PO0A 2AJ4A 2F4VI 1U2RA 1H73A 4LPFA 4MDTA 4JV5E 1IBKE 4B3RE 4Z7YA 1K47A 4OO1F 3P3EA 4OO1A 4AQYI 2Z5CB 1HNWE 2PO1B 4DR4E 2VESA 4GQUA 4HY1A 3QT6A 3L7ZA 1EA6A 3NZKA 4DPWA 2HK3A 2V34A 1HNXI 4YHHI 1H74A 3F0NA 2UUBE 2HHHI 1FNMA 4DV6I 3HJCA 3GLLA 1FWLA 2WW4A 2J7KA 5IT9C 2CG9A 1UEKA 5DRQA 4OO1C 4DV5E 4B3SE 2V2VA 2HFUA 4LF7I 3P3CA 4LF6I 4DR5I 4GKJE 4HACB 4DR7I 4LFBI 4BA2B 5DRRA 5K36D 3WU5A 5K36B 4GKKE 1E3PA 4IFDF 3J80C 4IFDA 2UUCI 2J65A 4BA1B 1XMOI 1J5EI 1Z0BA 1HNZI 1B63A 1IBME 1Z5CA 3H1CA 1R6LA 5BR8I 2Z5CA 4DV2I 1KTVA 2PO1A 3J81C 4DUYE 1Y4UA 2VQFI 2NN6F 4B3TI 1H72C 2PO2A 4JI7E 2DEIA 5C0XD 4DPXA 2AE8A 5C0XB 1OJ4A 3PRYA 2ZM6E 4AM3A 1ZXMA 4X65I 4LF4I 1MU5A 4IFDC 3GCMA 4USKA 1XNQI 1XHKA 1RHYA 3JAMQ 4WUDA 4KQVA 2PNZB 2UXBI 4K0KI 4DR6E 4HACA 3J7AG 4QNKA 4DV1I 2VF3A 2PO0B 5DRPA 4JV5I 5K36A 1HK7A 4B3RI 4I3HA 1Z5BA 4UTGA 4DUZE 4BA1A 2UXCE 4OO1D 1HNWI 4DR4I 2JE6B 1N36E 5JEAE 4JI0I 3LPSA 4DV4E 4X62E 3B4TA 3B8HA 4FWDA 1N32E 4IZJD 1MX0A 4IZJB 5C0XA 4FN5A 2UUBI 4Z7CA 3Q1QA 2IESA 3B82A 1XMQI 2BM1A 4OX9E 1ZM3A 5K36C 4U3BA 4X64E 4J3DA 4EMDA 3T1YE 1RR9A 3OTOI 5ELWA 1NHIA 4GKJI 4FWHA 2PNZA 2C37B 4ED4A 4GKKI 2UUAE 3PS2A 4IFDD 1I94E 1MG7A 5C0XC 4R1FA 1XXEA 1IBMI 2ZITA 1OYRA 3V2UC 1PVGA 4DR3E 4FW5A 2JE6A 4JI8E 4DR1E 4JI7I 2NN6D 4PRXA 2NN6B 1NZ0A 2Z5BA 2PO2B 4LF9E 1OYPA 1H7UA 3T1HE 5GMDA 3ZZ0A 4IZJA 3ZM7A 5GMEA 2UU9I 1USUA 1Z0CA 3ZKBA 3J80Q 4ISAA 1DARA 1Y60A 4JG4A 5LMNE 4OZEA 4FW4A 4LF8E 4NXNE 4M1KA 3H4LA 4IS9A 1B62A 3UHMA 3D4JA 4DR6I 1KVKA 2C37A 2O1WA 1Z0VA 2UXCI 4U3DA 4PRVA 4LFAE 4YY3E 2JT2A 5JEAF 1N33E 3QT5A 4DV4I 4JYAE 4X62I 2GO3A 4JI5E 2BA0D 2IOPA 4X66E 3M7ND 2X7IA 3WU6A 1N32I 1Y6ZA 5LL6R 1NHHA 2NN6A 1ELOA 4IZKB 4USMA 3M6AA 2BA1G 1OYSA 4OX9I 4MU3A 2PNLA 4OKGA 5FLXQ 1Z0WA 4JI3E 1S16A 4DV3I 3QT8A 4NXME 1EI1A 4AIDA 4LOMA 4JI6E 4DV0E 1S4EA 1XNRE 3GMEA 2GS8A 1I94I 1NHJA 3PYGA 1R6MA 2NN6C 4LF5E 2BA0G 3M7NG 4WUCA 4FWGA 1IBKI 2V2ZA 1HNXE 3PYDA 2E5LE 4N3OA 5A2QQ 2CVEA 4LF9I 3P06A 4FW6A 4LCHA 4DPTA 4UT4A 1Z59A 2Z5BB 1KKHA 1N34E 3T1HI 4IZKA 2IERA 3HULA 1QZRA 1KIJA 2IOQA 2HKEA 2F1DA 1ZM2A 3JAMC 4LF8I 4NXNI 4B3ME 1UDQA 5DNXA 1XMOE 4DV5I 4B3SI 4FW3A 2HK2A 4P7AA 3M85D 4DV2E 2DEJA 3LNUA 3HKMA 4DV7E 2WNRB 4B3TE 4URLA 4DU7A 5EKWA 4HXZA 1WUUA 4MYUA 2OI2A 4YY3I 2UXDE 5JEAD 2O1UA 5L3JA 5IWAE 4JYAI 5JEAB 1VISA 4X66I 1H7SA 2WP8B 4DUYI 4DU8A 1HR0E 4DPUA 4JI2E 5DNLA 2C39B 4HYMA 1IBLE 5FWKA 3PS3A 5IT9Q 2C38B 2PNMA 1YHCA 2BR2B 2ZM6I 2VQEE 4PU9A 1ZM4A 4RPFA 1Z0TA 3CDIA 3M85G 4JI3I 2O1VA 5LMUE 2JEAB 4DV1E 5K36E 1ZM9A 4NXMI 4JI1E 4NBQA 1YH8A 2V8PA 4JI6I 2BA1D 4DV0I 1XNRI 3K17A 2JEBB 1N0UA 1PIEA 3U1KA 2GO4A 5EL9A 4JI0E 4LF5I 3J81Q 2XEXA 1UDOA 2ZBKB 3B78A 1A6FA 2WNRA 4FW7A 3KRNA 2E5LI 4LFCE 4DUZI 2E1RA 5C0XE 4JI4E 1N36I 1Z5AA 3ZKDA 1Z0GA 5JEAA 1D6TA 1XMQE 4XTJA 1E3HA 1FJGE 2WP8A 4KHPE 4ZVIA 1N34I 2R3VA 4AIMA 2C39A 3P3GA 3QT7A 5DROA 2C38A 3OTOE 2BR2A 2BV3A 1PKPA 3J7AM 2BM0A 4B3MI 4X64I 4DR2E 3GONA 1RREA 2X36A 2JEAA 3T1YI 2F4VE 3DD6A 2HFSA 2HKJA 3P76A 5JEAC 4OO1E 4P52A 4DV7I 4AQYE 1UDNA 1N0VC 2A2DA 2JEBA 2UUAI 4DPYA 1Y5YA 2V2QA 1P42A 2R42A 3U1YA 1ZXNA 2UXDI 1BKNA 5IWAI 4MU0A 4DR3I 3V5RA 4LCGA 4YHHE 4JI8I 4MU4A 3WU4A 4MU1A 1HR0I 2UU9E 4DR1I 4DV6E 2HHHE 4JI2I 1USVA 4FW9A 1IBLI 2CZ9A 1FWKA 1VI7A 2VQEI 4MQYA 4LF7E 5FLXC 5LMUI 3CDJA 4LF6E 4BA2A 5K36F 4DR5E 4DR7E 4LFBE 2Q2EB 5LMNI 4JI1I 4IFDE 3ZZTA 1Z0EA 2UUCE 4OO1B 1J5EE 1HNZE 4DXLA 2CGEA 4WUBA 2O1TA 2NPFA 5BR8E 1Y4SA 2O3ZA 3L7ZB 3PYFA 4LFCI 2NN6E 2VQFE 5C0XF 3LTOA 3K1JA 4JI4I 4LFAI 3Q6MA 1N33I 2GQ0A 2A2CA 3CWVA 4QNJA 3Q6NA 5A2QC 1FJGI 4KHPI 4JI5I 4X65E 3PYEA 4LF4E 3WU3A 3K85A 1FKAE 3PS1A 2Z5EA 1XNQE 4DV3E 2LJPA 4LCFA
chains in the Genus database with same CATH topology
3ZZUA 4MYTA 2EFGA 4DR2I 2UXBE 4K0KE 1FI4A 2AJ4A 2F4VI 1U2RA 1H73A 4JV5E 1IBKE 4B3RE 4Z7YA 1K47A 4AQYI 2Z5CB 1HNWE 4DR4E 4HY1A 3QT6A 1EA6A 4DPWA 2HK3A 2V34A 1HNXI 4YHHI 1H74A 3F0NA 2UUBE 2HHHI 1FNMA 4DV6I 3HJCA 1FWLA 2WW4A 2J7KA 5IT9C 2CG9A 1UEKA 4DV5E 4B3SE 2V2VA 2HFUA 4LF7I 4LF6I 4DR5I 4GKJE 4HACB 4DR7I 4LFBI 3WU5A 4GKKE 3J80C 2UUCI 1XMOI 1J5EI 1Z0BA 1HNZI 1B63A 1IBME 1Z5CA 5BR8I 2Z5CA 4DV2I 1KTVA 3J81C 4DUYE 1Y4UA 2VQFI 4B3TI 1H72C 4JI7E 2DEIA 4DPXA 1OJ4A 3PRYA 2ZM6E 1ZXMA 4X65I 4LF4I 1MU5A 4USKA 1XNQI 1XHKA 3JAMQ 4WUDA 4KQVA 2UXBI 4K0KI 4DR6E 4HACA 3J7AG 4DV1I 2VF3A 4JV5I 1HK7A 4B3RI 4I3HA 1Z5BA 4UTGA 4DUZE 2UXCE 1HNWI 4DR4I 1N36E 4JI0I 3LPSA 4DV4E 4X62E 3B8HA 4FWDA 1N32E 4IZJD 1MX0A 4IZJB 4FN5A 2UUBI 4Z7CA 3Q1QA 3B82A 1XMQI 2BM1A 4OX9E 1ZM3A 4X64E 4EMDA 3T1YE 1RR9A 3OTOI 1NHIA 4GKJI 4FWHA 4ED4A 4GKKI 2UUAE 1I94E 1MG7A 4R1FA 1IBMI 2ZITA 3V2UC 4DR3E 1PVGA 4JI8E 4DR1E 4JI7I 4PRXA 2Z5BA 1NZ0A 4LF9E 1H7UA 3T1HE 5GMDA 3ZZ0A 4IZJA 3ZM7A 5GMEA 2UU9I 1USUA 1Z0CA 3ZKBA 3J80Q 1DARA 4JG4A 5LMNE 4LF8E 4NXNE 4M1KA 3H4LA 1B62A 3D4JA 4DR6I 1KVKA 2O1WA 1Z0VA 2UXCI 4PRVA 4LFAE 4YY3E 1N33E 3QT5A 4DV4I 4JYAE 4X62I 4JI5E 2IOPA 4X66E 2X7IA 3WU6A 1N32I 1Y6ZA 5LL6R 1NHHA 1ELOA 4IZKB 4USMA 3M6AA 4OX9I 2PNLA 5FLXQ 1Z0WA 4JI3E 1S16A 4DV3I 3QT8A 4NXME 1EI1A 4JI6E 4DV0E 1S4EA 1XNRE 2GS8A 1I94I 1NHJA 3PYGA 4LF5E 4WUCA 4FWGA 1IBKI 2V2ZA 1HNXE 3PYDA 2E5LE 4N3OA 5A2QQ 4LF9I 3P06A 4DPTA 4UT4A 1Z59A 2Z5BB 1KKHA 1N34E 3T1HI 4IZKA 3HULA 1QZRA 1KIJA 2IOQA 2HKEA 1ZM2A 3JAMC 4LF8I 4NXNI 4B3ME 1XMOE 4DV5I 4B3SI 2HK2A 4P7AA 4DV2E 2DEJA 3LNUA 4DV7E 4B3TE 4URLA 4DU7A 4HXZA 1WUUA 4MYUA 2OI2A 4YY3I 2UXDE 2O1UA 5L3JA 5IWAE 4JYAI 1VISA 4X66I 1H7SA 4DUYI 4DU8A 1HR0E 4DPUA 4JI2E 4HYMA 1IBLE 5FWKA 5IT9Q 2PNMA 2ZM6I 2VQEE 4PU9A 1ZM4A 4RPFA 1Z0TA 4JI3I 2O1VA 5LMUE 4DV1E 1ZM9A 4NXMI 4JI1E 2V8PA 4JI6I 4DV0I 1XNRI 3K17A 1N0UA 1PIEA 4JI0E 4LF5I 3J81Q 2XEXA 2ZBKB 3B78A 1A6FA 2E5LI 4LFCE 4DUZI 2E1RA 4JI4E 1N36I 1Z5AA 3ZKDA 1Z0GA 1D6TA 1XMQE 4XTJA 1FJGE 4KHPE 4ZVIA 1N34I 2R3VA 3QT7A 3OTOE 2BV3A 1PKPA 3J7AM 2BM0A 4B3MI 4X64I 4DR2E 3GONA 1RREA 2X36A 3T1YI 2F4VE 2HFSA 2HKJA 4P52A 4DV7I 4AQYE 1N0VC 2A2DA 2UUAI 4DPYA 2V2QA 2R42A 1ZXNA 2UXDI 1BKNA 5IWAI 4DR3I 3V5RA 4YHHE 4JI8I 3WU4A 1HR0I 2UU9E 4DR1I 4DV6E 2HHHE 4JI2I 1USVA 4FW9A 1IBLI 2CZ9A 1FWKA 2VQEI 4LF7E 5FLXC 5LMUI 4LF6E 4DR5E 4DR7E 4LFBE 2Q2EB 5LMNI 4JI1I 3ZZTA 1Z0EA 2UUCE 1J5EE 1HNZE 4DXLA 2CGEA 4WUBA 2O1TA 2NPFA 5BR8E 1Y4SA 3PYFA 4LFCI 2VQFE 3LTOA 3K1JA 4JI4I 4LFAI 3Q6MA 1N33I 2GQ0A 2A2CA 3CWVA 3Q6NA 5A2QC 1FJGI 4KHPI 4JI5I 4X65E 3PYEA 4LF4E 3WU3A 3K85A 1FKAE 2Z5EA 1XNQE 4DV3E 2LJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZZU A;  4MYT A;  2EFG A;  4DR2 I;  2UXB E;  4K0K E;  1FI4 A;  2AJ4 A;  2F4V I;  1U2R A;  1H73 A;  4JV5 E;  1IBK E;  4B3R E;  4Z7Y A;  1K47 A;  4AQY I;  1HNW E;  4DR4 E;  4HY1 A;  3QT6 A;  1EA6 A;  4DPW A;  2HK3 A;  2V34 A;  1HNX I;  4YHH I;  1H74 A;  3F0N A;  2UUB E;  2HHH I;  1FNM A;  4DV6 I;  1FWL A;  2WW4 A;  2J7K A;  5IT9 C;  1UEK A;  4DV5 E;  4B3S E;  2V2V A;  2HFU A;  4LF7 I;  4LF6 I;  4DR5 I;  4GKJ E;  4HAC B;  4DR7 I;  4LFB I;  3WU5 A;  4GKK E;  3J80 C;  2UUC I;  1XMO I;  1J5E I;  1Z0B A;  1HNZ I;  1B63 A;  1IBM E;  1Z5C A;  5BR8 I;  4DV2 I;  1KTV A;  3J81 C;  4DUY E;  2VQF I;  4B3T I;  1H72 C;  4JI7 E;  2DEI A;  4DPX A;  1OJ4 A;  2ZM6 E;  1ZXM A;  4X65 I;  4LF4 I;  1MU5 A;  4USK A;  1XNQ I;  1XHK A;  3JAM Q;  4WUD A;  4KQV A;  2UXB I;  4K0K I;  4DR6 E;  4HAC A;  3J7A G;  4DV1 I;  2VF3 A;  4JV5 I;  4B3R I;  4I3H A;  1Z5B A;  4UTG A;  4DUZ E;  2UXC E;  1HNW I;  4DR4 I;  1N36 E;  4JI0 I;  3LPS A;  4DV4 E;  4X62 E;  3B8H A;  4FWD A;  1N32 E;  1MX0 A;  4FN5 A;  2UUB I;  4Z7C A;  3Q1Q A;  3B82 A;  1XMQ I;  2BM1 A;  4OX9 E;  1ZM3 A;  4X64 E;  4EMD A;  3T1Y E;  1RR9 A;  3OTO I;  1NHI A;  4GKJ I;  4FWH A;  4ED4 A;  4GKK I;  2UUA E;  1I94 E;  1MG7 A;  4R1F A;  1IBM I;  2ZIT A;  3V2U C;  4DR3 E;  1PVG A;  4JI8 E;  4DR1 E;  4JI7 I;  4PRX A;  4LF9 E;  1NZ0 A;  1H7U A;  3T1H E;  5GMD A;  3ZZ0 A;  3ZM7 A;  5GME A;  2UU9 I;  1Z0C A;  3ZKB A;  3J80 Q;  1DAR A;  4JG4 A;  5LMN E;  4LF8 E;  4NXN E;  4M1K A;  3H4L A;  1B62 A;  3D4J A;  4DR6 I;  1KVK A;  1Z0V A;  2UXC I;  4PRV A;  4LFA E;  4YY3 E;  1N33 E;  3QT5 A;  4DV4 I;  4JYA E;  4X62 I;  4JI5 E;  4X66 E;  2X7I A;  3WU6 A;  1N32 I;  5LL6 R;  1NHH A;  1ELO A;  4USM A;  3M6A A;  4OX9 I;  5FLX Q;  1Z0W A;  4JI3 E;  1S16 A;  4DV3 I;  3QT8 A;  4NXM E;  1EI1 A;  4JI6 E;  4DV0 E;  1S4E A;  1XNR E;  2GS8 A;  1I94 I;  1NHJ A;  3PYG A;  4LF5 E;  4WUC A;  4FWG A;  1IBK I;  2V2Z A;  1HNX E;  3PYD A;  2E5L E;  5A2Q Q;  4LF9 I;  4DPT A;  4UT4 A;  1Z59 A;  1KKH A;  1N34 E;  3T1H I;  3HUL A;  1QZR A;  1KIJ A;  2HKE A;  1ZM2 A;  3JAM C;  4LF8 I;  4NXN I;  4B3M E;  1XMO E;  4DV5 I;  4B3S I;  2HK2 A;  4P7A A;  4DV2 E;  2DEJ A;  3LNU A;  4DV7 E;  4B3T E;  4URL A;  4DU7 A;  4HXZ A;  1WUU A;  4MYU A;  2OI2 A;  4YY3 I;  2UXD E;  5IWA E;  5L3J A;  4JYA I;  1VIS A;  4X66 I;  1H7S A;  4DUY I;  4DU8 A;  1HR0 E;  4DPU A;  4JI2 E;  4HYM A;  1IBL E;  5IT9 Q;  2ZM6 I;  2VQE E;  4PU9 A;  1ZM4 A;  4RPF A;  1Z0T A;  4JI3 I;  5LMU E;  4DV1 E;  1ZM9 A;  4NXM I;  4JI1 E;  2V8P A;  4JI6 I;  4DV0 I;  1XNR I;  3K17 A;  1N0U A;  1PIE A;  4JI0 E;  4LF5 I;  3J81 Q;  2XEX A;  2ZBK B;  3B78 A;  1A6F A;  2E5L I;  4LFC E;  4DUZ I;  2E1R A;  4JI4 E;  1N36 I;  1Z5A A;  3ZKD A;  1Z0G A;  1D6T A;  1XMQ E;  4XTJ A;  1FJG E;  4KHP E;  4ZVI A;  1N34 I;  2R3V A;  3QT7 A;  3OTO E;  2BV3 A;  1PKP A;  3J7A M;  2BM0 A;  4B3M I;  4X64 I;  4DR2 E;  3GON A;  1RRE A;  2X36 A;  3T1Y I;  2F4V E;  2HFS A;  2HKJ A;  4P52 A;  4DV7 I;  4AQY E;  1N0V C;  2A2D A;  2UUA I;  4DPY A;  2V2Q A;  2R42 A;  1ZXN A;  2UXD I;  1BKN A;  5IWA I;  4DR3 I;  3V5R A;  4YHH E;  4JI8 I;  3WU4 A;  1HR0 I;  2UU9 E;  4DR1 I;  4DV6 E;  2HHH E;  4JI2 I;  4FW9 A;  1IBL I;  2CZ9 A;  1FWK A;  2VQE I;  4LF7 E;  5FLX C;  5LMU I;  4LF6 E;  4DR5 E;  4DR7 E;  4LFB E;  2Q2E B;  5LMN I;  4JI1 I;  3ZZT A;  1Z0E A;  2UUC E;  1J5E E;  1HNZ E;  4DXL A;  4WUB A;  2NPF A;  5BR8 E;  3PYF A;  4LFC I;  2VQF E;  3LTO A;  3K1J A;  4JI4 I;  4LFA I;  1N33 I;  2A2C A;  3CWV A;  5A2Q C;  1FJG I;  4KHP I;  4JI5 I;  4X65 E;  3PYE A;  4LF4 E;  3WU3 A;  1FKA E;  1XNQ E;  4DV3 E;  2LJP A; 
#chains in the Genus database with same CATH topology
 3ZZU A;  1UDS A;  4MYT A;  2EFG A;  4DR2 I;  2UXB E;  4IFD B;  4K0K E;  1FI4 A;  2PO0 A;  2AJ4 A;  2F4V I;  1U2R A;  1H73 A;  4LPF A;  4MDT A;  4JV5 E;  1IBK E;  4B3R E;  4Z7Y A;  1K47 A;  4OO1 F;  3P3E A;  4OO1 A;  4AQY I;  2Z5C B;  1HNW E;  2PO1 B;  4DR4 E;  2VES A;  4GQU A;  4HY1 A;  3QT6 A;  3L7Z A;  1EA6 A;  3NZK A;  4DPW A;  2HK3 A;  2V34 A;  1HNX I;  4YHH I;  1H74 A;  3F0N A;  2UUB E;  2HHH I;  1FNM A;  4DV6 I;  3HJC A;  3GLL A;  1FWL A;  2WW4 A;  2J7K A;  5IT9 C;  2CG9 A;  1UEK A;  5DRQ A;  4OO1 C;  4DV5 E;  4B3S E;  2V2V A;  2HFU A;  4LF7 I;  3P3C A;  4LF6 I;  4DR5 I;  4GKJ E;  4HAC B;  4DR7 I;  4LFB I;  4BA2 B;  5DRR A;  5K36 D;  3WU5 A;  5K36 B;  4GKK E;  1E3P A;  4IFD F;  3J80 C;  4IFD A;  2UUC I;  2J65 A;  4BA1 B;  1XMO I;  1J5E I;  1Z0B A;  1HNZ I;  1B63 A;  1IBM E;  1Z5C A;  3H1C A;  1R6L A;  5BR8 I;  2Z5C A;  4DV2 I;  1KTV A;  2PO1 A;  3J81 C;  4DUY E;  1Y4U A;  2VQF I;  2NN6 F;  4B3T I;  1H72 C;  2PO2 A;  4JI7 E;  2DEI A;  5C0X D;  4DPX A;  2AE8 A;  5C0X B;  1OJ4 A;  3PRY A;  2ZM6 E;  4AM3 A;  1ZXM A;  4X65 I;  4LF4 I;  1MU5 A;  4IFD C;  3GCM A;  4USK A;  1XNQ I;  1XHK A;  1RHY A;  3JAM Q;  4WUD A;  4KQV A;  2PNZ B;  2UXB I;  4K0K I;  4DR6 E;  4HAC A;  3J7A G;  4QNK A;  4DV1 I;  2VF3 A;  2PO0 B;  5DRP A;  4JV5 I;  5K36 A;  1HK7 A;  4B3R I;  4I3H A;  1Z5B A;  4UTG A;  4DUZ E;  4BA1 A;  2UXC E;  4OO1 D;  1HNW I;  4DR4 I;  2JE6 B;  1N36 E;  5JEA E;  4JI0 I;  3LPS A;  4DV4 E;  4X62 E;  3B4T A;  3B8H A;  4FWD A;  1N32 E;  4IZJ D;  1MX0 A;  4IZJ B;  5C0X A;  4FN5 A;  2UUB I;  4Z7C A;  3Q1Q A;  2IES A;  3B82 A;  1XMQ I;  2BM1 A;  4OX9 E;  1ZM3 A;  5K36 C;  4U3B A;  4X64 E;  4J3D A;  4EMD A;  3T1Y E;  1RR9 A;  3OTO I;  5ELW A;  1NHI A;  4GKJ I;  4FWH A;  2PNZ A;  2C37 B;  4ED4 A;  4GKK I;  2UUA E;  3PS2 A;  4IFD D;  1I94 E;  1MG7 A;  5C0X C;  4R1F A;  1XXE A;  1IBM I;  2ZIT A;  1OYR A;  3V2U C;  1PVG A;  4DR3 E;  4FW5 A;  2JE6 A;  4JI8 E;  4DR1 E;  4JI7 I;  2NN6 D;  4PRX A;  2NN6 B;  1NZ0 A;  2Z5B A;  2PO2 B;  4LF9 E;  1OYP A;  1H7U A;  3T1H E;  5GMD A;  3ZZ0 A;  4IZJ A;  3ZM7 A;  5GME A;  2UU9 I;  1USU A;  1Z0C A;  3ZKB A;  3J80 Q;  4ISA A;  1DAR A;  1Y60 A;  4JG4 A;  5LMN E;  4OZE A;  4FW4 A;  4LF8 E;  4NXN E;  4M1K A;  3H4L A;  4IS9 A;  1B62 A;  3UHM A;  3D4J A;  4DR6 I;  1KVK A;  2C37 A;  2O1W A;  1Z0V A;  2UXC I;  4U3D A;  4PRV A;  4LFA E;  4YY3 E;  2JT2 A;  5JEA F;  1N33 E;  3QT5 A;  4DV4 I;  4JYA E;  4X62 I;  2GO3 A;  4JI5 E;  2BA0 D;  2IOP A;  4X66 E;  3M7N D;  2X7I A;  3WU6 A;  1N32 I;  1Y6Z A;  5LL6 R;  1NHH A;  2NN6 A;  1ELO A;  4IZK B;  4USM A;  3M6A A;  2BA1 G;  1OYS A;  4OX9 I;  4MU3 A;  2PNL A;  4OKG A;  5FLX Q;  1Z0W A;  4JI3 E;  1S16 A;  4DV3 I;  3QT8 A;  4NXM E;  1EI1 A;  4AID A;  4LOM A;  4JI6 E;  4DV0 E;  1S4E A;  1XNR E;  3GME A;  2GS8 A;  1I94 I;  1NHJ A;  3PYG A;  1R6M A;  2NN6 C;  4LF5 E;  2BA0 G;  3M7N G;  4WUC A;  4FWG A;  1IBK I;  2V2Z A;  1HNX E;  3PYD A;  2E5L E;  4N3O A;  5A2Q Q;  2CVE A;  4LF9 I;  3P06 A;  4FW6 A;  4LCH A;  4DPT A;  4UT4 A;  1Z59 A;  2Z5B B;  1KKH A;  1N34 E;  3T1H I;  4IZK A;  2IER A;  3HUL A;  1QZR A;  1KIJ A;  2IOQ A;  2HKE A;  2F1D A;  1ZM2 A;  3JAM C;  4LF8 I;  4NXN I;  4B3M E;  1UDQ A;  5DNX A;  1XMO E;  4DV5 I;  4B3S I;  4FW3 A;  2HK2 A;  4P7A A;  3M85 D;  4DV2 E;  2DEJ A;  3LNU A;  3HKM A;  4DV7 E;  2WNR B;  4B3T E;  4URL A;  4DU7 A;  5EKW A;  4HXZ A;  1WUU A;  4MYU A;  2OI2 A;  4YY3 I;  2UXD E;  5JEA D;  2O1U A;  5L3J A;  5IWA E;  4JYA I;  5JEA B;  1VIS A;  4X66 I;  1H7S A;  2WP8 B;  4DUY I;  4DU8 A;  1HR0 E;  4DPU A;  4JI2 E;  5DNL A;  2C39 B;  4HYM A;  1IBL E;  5FWK A;  3PS3 A;  5IT9 Q;  2C38 B;  2PNM A;  1YHC A;  2BR2 B;  2ZM6 I;  2VQE E;  4PU9 A;  1ZM4 A;  4RPF A;  1Z0T A;  3CDI A;  3M85 G;  4JI3 I;  2O1V A;  5LMU E;  2JEA B;  4DV1 E;  5K36 E;  1ZM9 A;  4NXM I;  4JI1 E;  4NBQ A;  1YH8 A;  2V8P A;  4JI6 I;  2BA1 D;  4DV0 I;  1XNR I;  3K17 A;  2JEB B;  1N0U A;  1PIE A;  3U1K A;  2GO4 A;  5EL9 A;  4JI0 E;  4LF5 I;  3J81 Q;  2XEX A;  1UDO A;  2ZBK B;  3B78 A;  1A6F A;  2WNR A;  4FW7 A;  3KRN A;  2E5L I;  4LFC E;  4DUZ I;  2E1R A;  5C0X E;  4JI4 E;  1N36 I;  1Z5A A;  3ZKD A;  1Z0G A;  5JEA A;  1D6T A;  1XMQ E;  4XTJ A;  1E3H A;  1FJG E;  2WP8 A;  4KHP E;  4ZVI A;  1N34 I;  2R3V A;  4AIM A;  2C39 A;  3P3G A;  3QT7 A;  5DRO A;  2C38 A;  3OTO E;  2BR2 A;  2BV3 A;  1PKP A;  3J7A M;  2BM0 A;  4B3M I;  4X64 I;  4DR2 E;  3GON A;  1RRE A;  2X36 A;  2JEA A;  3T1Y I;  2F4V E;  3DD6 A;  2HFS A;  2HKJ A;  3P76 A;  5JEA C;  4OO1 E;  4P52 A;  4DV7 I;  4AQY E;  1UDN A;  1N0V C;  2A2D A;  2JEB A;  2UUA I;  4DPY A;  1Y5Y A;  2V2Q A;  1P42 A;  2R42 A;  3U1Y A;  1ZXN A;  2UXD I;  1BKN A;  5IWA I;  4MU0 A;  4DR3 I;  3V5R A;  4LCG A;  4YHH E;  4JI8 I;  4MU4 A;  3WU4 A;  4MU1 A;  1HR0 I;  2UU9 E;  4DR1 I;  4DV6 E;  2HHH E;  4JI2 I;  1USV A;  4FW9 A;  1IBL I;  2CZ9 A;  1FWK A;  1VI7 A;  2VQE I;  4MQY A;  4LF7 E;  5FLX C;  5LMU I;  3CDJ A;  4LF6 E;  4BA2 A;  5K36 F;  4DR5 E;  4DR7 E;  4LFB E;  2Q2E B;  5LMN I;  4JI1 I;  4IFD E;  3ZZT A;  1Z0E A;  2UUC E;  4OO1 B;  1J5E E;  1HNZ E;  4DXL A;  2CGE A;  4WUB A;  2O1T A;  2NPF A;  5BR8 E;  1Y4S A;  2O3Z A;  3L7Z B;  3PYF A;  4LFC I;  2NN6 E;  2VQF E;  5C0X F;  3LTO A;  3K1J A;  4JI4 I;  4LFA I;  3Q6M A;  1N33 I;  2GQ0 A;  2A2C A;  3CWV A;  4QNJ A;  3Q6N A;  5A2Q C;  1FJG I;  4KHP I;  4JI5 I;  4X65 E;  3PYE A;  4LF4 E;  3WU3 A;  3K85 A;  1FKA E;  3PS1 A;  2Z5E A;  1XNQ E;  4DV3 E;  2LJP A;  4LCF A; 
#chains in the Genus database with same CATH homology
 3ZZU A;  4MYT A;  2EFG A;  4DR2 I;  2UXB E;  4K0K E;  1FI4 A;  2AJ4 A;  2F4V I;  1U2R A;  1H73 A;  4JV5 E;  1IBK E;  4B3R E;  4Z7Y A;  1K47 A;  4AQY I;  2Z5C B;  1HNW E;  4DR4 E;  4HY1 A;  3QT6 A;  1EA6 A;  4DPW A;  2HK3 A;  2V34 A;  1HNX I;  4YHH I;  1H74 A;  3F0N A;  2UUB E;  2HHH I;  1FNM A;  4DV6 I;  3HJC A;  1FWL A;  2WW4 A;  2J7K A;  5IT9 C;  2CG9 A;  1UEK A;  4DV5 E;  4B3S E;  2V2V A;  2HFU A;  4LF7 I;  4LF6 I;  4DR5 I;  4GKJ E;  4HAC B;  4DR7 I;  4LFB I;  3WU5 A;  4GKK E;  3J80 C;  2UUC I;  1XMO I;  1J5E I;  1Z0B A;  1HNZ I;  1B63 A;  1IBM E;  1Z5C A;  5BR8 I;  2Z5C A;  4DV2 I;  1KTV A;  3J81 C;  4DUY E;  1Y4U A;  2VQF I;  4B3T I;  1H72 C;  4JI7 E;  2DEI A;  4DPX A;  1OJ4 A;  3PRY A;  2ZM6 E;  1ZXM A;  4X65 I;  4LF4 I;  1MU5 A;  4USK A;  1XNQ I;  1XHK A;  3JAM Q;  4WUD A;  4KQV A;  2UXB I;  4K0K I;  4DR6 E;  4HAC A;  3J7A G;  4DV1 I;  2VF3 A;  4JV5 I;  1HK7 A;  4B3R I;  4I3H A;  1Z5B A;  4UTG A;  4DUZ E;  2UXC E;  1HNW I;  4DR4 I;  1N36 E;  4JI0 I;  3LPS A;  4DV4 E;  4X62 E;  3B8H A;  4FWD A;  1N32 E;  4IZJ D;  1MX0 A;  4IZJ B;  4FN5 A;  2UUB I;  4Z7C A;  3Q1Q A;  3B82 A;  1XMQ I;  2BM1 A;  4OX9 E;  1ZM3 A;  4X64 E;  4EMD A;  3T1Y E;  1RR9 A;  3OTO I;  1NHI A;  4GKJ I;  4FWH A;  4ED4 A;  4GKK I;  2UUA E;  1I94 E;  1MG7 A;  4R1F A;  1IBM I;  2ZIT A;  3V2U C;  4DR3 E;  1PVG A;  4JI8 E;  4DR1 E;  4JI7 I;  4PRX A;  2Z5B A;  1NZ0 A;  4LF9 E;  1H7U A;  3T1H E;  5GMD A;  3ZZ0 A;  4IZJ A;  3ZM7 A;  5GME A;  2UU9 I;  1USU A;  1Z0C A;  3ZKB A;  3J80 Q;  1DAR A;  4JG4 A;  5LMN E;  4LF8 E;  4NXN E;  4M1K A;  3H4L A;  1B62 A;  3D4J A;  4DR6 I;  1KVK A;  2O1W A;  1Z0V A;  2UXC I;  4PRV A;  4LFA E;  4YY3 E;  1N33 E;  3QT5 A;  4DV4 I;  4JYA E;  4X62 I;  4JI5 E;  2IOP A;  4X66 E;  2X7I A;  3WU6 A;  1N32 I;  1Y6Z A;  5LL6 R;  1NHH A;  1ELO A;  4IZK B;  4USM A;  3M6A A;  4OX9 I;  2PNL A;  5FLX Q;  1Z0W A;  4JI3 E;  1S16 A;  4DV3 I;  3QT8 A;  4NXM E;  1EI1 A;  4JI6 E;  4DV0 E;  1S4E A;  1XNR E;  2GS8 A;  1I94 I;  1NHJ A;  3PYG A;  4LF5 E;  4WUC A;  4FWG A;  1IBK I;  2V2Z A;  1HNX E;  3PYD A;  2E5L E;  4N3O A;  5A2Q Q;  4LF9 I;  3P06 A;  4DPT A;  4UT4 A;  1Z59 A;  2Z5B B;  1KKH A;  1N34 E;  3T1H I;  4IZK A;  3HUL A;  1QZR A;  1KIJ A;  2IOQ A;  2HKE A;  1ZM2 A;  3JAM C;  4LF8 I;  4NXN I;  4B3M E;  1XMO E;  4DV5 I;  4B3S I;  2HK2 A;  4P7A A;  4DV2 E;  2DEJ A;  3LNU A;  4DV7 E;  4B3T E;  4URL A;  4DU7 A;  4HXZ A;  1WUU A;  4MYU A;  2OI2 A;  4YY3 I;  2UXD E;  2O1U A;  5L3J A;  5IWA E;  4JYA I;  1VIS A;  4X66 I;  1H7S A;  4DUY I;  4DU8 A;  1HR0 E;  4DPU A;  4JI2 E;  4HYM A;  1IBL E;  5FWK A;  5IT9 Q;  2PNM A;  2ZM6 I;  2VQE E;  4PU9 A;  1ZM4 A;  4RPF A;  1Z0T A;  4JI3 I;  2O1V A;  5LMU E;  4DV1 E;  1ZM9 A;  4NXM I;  4JI1 E;  2V8P A;  4JI6 I;  4DV0 I;  1XNR I;  3K17 A;  1N0U A;  1PIE A;  4JI0 E;  4LF5 I;  3J81 Q;  2XEX A;  2ZBK B;  3B78 A;  1A6F A;  2E5L I;  4LFC E;  4DUZ I;  2E1R A;  4JI4 E;  1N36 I;  1Z5A A;  3ZKD A;  1Z0G A;  1D6T A;  1XMQ E;  4XTJ A;  1FJG E;  4KHP E;  4ZVI A;  1N34 I;  2R3V A;  3QT7 A;  3OTO E;  2BV3 A;  1PKP A;  3J7A M;  2BM0 A;  4B3M I;  4X64 I;  4DR2 E;  3GON A;  1RRE A;  2X36 A;  3T1Y I;  2F4V E;  2HFS A;  2HKJ A;  4P52 A;  4DV7 I;  4AQY E;  1N0V C;  2A2D A;  2UUA I;  4DPY A;  2V2Q A;  2R42 A;  1ZXN A;  2UXD I;  1BKN A;  5IWA I;  4DR3 I;  3V5R A;  4YHH E;  4JI8 I;  3WU4 A;  1HR0 I;  2UU9 E;  4DR1 I;  4DV6 E;  2HHH E;  4JI2 I;  1USV A;  4FW9 A;  1IBL I;  2CZ9 A;  1FWK A;  2VQE I;  4LF7 E;  5FLX C;  5LMU I;  4LF6 E;  4DR5 E;  4DR7 E;  4LFB E;  2Q2E B;  5LMN I;  4JI1 I;  3ZZT A;  1Z0E A;  2UUC E;  1J5E E;  1HNZ E;  4DXL A;  2CGE A;  4WUB A;  2O1T A;  2NPF A;  5BR8 E;  1Y4S A;  3PYF A;  4LFC I;  2VQF E;  3LTO A;  3K1J A;  4JI4 I;  4LFA I;  3Q6M A;  1N33 I;  2GQ0 A;  2A2C A;  3CWV A;  3Q6N A;  5A2Q C;  1FJG I;  4KHP I;  4JI5 I;  4X65 E;  3PYE A;  4LF4 E;  3WU3 A;  3K85 A;  1FKA E;  2Z5E A;  1XNQ E;  4DV3 E;  2LJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...