1HNXI

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
127
structure length
127
Chain Sequence
b'EQYYGTGRRKEAVARVFLRPGNGKVTVNGQDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDYRAKLKPLGFLTRDARVVERKKYGKHKARRAPQYSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
molecule tags Ribosome
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 26
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF00380 Ribosomal_S9 Ribosomal protein S9/S16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 1hnxI00
2VQEE 1Z0EA 1KKHA 4ZVIA 2HHHI 1B62A 5A2QC 3B78A 4KQVA 4B3TI 4JG4A 2F4VE 2E1RA 1ZM9A 1EA6A 3JAMC 2J7KA 4PRVA 2UXCI 2VQFI 4LF5E 4DXLA 2UXBI 1Z0GA 1IBKE 1XNRE 1H73A 2UXDI 4DU8A 3PYGA 3T1HE 3B82A 1N33E 3QT6A 4B3SE 1N0UA 4DV1E 3ZM7A 4JI8I 4B3TE 1Z0VA 1Z0BA 4DUYI 1PVGA 4LF9I 1XMOI 4UTGA 1KVKA 4DR5E 4USKA 4DV5I 4DV0E 4DPTA 1IBMI 1H74A 4AQYE 4JV5I 5LMNE 4X62I 1N36I 2HKEA 1K47A 2Q2EB 4KHPI 1XHKA 4YHHI 2F4VI 3H4LA 4PU9A 3PYFA 1FI4A 1S16A 1Z5CA 4JI4E 4LF9E 1XNQE 1Z0WA 1FJGI 1NHJA 2ZITA 5BR8I 2V2VA 4JI2E 3QT7A 4HACA 2E5LE 3K1JA 1XMQE 1N32E 4DR1I 5FLXC 4KHPE 1DARA 2ZBKB 4DPYA 2UUBI 2BM0A 3WU4A 4DV6E 4FWHA 4LF5I 2WW4A 4R1FA 1RR9A 1ZM3A 4DV0I 4DV1I 4YY3E 4JI1E 4K0KI 1D6TA 3T1HI 3Q1QA 2DEJA 5IT9Q 4DR3E 1ZM2A 4YY3I 1NHHA 2BV3A 1N36E 2X7IA 3ZKBA 4LFAE 1N34I 4NXME 1IBME 4LF7E 4JI5I 3B8HA 1HR0E 4GKKE 1U2RA 2CZ9A 1N34E 1FJGE 2ZM6E 1FWLA 4JI5E 4LF7I 4URLA 4JYAE 1HNWI 4LFCE 5LMUI 4DR7I 4LFBI 4OX9I 4DPWA 1VISA 1H7SA 4DR6E 5LMUE 1XNRI 4LFBE 5IWAI 4LF8E 4FWGA 5A2QQ 4JI8E 5IT9C 1ZXMA 3J7AG 2HFUA 3T1YI 4JI7E 3V2UC 3ZZUA 3WU6A 4HY1A 4DV2I 1H72C 3J80Q 4GKKI 1Z5BA 4K0KE 4JI0I 4X64I 4DV7I 4JI3I 3WU3A 2UUBE 4JYAI 1HNWE 3J81Q 2V2ZA 4JI7I 4DR2E 1A6FA 4UT4A 2UXCE 4I3HA 4JI1I 4Z7CA 5LL6R 2HFSA 3CWVA 3ZZ0A 4X65E 3GONA 5GMDA 2ZM6I 3V5RA 4JI3E 4MYTA 3WU5A 4DR1E 2UUCE 4DR4I 2V8PA 1I94I 4DV3E 4NXNE 5BR8E 1Z5AA 1N0VC 1J5EI 4B3RI 1NZ0A 2AJ4A 5LMNI 4LF4I 2BM1A 4HYMA 4LF6E 4DR7E 4X65I 4OX9E 2HK2A 1HNXE 3HULA 4P52A 4DV3I 3JAMQ 4DUZI 2UUCI 1PKPA 3K17A 4WUCA 4FN5A 4B3SI 2UXBE 2VF3A 4DU7A 4NXMI 2VQFE 1XNQI 1HNZE 4B3ME 1J5EE 4FWDA 2V34A 1IBKI 4B3RE 3LPSA 4WUDA 2LJPA 4YHHE 1QZRA 4PRXA 1N33I 2UU9I 1MG7A 4X66E 1Z0CA 4DV4I 1IBLE 1XMOE 4P7AA 2HK3A 1EI1A 1KTVA 3QT5A 4DR5I 1ZXNA 4X66I 1PIEA 4DV2E 1I94E 2XEXA 4HACB 5IWAE 2A2CA 1HNXI 4FW9A 4JI2I 4LFAI 4LF6I 4JI4I 1FWKA 4GKJI 1FKAE 4DPXA 2EFGA 1HR0I 1IBLI 1Z0TA 1MX0A 1ELOA 1N32I 4JI0E 4JI6I 4DR2I 1Z59A 2UUAE 2OI2A 3F0NA 4JV5E 4XTJA 3J81C 4LF8I 2NPFA 5GMEA 2VQEI 1UEKA 5L3JA 4DV5E 3OTOI 4WUBA 1HNZI 3ZZTA 4JI6E 4NXNI 1WUUA 1NHIA 2UUAI 4DPUA 2R3VA 4DR4E 3PYEA 2X36A 1KIJA 1H7UA 2A2DA 3PYDA 2UU9E 1ZM4A 4X64E 4DV7E 3J80C 4ED4A 2DEIA 1S4EA 4LF4E 2E5LI 3J7AM 4GKJE 4DUZE 1XMQI 5FLXQ 4MYUA 1B63A 2GS8A 4Z7YA 1RREA 4B3MI 4AQYI 2HHHE 3D4JA 4X62E 4DR6I 1MU5A 4LFCI 1BKNA 3LTOA 1OJ4A 4DV6I 4DUYE 4M1KA 4EMDA 4DR3I 2R42A 4USMA 2V2QA 2HKJA 3M6AA 4HXZA 3T1YE 3OTOE 3ZKDA 3QT8A 4DV4E 3LNUA 1FNMA 4RPFA 2UXDE
chains in the Genus database with same CATH superfamily
2NN6B 2VQEE 1Z0EA 1YHCA 1KKHA 3GCMA 3P3CA 5DRRA 4ZVIA 2HHHI 1B62A 5A2QC 3B78A 2BA0D 4KQVA 5C0XC 4B3TI 4JG4A 2F4VE 4U3DA 1UDQA 2E1RA 1ZM9A 1EA6A 3JAMC 5K36A 2J7KA 4PRVA 2UXCI 3NZKA 4AIDA 2VQFI 2JE6A 1HK7A 4LF5E 4DXLA 2UXBI 1Z0GA 1IBKE 2C38B 1XNRE 5C0XF 5C0XD 4MU4A 1H73A 2CG9A 2UXDI 4DU8A 4FW7A 3PYGA 3T1HE 3B82A 3P76A 5K36F 1N33E 5K36D 3QT6A 4B3SE 1N0UA 2PNLA 4DV1E 3ZM7A 4JI8I 4QNKA 4B3TE 1Z0VA 1Z0BA 4DUYI 1PVGA 4LF9I 1XMOI 4UTGA 1KVKA 4DR5E 4USKA 4DV5I 4DV0E 4DPTA 1IBMI 2GQ0A 1H74A 2PNZA 4AQYE 4JV5I 5LMNE 4X62I 2NN6E 5JEAB 1N36I 2HKEA 1K47A 3PS1A 2Q2EB 2PO1A 2IESA 4KHPI 2O3ZA 1USUA 1XHKA 4YHHI 2F4VI 3H4LA 4PU9A 3CDJA 2VESA 3PYFA 1FI4A 1S16A 1Z5CA 4JI4E 4LF9E 1XNQE 4IFDA 1Z0WA 1FJGI 3U1YA 2NN6C 1NHJA 2ZITA 5BR8I 2V2VA 4JI2E 3QT7A 4HACA 2E5LE 4LCHA 3K1JA 1XMQE 1N32E 4DR1I 5FLXC 4KHPE 1DARA 2ZBKB 4DPYA 2UUBI 2BM0A 2JE6B 3WU4A 3HKMA 4BA2B 4DV6E 2PO0B 4FWHA 2WP8A 4LF5I 4OO1C 2WW4A 3Q6MA 4R1FA 1RR9A 1ZM3A 4DV0I 2Z5EA 4DV1I 4YY3E 4JI1E 4BA1A 4IZJA 4K0KI 1D6TA 2Z5CA 2BA1G 4IZKA 3T1HI 3Q1QA 2DEJA 5IT9Q 4DR3E 1ZM2A 2J65A 1UDNA 4YY3I 4OKGA 2C39B 3P06A 2Z5BB 1NHHA 2BV3A 4LOMA 1OYPA 1N36E 2X7IA 3P3GA 3ZKBA 4LFAE 2GO3A 2JT2A 1N34I 4NXME 1E3PA 4BA2A 1IBME 2NN6D 2NN6F 4JI5I 4LF7E 3B8HA 1HR0E 4GKKE 1U2RA 2CZ9A 1N34E 1FJGE 4J3DA 5DRPA 2ZM6E 1FWLA 4JI5E 4LF7I 4URLA 1Y5YA 4JYAE 1HNWI 4LFCE 5LMUI 4IFDD 4IFDF 4DR7I 4LFBI 1USVA 4OX9I 4DPWA 1VISA 1UDSA 1H7SA 4DR6E 2O1TA 5ELWA 5LMUE 3CDIA 1XNRI 4LFBE 5IWAI 4LF8E 1R6LA 4FWGA 4AIMA 5A2QQ 4JI8E 5IT9C 4IFDE 1ZXMA 3L7ZA 3J7AG 2HFUA 3T1YI 4JI7E 3V2UC 3ZZUA 3WU6A 4LPFA 4HY1A 4DV2I 2GO4A 1H72C 3J80Q 4GKKI 1Z5BA 4K0KE 4JI0I 4X64I 4DV7I 4JI3I 4U3BA 3WU3A 2UUBE 5DNLA 4JYAI 1HNWE 3J81Q 2V2ZA 4LCFA 2O1WA 3PS2A 2O1UA 4JI7I 5K36C 4DR2E 1A6FA 4UT4A 4AM3A 2UXCE 4I3HA 5JEAC 3K85A 4MQYA 4JI1I 2IERA 4Z7CA 5LL6R 2HFSA 2NN6A 3CWVA 2Z5BA 2IOPA 3ZZ0A 4X65E 5EL9A 3GONA 5GMDA 5EKWA 2ZM6I 2CVEA 3M85G 3V5RA 4BA1B 4JI3E 2C37A 4OZEA 2AE8A 4MYTA 3WU5A 4MU1A 4DR1E 2UUCE 4DR4I 2V8PA 1I94I 4DV3E 4NXNE 3M7ND 5BR8E 1Y4SA 4QNJA 4IZJD 2PNMA 1Z5AA 2WNRB 3Q6NA 4FW3A 2BA0G 1N0VC 4MU0A 1P42A 1J5EI 4B3RI 1NZ0A 2AJ4A 5LMNI 4LF4I 2BM1A 4HYMA 4LF6E 4DR7E 4X65I 1Y6ZA 3M85D 4OX9E 2HK2A 1HNXE 3HULA 4P52A 4DV3I 2JEAA 3JAMQ 4DUZI 2UUCI 1PKPA 3DD6A 4MU3A 3K17A 4WUCA 4FN5A 2PNZB 4B3SI 4FW5A 2UXBE 2VF3A 3GLLA 4MDTA 4DU7A 4NXMI 2VQFE 1XNQI 1HNZE 4B3ME 1J5EE 4FWDA 2V34A 1IBKI 2C39A 2O1VA 4B3RE 3LPSA 4WUDA 1OYRA 2LJPA 5FWKA 5JEAA 4YHHE 3U1KA 2JEAB 4N3OA 1QZRA 4IZKB 4PRXA 1UDOA 1N33I 2F1DA 2BA1D 2UU9I 1MG7A 5C0XB 4X66E 1Z0CA 4DV4I 1IBLE 1XMOE 2WNRA 4P7AA 2HK3A 1EI1A 1KTVA 4OO1B 3QT5A 4DR5I 1ZXNA 4X66I 1XXEA 1PIEA 4GQUA 4DV2E 1I94E 2XEXA 4HACB 5IWAE 4IFDC 4NBQA 1Y60A 2A2CA 1HNXI 2PO0A 4FW9A 1RHYA 4IFDB 4JI2I 4OO1A 4LFAI 4LF6I 1Y4UA 2PO2A 4JI4I 1FWKA 3PS3A 5C0XA 4GKJI 5K36B 2Z5CB 1FKAE 4ISAA 4IZJB 4DPXA 2EFGA 1HR0I 1IBLI 1Z0TA 1MX0A 5DRQA 1ELOA 1N32I 4JI0E 4JI6I 4DR2I 1Z59A 2UUAE 3HJCA 2OI2A 3KRNA 3F0NA 4JV5E 5K36E 4XTJA 3J81C 4LF8I 2NPFA 5GMEA 2C37B 3H1CA 3UHMA 2VQEI 1UEKA 2PO1B 5L3JA 4DV5E 3OTOI 4WUBA 2PO2B 1HNZI 4OO1D 4OO1F 3ZZTA 4JI6E 4NXNI 2BR2B 1WUUA 1NHIA 2UUAI 3M7NG 5JEAF 5JEAD 3P3EA 4DPUA 2R3VA 4DR4E 3PYEA 1VI7A 4OO1E 2CGEA 2X36A 1KIJA 3PRYA 1H7UA 1YH8A 2A2DA 5C0XE 3PYDA 2UU9E 1ZM4A 4X64E 4DV7E 3J80C 2JEBB 4ED4A 2DEIA 1S4EA 4LF4E 2E5LI 3J7AM 4GKJE 4DUZE 1XMQI 2BR2A 5FLXQ 4FW4A 4MYUA 1B63A 2C38A 4LCGA 2GS8A 4Z7YA 1RREA 4FW6A 4B3MI 4AQYI 1OYSA 3GMEA 3D4JA 2HHHE 4X62E 4DR6I 3L7ZB 1MU5A 2IOQA 1BKNA 4LFCI 2JEBA 3LTOA 5JEAE 1OJ4A 1E3HA 4DV6I 4DUYE 4M1KA 4EMDA 3B4TA 2R42A 4USMA 4DR3I 2V2QA 2HKJA 3M6AA 4HXZA 5DNXA 3T1YE 3OTOE 3ZKDA 3QT8A 4IS9A 2WP8B 5DROA 1R6MA 4DV4E 3LNUA 1FNMA 4RPFA 2UXDE
chains in the Genus database with same CATH topology
2VQEE 1Z0EA 1KKHA 4ZVIA 2HHHI 1B62A 5A2QC 3B78A 4KQVA 4B3TI 4JG4A 2F4VE 2E1RA 1ZM9A 1EA6A 3JAMC 2J7KA 4PRVA 2UXCI 2VQFI 1HK7A 4LF5E 4DXLA 2UXBI 1Z0GA 1IBKE 1XNRE 1H73A 2CG9A 2UXDI 4DU8A 3PYGA 3T1HE 3B82A 1N33E 3QT6A 4B3SE 1N0UA 2PNLA 4DV1E 3ZM7A 4JI8I 4B3TE 1Z0VA 1Z0BA 4DUYI 1PVGA 4LF9I 1XMOI 4UTGA 1KVKA 4DR5E 4USKA 4DV5I 4DV0E 4DPTA 1IBMI 2GQ0A 1H74A 4AQYE 4JV5I 5LMNE 4X62I 1N36I 2HKEA 1K47A 2Q2EB 4KHPI 1USUA 1XHKA 4YHHI 2F4VI 3H4LA 4PU9A 3PYFA 1FI4A 1S16A 1Z5CA 4JI4E 4LF9E 1XNQE 1Z0WA 1FJGI 1NHJA 2ZITA 5BR8I 2V2VA 4JI2E 3QT7A 4HACA 2E5LE 3K1JA 1XMQE 1N32E 4DR1I 5FLXC 4KHPE 1DARA 2UUBI 2ZBKB 4DPYA 2BM0A 3WU4A 4DV6E 4FWHA 4LF5I 2WW4A 3Q6MA 4R1FA 1RR9A 1ZM3A 4DV0I 2Z5EA 4DV1I 4YY3E 4JI1E 4IZJA 4K0KI 1D6TA 2Z5CA 4IZKA 3T1HI 3Q1QA 2DEJA 5IT9Q 4DR3E 1ZM2A 4YY3I 3P06A 2Z5BB 1NHHA 2BV3A 1N36E 2X7IA 3ZKBA 4LFAE 1N34I 4NXME 1IBME 4JI5I 4LF7E 3B8HA 1HR0E 4GKKE 1U2RA 2CZ9A 1N34E 1FJGE 2ZM6E 1FWLA 4JI5E 4LF7I 4URLA 4JYAE 1HNWI 4LFCE 5LMUI 4DR7I 4LFBI 1USVA 4OX9I 4DPWA 1VISA 1H7SA 4DR6E 2O1TA 5LMUE 1XNRI 4LFBE 5IWAI 4LF8E 4FWGA 5A2QQ 5IT9C 4JI8E 1ZXMA 3J7AG 2HFUA 3T1YI 4JI7E 3V2UC 3ZZUA 3WU6A 4HY1A 4DV2I 1H72C 3J80Q 4GKKI 1Z5BA 4K0KE 4JI0I 4X64I 4DV7I 4JI3I 3WU3A 2UUBE 4JYAI 1HNWE 3J81Q 2V2ZA 2O1WA 2O1UA 4JI7I 4DR2E 1A6FA 4UT4A 2UXCE 4I3HA 3K85A 4JI1I 4Z7CA 5LL6R 2HFSA 3CWVA 2Z5BA 2IOPA 3ZZ0A 4X65E 3GONA 5GMDA 2ZM6I 3V5RA 4JI3E 4MYTA 3WU5A 4DR1E 2UUCE 4DR4I 2V8PA 1I94I 4DV3E 4NXNE 5BR8E 1Y4SA 4IZJD 2PNMA 1Z5AA 3Q6NA 1N0VC 1J5EI 4B3RI 1NZ0A 2AJ4A 5LMNI 4LF4I 2BM1A 4HYMA 4LF6E 4DR7E 4X65I 1Y6ZA 4OX9E 2HK2A 1HNXE 3HULA 4P52A 4DV3I 3JAMQ 4DUZI 2UUCI 1PKPA 3K17A 4WUCA 4FN5A 4B3SI 2UXBE 2VF3A 4DU7A 4NXMI 2VQFE 1XNQI 1HNZE 4B3ME 1J5EE 4FWDA 2V34A 1IBKI 2O1VA 4B3RE 3LPSA 4WUDA 2LJPA 5FWKA 4YHHE 4N3OA 1QZRA 4IZKB 4PRXA 1N33I 2UU9I 1MG7A 4X66E 1Z0CA 4DV4I 1IBLE 1XMOE 4P7AA 2HK3A 1EI1A 1KTVA 3QT5A 4DR5I 1ZXNA 4X66I 1PIEA 4DV2E 1I94E 2XEXA 4HACB 5IWAE 2A2CA 1HNXI 4FW9A 4JI2I 4LFAI 4LF6I 1Y4UA 4JI4I 1FWKA 4GKJI 2Z5CB 1FKAE 4IZJB 4DPXA 2EFGA 1HR0I 1IBLI 1Z0TA 1MX0A 1ELOA 1N32I 4JI0E 4JI6I 4DR2I 1Z59A 2UUAE 3HJCA 2OI2A 3F0NA 4JV5E 4XTJA 3J81C 4LF8I 2NPFA 5GMEA 2VQEI 1UEKA 5L3JA 4DV5E 3OTOI 4WUBA 1HNZI 3ZZTA 4JI6E 4NXNI 1WUUA 1NHIA 2UUAI 4DPUA 2R3VA 4DR4E 3PYEA 2CGEA 2X36A 1KIJA 3PRYA 1H7UA 2A2DA 3PYDA 2UU9E 1ZM4A 4X64E 4DV7E 3J80C 4ED4A 2DEIA 1S4EA 4LF4E 2E5LI 3J7AM 4GKJE 4DUZE 1XMQI 5FLXQ 4MYUA 1B63A 2GS8A 4Z7YA 1RREA 4B3MI 4AQYI 2HHHE 3D4JA 4X62E 4DR6I 1MU5A 2IOQA 1BKNA 4LFCI 3LTOA 1OJ4A 4DV6I 4DUYE 4M1KA 4EMDA 4DR3I 2R42A 4USMA 2V2QA 2HKJA 3M6AA 4HXZA 3T1YE 3OTOE 3ZKDA 3QT8A 4DV4E 3LNUA 1FNMA 4RPFA 2UXDE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE E;  1Z0E A;  1KKH A;  4ZVI A;  2HHH I;  1B62 A;  5A2Q C;  3B78 A;  4KQV A;  4B3T I;  4JG4 A;  2F4V E;  2E1R A;  1ZM9 A;  1EA6 A;  3JAM C;  2J7K A;  4PRV A;  2UXC I;  2VQF I;  4LF5 E;  4DXL A;  2UXB I;  1Z0G A;  1IBK E;  1XNR E;  1H73 A;  2UXD I;  4DU8 A;  3PYG A;  3T1H E;  3B82 A;  1N33 E;  3QT6 A;  4B3S E;  1N0U A;  4DV1 E;  3ZM7 A;  4JI8 I;  4B3T E;  1Z0V A;  1Z0B A;  4DUY I;  1PVG A;  4LF9 I;  1XMO I;  4UTG A;  1KVK A;  4DR5 E;  4USK A;  4DV5 I;  4DV0 E;  4DPT A;  1IBM I;  1H74 A;  4AQY E;  4JV5 I;  5LMN E;  4X62 I;  1N36 I;  2HKE A;  1K47 A;  2Q2E B;  4KHP I;  1XHK A;  4YHH I;  2F4V I;  3H4L A;  4PU9 A;  3PYF A;  1FI4 A;  1S16 A;  1Z5C A;  4JI4 E;  4LF9 E;  1XNQ E;  1Z0W A;  1FJG I;  1NHJ A;  2ZIT A;  5BR8 I;  2V2V A;  4JI2 E;  3QT7 A;  4HAC A;  2E5L E;  3K1J A;  1XMQ E;  1N32 E;  4DR1 I;  5FLX C;  4KHP E;  1DAR A;  2ZBK B;  4DPY A;  2UUB I;  2BM0 A;  3WU4 A;  4DV6 E;  4FWH A;  4LF5 I;  2WW4 A;  4R1F A;  1RR9 A;  1ZM3 A;  4DV0 I;  4DV1 I;  4YY3 E;  4JI1 E;  4K0K I;  1D6T A;  3T1H I;  3Q1Q A;  2DEJ A;  5IT9 Q;  4DR3 E;  1ZM2 A;  4YY3 I;  1NHH A;  2BV3 A;  1N36 E;  2X7I A;  3ZKB A;  4LFA E;  1N34 I;  4NXM E;  1IBM E;  4LF7 E;  4JI5 I;  3B8H A;  1HR0 E;  4GKK E;  1U2R A;  2CZ9 A;  1N34 E;  1FJG E;  2ZM6 E;  1FWL A;  4JI5 E;  4LF7 I;  4URL A;  4JYA E;  1HNW I;  4LFC E;  5LMU I;  4DR7 I;  4LFB I;  4OX9 I;  4DPW A;  1VIS A;  1H7S A;  4DR6 E;  5LMU E;  1XNR I;  4LFB E;  5IWA I;  4LF8 E;  4FWG A;  5A2Q Q;  4JI8 E;  5IT9 C;  1ZXM A;  3J7A G;  2HFU A;  3T1Y I;  4JI7 E;  3V2U C;  3ZZU A;  3WU6 A;  4HY1 A;  4DV2 I;  1H72 C;  3J80 Q;  4GKK I;  1Z5B A;  4K0K E;  4JI0 I;  4X64 I;  4DV7 I;  4JI3 I;  3WU3 A;  2UUB E;  4JYA I;  1HNW E;  3J81 Q;  2V2Z A;  4JI7 I;  4DR2 E;  1A6F A;  4UT4 A;  2UXC E;  4I3H A;  4JI1 I;  4Z7C A;  5LL6 R;  2HFS A;  3CWV A;  3ZZ0 A;  4X65 E;  3GON A;  5GMD A;  2ZM6 I;  3V5R A;  4JI3 E;  4MYT A;  3WU5 A;  4DR1 E;  2UUC E;  4DR4 I;  2V8P A;  1I94 I;  4DV3 E;  4NXN E;  5BR8 E;  1Z5A A;  1N0V C;  1J5E I;  4B3R I;  1NZ0 A;  2AJ4 A;  5LMN I;  4LF4 I;  2BM1 A;  4HYM A;  4LF6 E;  4DR7 E;  4X65 I;  4OX9 E;  2HK2 A;  1HNX E;  3HUL A;  4P52 A;  4DV3 I;  3JAM Q;  4DUZ I;  2UUC I;  1PKP A;  3K17 A;  4WUC A;  4FN5 A;  4B3S I;  2UXB E;  2VF3 A;  4DU7 A;  4NXM I;  2VQF E;  1XNQ I;  1HNZ E;  4B3M E;  1J5E E;  4FWD A;  2V34 A;  1IBK I;  4B3R E;  3LPS A;  4WUD A;  2LJP A;  4YHH E;  1QZR A;  4PRX A;  1N33 I;  2UU9 I;  1MG7 A;  4X66 E;  1Z0C A;  4DV4 I;  1IBL E;  1XMO E;  4P7A A;  2HK3 A;  1EI1 A;  1KTV A;  3QT5 A;  4DR5 I;  1ZXN A;  4X66 I;  1PIE A;  4DV2 E;  1I94 E;  2XEX A;  4HAC B;  5IWA E;  2A2C A;  1HNX I;  4FW9 A;  4JI2 I;  4LFA I;  4LF6 I;  4JI4 I;  1FWK A;  4GKJ I;  1FKA E;  4DPX A;  2EFG A;  1HR0 I;  1IBL I;  1Z0T A;  1MX0 A;  1ELO A;  1N32 I;  4JI0 E;  4JI6 I;  4DR2 I;  1Z59 A;  2UUA E;  2OI2 A;  3F0N A;  4JV5 E;  4XTJ A;  3J81 C;  4LF8 I;  2NPF A;  5GME A;  2VQE I;  1UEK A;  5L3J A;  4DV5 E;  3OTO I;  4WUB A;  1HNZ I;  3ZZT A;  4JI6 E;  4NXN I;  1WUU A;  1NHI A;  2UUA I;  4DPU A;  2R3V A;  4DR4 E;  3PYE A;  2X36 A;  1KIJ A;  1H7U A;  2A2D A;  3PYD A;  2UU9 E;  1ZM4 A;  4X64 E;  4DV7 E;  3J80 C;  4ED4 A;  2DEI A;  1S4E A;  4LF4 E;  2E5L I;  3J7A M;  4GKJ E;  4DUZ E;  1XMQ I;  5FLX Q;  4MYU A;  1B63 A;  2GS8 A;  4Z7Y A;  1RRE A;  4B3M I;  4AQY I;  2HHH E;  3D4J A;  4X62 E;  4DR6 I;  1MU5 A;  4LFC I;  1BKN A;  3LTO A;  1OJ4 A;  4DV6 I;  4DUY E;  4M1K A;  4EMD A;  4DR3 I;  2R42 A;  4USM A;  2V2Q A;  2HKJ A;  3M6A A;  4HXZ A;  3T1Y E;  3OTO E;  3ZKD A;  3QT8 A;  4DV4 E;  3LNU A;  1FNM A;  4RPF A;  2UXD E; 
#chains in the Genus database with same CATH topology
 2NN6 B;  2VQE E;  1Z0E A;  1YHC A;  1KKH A;  3GCM A;  3P3C A;  5DRR A;  4ZVI A;  2HHH I;  1B62 A;  5A2Q C;  3B78 A;  2BA0 D;  4KQV A;  5C0X C;  4B3T I;  4JG4 A;  2F4V E;  4U3D A;  1UDQ A;  2E1R A;  1ZM9 A;  1EA6 A;  3JAM C;  5K36 A;  2J7K A;  4PRV A;  2UXC I;  3NZK A;  4AID A;  2VQF I;  2JE6 A;  1HK7 A;  4LF5 E;  4DXL A;  2UXB I;  1Z0G A;  1IBK E;  2C38 B;  1XNR E;  5C0X F;  5C0X D;  4MU4 A;  1H73 A;  2CG9 A;  2UXD I;  4DU8 A;  4FW7 A;  3PYG A;  3T1H E;  3B82 A;  3P76 A;  5K36 F;  1N33 E;  5K36 D;  3QT6 A;  4B3S E;  1N0U A;  2PNL A;  4DV1 E;  3ZM7 A;  4JI8 I;  4QNK A;  4B3T E;  1Z0V A;  1Z0B A;  4DUY I;  1PVG A;  4LF9 I;  1XMO I;  4UTG A;  1KVK A;  4DR5 E;  4USK A;  4DV5 I;  4DV0 E;  4DPT A;  1IBM I;  2GQ0 A;  1H74 A;  2PNZ A;  4AQY E;  4JV5 I;  5LMN E;  4X62 I;  2NN6 E;  5JEA B;  1N36 I;  2HKE A;  1K47 A;  3PS1 A;  2Q2E B;  2PO1 A;  2IES A;  4KHP I;  2O3Z A;  1USU A;  1XHK A;  4YHH I;  2F4V I;  3H4L A;  4PU9 A;  3CDJ A;  2VES A;  3PYF A;  1FI4 A;  1S16 A;  1Z5C A;  4JI4 E;  4LF9 E;  1XNQ E;  4IFD A;  1Z0W A;  1FJG I;  3U1Y A;  2NN6 C;  1NHJ A;  2ZIT A;  5BR8 I;  2V2V A;  4JI2 E;  3QT7 A;  4HAC A;  2E5L E;  4LCH A;  3K1J A;  1XMQ E;  1N32 E;  4DR1 I;  5FLX C;  4KHP E;  1DAR A;  2ZBK B;  4DPY A;  2UUB I;  2BM0 A;  2JE6 B;  3WU4 A;  3HKM A;  4BA2 B;  4DV6 E;  2PO0 B;  4FWH A;  2WP8 A;  4LF5 I;  4OO1 C;  2WW4 A;  3Q6M A;  4R1F A;  1RR9 A;  1ZM3 A;  4DV0 I;  2Z5E A;  4DV1 I;  4YY3 E;  4JI1 E;  4BA1 A;  4IZJ A;  4K0K I;  1D6T A;  2Z5C A;  2BA1 G;  4IZK A;  3T1H I;  3Q1Q A;  2DEJ A;  5IT9 Q;  4DR3 E;  1ZM2 A;  2J65 A;  1UDN A;  4YY3 I;  4OKG A;  2C39 B;  3P06 A;  2Z5B B;  1NHH A;  2BV3 A;  4LOM A;  1OYP A;  1N36 E;  2X7I A;  3P3G A;  3ZKB A;  4LFA E;  2GO3 A;  2JT2 A;  1N34 I;  4NXM E;  1E3P A;  4BA2 A;  1IBM E;  2NN6 D;  2NN6 F;  4JI5 I;  4LF7 E;  3B8H A;  1HR0 E;  4GKK E;  1U2R A;  2CZ9 A;  1N34 E;  1FJG E;  4J3D A;  5DRP A;  2ZM6 E;  1FWL A;  4JI5 E;  4LF7 I;  4URL A;  1Y5Y A;  4JYA E;  1HNW I;  4LFC E;  5LMU I;  4IFD D;  4IFD F;  4DR7 I;  4LFB I;  1USV A;  4OX9 I;  4DPW A;  1VIS A;  1UDS A;  1H7S A;  4DR6 E;  2O1T A;  5ELW A;  5LMU E;  3CDI A;  1XNR I;  4LFB E;  5IWA I;  4LF8 E;  1R6L A;  4FWG A;  4AIM A;  5A2Q Q;  4JI8 E;  5IT9 C;  4IFD E;  1ZXM A;  3L7Z A;  3J7A G;  2HFU A;  3T1Y I;  4JI7 E;  3V2U C;  3ZZU A;  3WU6 A;  4LPF A;  4HY1 A;  4DV2 I;  2GO4 A;  1H72 C;  3J80 Q;  4GKK I;  1Z5B A;  4K0K E;  4JI0 I;  4X64 I;  4DV7 I;  4JI3 I;  4U3B A;  3WU3 A;  2UUB E;  5DNL A;  4JYA I;  1HNW E;  3J81 Q;  2V2Z A;  4LCF A;  2O1W A;  3PS2 A;  2O1U A;  4JI7 I;  5K36 C;  4DR2 E;  1A6F A;  4UT4 A;  4AM3 A;  2UXC E;  4I3H A;  5JEA C;  3K85 A;  4MQY A;  4JI1 I;  2IER A;  4Z7C A;  5LL6 R;  2HFS A;  2NN6 A;  3CWV A;  2Z5B A;  2IOP A;  3ZZ0 A;  4X65 E;  5EL9 A;  3GON A;  5GMD A;  5EKW A;  2ZM6 I;  2CVE A;  3M85 G;  3V5R A;  4BA1 B;  4JI3 E;  2C37 A;  4OZE A;  2AE8 A;  4MYT A;  3WU5 A;  4MU1 A;  4DR1 E;  2UUC E;  4DR4 I;  2V8P A;  1I94 I;  4DV3 E;  4NXN E;  3M7N D;  5BR8 E;  1Y4S A;  4QNJ A;  4IZJ D;  2PNM A;  1Z5A A;  2WNR B;  3Q6N A;  4FW3 A;  2BA0 G;  1N0V C;  4MU0 A;  1P42 A;  1J5E I;  4B3R I;  1NZ0 A;  2AJ4 A;  5LMN I;  4LF4 I;  2BM1 A;  4HYM A;  4LF6 E;  4DR7 E;  4X65 I;  1Y6Z A;  3M85 D;  4OX9 E;  2HK2 A;  1HNX E;  3HUL A;  4P52 A;  4DV3 I;  2JEA A;  3JAM Q;  4DUZ I;  2UUC I;  1PKP A;  3DD6 A;  4MU3 A;  3K17 A;  4WUC A;  4FN5 A;  2PNZ B;  4B3S I;  4FW5 A;  2UXB E;  2VF3 A;  3GLL A;  4MDT A;  4DU7 A;  4NXM I;  2VQF E;  1XNQ I;  1HNZ E;  4B3M E;  1J5E E;  4FWD A;  2V34 A;  1IBK I;  2C39 A;  2O1V A;  4B3R E;  3LPS A;  4WUD A;  1OYR A;  2LJP A;  5FWK A;  5JEA A;  4YHH E;  3U1K A;  2JEA B;  4N3O A;  1QZR A;  4IZK B;  4PRX A;  1UDO A;  1N33 I;  2F1D A;  2BA1 D;  2UU9 I;  1MG7 A;  5C0X B;  4X66 E;  1Z0C A;  4DV4 I;  1IBL E;  1XMO E;  2WNR A;  4P7A A;  2HK3 A;  1EI1 A;  1KTV A;  4OO1 B;  3QT5 A;  4DR5 I;  1ZXN A;  4X66 I;  1XXE A;  1PIE A;  4GQU A;  4DV2 E;  1I94 E;  2XEX A;  4HAC B;  5IWA E;  4IFD C;  4NBQ A;  1Y60 A;  2A2C A;  1HNX I;  2PO0 A;  4FW9 A;  1RHY A;  4IFD B;  4JI2 I;  4OO1 A;  4LFA I;  4LF6 I;  1Y4U A;  2PO2 A;  4JI4 I;  1FWK A;  3PS3 A;  5C0X A;  4GKJ I;  5K36 B;  2Z5C B;  1FKA E;  4ISA A;  4IZJ B;  4DPX A;  2EFG A;  1HR0 I;  1IBL I;  1Z0T A;  1MX0 A;  5DRQ A;  1ELO A;  1N32 I;  4JI0 E;  4JI6 I;  4DR2 I;  1Z59 A;  2UUA E;  3HJC A;  2OI2 A;  3KRN A;  3F0N A;  4JV5 E;  5K36 E;  4XTJ A;  3J81 C;  4LF8 I;  2NPF A;  5GME A;  2C37 B;  3H1C A;  3UHM A;  2VQE I;  1UEK A;  2PO1 B;  5L3J A;  4DV5 E;  3OTO I;  4WUB A;  2PO2 B;  1HNZ I;  4OO1 D;  4OO1 F;  3ZZT A;  4JI6 E;  4NXN I;  2BR2 B;  1WUU A;  1NHI A;  2UUA I;  3M7N G;  5JEA F;  5JEA D;  3P3E A;  4DPU A;  2R3V A;  4DR4 E;  3PYE A;  1VI7 A;  4OO1 E;  2CGE A;  2X36 A;  1KIJ A;  3PRY A;  1H7U A;  1YH8 A;  2A2D A;  5C0X E;  3PYD A;  2UU9 E;  1ZM4 A;  4X64 E;  4DV7 E;  3J80 C;  2JEB B;  4ED4 A;  2DEI A;  1S4E A;  4LF4 E;  2E5L I;  3J7A M;  4GKJ E;  4DUZ E;  1XMQ I;  2BR2 A;  5FLX Q;  4FW4 A;  4MYU A;  1B63 A;  2C38 A;  4LCG A;  2GS8 A;  4Z7Y A;  1RRE A;  4FW6 A;  4B3M I;  4AQY I;  1OYS A;  3GME A;  3D4J A;  2HHH E;  4X62 E;  4DR6 I;  3L7Z B;  1MU5 A;  2IOQ A;  1BKN A;  4LFC I;  2JEB A;  3LTO A;  5JEA E;  1OJ4 A;  1E3H A;  4DV6 I;  4DUY E;  4M1K A;  4EMD A;  3B4T A;  2R42 A;  4USM A;  4DR3 I;  2V2Q A;  2HKJ A;  3M6A A;  4HXZ A;  5DNX A;  3T1Y E;  3OTO E;  3ZKD A;  3QT8 A;  4IS9 A;  2WP8 B;  5DRO A;  1R6M A;  4DV4 E;  3LNU A;  1FNM A;  4RPF A;  2UXD E; 
#chains in the Genus database with same CATH homology
 2VQE E;  1Z0E A;  1KKH A;  4ZVI A;  2HHH I;  1B62 A;  5A2Q C;  3B78 A;  4KQV A;  4B3T I;  4JG4 A;  2F4V E;  2E1R A;  1ZM9 A;  1EA6 A;  3JAM C;  2J7K A;  4PRV A;  2UXC I;  2VQF I;  1HK7 A;  4LF5 E;  4DXL A;  2UXB I;  1Z0G A;  1IBK E;  1XNR E;  1H73 A;  2CG9 A;  2UXD I;  4DU8 A;  3PYG A;  3T1H E;  3B82 A;  1N33 E;  3QT6 A;  4B3S E;  1N0U A;  2PNL A;  4DV1 E;  3ZM7 A;  4JI8 I;  4B3T E;  1Z0V A;  1Z0B A;  4DUY I;  1PVG A;  4LF9 I;  1XMO I;  4UTG A;  1KVK A;  4DR5 E;  4USK A;  4DV5 I;  4DV0 E;  4DPT A;  1IBM I;  2GQ0 A;  1H74 A;  4AQY E;  4JV5 I;  5LMN E;  4X62 I;  1N36 I;  2HKE A;  1K47 A;  2Q2E B;  4KHP I;  1USU A;  1XHK A;  4YHH I;  2F4V I;  3H4L A;  4PU9 A;  3PYF A;  1FI4 A;  1S16 A;  1Z5C A;  4JI4 E;  4LF9 E;  1XNQ E;  1Z0W A;  1FJG I;  1NHJ A;  2ZIT A;  5BR8 I;  2V2V A;  4JI2 E;  3QT7 A;  4HAC A;  2E5L E;  3K1J A;  1XMQ E;  1N32 E;  4DR1 I;  5FLX C;  4KHP E;  1DAR A;  2UUB I;  2ZBK B;  4DPY A;  2BM0 A;  3WU4 A;  4DV6 E;  4FWH A;  4LF5 I;  2WW4 A;  3Q6M A;  4R1F A;  1RR9 A;  1ZM3 A;  4DV0 I;  2Z5E A;  4DV1 I;  4YY3 E;  4JI1 E;  4IZJ A;  4K0K I;  1D6T A;  2Z5C A;  4IZK A;  3T1H I;  3Q1Q A;  2DEJ A;  5IT9 Q;  4DR3 E;  1ZM2 A;  4YY3 I;  3P06 A;  2Z5B B;  1NHH A;  2BV3 A;  1N36 E;  2X7I A;  3ZKB A;  4LFA E;  1N34 I;  4NXM E;  1IBM E;  4JI5 I;  4LF7 E;  3B8H A;  1HR0 E;  4GKK E;  1U2R A;  2CZ9 A;  1N34 E;  1FJG E;  2ZM6 E;  1FWL A;  4JI5 E;  4LF7 I;  4URL A;  4JYA E;  1HNW I;  4LFC E;  5LMU I;  4DR7 I;  4LFB I;  1USV A;  4OX9 I;  4DPW A;  1VIS A;  1H7S A;  4DR6 E;  2O1T A;  5LMU E;  1XNR I;  4LFB E;  5IWA I;  4LF8 E;  4FWG A;  5A2Q Q;  5IT9 C;  4JI8 E;  1ZXM A;  3J7A G;  2HFU A;  3T1Y I;  4JI7 E;  3V2U C;  3ZZU A;  3WU6 A;  4HY1 A;  4DV2 I;  1H72 C;  3J80 Q;  4GKK I;  1Z5B A;  4K0K E;  4JI0 I;  4X64 I;  4DV7 I;  4JI3 I;  3WU3 A;  2UUB E;  4JYA I;  1HNW E;  3J81 Q;  2V2Z A;  2O1W A;  2O1U A;  4JI7 I;  4DR2 E;  1A6F A;  4UT4 A;  2UXC E;  4I3H A;  3K85 A;  4JI1 I;  4Z7C A;  5LL6 R;  2HFS A;  3CWV A;  2Z5B A;  2IOP A;  3ZZ0 A;  4X65 E;  3GON A;  5GMD A;  2ZM6 I;  3V5R A;  4JI3 E;  4MYT A;  3WU5 A;  4DR1 E;  2UUC E;  4DR4 I;  2V8P A;  1I94 I;  4DV3 E;  4NXN E;  5BR8 E;  1Y4S A;  4IZJ D;  2PNM A;  1Z5A A;  3Q6N A;  1N0V C;  1J5E I;  4B3R I;  1NZ0 A;  2AJ4 A;  5LMN I;  4LF4 I;  2BM1 A;  4HYM A;  4LF6 E;  4DR7 E;  4X65 I;  1Y6Z A;  4OX9 E;  2HK2 A;  1HNX E;  3HUL A;  4P52 A;  4DV3 I;  3JAM Q;  4DUZ I;  2UUC I;  1PKP A;  3K17 A;  4WUC A;  4FN5 A;  4B3S I;  2UXB E;  2VF3 A;  4DU7 A;  4NXM I;  2VQF E;  1XNQ I;  1HNZ E;  4B3M E;  1J5E E;  4FWD A;  2V34 A;  1IBK I;  2O1V A;  4B3R E;  3LPS A;  4WUD A;  2LJP A;  5FWK A;  4YHH E;  4N3O A;  1QZR A;  4IZK B;  4PRX A;  1N33 I;  2UU9 I;  1MG7 A;  4X66 E;  1Z0C A;  4DV4 I;  1IBL E;  1XMO E;  4P7A A;  2HK3 A;  1EI1 A;  1KTV A;  3QT5 A;  4DR5 I;  1ZXN A;  4X66 I;  1PIE A;  4DV2 E;  1I94 E;  2XEX A;  4HAC B;  5IWA E;  2A2C A;  1HNX I;  4FW9 A;  4JI2 I;  4LFA I;  4LF6 I;  1Y4U A;  4JI4 I;  1FWK A;  4GKJ I;  2Z5C B;  1FKA E;  4IZJ B;  4DPX A;  2EFG A;  1HR0 I;  1IBL I;  1Z0T A;  1MX0 A;  1ELO A;  1N32 I;  4JI0 E;  4JI6 I;  4DR2 I;  1Z59 A;  2UUA E;  3HJC A;  2OI2 A;  3F0N A;  4JV5 E;  4XTJ A;  3J81 C;  4LF8 I;  2NPF A;  5GME A;  2VQE I;  1UEK A;  5L3J A;  4DV5 E;  3OTO I;  4WUB A;  1HNZ I;  3ZZT A;  4JI6 E;  4NXN I;  1WUU A;  1NHI A;  2UUA I;  4DPU A;  2R3V A;  4DR4 E;  3PYE A;  2CGE A;  2X36 A;  1KIJ A;  3PRY A;  1H7U A;  2A2D A;  3PYD A;  2UU9 E;  1ZM4 A;  4X64 E;  4DV7 E;  3J80 C;  4ED4 A;  2DEI A;  1S4E A;  4LF4 E;  2E5L I;  3J7A M;  4GKJ E;  4DUZ E;  1XMQ I;  5FLX Q;  4MYU A;  1B63 A;  2GS8 A;  4Z7Y A;  1RRE A;  4B3M I;  4AQY I;  2HHH E;  3D4J A;  4X62 E;  4DR6 I;  1MU5 A;  2IOQ A;  1BKN A;  4LFC I;  3LTO A;  1OJ4 A;  4DV6 I;  4DUY E;  4M1K A;  4EMD A;  4DR3 I;  2R42 A;  4USM A;  2V2Q A;  2HKJ A;  3M6A A;  4HXZ A;  3T1Y E;  3OTO E;  3ZKD A;  3QT8 A;  4DV4 E;  3LNU A;  1FNM A;  4RPF A;  2UXD E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...