1HNXJ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
KIRIKLRGFDHKTLDASAQKIVEAARRSGAQVSGPIPLPTRVRRFTVIRGPFKHKDSREHFELRTHNRLVDIINPNRKTIEQLMTLDLPTGVEIEIKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF00338 Ribosomal_S10 Ribosomal protein S10p/S20e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.600 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Ribosomal protein S10 domain 1hnxJ00
4NEZA 2HHHJ 4JYAJ 2UU9J 1N36J 2UXCJ 4GKJJ 4LF6J 3W1YC 5AJ3J 4DUYJ 2UUBJ 4LF7J 4B3SJ 4LF4J 1HR0J 1J5EJ 2KL8A 3D3CJ 4V1Ak 4DR3J 2MEWA 5IWAJ 1XNRJ 2UXBJ 4JI8J 3OTOJ 4DV6J 4PWWA 4DR4J 4AQYJ 4DV1J 4RJVA 5IT9U 4YHHJ 4JI1J 5FLXU 3T1YJ 1N33J 2MTLA 4DUZJ 4LF8J 4KHPJ 3R2CJ 1N34J 1HNWJ 4LF5J 4DV5J 4DV7J 3JAMU 3R2DJ 1N32J 4NXNJ 2VQEJ 4NEYA 4KY3A 5LMNJ 2E5LJ 1HNZJ 2KVQE 3J81U 4JI4J 4KYZA 2UUCJ 4DV2J 3IMQJ 4K0KJ 4HHUA 2UUAJ 5BR8J 1FJGJ 5A2QU 4B3MJ 4DR6J 4JI2J 1XNQJ 3J80U 4DR7J 4DR2J 4DV4J 4B3RJ 1IBKJ 2VQFJ 4B3TJ 4LFAJ 4DV0J 1HNXJ 5LMUJ 4YY3J 4DR1J 1XMOJ 1IBMJ 4LFBJ 4X66J 3J7AN 4JI6J 4LF9J 4DR5J 4NXMJ 2UXDJ 4OX9J 4X62J 4DV3J 4JV5J 1I94J 3T1HJ 1XMQJ 4X64J 1IBLJ 4JI5J 3D3BJ 4LFCJ 2ZM6J 5LM7E 4JI3J 4JI0J 4JI7J 2F4VJ 4GKKJ 2MQ8A 4X65J
chains in the Genus database with same CATH superfamily
3DOKB 3GG0A 1YJVA 2BUNA 4AXJA 2BJDA 3H2LA 3KLFA 4HT5A 4DG1B 2GVZB 3RAQA 2W7AA 1KVKA 1WKJA 2LKZA 1FX2A 1OPZA 5KG0A 4ETXA 4PRFA 5CHCB 2HMIA 1KRPA 3MI7X 4OHXA 4IRKA 1QY7A 5I3UA 1JXLA 1TL7B 4R0JA 3IM8A 2UV8G 3GR1A 3QNWB 3MEKA 5KFNA 4OI0A 1S76D 3P5BP 2J5AA 3AD9C 2IM3A 4TKTA 5A8WB 2MKSA 2AD9A 4B3SJ 1JLBB 1HR0J 2EFGA 4NLQA 3TEHB 3TAMA 1NRKA 2KL8A 3B54A 3KLEA 2BRLA 4KPCA 4OYWA 1YGYA 1Y5IB 3EVWA 3QPIA 4QR2A 5F8HA 2MGZA 4ER8A 2DPJA 3M8WA 2ZVSA 1FK9B 1OSDA 1S4EA 2HGLA 3M8SA 1X31C 3IBCB 3SDEA 3CCTA 4H4KC 2CJYB 1VQOS 3JQJA 1VJWA 1HHSA 1AB8A 2AMCB 1AYEA 2JL9A 3UCZP 3H7HB 4RW8A 4O44B 2MKHA 3SXLA 2OP5A 4P71A 1U09A 2DR5A 5HVHA 3M30A 4H4OB 5ETSA 4WFBQ 3CD0A 3HHNB 2HS4A 4RL1A 3G4SS 4DR1F 4FVMA 1S6QA 1CJUB 1NPRA 2J6TA 2FVQA 2E1AA 2HGNA 4QU7A 3QMQA 3S01A 1GQEA 1NHUA 3SSSA 1YJTA 4N77A 4H4MB 5DG9A 3F0NA 2C2EA 4C8OA 2RDDA 1CJKA 4OJHA 2ZDPA 4PR6A 3TQ1A 1X4GA 2K3KA 1REVB 2PMHA 1TUVA 1V5IB 2FHJD 4KO0B 4CTAB 5DG8A 3ZC4A 1NDLA 3PV8A 2NYHA 3CXCR 2KXHA 4DV2J 4ZN1A 1QAJA 3V6KA 1IXKA 3PKYA 3AQOA 4AL7A 1GK8A 5L1IA 4Q0BA 2AX0A 1MU2A 1VQNS 4LT6A 1U1MA 1WKKA 2JVOA 4F04B 4WTOB 5E3RA 1JWWA 2Q66A 3PW2A 4NWBA 2CVEA 3ULHA 2L9WA 4DUTA 3MMAA 3QAUA 1PCAA 2P6TA 3GYGA 2C3UA 4RWXA 3J81j 3MM9B 3JSMA 4WXOA 2R9LA 3B4MA 3TARA 2G9OA 3L3CA 2JRSA 2XB2D 1RWXB 2ZDOA 2V2QA 3M2VA 3SQOP 5ADZA 1RYSA 2J6SA 1DTTA 2FJWA 5F0WA 1IBMJ 2DGXA 1RT2B 1ITPA 1FNOA 2B7BB 1C1CA 3TRGA 5EX0A 4ATNA 4F4ZA 1C1BB 2EK1A 4A8WA 2YNFB 3IGNA 3SCIE 2IRYA 3TI0A 4RR5A 1SCJB 2HBRB 3TUPA 1TKXB 1B70B 3EXYA 3QGIA 4N47A 2P9EA 1NPKA 2A1BA 2QL7B 1HL6A 3IG1A 3QIDA 3S1TA 4YS2A 5B0BA 4DFPA 3FRZA 4X66F 2BKOA 2DGSA 4WFAQ 4LFBF 4FDFA 1IBLJ 4P9SA 2XYHB 4IUFA 1NM2A 3TUJC 3C16A 2L3MA 2K8GA 4JI3J 2XZDB 3BM7A 1GEHA 2E29A 2M4MA 5I4MA 5EGYA 3B82A 2BW2A 1IWAA 3WDOA 3KHRA 4DF8A 2Y8WA 3MXHP 4CLLA 1FRKA 3TVZA 1J2VA 2VJUA 2MYFA 1VRQC 2Z8QA 2XM3A 1WWHA 3PDNA 3IWXA 4M5HA 3IA0A 3DU6A 3MMJA 1DURA 1S1UA 1T3OA 3PFEA 4PKDB 5KG6A 3V5RA 2F4FA 4Y00A 5JUMA 3AT1B 3CJTA 1CJTB 4EU0A 3CPWR 2JEIA 3VGSA 4O4RA 5KFQA 1P8GA 1LWCA 2DNLA 1S77D 1SXLA 3MEGB 1EAYC 4K4XA 1K9MT 4EZ6A 1I94J 4A8MP 1I3OB 2PDAA 2WHOA 2CNKB 2E5IA 1S7IA 3CO9A 5HVGA 4QR1A 4C11B 2YKNB 4RU9A 3GV7B 3H0PA 5A8RA 4F2RA 2K06A 2R7VA 3I0SB 1RBOB 3RBZA 4DSIA 4Y2AA 1NJXA 4DV4F 3IRWP 1MNEA 2X1FA 5HP1B 1JLCB 2AV5A 1UFWA 4RW8B 5GMKa 5KFWA 5LSRA 1LWEA 4QIFA 4FYDA 2U2FA 1YX2A 2XMKA 4WWSA 5IT4A 2KI2A 2EBGA 2J0XA 5IC4B 2LXFA 5BYQA 2AYMA 1NJIT 2UP1A 2JDJA 5K8NA 4YHHF 1FF2A 2QMWA 3FC9A 3W8PA 2LEPA 2B51A 1Q8KA 2N3LA 4XIUA 4YHHJ 1BD6A 1RWVB 1LWXA 4LREA 4B3TF 3L9ZA 4P10A 3T1YJ 5DDOC 1X9WA 1Y3KA 3UVJA 1YSJA 2MQOA 2QEXS 1YZ6A 2DYAA 2GMLA 2RE1A 4YDXA 1TL4A 3R2CJ 3R97A 3CT9A 4QW8A 4WFXA 4DJBA 3TAPA 2UU9F 4RNHA 1WTBA 2J7WA 3GJSB 3DLHA 2SXLA 2HIQA 3C6UB 3CCWA 3DYAB 3PYDA 3JAMU 2VC1A 2E1CA 1N32J 3R2DJ 4KHPF 2KHDA 1KQGB 3V6HA 2LEBA 4LIRA 1W2IA 1FFWB 2MLYA 3CJ0A 4GO7X 5DO2A 2XGPA 3KJVB 4EYIB 3M4XA 3HPOA 3THPA 2CPZA 2V94A 3TX0A 4R5PA 1MSWD 3EICA 3FZ2A 5FLXY 4DG1A 3KK1A 3J81U 1N5VA 2YQ0A 3A4TA 3KDOA 2FD2A 3CCSS 3IWLA 3MUTP 2GO9A 4PCQA 4USVA 1Y9OA 4QJVA 1IM6A 1MMNA 3MM9A 3N28A 4USHA 4ZLJA 4RNMA 2MKKA 3OVSA 3DXSX 3JSMB 1ZM2A 5GAHU 1L3SA 1D0EA 1HW9A 1LFWA 3HHDA 1NK0A 1WC1A 1V3SA 2HQDA 2XBPA 3JSYA 3TUIC 4PEOA 3PYEA 4DV4J 4KGKA 3V81A 1XK8A 3B6BA 2ZHAA 4DOZA 5ETOA 2ZC3A 4FN5A 3EDRB 3KNGA 3OTEA 8ATCB 3CEDA 2AIRB 4F3QA 4ZP9A 3U27A 2OI2A 1FJGF 4RUHA 3UFCX 1BXNA 1JLEA 5KFKA 4LFBJ 3W60A 1X0FA 5DETA 4OYPA 4LR8A 2HW3A 1WG1A 1XIQA 3EGWB 4OFZA 1JKHB 1R3NA 1XN9A 2JWNA 3MM6B 3QT7A 3TW0A 1N6QA 1TFWA 3KLIB 4IFVA 1UPPA 1OYEA 2BM1A 4WPAA 2Z2YB 3K5MA 4J9LA 3MOJB 2XGQA 1NDPA 4OI4A 1H0HB 2QYGA 2BV3A 2OSQA 5KG2A 3OVAA 4J9KA 1XMQJ 1TAUA 2AEMA 5AXLA 3HO1A 1HQEA 1BC6A 2B0GA 2DHGA 4Q5VA 2IBOA 1HNVA 4CLSA 4ANCA 3D67A 3NAIA 5I3PA 2HBZB 1S1UB 1ZOTA 2ASYA 2WVBA 3JXOA 3OD2A 1FK9A 1VS3A 3AD7C 4LFCJ 3AOBA 3C6TB 3CE8A 3MWBA 3LP2A 1DTQA 1FE0A 2VC0A 5C42B 3BGFA 1RBAA 2CQGA 3DOMA 4NLDA 3CB4A 2GAGC 4AD6A 3OFGA 3D0IE 1X5PA 1SPBP 4ZIVA 1T05A 1HI0P 3W63A 4A48A 4H4OA 1DQ8A 4O4GB 1RB0A 4MAKA 4NCGA 3T1HJ 3MR6A 4PYAA 2QSFA 1N36J 1DAXA 1TL3B 4NI2A 1F60B 1JLGA 4M5IA 4F4XA 1N5YA 1VHIA 2RNEA 3R9LA 5B0EA 3RW7A 5KFYA 4Z2XA 2ABYA 3AJ1A 4KKOA 4Y6IA 1LWEB 4K4TA 3WC2A 4OI1A 4DSEA 4O3RA 3E2EA 4C0OC 5KFTA 4C2MA 2YNGB 5D4OA 1DY3A 5SZTA 1RT6A 4OHZA 2MJUA 2RHQB 2ZBQA 3ZO7A 2HFVA 3ZTRA 3T6BA 2KZMA 4CO3A 1RTZA 2CG8A 2WRMA 2GA7A 2D3ZA 2YKQA 2UXBJ 4GVLA 4Q2LA 4LF9F 1RK8A 4USWA 4DSFA 1RT2A 3SYZA 4RW4B 2VG6A 4OV6A 2MKIA 2XO7A 3HHKA 5G0RB 4CYUA 1FRHA 2XSJB 1LW0B 1MWQA 2B5JA 1HWLA 2YNFA 2ZNYA 5SUHA 2FVSA 2HHTA 3DCAA 5JVHQ 3MMBB 4JV1A 1TKXA 1X4HA 3AXKA 3C6UA 4A8XA 1N0VC 6FD1A 2A10A 2A3JA 4JOUA 4BCAA 3R7NB 2RUSA 2XSFA 1N33J 1NBEB 1IWGA 4WIIA 2VG5B 3BSOA 3ZZTA 2MZSA 3W7BA 3OBIA 4AT1B 4CQ1A 3D0GE 5HO4A 4YB1P 4DV5J 3CCRS 3LH2S 3ISND 5L46A 2DHXA 3MUMP 2LP4A 3BKFA 3M05A 4ZCKA 4TU9A 1F2GA 3I32A 3I31A 4KGMA 3Q8QB 2MPUA 4LVNP 4ZVHA 3F41A 4DQQA 3WX8A 2F40A 4M94A 5KFSA 4EZ9A 4YMEA 2BXJA 3M6WA 2IPOB 2QA1A 1HNZJ 5D78A 2W9BA 1TVRB 5CYMB 5LMNF 3MECA 4FNIA 2KFZA 2HNYA 2C1EB 2YX1A 3ICLA 3MPVA 2Z2MA 2H4WB 4FNHA 2BE2B 5KFDA 2FC9A 2ZZMA 1S1XA 1SH3A 1E6VA 1RAEB 2CVIA 4D3HA 2QV6A 2YKNA 5B09A 3I55S 5EN1A 1S59A 1OYDA 3I4HX 2G2YA 4DR6J 1BGXT 4ED8A 3AFGA 3J80U 1RHKB 1M5OC 1JLCA 4LSNB 3OPKA 3R27A 1QVFR 6AT1B 3BBFA 1Q16B 4NLWA 1RISA 2EI5A 2HHVA 4C8NA 4ID5A 2Q43A 5FDLA 2CPFA 4CNYA 2XZTB 1U8WA 3BB5A 3EZOA 3GG1A 3PYGA 1HQEB 1MLAA 1DBDA 2XC9A 1FFSB 4P6QA 3UN5A 3ZTOA 4WJBA 3UDVA 3DHXA 3NS6A 3ET6B 2W8LA 1RAFB 4QWBA 1FKOB 4DV1F 2ZUGA 3I5CA 3I56S 2IMOA 4ZHRA 4IO9Q 2PC6A 2DJWA 2E9ZA 1JLAB 2DCLA 5HP1A 1D8ZA 2D69A 3HVRA 2VPZB 4K50A 3PKMA 3DDIA 4IDKA 4IO1A 3PRDA 3NOGA 2EK6A 4MIAA 1S1WA 1YIJS 3G71S 2NUHA 3EGNA 2BR0A 4Y0FA 1XC9A 1HBOB 1LXJA 5GMDA 4J37A 3ENVA 3A8KA 4LSZB 3ZZRA 1NK4A 3PNIA 1MMDA 1S6OA 4NI2B 1ZYQA 4RWWA 2RD5C 2R2RA 1GAOA 1R6VA 3E51A 4O3PA 4Z7CA 4FPIA 5E3QA 1FRXA 2I38A 2ILYA 4KFBA 1SC3B 4RW7B 4ED5A 5BXIA 1HYSB 1X9SA 2HQ3A 2QN6B 1R89A 3NMAA 1TMJA 1RAJA 3KOAA 2QLXA 2ZC4A 4RLEA 2VD3A 3W1YC 2D9OA 2PT0A 4X4OA 4RUAA 3LGMA 5AJ3J 4K4YA 1ZPWX 2CQDA 1I6JA 3R8YA 2QA2A 4EI2A 3HK2A 2VPWB 3OFHA 1N4LA 1H2TZ 1VQYA 1SKRA 1LW0A 2B5JB 2E5JA 1M5HA 1S6PA 3AD8C 2A2DA 2JLEA 3D3CJ 4ECXA 4LMZA 2MLXA 3A8IA 4C0HA 3F56A 4F67A 3GZ7A 2ZJRQ 3MDFA 5F8IA 2KM8B 4JI3F 2N4DA 1REGX 1TMMA 2OMLA 4I6YA 4LJMA 1IKYA 4ED4A 4TQRA 3AOAA 3CC2S 4EWTA 1B4SA 2ZITA 2GIQA 4H54A 3V6JA 5GAGI 3ILLA 5DZ7A 2BABA 3NS5A 3OQ2A 1VJQA 3OTBA 4RBTA 3MAQA 1HBMA 1WSRA 2DR8A 2M52A 3W62A 2QX0A 2R8JA 3NNCA 4JYAF 1RHJB 3M8YA 3RU0A 1U4BA 1APSA 1R6YA 1IR1A 1VI7A 4LRDA 3VAJA 4ED1A 5H9EJ 1IBKF 5ETNA 3MM5A 1HBUA 2CPYA 2HG4A 1SQFA 3D5MA 1KC8T 4DUZJ 4X2BA 4WU3A 1Y5NB 4F0HA 2N3OA 4USTA 5L9XA 1JJCB 5E2QA 2ZHBA 3LPYA 1M5PC 3EGZA 2HNYB 4D3GA 1SV5A 4PUOB 5K8PA 3GSIA 4LVOP 2HHUA 4ZJQA 1IBLF 4O4GA 4B02A 5KT3A 2OKQA 2HVEA 2VJVA 1YKWA 5LMNJ 2Y1JA 2P9GA 4XDCA 4URGA 4PZVA 3VAGA 2E5LJ 3CGIA 3DRXA 4JI4J 7AT1B 2OPPB 9ATCB 2BJ8A 5IT0A 4NMLA 2VHGA 4BDPA 2E9RX 4KHRA 1Y3JA 1LWFB 3QLHB 1VK3A 4MIBA 3KK2A 3PYFA 4ECSA 1YRUA 5BR8J 1OWXA 3H4DA 2KFNA 5LL6d 2LLZA 3KG4A 1RTJB 4GVBA 4W90B 1DTQB 1H72C 1UVJA 2DXDA 3DOMB 4GKKF 4EBDA 5KFHA 2XNQA 3FCHA 1AUSL 4YB6A 3RGIA 1T05B 1RP5A 4UF4A 1T9UA 1R8CA 1V9OA 4ZVTB 2CQ1A 2J76E 3RBDA 4DR7F 2AZ3A 2CPIA 2H54B 2PE8A 2V63A 3H40A 5I3QA 2Z0GA 4X62F 1HD1A 7FD1A 1Z4UA 4I7FB 2HAFA 2HS3A 1JLAA 4DR1J 3QZ7A 3GV5B 2HBQB 1RBLA 4M5MA 2GZOA 4OZ1A 4G1PA 1TV6A 5E3AA 1WEXA 2OGUA 2OUGA 2V8DA 4JBCA 4NRTA 3ZTQA 1TUGB 3ZZYA 4Z37A 3V4IA 4GKJF 1NEEA 3DGPA 4QYZJ 5HBMB 2M9KA 4ZVUB 4ICLB 4JB8B 2OPRA 2VFRA 2HGMA 3P6YC 2VASA 3NNHA 4F4WA 3VZIA 1IR2A 2I6WA 1UFKA 4HL9A 1PSDA 4W92B 2R7UA 3SIPB 1P6TA 5L1LA 5GAGU 2C2MB 3KTQA 4FF1A 1SL0A 1LW2A 2NZCA 4ZVRB 2QLFB 2CIMA 2YX4A 1L3TA 1N52B 5KFJA 1RHQB 2YX7A 4K5SA 4NLOA 5G0RA 2AJQA 2Z4PA 1S9FA 1J27A 3Q8SB 1VC6A 3DU5A 4ZCLA 4HKQA 1CLFA 1WEYA 5LXRA 5A2QY 3PW0A 4ED0A 2RU3A 2XY7A 5ETMA 1RJJA 1R0CB 2MQNA 1SUQA 2XMWA 3RB0A 3FNNA 2G1HA 3MCMA 5F9LA 5CZXA 2GHWA 1QSLA 2G2OA 1P1LA 1K44A 2AWZA 2DNZA 4MYTA 1OQ6A 1XMBA 2M88A 3OFFA 4C8MA 2F4VF 5D77A 4DFJA 1R8BA 1G1XA 4KH0B 2YNIA 3KWMA 1HPZB 1OO0B 4UUWA 4LQ9A 3QIPA 1HQUA 3EX7B 2L41A 1R8HA 3J7A1 1U6ZA 4C3MA 4DU8A 3QWUA 1AROP 2BZ2A 3RG6A 1H7WA 1WELA 3M8ZA 4C48A 1EQMA 4Y34A 5CCLA 4LQ3A 5ETLA 1KTQA 2BQRA 3DRRA 3D4JA 1XJWB 5EWGA 1UA0A 2CQ3A 2DY1A 2H4YB 3QGPA 1EX8A 4OYXA 1NHVA 2FZKB 4DCOB 4JV2A 1U6BA 1CS4B 2RSQA 3RR7A 5F8NA 4KR0B 4PWWA 5J2PB 1NZ8A 4I6AA 3TP2A 2MQPA 2HHXA 3HCXA 2VODA 1FKOA 4IH5A 2AU0A 3DI6B 2R2TA 4DWIA 1FI4A 3HI9A 1JIHA 4X65F 4IQMA 4XPCA 4Q8EA 2BEFA 1K1SA 3DC2A 3VTIA 4A8SA 4JI1J 4GO5X 1KNZA 2HHWA 3N5FA 4OLOA 2MKYA 4L74A 1K73T 3TZYA 2O5DA 1T8EA 3V6DA 3CNQP 1EIYB 4LF8J 3QAEA 3T5JA 1NKEA 2C3MA 3W64A 1QUVA 2YWFA 1JLQB 2Z57B 3HHLC 3K17A 1EB0A 1GXTA 2VBXA 4DV7J 3H59A 5J1PA 3M9OB 2R7QA 2W8KA 4ECUA 2P9CA 3M8QA 4DPTA 4UZBA 4B9NA 3TZZA 1W7WA 2HZCA 3HULA 4PXCA 1CG2A 4QWEA 2HURA 2YQ3A 1SIWB 1UL3A 1RLCL 1S12A 4U9RA 2FY8A 1RXOB 2DNGA 4LRCA 4IOBA 3TR5A 3P49B 2KVQE 2HS0A 1U24A 3VQTA 1WACA 3H2VE 1F5BA 4G1QB 4ZS6A 4BWJA 1U48A 1O0PA 1GXLA 2UUAJ 1U0HB 2K3IA 2CQIA 1NH8A 4LBPA 2A2CA 2RH3A 4OHWA 5F9NA 1TR0A 1A0OB 1WOPA 2RF2B 1PC4A 2ZD1A 1TL7A 2IM1A 3HKZD 4E0DA 2LDIA 1S6PB 2LCWA 2QMXA 5DQIA 4P73A 1IR0A 1JLBA 2H65B 5AT1B 4B3TJ 4KFBB 4DV3F 5K9FA 4G6VB 1OPIA 3CDEA 5LOQA 1YITS 2KT2A 5HQ8A 3OV7A 1HIYA 4X4SA 3UD3P 1M5VC 4I68A 2DGTA 3C14A 3IC1A 4NASA 2HHQA 4X66J 1TL1B 2YPZA 3BN7A 3W66A 4HR2A 5D3GB 1HBMB 4OI6A 5K8OA 4LF7F 3DRSA 4NXMJ 2L08A 3MM7A 4IFYB 1VMBA 4CRJA 4OX9J 3ZZPA 1S1VA 2E7XA 3TJAA 4Q45A 4YR3A 2XHWA 2OLWA 1DRZA 1E6YA 1OY6A 4OI2A 2R8GA 2ADCA 3SCJE 3BYRA 3J7YI 4LF5F 3SZ2A 5H9FJ 1CJUA 2RB7A 4AFFA 5KFCA 3CCES 1TTHB 5KT5A 5THWA 3JB9k 2EFNA 2O67A 2VH7A 3RJMB 3T19A 4UY85 2PIIA 2XNRA 2MSSA 2OEMA 1U2RA 2BOAA 1RKIA 3R5CA 1FEEA 5A6PA 2MKCA 4M5JA 1YQHA 3JYTA 2DH7A 3OT9A 1PJ7A 4A8QA 1DLOB 2W2MP 1KOHA 1F2HA 3DNCA 1LXNA 3OTCA 1LQ9A 3QLHA 3R5JB 4NLVA 3TA0A 3KK2B 3RAXA 2VKZG 2DT9A 4EMDA 1PAEX 5BJRA 1NJZA 3G9CA 2DNRA 4UUXA 1CS4A 4X4NA 2OEJA 3LGHA 3DGVA 1O6XA 1U02A 3N9UC 1JJ2R 1WJ9A 2KJWA 5E5NA 3Q24A 1J5EJ 1RTDA 2EBEA 3R5DA 4EBEA 3W2VA 5J2MA 1KHVA 4DV6F 3BS9A 1NK5A 2CQ0A 3IS9A 4OX7A 4C6AA 1T9VA 4CTAA 1FDAA 2DTJA 4JI5F 4ZPCA 4QR0A 4DN9A 4I4BA 3LTOA 4NYOA 2IJNA 2D9PA 4NX9A 8AT1B 2V2ZA 3OR1A 4C8ZA 3CJ8A 1U1PA 4ES2A 3PR5B 3M9NB 2CJAA 2MZ1A 2HFNA 4OIXA 2PMZD 2UXBF 1WC4A 1ZH5A 1F3FA 3KLFB 2EC0A 5D0HA 3NRBA 2EXUA 4WP9A 5K20B 3RUBL 5KG7A 4LIWA 4N7TA 3W3SA 1RT3B 2H5EA 1FXLA 3FMBA 2LQBA 1R0AB 3U1LA 2CYYA 3OJUA 2AP6A 3KNAA 2W9AA 2V9WA 5E33A 4DPYA 5IV4A 3QZ8A 2CKWA 3EZUA 3V4IB 4L6V3 3TAMB 5A8KB 4K4VA 3GFZA 1W2BR 3GJTB 3O5TB 3T41A 2MQQA 3BF4A 1JXVA 1Q8LA 3QJJA 2UUCJ 1LK5A 3GFYA 3O1LA 2XY6A 3K2YA 1FNMA 4A8KA 4CWBA 1OMSA 2RS2A 4IRCA 2VOOA 2NLWA 4CLPA 2WVEA 4OZJA 3O3LA 2P5VA 5HMWA 1YJ9S 3EM1A 4C8LA 3C14B 1SL2A 3Q0AA 2YKMB 2XLJA 5HMYA 3E3XA 1PO6A 4L76A 2YPYA 3M1VA 2GV1A 2DR9A 1A9NB 3MMCA 3IP0A 4HACB 3RYLA 5C24B 2HFUA 1IBKJ 3KK3A 1B7FA 2RHSB 1H73A 1ZPVA 4HTIA 5J2QB 4CM0A 4QZVB 1AXQA 4N8NA 1UVMA 3HM9A 3BO3A 3MF5A 2EW9A 1N56A 1WORA 1GMWA 4OYOA 2UV8A 4F2SA 1KQSR 1VDHA 1S79A 5KFFA 2OTLS 2DY9A 2UUBF 1M1KT 3PHTA 4DV3J 2EWHA 4JV5J 1XERA 1FT8A 2X1BA 1DTTB 3CIZA 4WYLA 1SJQA 4C98A 1NAQA 4EO8A 2U1AA 2IA6A 2ZWPA 4B3SF 3Q2SC 2C42A 2D1CA 5E41A 2FDNA 3Q86A 3HP6A 1F6TA 2FZCB 4JI0F 1XR6A 4MKVA 2Y0BB 3HVTB 4CM2A 3FSXA 3HFVA 3D66A 1WEZA 5D0EA 4ZPDA 1VBYA 4PQUB 1PAUB 4JI7J 3M6UA 4ANDA 2LA4A 3PJXA 5HI7A 4L73A 5C25A 5LJ5Y 3OJSA 3BQ0A 2RIJA 1VQSA 4FYVB 3MR2A 1ZM9A 2DNMA 4CH7A 2ZH7A 4QIWD 2V4JA 4ECVA 3B8HA 3D6HB 4ZPBA 2RDIA 2ROPA 4ZP8A 2HNZA 4DSJA 2R8IA 1RTDB 3ZZ0A 2G0JA 4P52A 1CSJA 4RW9A 1FESA 3UDEA 3UI3A 4DZDA 1QAYA 3O2IA 4EFAC 2YWEA 2N7CA 2PN6A 4Z7YA 1ZA2B 4DXLA 4U96A 4CT9A 5LSOA 2DPIA 4V19X 3K59A 1YRXA 3MUVP 2OH2A 3UN2A 3C16B 5GADU 2XY5A 1FDNA 1EP4A 4JI1F 1PKUA 1XNRJ 1KQKA 4M5GA 1CQMA 1V6HA 2F8MA 4IR1A 1FDDA 4KGVB 2M5YA 5HLFB 2CJXB 3BN4A 3N79A 1JMTA 1GX5A 3GCXP 5JMNA 2D3O1 1T3NA 2UXDF 1VIXA 1LFPA 3ENWA 2AEJA 4KQZA 1VHFA 5CABA 3QT8A 2HHHF 4B3OA 2BRKA 5FLXU 2FJBB 2E7VA 4TY9A 2RS8A 1FKAF 2DRDA 3MPWA 3R5GA 2DCUB 3I9V9 2VFUA 1UJ4A 1UVLA 2RQKA 2WSEC 3V81B 1NK6A 1VC5A 2K2PA 4TXSA 3CCUS 3T3FA 1P9QC 2D74B 3R1HA 1FVQA 2NSCA 3BPDA 3NGRA 1S72S 3ETOA 1WC3A 2FGOA 2RKIA 2P8IA 3FEZA 2FYXA 2CPHA 4O0IA 2QIFA 4NEYA 4TU7A 5C42A 2VL1A 1SBRA 1FJEB 1VQ6S 2ZH3A 1FE4A 2YKOA 3CCZA 3ZZUA 4DI6A 2W4DA 3DN9A 1S97A 3I0RA 3RBXA 4P74A 2XLIA 3CULA 2Q1LA 4ANEA 1UCNA 2BANB 2CJQA 3CIMA 4HH0A 4LBIA 3SI8A 1QSYA 1RADB 2F9DA 4J5OA 3AAWB 3KMSA 1KS2A 1VK8A 4MKYA 1TL3A 4CT8A 4DX8H 5HL7Q 3L95X 3EJMA 3CCMS 4ECRA 4ZPVR 4K5RA 1IUJA 2HK3A 1VGYA 3LF0A 2DNNA 3CJKB 4ES3A 5AE2A 1Z2LA 5ITHA 2P2CB 2ZOFA 3L7UA 5D6GA 3CDUA 3LUYA 2DK2A 3GMGA 2FHJA 4F26A 1GH8A 2EVZA 1XNQJ 1X4AA 3UVJB 1KFDA 1F1BB 1EJ7L 2JJ4D 3JYTB 1SH2A 1T94A 4KB7A 3BSNA 2CQ4A 3C8YA 2HQGA 1ICEB 1KLMA 3QQCD 3KLHB 1VC0A 1SQEA 4MFBB 3VVUA 4ZIWA 5LMUJ 1ZZNA 1XMOJ 4IR9A 2LMIA 2JFKA 2X3GA 2R4FA 3ITHA 3S7RA 3VZHA 1EKRA 3ZNUA 5L39A 3KJVA 4Y3CA 1RA6A 1JLGB 4USMA 1YTYA 1N5YB 4L3NA 2GCFA 2Q6BA 2ZBPA 3P5TL 1G3OA 4MK8A 5IQ6A 4DR5J 4LF9J 3HVTA 4PQUA 1RWKB 2BQUA 3WBZA 4X62J 2HSEB 5KT2A 4DPOA 4EYHB 3HJVA 3VQSA 1AFIA 1YRTA 1GXUA 2VKRA 1RT6B 3MURP 2LQ5A 3L09A 3BH7B 4TLQA 1RU1A 1FRMA 1UETA 4OX8A 2F65A 2BM0A 4IFVB 1WF0A 5BR8F 3BGOP 3CMQA 4HVZA 3OR1B 3VAMA 3TOQA 2XMMA 4DSKA 1WHWA 1NB2A 4MTPA 3OHBA 1JJHA 2YKPA 4CYUB 2VFSA 4X64F 2HQIA 1IM4A 1S1TA 2O66A 3DLLQ 1C0UA 1NCLA 3PX6A 4N56A 1BE4A 1BQNA 1TL5A 2HZVA 1LKZA 3LP2B 3WC0A 4NLTA 3EYZA 4I56A 3MECB 3G6ES 2Q79A 2XYPB 4RNFA 1F9FA 1JKHA 2HVHA 2OTJS 5AE3A 5CH7B 1FKPB 3NGDA 3HVWA 4A4JA 3OTOF 4X4TA 1VBKA 2VZ9A 1V5VA 3M1VB 3ELHA 2DVIA 4LF4J 3MMCB 4HACA 4DS4A 4DR4F 1R31A 3KK3B 1U1NA 1QTMA 1IKXA 4DPWA 1RTHB 3A3NB 2L9NA 1R7IA 1HBNB 4M63A 2DISA 2HVDA 3G8SA 3OSPA 2Y9HA 4YQWA 1YJWS 4LR7A 5C2CA 4ZDNA 2OPQA 2CA9A 1JK9B 4R0EA 1JLFA 1EETB 1UWBA 3P8BB 4KBIA 4W4MA 5D15A 2HWTA 3FGVA 3DLEB 2GHVC 4RJVA 3MM8A 3AY0A 4RX6A 2YWWA 2DH9A 3HMJG 1SJ4P 4X4VA 2RKIB 5D8HB 1KVIA 3AXMA 2WVCA 4B3RF 3I9ZA 3AH6A 3D68A 4QYRA 4FZVA 3H20A 1DQAA 1GT8A 3M32B 2W9CB 5H9FK 4JV0A 4FS2A 1M0SA 5HROA 3G8QA 1N34J 1T9TA 5KG1A 4ID5B 2R8HA 2CJKA 1VRTA 1RA7A 3PXGa 1NLKL 5C25B 2YNGA 3KLVA 2FLOA 3ISNC 1NU4A 1D9AA 2E44A 3EPGA 4J9PA 3BSCA 2VQEJ 4KPYA 1AZSA 3GB0A 3C19A 4ECZA 4F3MA 3ET6A 4OV1A 2HNZB 4GC6A 3F73A 2AX1A 2DGVA 3IAS9 2B4PA 2KHCA 3AJ2A 2QTWA 4RW4A 5JJBA 4PAAA 2Y1LB 1NK8A 4ILMA 3NKYA 1S4FA 3IMQJ 4IKAA 3BKTA 4NMXA 4A46A 1N32F 2B8QA 3DDNA 4FKYA 2CXEA 3FSYA 2FLNA 1XR5A 5HN0A 1KLMB 1PYTA 2ZBIA 2ZZTA 3T1AA 2XCAA 3PJWA 2VPXB 1T95A 3JSRA 1RU2A 3GV8B 5U47A 1YHQS 2LU1A 2V4JB 1SL1A 1S10A 1ZTWA 1Q7LB 2OD4A 2YWGA 1K0TA 1KQFB 1S1XB 2XMVA 3PHEA 3TO8A 2BJ1A 2IYGA 2RRNA 2IVFB 1SQGA 4OYBA 1UKUA 2ZJPQ 4O3SA 1XNRF 1IQTA 3ENQA 1FRJA 3HZEA 2HMIB 1C4AA 4DLEA 4KH1B 4LRAA 2DRAA 2RQCA 1TKTA 2CQHA 1BY9A 3FFIA 4JI6J 4BHQA 4R25A 3C15A 2N4CA 2ROEA 2YY3A 5MAOA 1AA1B 1TVRA 2XCPA 4HYKA 2MQMA 4C8KA 5AJ3F 1ZAXA 3BGLA 4KE5A 1CC7A 2LA6A 5L9NA 5F8GA 3KLEB 3SV3A 1UEKA 4IH7A 4AQYF 4DX6A 1MW7A 4ERDA 3OL7A 2MGZB 2E1PA 5KFEA 1S5ZA 3NGSA 2VUGA 3FSIA 2YH1A 2FHKA 3RTVA 1H3DA 1MG7A 2B9EA 2Z2ZA 3LAKA 3UNGC 1KR4A 4ECTA 1QAXA 4CO5A 5T41A 1OSCA 4DDFA 1KD1T 1WDTA 4ZLPA 1VQPS 2E9TA 1WSVA 2J9CA 4NCAA 3HHLB 3LAMA 1U6FA 2CNNB 2EEYA 4CDIA 2KJVA 2M2BA 2IC3A 4OZ3A 3PR4A 4G1IA 3BJYA 4HDGA 3FUYA 3LALA 4J91A 3NGTA 1N5QA 2N82B 3GIMA 3KG1A 3TJ8A 2Y8YA 2B43A 3WZ0A 1XQIA 4DUYF 1J5OB 2I5JB 1O51A 2ALYB 1GMVA 4QIEA 2AGQA 2Q6CA 1FDBA 1EHWA 1RWNB 2M8HA 3ILIA 2K7KA 2GS8A 1IKXB 4EEYA 2KU7A 2ZVIA 5I42B 1LNQA 4DQIA 3A8JA 1FCAA 2GO8A 2M0GB 3CW2C 3LGNA 4ZHRB 2VV5A 5ETVA 1HNXF 3OUYA 2UUBJ 2XMAA 3KKFA 1U7LA 4PQAA 5CYQA 1TZ0A 1NPPA 3BZQA 3IRXA 4DCPB 3EPIA 3T1HF 3POTA 1S1WB 1TELA 3R7BB 3VF0B 1UW4A 1OQ3A 2E7WA 5DQGA 1D9DA 3THVA 4KRWA 2APOA 2RT3A 3KXDA 3IBFB 3ITHB 4RUCA 2LXUA 1Y0HA 5IXUA 1U1QA 5GAHI 4J9SA 4DQRA 2GFFA 5M2PA 3QJPA 4DR4J 3CVKA 1MU2B 4IG0B 3IXQA 1Q5YA 1LWFA 2W7OA 2X1AA 1T7PA 3NY0A 4WP8A 1RSCA 3T6JA 5KAKA 3DGPB 1RTJA 1WTFA 3KDNA 4QPXA 3IR5B 4FP9A 1Q79A 2VA3A 1HARA 2JSXA 5IC6B 4Q43A 3MEDB 1MROB 2Y1RI 1UFLA 1PGZA 4N76A 1VBXA 3OVBA 5HK4A 2BA9A 5GAEI 1PBAA 2GVZA 3EGVA 2GVDA 3EVOA 4KGXB 4RKUC 2VB6A 3PACA 4YB5A 1R27B 4MFBA 4TVAB 4ZP6A 3SMZA 5L38A 1HNWJ 1VQMS 5ETRA 3BQ2A 1URRA 3LWLA 3EWGA 3TA2A 4Y2CA 3TYTA 3AB2B 1HHTP 5EWEA 3PO4A 2MY7A 3LW5C 2WTFA 3HSJA 2V9KA 4CNZA 4ECYA 4CLYA 2UUTA 4CLWA 5LSLA 3Q22A 3Q23A 2V67A 3VWSA 4CCHA 4QYZK 2FHOB 1UA1A 2MQLA 3CF5Q 4RO0A 2O1PA 2FY1A 2DHSA 4K59A 3G82A 2NS1B 3BR8A 4Y2KA 4QWCA 2QSWA 1RT1B 5EUHA 2QYCA 4PXEA 5IQQA 3MTKA 5E3CA 4WCEQ 2Z2LA 3KUHA 1MN9A 3SDEB 3MHYA 3PW5A 2MY8A 2HNDB 4M1KA 3IWNC 4B3OB 2A18A 4TN2A 4LFCF 2LXIA 4J9NA 4NLSA 1SJRA 2IAJB 3QIPB 1NKCA 2WW8A 3D6TB 3G6XA 4DR2J 2IFXA 5F8JA 1T0TV 1SKUB 1HBNA 4OJGA 2VQFJ 1BQNB 5HQLA 1HNWF 4LRFA 3O6QA 3G96A 4F50A 3H5XA 3RB6A 3U1NA 2B9YA 2JOQA 1FKPA 2ACYA 2YKAA 1R8AA 3D6MB 3VVTA 5CAAA 2XMJA 2ZH6A 3DLEA 5J2PA 3D7SB 3OSNA 2WZ1A 2BBEA 2G13A 1SJ1A 3DOLB 4ZN3A 3SQGB 3UR3C 4DV0F 3T5HA 3CJ3A 4PXBA 1TK0A 3IR7B 3SFUA 1M5SA 2B3TB 3FBBA 4DR3F 3R1LA 2ASJA 3QSYB 3KG0A 4X64J 2AHOB 4EK2A 1Q82T 1MWZA 4MIWA 3M8RA 4I0WA 3R3TA 2OMOA 2VBZA 3FEXB 2NPIA 3QRRA 3FEYB 1UEUA 2DNPA 2KRBA 4QW9A 2E5LF 3VALA 1JLQA 1Y7PA 4DL3A 2WCXA 2HRUA 3R7SB 4BS2A 3OL9A 4DHVA 4LF6F 5KFIA 3B78A 1TAQA 1WOOA 1DARA 3ETMA 4Q44A 4IOCQ 1NJYA 3UD5A 2CJBA 2IA0A 5KFUA 2RAQA 2ZOMA 1LW2B 2MXYA 3A3OB 1CJVB 3OHAA 1ULRA 3GONA 2V8GA 1KEKA 2QGFB 5J1EA 2MQ8A 4I7FA 3NEKA 3HSDA 2QRRA 4DQPA 1DHMA 3D54A 5B0FA 4QWAA 3K8VA 3NS7B 2ZEJA 5DJBA 4BC7A 2AYGA 2KFYA 4F8RA 2G2ZA 5CYQB 5KFVA 2ZJQQ 2XYGB 1Q81T 1F3VA 1RAGB 4FKXA 3DYAA 3CD5A 1F5CA 1GFWB 4WE1B 4OX9F 4DUYJ 2I2YA 2VFVA 2PI5A 3PIOQ 3M8PA 3VCDA 5D4PA 4LF7J 1NH7A 1FVSA 3RZAA 4BLGA 4CO2A 3M8QB 4IG0A 1TK5A 4B9MA 2JEJA 4OYIA 2CQCA 4U7CA 4P2SA 3G6YA 2V2VA 1RGVA 2XHCA 2RDJA 2R3VA 5IWAJ 3PW4A 1HMVB 1URNA 4BBYA 2NXEA 3NAHA 1KFSA 4WTYA 1X8DA 1TU0B 4I2QB 4DSLA 1MROA 5DDQC 2BOPA 4U67Q 4I64A 5L1JA 5B0CA 1EARA 4AQYJ 1RUSA 2GIRA 4NCBA 3HD2A 2HZAA 2KO1A 4HHHA 4UOCA 1ZS6A 2KN4A 2YTCA 3GJRB 1NB7A 4QCLA 3PX4A 2FVCA 1M5KC 3WIUA 5ETTA 3MM7B 3G87A 4IFYA 3ZFVA 2UUAF 1L3UA 3CJ4A 4OI3A 4AE5A 1S1VB 4LSLA 5T14A 1RAAB 4GC7A 4I1TA 1T11A 2KT3A 1KSPA 4F3OA 1BLUA 1WNEA 4KHPJ 4K2XA 4JI2F 1RWMB 5KFZA 3VGVA 2PEBA 5IS2A 2YWHA 3AA8A 3KHLA 3PTWA 1B0VA 2JVRA 1RABB 1S9GB 5CQGA 5K14A 2GX8A 1H6KX 3VV2B 2ERRA 2VOPA 4E2FB 2E5HA 1ELOA 1TKTB 2IVMA 4PWUA 4J9OA 2ILZA 2OFHX 5T7LA 1G2EA 1TL1A 4KT0C 2UXCF 1OJ4A 2DGOA 1WD6A 1CULA 4WFZA 2E66A 1J5OA 2IVYA 3PO5A 4ITSA 1FRLA 3DFEA 1UP1A 3QT5A 5EHHA 4PWDA 2DGWA 2DB1A 2BKPA 4NLUA 1UZDA 3O44A 5C5JA 1NHKL 3BGRA 2J7UA 3PEHA 4OZ2A 5AXMA 4CLZA 1NZAA 4HHUA 3OW2R 4IH6A 5DLFA 2HHSA 3T9ZA 4U7UK 3MCSA 5KFMA 1FJCA 2G0IA 5A2QU 1JXEA 2CAJA 4EO6A 2IC3B 1O8BA 1C0TA 4ZJOA 4J90A 3BO2A 5FD1A 2QLJB 4CO0A 2KXFA 4ED3A 4FF3A 1WC5A 5E0OA 3KFWX 4DBQA 2DNKA 4U6PA 4AL5A 1WHXA 1R8PA 2H48B 4USJC 3W2VB 3W8GA 1VLYA 2XO6A 3UN3A 3KHGA 3GQCA 2WOMB 2HFSA 1TQLA 2A6MA 2W01A 3BEGB 2O01C 2J7KA 1S0OA 2LDYA 1ZA1B 2I0XA 3H5YA 2WSFC 3K57A 3FVYA 1S99A 2RMLA 5L1KA 2JLFA 4JI8F 4TY8B 2CPJA 4XPEA 3JQKA 4A8FA 1VQLS 5FJ4A 3WQPA 1EKSA 3UQSA 5M2RA 3V4MA 1NO8A 4K4ZA 4NYPA 2F1FA 1U45A 3SEOA 5J2MB 3DHWC 4ZPAA 3IS9B 5LM7E 2VPYB 1OY9A 4WP3A 4ZVGA 4YDDB 3AHPA 5EX3A 4JI0J 1RWOB 2AYEA 2OPSA 2EFOA 1UW9A 3EMTA 4YR2A 2JC1A 4C8YA 1Q53A 1D09B 4DV2F 3CUNA 1RZMA 2PO4A 5IM0B 5DQHA 1B0PA 3IM9A 5KFOA 4DLGA 4FS1A 3E8OA 4WIQA 3DDKA 1X4FA 2W2PP 3CJ2A 1RT7B 4WE1A 2R7TA 1HI8A 4NLYA 3MEDA 2WBMA 2DR6A 3W9HA 4WF9Q 1WOSA 3CJ5A 2B4VA 1S9EB 3HX9A 4WK3A 5CD4H 3ZZOA 1IKWB 2IY5B 2DNYA 2VDIA 2R2SA 3DRSB 2HRYA 3LPEA 3OXFA 4OZ5A 3CD7A 4TU8A 2B6AA 3CC7S 2C2RA 3N01A 4MK7A 3NMRA 3ADAC 3H98A 3QSIA 4OYMA 1YJRA 4ZPTR 4XO0A 1I1GA 4DL6A 3HHLD 2FZGB 2E1RA 4PPZA 2AYBA 3K5LA 2GQ2A 2YKMA 3UE2A 5DM6Q 1X5OA 2KDOA 1GMUA 4DZ6A 5C24A 4DX7A 3MR3A 1B3TA 1S0NA 4X4QA 4B9TA 3DLKA 2B4UA 3WX4A 2BJ7A 1HWIA 2QA4G 4DV6J 4UOGA 5DG7A 5C7PA 3BDPA 3UW1A 2LQ8A 1QTNB 2I8EA 2V8HA 3Q8PB 2BJ3A 2HK2A 3DOLA 3IFEA 5D0RA 3ZNJ1 3VAFA 4NZ7A 1MWYA 2LU2A 3KLGA 3K8WA 3ZZZA 4F4YA 2CDRB 2GJFA 1HWUA 2XWYA 2NXCA 2W4CA 2IYIA 3T5KA 2QMUB 1CBKA 1PYOB 4JP8A 4F36A 3HXMA 2ADBA 3ILOA 1FNXH 4ZVEA 2OHDA 2ATCB 2MMYA 3FBFA 1N36F 3CCVS 3NL0A 2K1RB 3M2UB 4J9MA 5J2QA 2DGQA 1X60A 3PCOB 4PWDB 2NQPA 1M90T 4O3QA 4DL5A 3PZPA 3PJ9A 4NOHA 1U8SA 4ZP7A 3L7PA 3HVAA 2XZWA 3GR0A 1ZM3A 2AJ2A 2KXNB 2DO4A 1UMJA 3SCLE 1UVIA 5BYRA 1S48A 4PG7A 1HKAA 1W26A 2RQMA 4UQTA 4B9UA 1C2PA 2NCKL 1WI6A 3K5OA 1PBUA 4HT7A 4LF1A 2LECA 2PFFB 1XMQF 4ZOSA 1YI2S 2XSJA 5HJXA 2R7WA 1BUXA 5LMUF 2IRXA 1VQ9S 3E01B 1SC6A 1H7XA 2ZWOA 3UDLA 9RUBA 7FDRA 4KIAA 3CDBA 1FWPA 3FRYA 8RUCA 1XTZA 1NSAA 3EZ5A 2KM8C 2DD8S 2ZKUA 5J1EB 1YDLA 2N7YA 5HMXA 3PW7A 2HVZA 1NXIA 3M6XA 1R0AA 5J2NB 1HNXJ 1HYSA 3QATA 1VRUB 4QIGA 4I2QA 4ES1A 5CA5A 4OL8A 3HF5A 3JS9A 4AL6A 1H38A 2GGPB 3CSKA 4M5DA 3ZXWA 5A8KA 1R43A 2XLKA 4C4WA 1U2CA 2XS5A 2MHEA 1LV5A 1MMLA 3MTJA 4NZ0A 3M8PB 1T03A 4DCJB 4ZCIA 4K4SA 3TANA 1YWXA 4FXDA 3TQEA 2GHPA 2X3DA 2W7PA 1U1RA 5H1SV 2QO3A 4G65A 5CYMA 1KDNA 1ZBTA 5A6WA 5CXTA 2UVRA 2CADA 1IKYB 1RT5A 2BE2A 2FJDB 3JQMA 3NCQA 5IWAF 1BQXA 2F9JA 1R0BG 1HD0A 3W5ZA 1XR7A 3LP0B 3VAKA 2C22A 1IJFB 1PIEA 3J80Y 5DM7Q 2YBVA 3QRPA 1WG5A 4MYUA 3P45B 2RRAA 3IR6B 2J6UA 1PG5B 3O8WA 3MR7A 4C9DA 3NCPA 5KG5A 3MCNA 3MM5B 1YJ7A 4DL0C 2EG2A 2AEFA 2QT7A 4AXIA 2HHHJ 5IT9Y 5A8WA 1AUDA 3M7VA 2A0FB 1Y11A 3AA9A 3NWGA 2BANA 2H3EB 2KT5A 2LVWA 4JI6F 3W9IA 1N8RT 5MLCV 3NLCA 5FIIA 4Y65A 2R7SA 2D41A 2AJ0A 3H25A 3D1OA 3HKWA 2OD6A 1U0SA 1DJ0A 2IIHA 1K47A 2IDLA 5KFRA 4Y28C 3DLKB 4ECQA 2XS7A 2J8AA 2C28A 5T7LB 2DHAA 2OEKA 4QQBA 1BWEA 3DLBA 4FYWB 3BQ1A 1QVGR 3UNYA 4WFNQ 3FQKA 4ED2A 2OJ3A 1KONA 4A8YA 1RTIA 2WSCC 4ZJLA 3GE9A 1FTRA 5B0DA 2KH9A 1BQMA 2JHEA 1WG4A 3K89A 2YNHB 4UY8T 4J9QA 1XEZA 1EQ0A 1VQ4S 1YJUA 2HRTA 3W61A 4X4PA 4KJIA 1N0UA 1FD2A 4PPDA 4QU6A 5KFAA 1S6QB 1V3RA 1RQ0A 3A12A 1Q95G 5B0GA 2EPIA 1Q0NA 3BYPA 3I4PA 1SIZA 2CQPA 2HFZA 2WB1D 5F3ZA 2JNJA 3QFHA 4ENOA 4J9RA 2FPHX 2PFDA 1FJ7A 2AKWB 1ACMB 1U26A 2Z56B 5DGBA 4RW9B 3TAQA 4H4MA 4FF4A 1A6LA 1CJKB 4NL5A 4NPOA 2ZHOA 3HHEA 4ED7A 5ETQA 4P7VA 2KTQA 3W5XA 2F3JA 4HDHA 3H2UB 4FVCA 4DL2A 3D2WA 2AQ4A 1HFEL 2ZKTA 3R5AA 4FXVA 4OLPA 4LF8F 2GW8A 5HBMA 1Y4ZB 3G2XA 2LYVA 3RRKA 4Q0BB 5F0UA 3ISZA 3T5LA 3EUNA 3E01A 3UWTA 3GILA 1SVDA 2CUYA 3DM2B 3QO9B 4TNOA 1S9EA 3QJLA 4RW6A 2WONA 3TZWA 1IKWA 1UTAA 4Q8FA 3J7YU 1NMEB 4C0BA 4OYAA 4EBCA 5I3UB 2OSRA 2XEXA 2ZBCA 3TA1A 2NUUG 2KG0A 2FJXA 3JTNA 4RBVA 4PG8A 2FUG9 4HH1A 4XTTA 1NK7A 5K5MA 5IM0A 3HLUA 2Q3PA 3N6MA 1IBCB 3RBEA 3N6NA 1SH0A 5B08A 2CZ9A 1JNZB 2XMTA 1JNRB 2HWHA 2E1MC 2J9DA 3CJKA 5CD4A 4LF2A 3C3LA 3BPSP 4DFKA 2LQJA 5HMZA 1NSQA 4CO1A 5C2GA 1I5OB 5HQMA 2DO0A 1KKHA 4O44A 4PUOA 2FVRA 1EETA 1UWBB 2OO4A 1HQUB 2RRBA 3KJQB 3I0RB 1U1OA 2JFDA 1Q8IA 4CLUA 3KLHA 4LUBA 2QE5A 2J0WA 1Q5VA 1K0VA 3AB4B 3K5PA 4DN0A 5A8RB 4F0KA 3MOZA 4K4UA 3PM9A 2WW4A 2COLA 3DRRB 4NA3A 3T9NA 4DFMA 2ZNZA 1VFJA 3C2PA 2R7XA 4MT1A 2IMWP 1SI9A 3D3BJ 4R8UA 2F5GA 4F0MA 3KUEA 5GVQA 4EGLA 1KOOA 2DBBA 2H5IB 4M5KA 4OJ3A 4K0KF 1JX4A 1RACB 2BJ9A 3MEGA 4KTQA 2OPQB 4YN3B 3VR1A 5KOWA 5H9EK 1U1KA 3J7Z5 1REVA 4KO0A 4WKRA 3CJQA 4QBUA 5LJ3Y 2W2OP 1YBTA 4OX6A 1UVKA 1HNZF 2DR7A 3M2VB 5F8LA 2Z30B 2KRRA 4CIOA 3MAAA 4J9VA 3H90A 4ZK7M 3FBCA 1TP7A 4OZ0A 2BDPA 1LEOA 3TEGA 4GKJJ 1C1CB 1TKZA 2K1RA 4XK8C 2WK4A 3FMWA 4PYDA 4ELTA 2P6SA 4ILRA 5D0GA 1HI1A 1S1TB 3AOCA 3GCWP 5KFGA 4ZLNA 2W9CA 1VQ7S 1FEHA 1WF1A 4M5LA 4RNOA 4K7QA 3FQLA 5E3PA 2RILA 5LXYA 2FVPA 4RNNA 3BH6B 3I5BA 3MMAB 3P3DA 2B4OA 2XQCA 3OLAA 1SC1B 4F02A 3D0HE 4ECWA 4V1Ak 1WI8A 2NXUA 5J1NA 4CH0S 1ZETA 2UVUA 3THTA 3OTDA 1VCTA 4IQXA 4CLFA 4RBUA 3MFHA 2FLPA 4LFAF 4GMKA 2ASDA 1CEZA 3TX8A 1TUWA 3B4DA 2F4VJ 3ZTSA 2KYXA 3QGGA 3PVXA 1S0VA 2RVJA 1HR0F 1MN7A 1HWJA 2VIHA 1K1QA 3UCGA 2ZH8A 1CVJA 1K8AT 1BHNA 1C0UB 4USIA 2W2QP 1CJTA 3Q8YA 5A76A 5AXKA 2BMBA 4S0MA 2ROGA 2IM0A 1TK8A 1RAIB 2R8KA 2LEAA 2MTLA 5J2NA 3PEJA 2BVZA 2DITA 1YLXA 3NNAA 1GX6A 1F9EB 1VRUA 2AGOA 4V19J 1G4CA 2HQCA 5KG4A 3D1HA 3MM8B 3HFZB 2GGPA 2H5JB 1QE1A 4WBFA 5DZ6A 3DM2A 3QO9A 3LP1A 4KAIA 3W2WB 3DXBA 2V50A 4ZVOB 4I2PB 5A0YA 5LT5A 4B17A 1RAOA 4DUZF 1T03B 4UW2A 3EDQB 2DXEA 3M32A 1RTHA 1B99A 2C3OA 1NSKL 2GQCA 2B9XA 2Y3YA 4K2JA 2HFOA 2POKA 1OY8A 3KLIA 1F0XA 2NSBA 3N5BA 1OIAA 4ETZA 4NLGA 4LBHA 1D3WA 1N54B 3FKBA 4ELUA 3M9MB 4KYZA 1E6YB 4JUZA 4X84A 1JLFB 1RT5B 2QC3A 3K7RA 1Q78A 4ALZA 3Q8RB 3OL8A 2VA2A 1AW0A 4C11A 1Q86T 3CJSA 4H4KA 3FCVA 3TVKA 3I0SA 1CC8A 1NNDA 1JLEB 2F7VA 2QG9B 4ZLLA 4XDDA 3GIKA 3GU0A 4MMOA 2AGPA 3UDCA 3EXCX 3L7OA 4B08A 3FBEA 4JI7F 1N6QB 3HT0A 4I67A 4WK1A 2CQ2A 4YP3A 3RB4A 4U7UD 2Z58B 5F8MA 3UPFA 1DZ5A 4ZMMA 4PG5A 4DMZA 2IRUA 2F8EX 5CCMA 2VICA 2VG7A 2F8HA 2IJRA 4FYYB 2RUGA 2V4QA 1HQ2A 3ENAA 1UJ5A 4R8UB 2ZH2A 2CRLA 4JV5F 1S0MA 3VHQA 2J9DE 3DMJB 2X1GA 3I6PA 3MGJA 4ILLA 2HQFA 1HLWA 3D9BA 3QBCA 1SKSA 3AODA 4QWDA 1FA0A 2V68A 2R42A 3H8YA 4J9UE 5DGAA 5IT9U 2HYIB 3IO1A 1T9YA 2GQQA 4P7TA 4F25A 4L72B 1VQ5S 1M1GA 1VISA 1XBWA 1ZAVA 2DIVA 2HHPA 3FFIB 3H5UA 5HJYA 2ZM6J 2FLLA 3A13A 3A3PB 4TLRA 2WBRA 3UR0A 1U0HA 1X5TA 1N34F 1VOMA 3LO3A 4DR2F 1EZZB 2AJFE 2HEKA 2M70A 4N8OA 4O23A 3D28A 2B9WA 4RPFA 2K7JA 4OYZA 1RDRA 5AE1A 2UVVA 5D3GA 2H9ZA 4HEA9 2CWKA 3GIRA 3KK1B 4DV5F 2DEIA 3MCOA 2B56A 4F7VA 4G3IA 2NPFA 4FF2A 3CJRA 3DKDA 1AFJA 2WONB 1KP6A 3QYYA 4FXWA 1TKDA 2R7RA 3EE3A 2CG4A 1TFYA 2FC8A 1FERA 3HHLA 4ZVSB 4C3LA 2V2KA 3KHHA 4LF6J 2I9SA 4OQJA 5KT7A 2GVDB 1I94F 1M1HA 4C97A 3D6FB 2G1DA 2HNDA 2X51A 2LFVA 2V8VA 3PY8A 3QFWA 2V4RA 3BO4A 2CDQA 1P1TA 1RI7A 3NG8A 4TYAA 1NJWA 1B64A 2Y0SD 3TVYA 4X4UA 3FDSA 4TYBA 1FX4A 2M7SA 2V69A 2QLWA 4URSA 1OS5A 4YUDA 2MEWA 5JXSA 4DR3J 4LF4F 1HNIB 2YQ1A 1IJEB 5HAOA 1QSSA 4RW6B 3OTOJ 1GNKA 4FYXB 3G82B 5DS7A 1PC5A 1T9WA 4NLRA 3OL6A 1VYAA 3RR8A 1FHTA 2DNQA 3GYNA 3I82A 3MM6A 3BBCA 3SSQA 2KG1A 2UUCF 3POTB 4UOFA 2ATLA 1YJNS 1L3KA 2GMHA 4NCGB 2WB4A 5K8MA 2I5JA 4DR5F 3SV4A 3LP1B 1UEVA 2JH3A 2BE9B 3J7ZT 2VQFF 2G4BA 3HSGA 1HNVB 2QL9B 3GIJA 2JC0A 1GMWD 4NE9C 5L8RC 3BREA 3C6TA 3VAIA 3HJFA 2NZ4A 2LQ9A 2BW7A 2W9BB 2NXNA 3RRGA 4OZNA 1QLNA 4B9LA 1QM9A 2CPEA 3NCRA 3OUYB 4DQSA 2CFXA 4OHYA 2DRBA 4DF4A 2MJNA 3PX0A 5HANA 1PILA 2MLZA 2PMWA 1QD1A 3IRXB 4WYWA 4NXNJ 1FXRA 1SKWA 2CQBA 1E6VB 1RT4B 4P75A 4CZCA 3UD4P 2CPDA 5KTQA 4UT4A 3RRHA 1Y5LB 1RHRB 2DNOA 3Q2TC 3BGUA 3ZTPA 1IQZA 3NXZA 4UOHA 3SQGA 3F44A 1RYRA 5DRKA 1NDCA 1TKZB 1UVNA 2HAIA 2MKJA 2R2UA 3J81Y 2HWIA 3PRBA 5GMEA 1WDDA 3FCWA 4IG3B 4KKOB 2ALZA 1U49A 4W98A 1C4CA 3WHIA 2DNHA 4UTGA 2ZZNA 4OJ1A 4FBTA 3C46A 3H4BA 3FJ2A 2CNOB 1YBAA 2D3OR 1HWKA 2V6AA 4DR7J 2VG5A 3JAMY 3BDEA 3NGUA 2FTRA 4J7CA 1J5EF 3QT6A 1I51B 1XNQF 4YY3F 3MAAB 4HTJA 4I6WA 2ZH4A 2DHHA 3SSRA 3GPAA 1RCOB 1RT3A 3IGVA 2VG6B 1N5SA 4RUBA 1WKLA 2OAUA 5KT6A 2EFPA 2DXFA 2IAJA 3MEEA 2NR0A 4OMFG 1FXDA 2C2NA 3KJFB 4IDKB 4DU7A 4CH1A 1FTCA 1H98A 3MMBA 3NBPB 1SB6A 2C2OB 3CMES 4JI4F 1G6BA 5HATA 3GTYX 3NP5A 1HBOA 1S49A 2JLGA 2GJ2A 2UXDJ 2BQ3A 1H2VZ 3DRPB 1BMQB 1RT1A 3GLJA 3JTOA 3TJ9A 4BC9A 2E5GA 3M2RB 3U7JA 4DPXA 4A47A 2JEGA 3L4BC 1SJ3P 1X9MA 1EP4B 2MHNA 4LSLB 5KT4A 2DGUA 4NLPA 3MR5A 3HFKA 4PG6A 4B9VA 1AT1B 1IKVB 4MKBA 1W25A 2IM2A 2H51B 1VR6A 3MAHA 1QE1B 3VGTA 4YR0A 3K0JA 1HMVA 4O0NA 4P2XA 3W2WA 5KOXA 2ASLA 3GJQB 4HLBA 2ZH5A 2QA4S 5KFLA 3JTPA 3MPYA 3GSDA 3JSBA 4LSNA 3Q89A 2M3DA 3FZBA 4WFYA 4DPUA 2AW0A 4O3NA 3WIVA 1ZM4A 2D7SA 4I69A 3CCLS 3KYLA 4DS5A 1Z2ZA 2FGCA 1RE1B 4O3OA 1FRIA 4RZRA 3ONQA 5FDLB 1RLDA 1Y10A 4M5NA 1X4EA 2MSTA 3RAMA 4ZCMA 2VBWA 2ZM6F 3IBWA 4JYAJ 3I87A 2R7OA 1GTHA 2UU9J 1LK7A 3I5AA 2UXCJ 1N5TA 2AF6A 3NGKA 2M8DB 4ELVA 2ZOGA 1ZZFA 2XTJP 3BSAA 3T1YF 4HI2A 1CJVA 2V8PA 2KKHA 4FPRA 1H74A 1YG0A 4I2PA 5A0YB 4NA2A 2WAQD 4PG4A 5D4LA 4C7QA 2H1YA 1X7VA 2PA8D 2ZFHA 2F63A 4YFUA 2CWXA 1G7CB 1UAWA 2XG8A 2VU5A 4DL7A 4F4KA 3IN5A 4ZVFA 3MPDA 3PIPQ 4QPTA 1PJ6A 2VG7B 5CYJA 1D1UA 3KMQA 3A8EA 2B7CB 3BR9A 3DLGB 4KV8A 1UZHA 1UWAA 2CZ4A 3AQPA 5DDRC 2X7IA 1RHMB 2PA3A 1U2FA 3UCUP 4URQU 5HSPA 4DV1J 3P96A 3R6GB 2ZH9A 2FQQB 2MZRA 1DQ9A 4WXWA 1JJ4A 1KWMA 1WHYA 2GJIA 4RW7A 5IOLA 4IRDA 3N4WA 1RHUB 1SC4B 2AJ1A 4HI1A 3DOKA 4TQSA 1V3ZA 2C2ZB 2YVSA 4DEZA 2ZH1A 3D1QA 1QUPA 3H42A 3GYXB 1P9YA 4ZKAA 2HVIA 1RWPB 3OR2A 1XWLA 4U8VA 5KFXA 2OPPA 1KVJA 3CWJA 4WZQA 3SBMA 3Q83A 2XS2A 1TV6B 3DMJA 2PD1A 3LANA 4WKYA 2BE7D 2J8SA 5RUBA 1SJFA 5AXNA 1JQGA 1BWVA 3MD1A 1S9GA 1YK9A 1IN0A 4CLKA 4ZA1A 3PFOA 2ZE2B 3GFHA 2EKNA 2EFVA 3TUZC 3G8TA 3TNVA 4B9SA 2VQEF 2GIFA 4CO4A 2KZZA 1IVZA 2DKOB 3LWMA 2BYCA 5HLFA 4K0KJ 1Z1ZA 3VGUA 3TZXA 1CULB 3W5YA 2J0QD 2D3UA 1KTVA 1S6UA 1JB0C 3NWRA 3EVMA 1WUUA 2KB2A 2B6AB 3C66A 2XI3A 3HSZA 4MKAA 5ETKA 3R5BA 4B3MJ 1N88A 1NK9A 1QDUB 2EC2A 3M30B 2MDAA 1U25A 2QLBB 3KJNB 4B3RJ 1Q8BA 3NBPA 4UQGA 2GMJA 3ILJA 3X3UA 4USKA 4L3KA 5K14B 4ICLA 2HBYB 4LFAJ 4DV0J 1RT7A 2FJEB 5E7OB 2C2KB 2FIUA 1S57A 2QL5B 4RU2A 3K58A 1NDKA 4YY3J 1SV5B 2PSZA 2IBKA 1ROFA 3V2UC 2DIUA 1T02A 4DX5A 3TWZA 5JVGQ 3J7AN 2PEHA 1RWWB 1FWLA 1WC0A 1IKVA 1LOUA 1Q4RA 3MFIA 3SCKE 4U95A 3K5NA 1X4BA 3U02A 3W9JA 2UVWA 2DH8A 2B8PA 1HBUB 2QZ8A 2ZBRA 1PJ5A 2WVFA 3CC4S 3AJDA 3DRYA 2V0NA 2W2NP 3BGRB 3P4UB 1HNIA 1RCXB 1U1LA 1XMOF 2GNKA 4USUA 3Q8VA 4JI5J 1Q1KA 1X4CA 2VONA 4GVBB 5B0AA 1X0PA 4TY8A 4XAKA 2NREA 3CDAA 3OFEA 1NSPA 2HIYA 1C0TB 4KSEB 4YEAA 1RKJA 2ACMA 3HT3A 3NOCA 1WHVA 4NXNF 3BKUA 4GKKJ 4N5SA 1YZ7A 3HD1A 4F4AA 2A6OA 2EFQA 3PG9A 3A1YG 1HPZA 1N33F 2WOMA 1VQ8S 2PGCA 2MZJA 3OXGA 3KLGB 4NEZA 2IHR1 4L75A 4E98A 2AZ1A 2OPSB 5B7WA 2QFJA 3X1LB 2BKNA 4LR9A 2KYZA 2YXLA 4N41A 4M8LA 4P2FA 5HROB 2IJFA 1RWUA 1U47A 1KBRA 2C3PA 3OXLA 4HHJA 2GC8A 1VRTB 2UZAA 5ETPA 4ZVPB 3W65A 5IFMA 1IBMF 1D8YA 2OIHA 2OPRB 3M2UA 4GRSA 2JEFA 2W4PA 3LA0A 4A8OA 2NXJA 2AJ4A 2YH0A 4E8UA 1RT4A 1CPZA 4UZCA 3M6VA 5EDWA 2XULA 3IG1B 4MH8A 2XMUA 3DI6A 4LRBA 5DLGA 1CQNA 2BJEA 1O5JA 4Q2MA 3N6LA 4JI8J 1YBUA 2ZUAA 3MEEB 3U1MA 1FD8A 3RW6A 4WZMA 3QWPA 4QOTA 2GAHC 4P72A 1UPMB 1P27B 4KHMA 2CZVC 4IG3A 4IYQA 4CP5A 4IOAQ 4CLTA 1KLNA 1KN6A 2KVIA 5GAEU 2CJ9A 3QGHA 5GADI 1WF2A 2V34A 4B3MF 4ED6A 3CCJS 1SUQB 4BWMA 4ZPWR 4NXMF 4C3KA 2RF2A 2ZD1B 3MZIA 3LQVA 4MJKA 2HLTA 1ZAWA 2NYIA 1HW8A 3N0VA 3G6VA 1VLOA 4AYBD 1N48A 1VIOA 1Y00A 5KG3A 2J0SD 1NKBA 2MB0B 4M95A 1F5AA 1LWCB 1QAIA 1HHQA 2HPUA 3CCQS 4Y2MA 4U8YA 4Q7AA 1KHWA 4LF5J 1D9FA 4NYZA 2EG1A 2ZE2A 4MK9A 4ZITA 3KUGA 3G86A 4G1QA 5KFBA 4YOEA 1B0TA 4M5DB 3C15B 1HA1A 2QFIA 4OHVA 3CMAS 3BBBA 4KY3A 3GWCA 5G4DA 1B7YB 1X4DA 2OFGX 4K8RA 3OLBA 4K4WA 3DRPA 2IDEA 3FK4A 2Y1IA 2O3DA 3GP9A 3M2RA 4NA1A 4OZLA 2CPXA 5D4NA 4WU2A 1L3VA 5KFPA 5CZVA 4FBUA 3GFXA 2QJ3A 2VFTA 4YB7A 2AT1B 2YNIB 3S8SA 3RB3A 3SFGA 1FO1A 2JX2A 1T9XA 2CNLB 3CO0P 1F9HA 4ZVQB 2L48A 1VQKS 2W24A 4NRUA 1FJGJ 2FB0A 2J9EA 3LP0A 5BYSA 5DDPC 4JI2J 3V6DB 3GIIA 3CTRA 3LOUA 3UO0A 2RJZA 2FJVA 1VBZA 4DV7F 3S6EA 2L9DA 2RQ4A 4P2MA 3HZGA 1RTIB 2VDHA 3QRQA 3PRVA 3DLJA 5IZHA 2MZTA 1BQMB 1X5SA 2EKYA 4Y2IA 2OELA 2PI4A 1DLOA 2MZQA 3US5A 2W1BA 5IV3A 4QIVA 2BX6A 1FFGB 5I42A 2HLUA 4ID8A 1FWKA 2XWXA 5HVFA 1L5UA 1PYSB 4KC5A 3I96A 2FJAB 1AZSB 2WVDA 1A7GE 2I1RA 3R6LB 4AUKA 2FHMA 1H2UX 6FDRA 4CI0B 3HDSA 1QJHA 3MPUB 2HKEA 5F3TA 4KGZB 4NZ6A 2G0CA 1YVFA 4EUVA 4R5PB 3CD6S 4NLXA 1RAHB 5F41A 1DFDA 2VF3A 3BV8A 3CDWA 2VBYA 4PABA 1NUEA 4X4RA 1UJ6A 1S7HA 1C1BA 5EWFA 3Q8UA 3OR2B 2BACA 3H5SA 3VAHA 2YNHA 3DLGA 3MD3A 4KV8B 4PXDA 2XI2A 2RU9A 2UUWA 2C2DA 2W25A 2C3YA 3IAM9 5M2UA 1WC6A 2YWKA 4DR6F 2JZ5A 1ZTTA 2V5HG 2DEJA 1Q7YT 1GTEA 4X65J 4DL4A
chains in the Genus database with same CATH topology
4NEZA 2HHHJ 4JYAJ 2UU9J 1N36J 2UXCJ 4GKJJ 4LF6J 3W1YC 5AJ3J 4DUYJ 2UUBJ 4LF7J 4B3SJ 4LF4J 1HR0J 1J5EJ 2KL8A 3D3CJ 4V1Ak 4DR3J 2MEWA 5IWAJ 1XNRJ 2UXBJ 4JI8J 3OTOJ 4DV6J 4PWWA 4DR4J 4AQYJ 4DV1J 4RJVA 5IT9U 4YHHJ 4JI1J 5FLXU 3T1YJ 1N33J 2MTLA 4DUZJ 4LF8J 4KHPJ 3R2CJ 1N34J 1HNWJ 4LF5J 4DV5J 4DV7J 3JAMU 3R2DJ 1N32J 4NXNJ 2VQEJ 4NEYA 4KY3A 5LMNJ 2E5LJ 1HNZJ 2KVQE 3J81U 4JI4J 4KYZA 2UUCJ 4DV2J 3IMQJ 4K0KJ 4HHUA 2UUAJ 5BR8J 1FJGJ 5A2QU 4B3MJ 4DR6J 4JI2J 1XNQJ 3J80U 4DR7J 4DR2J 4DV4J 4B3RJ 1IBKJ 2VQFJ 4B3TJ 4LFAJ 4DV0J 1HNXJ 5LMUJ 4YY3J 4DR1J 1XMOJ 1IBMJ 4LFBJ 4X66J 3J7AN 4JI6J 4LF9J 4DR5J 4NXMJ 2UXDJ 4OX9J 4X62J 4DV3J 4JV5J 1I94J 3T1HJ 1XMQJ 4X64J 1IBLJ 4JI5J 3D3BJ 4LFCJ 2ZM6J 5LM7E 4JI3J 4JI0J 4JI7J 2F4VJ 4GKKJ 2MQ8A 4X65J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NEZ A;  2HHH J;  4JYA J;  2UU9 J;  1N36 J;  2UXC J;  4GKJ J;  4LF6 J;  3W1Y C;  5AJ3 J;  4DUY J;  2UUB J;  4LF7 J;  4B3S J;  4LF4 J;  1HR0 J;  1J5E J;  2KL8 A;  3D3C J;  4V1A k;  4DR3 J;  2MEW A;  5IWA J;  1XNR J;  2UXB J;  4JI8 J;  3OTO J;  4DV6 J;  4PWW A;  4DR4 J;  4AQY J;  4DV1 J;  4RJV A;  5IT9 U;  4YHH J;  4JI1 J;  5FLX U;  3T1Y J;  1N33 J;  2MTL A;  4DUZ J;  4LF8 J;  4KHP J;  3R2C J;  1N34 J;  1HNW J;  4LF5 J;  4DV5 J;  4DV7 J;  3JAM U;  3R2D J;  1N32 J;  4NXN J;  2VQE J;  4NEY A;  4KY3 A;  5LMN J;  2E5L J;  1HNZ J;  2KVQ E;  3J81 U;  4JI4 J;  4KYZ A;  2UUC J;  4DV2 J;  3IMQ J;  4K0K J;  4HHU A;  2UUA J;  5BR8 J;  1FJG J;  5A2Q U;  4B3M J;  4DR6 J;  4JI2 J;  1XNQ J;  3J80 U;  4DR7 J;  4DR2 J;  4DV4 J;  4B3R J;  1IBK J;  2VQF J;  4B3T J;  4LFA J;  4DV0 J;  1HNX J;  5LMU J;  4YY3 J;  4DR1 J;  1XMO J;  1IBM J;  4LFB J;  4X66 J;  3J7A N;  4JI6 J;  4LF9 J;  4DR5 J;  4NXM J;  2UXD J;  4OX9 J;  4X62 J;  4DV3 J;  4JV5 J;  1I94 J;  3T1H J;  1XMQ J;  4X64 J;  1IBL J;  4JI5 J;  3D3B J;  4LFC J;  2ZM6 J;  5LM7 E;  4JI3 J;  4JI0 J;  4JI7 J;  2F4V J;  4GKK J;  2MQ8 A;  4X65 J; 
#chains in the Genus database with same CATH topology
 3DOK B;  3GG0 A;  1YJV A;  2BUN A;  4AXJ A;  2BJD A;  3H2L A;  3KLF A;  4HT5 A;  4DG1 B;  2GVZ B;  3RAQ A;  2W7A A;  1KVK A;  1WKJ A;  2LKZ A;  1FX2 A;  1OPZ A;  5KG0 A;  4ETX A;  4PRF A;  5CHC B;  2HMI A;  1KRP A;  3MI7 X;  4OHX A;  4IRK A;  1QY7 A;  5I3U A;  1JXL A;  1TL7 B;  4R0J A;  3IM8 A;  2UV8 G;  3GR1 A;  3QNW B;  3MEK A;  5KFN A;  4OI0 A;  1S76 D;  3P5B P;  2J5A A;  3AD9 C;  2IM3 A;  4TKT A;  5A8W B;  2MKS A;  2AD9 A;  4B3S J;  1JLB B;  1HR0 J;  2EFG A;  4NLQ A;  3TEH B;  3TAM A;  1NRK A;  2KL8 A;  3B54 A;  3KLE A;  2BRL A;  4KPC A;  4OYW A;  1YGY A;  1Y5I B;  3EVW A;  3QPI A;  4QR2 A;  5F8H A;  2MGZ A;  4ER8 A;  2DPJ A;  3M8W A;  2ZVS A;  1FK9 B;  1OSD A;  1S4E A;  2HGL A;  3M8S A;  1X31 C;  3IBC B;  3SDE A;  3CCT A;  4H4K C;  2CJY B;  1VQO S;  3JQJ A;  1VJW A;  1HHS A;  1AB8 A;  2AMC B;  1AYE A;  2JL9 A;  3UCZ P;  3H7H B;  4RW8 A;  4O44 B;  2MKH A;  3SXL A;  2OP5 A;  4P71 A;  1U09 A;  2DR5 A;  5HVH A;  3M30 A;  4H4O B;  5ETS A;  4WFB Q;  3CD0 A;  3HHN B;  2HS4 A;  4RL1 A;  3G4S S;  4DR1 F;  4FVM A;  1S6Q A;  1CJU B;  1NPR A;  2J6T A;  2FVQ A;  2E1A A;  2HGN A;  4QU7 A;  3QMQ A;  3S01 A;  1GQE A;  1NHU A;  3SSS A;  1YJT A;  4N77 A;  4H4M B;  5DG9 A;  3F0N A;  2C2E A;  4C8O A;  2RDD A;  1CJK A;  4OJH A;  2ZDP A;  4PR6 A;  3TQ1 A;  1X4G A;  2K3K A;  1REV B;  2PMH A;  1TUV A;  1V5I B;  2FHJ D;  4KO0 B;  4CTA B;  5DG8 A;  3ZC4 A;  1NDL A;  3PV8 A;  2NYH A;  3CXC R;  2KXH A;  4DV2 J;  4ZN1 A;  1QAJ A;  3V6K A;  1IXK A;  3PKY A;  3AQO A;  4AL7 A;  1GK8 A;  5L1I A;  4Q0B A;  2AX0 A;  1MU2 A;  1VQN S;  4LT6 A;  1U1M A;  1WKK A;  2JVO A;  4F04 B;  4WTO B;  5E3R A;  1JWW A;  2Q66 A;  3PW2 A;  4NWB A;  2CVE A;  3ULH A;  2L9W A;  4DUT A;  3MMA A;  3QAU A;  1PCA A;  2P6T A;  3GYG A;  2C3U A;  4RWX A;  3J81 j;  3MM9 B;  3JSM A;  4WXO A;  2R9L A;  3B4M A;  3TAR A;  2G9O A;  3L3C A;  2JRS A;  2XB2 D;  1RWX B;  2ZDO A;  2V2Q A;  3M2V A;  3SQO P;  5ADZ A;  1RYS A;  2J6S A;  1DTT A;  2FJW A;  5F0W A;  1IBM J;  2DGX A;  1RT2 B;  1ITP A;  1FNO A;  2B7B B;  1C1C A;  3TRG A;  5EX0 A;  4ATN A;  4F4Z A;  1C1B B;  2EK1 A;  4A8W A;  2YNF B;  3IGN A;  3SCI E;  2IRY A;  3TI0 A;  4RR5 A;  1SCJ B;  2HBR B;  3TUP A;  1TKX B;  1B70 B;  3EXY A;  3QGI A;  4N47 A;  2P9E A;  1NPK A;  2A1B A;  2QL7 B;  1HL6 A;  3IG1 A;  3QID A;  3S1T A;  4YS2 A;  5B0B A;  4DFP A;  3FRZ A;  4X66 F;  2BKO A;  2DGS A;  4WFA Q;  4LFB F;  4FDF A;  1IBL J;  4P9S A;  2XYH B;  4IUF A;  1NM2 A;  3TUJ C;  3C16 A;  2L3M A;  2K8G A;  4JI3 J;  2XZD B;  3BM7 A;  1GEH A;  2E29 A;  2M4M A;  5I4M A;  5EGY A;  3B82 A;  2BW2 A;  1IWA A;  3WDO A;  3KHR A;  4DF8 A;  2Y8W A;  3MXH P;  4CLL A;  1FRK A;  3TVZ A;  1J2V A;  2VJU A;  2MYF A;  1VRQ C;  2Z8Q A;  2XM3 A;  1WWH A;  3PDN A;  3IWX A;  4M5H A;  3IA0 A;  3DU6 A;  3MMJ A;  1DUR A;  1S1U A;  1T3O A;  3PFE A;  4PKD B;  5KG6 A;  3V5R A;  2F4F A;  4Y00 A;  5JUM A;  3AT1 B;  3CJT A;  1CJT B;  4EU0 A;  3CPW R;  2JEI A;  3VGS A;  4O4R A;  5KFQ A;  1P8G A;  1LWC A;  2DNL A;  1S77 D;  1SXL A;  3MEG B;  1EAY C;  4K4X A;  1K9M T;  4EZ6 A;  1I94 J;  4A8M P;  1I3O B;  2PDA A;  2WHO A;  2CNK B;  2E5I A;  1S7I A;  3CO9 A;  5HVG A;  4QR1 A;  4C11 B;  2YKN B;  4RU9 A;  3GV7 B;  3H0P A;  5A8R A;  4F2R A;  2K06 A;  2R7V A;  3I0S B;  1RBO B;  3RBZ A;  4DSI A;  4Y2A A;  1NJX A;  4DV4 F;  3IRW P;  1MNE A;  2X1F A;  5HP1 B;  1JLC B;  2AV5 A;  1UFW A;  4RW8 B;  5GMK a;  5KFW A;  5LSR A;  1LWE A;  4QIF A;  4FYD A;  2U2F A;  1YX2 A;  2XMK A;  4WWS A;  5IT4 A;  2KI2 A;  2EBG A;  2J0X A;  5IC4 B;  2LXF A;  5BYQ A;  2AYM A;  1NJI T;  2UP1 A;  2JDJ A;  5K8N A;  4YHH F;  1FF2 A;  2QMW A;  3FC9 A;  3W8P A;  2LEP A;  2B51 A;  1Q8K A;  2N3L A;  4XIU A;  4YHH J;  1BD6 A;  1RWV B;  1LWX A;  4LRE A;  4B3T F;  3L9Z A;  4P10 A;  3T1Y J;  5DDO C;  1X9W A;  1Y3K A;  3UVJ A;  1YSJ A;  2MQO A;  2QEX S;  1YZ6 A;  2DYA A;  2GML A;  2RE1 A;  4YDX A;  1TL4 A;  3R2C J;  3R97 A;  3CT9 A;  4QW8 A;  4WFX A;  4DJB A;  3TAP A;  2UU9 F;  4RNH A;  1WTB A;  2J7W A;  3GJS B;  3DLH A;  2SXL A;  2HIQ A;  3C6U B;  3CCW A;  3DYA B;  3PYD A;  3JAM U;  2VC1 A;  2E1C A;  1N32 J;  3R2D J;  4KHP F;  2KHD A;  1KQG B;  3V6H A;  2LEB A;  4LIR A;  1W2I A;  1FFW B;  2MLY A;  3CJ0 A;  4GO7 X;  5DO2 A;  2XGP A;  3KJV B;  4EYI B;  3M4X A;  3HPO A;  3THP A;  2CPZ A;  2V94 A;  3TX0 A;  4R5P A;  1MSW D;  3EIC A;  3FZ2 A;  5FLX Y;  4DG1 A;  3KK1 A;  3J81 U;  1N5V A;  2YQ0 A;  3A4T A;  3KDO A;  2FD2 A;  3CCS S;  3IWL A;  3MUT P;  2GO9 A;  4PCQ A;  4USV A;  1Y9O A;  4QJV A;  1IM6 A;  1MMN A;  3MM9 A;  3N28 A;  4USH A;  4ZLJ A;  4RNM A;  2MKK A;  3OVS A;  3DXS X;  3JSM B;  1ZM2 A;  5GAH U;  1L3S A;  1D0E A;  1HW9 A;  1LFW A;  3HHD A;  1NK0 A;  1WC1 A;  1V3S A;  2HQD A;  2XBP A;  3JSY A;  3TUI C;  4PEO A;  3PYE A;  4DV4 J;  4KGK A;  3V81 A;  1XK8 A;  3B6B A;  2ZHA A;  4DOZ A;  5ETO A;  2ZC3 A;  4FN5 A;  3EDR B;  3KNG A;  3OTE A;  8ATC B;  3CED A;  2AIR B;  4F3Q A;  4ZP9 A;  3U27 A;  2OI2 A;  1FJG F;  4RUH A;  3UFC X;  1BXN A;  1JLE A;  5KFK A;  4LFB J;  3W60 A;  1X0F A;  5DET A;  4OYP A;  4LR8 A;  2HW3 A;  1WG1 A;  1XIQ A;  3EGW B;  4OFZ A;  1JKH B;  1R3N A;  1XN9 A;  2JWN A;  3MM6 B;  3QT7 A;  3TW0 A;  1N6Q A;  1TFW A;  3KLI B;  4IFV A;  1UPP A;  1OYE A;  2BM1 A;  4WPA A;  2Z2Y B;  3K5M A;  4J9L A;  3MOJ B;  2XGQ A;  1NDP A;  4OI4 A;  1H0H B;  2QYG A;  2BV3 A;  2OSQ A;  5KG2 A;  3OVA A;  4J9K A;  1XMQ J;  1TAU A;  2AEM A;  5AXL A;  3HO1 A;  1HQE A;  1BC6 A;  2B0G A;  2DHG A;  4Q5V A;  2IBO A;  1HNV A;  4CLS A;  4ANC A;  3D67 A;  3NAI A;  5I3P A;  2HBZ B;  1S1U B;  1ZOT A;  2ASY A;  2WVB A;  3JXO A;  3OD2 A;  1FK9 A;  1VS3 A;  3AD7 C;  4LFC J;  3AOB A;  3C6T B;  3CE8 A;  3MWB A;  3LP2 A;  1DTQ A;  1FE0 A;  2VC0 A;  5C42 B;  3BGF A;  1RBA A;  2CQG A;  3DOM A;  4NLD A;  3CB4 A;  2GAG C;  4AD6 A;  3OFG A;  3D0I E;  1X5P A;  1SPB P;  4ZIV A;  1T05 A;  1HI0 P;  3W63 A;  4A48 A;  4H4O A;  1DQ8 A;  4O4G B;  1RB0 A;  4MAK A;  4NCG A;  3T1H J;  3MR6 A;  4PYA A;  2QSF A;  1N36 J;  1DAX A;  1TL3 B;  4NI2 A;  1F60 B;  1JLG A;  4M5I A;  4F4X A;  1N5Y A;  1VHI A;  2RNE A;  3R9L A;  5B0E A;  3RW7 A;  5KFY A;  4Z2X A;  2ABY A;  3AJ1 A;  4KKO A;  4Y6I A;  1LWE B;  4K4T A;  3WC2 A;  4OI1 A;  4DSE A;  4O3R A;  3E2E A;  4C0O C;  5KFT A;  4C2M A;  2YNG B;  5D4O A;  1DY3 A;  5SZT A;  1RT6 A;  4OHZ A;  2MJU A;  2RHQ B;  2ZBQ A;  3ZO7 A;  2HFV A;  3ZTR A;  3T6B A;  2KZM A;  4CO3 A;  1RTZ A;  2CG8 A;  2WRM A;  2GA7 A;  2D3Z A;  2YKQ A;  2UXB J;  4GVL A;  4Q2L A;  4LF9 F;  1RK8 A;  4USW A;  4DSF A;  1RT2 A;  3SYZ A;  4RW4 B;  2VG6 A;  4OV6 A;  2MKI A;  2XO7 A;  3HHK A;  5G0R B;  4CYU A;  1FRH A;  2XSJ B;  1LW0 B;  1MWQ A;  2B5J A;  1HWL A;  2YNF A;  2ZNY A;  5SUH A;  2FVS A;  2HHT A;  3DCA A;  5JVH Q;  3MMB B;  4JV1 A;  1TKX A;  1X4H A;  3AXK A;  3C6U A;  4A8X A;  1N0V C;  6FD1 A;  2A10 A;  2A3J A;  4JOU A;  4BCA A;  3R7N B;  2RUS A;  2XSF A;  1N33 J;  1NBE B;  1IWG A;  4WII A;  2VG5 B;  3BSO A;  3ZZT A;  2MZS A;  3W7B A;  3OBI A;  4AT1 B;  4CQ1 A;  3D0G E;  5HO4 A;  4YB1 P;  4DV5 J;  3CCR S;  3LH2 S;  3ISN D;  5L46 A;  2DHX A;  3MUM P;  2LP4 A;  3BKF A;  3M05 A;  4ZCK A;  4TU9 A;  1F2G A;  3I32 A;  3I31 A;  4KGM A;  3Q8Q B;  2MPU A;  4LVN P;  4ZVH A;  3F41 A;  4DQQ A;  3WX8 A;  2F40 A;  4M94 A;  5KFS A;  4EZ9 A;  4YME A;  2BXJ A;  3M6W A;  2IPO B;  2QA1 A;  1HNZ J;  5D78 A;  2W9B A;  1TVR B;  5CYM B;  5LMN F;  3MEC A;  4FNI A;  2KFZ A;  2HNY A;  2C1E B;  2YX1 A;  3ICL A;  3MPV A;  2Z2M A;  2H4W B;  4FNH A;  2BE2 B;  5KFD A;  2FC9 A;  2ZZM A;  1S1X A;  1SH3 A;  1E6V A;  1RAE B;  2CVI A;  4D3H A;  2QV6 A;  2YKN A;  5B09 A;  3I55 S;  5EN1 A;  1S59 A;  1OYD A;  3I4H X;  2G2Y A;  4DR6 J;  1BGX T;  4ED8 A;  3AFG A;  3J80 U;  1RHK B;  1M5O C;  1JLC A;  4LSN B;  3OPK A;  3R27 A;  1QVF R;  6AT1 B;  3BBF A;  1Q16 B;  4NLW A;  1RIS A;  2EI5 A;  2HHV A;  4C8N A;  4ID5 A;  2Q43 A;  5FDL A;  2CPF A;  4CNY A;  2XZT B;  1U8W A;  3BB5 A;  3EZO A;  3GG1 A;  3PYG A;  1HQE B;  1MLA A;  1DBD A;  2XC9 A;  1FFS B;  4P6Q A;  3UN5 A;  3ZTO A;  4WJB A;  3UDV A;  3DHX A;  3NS6 A;  3ET6 B;  2W8L A;  1RAF B;  4QWB A;  1FKO B;  4DV1 F;  2ZUG A;  3I5C A;  3I56 S;  2IMO A;  4ZHR A;  4IO9 Q;  2PC6 A;  2DJW A;  2E9Z A;  1JLA B;  2DCL A;  5HP1 A;  1D8Z A;  2D69 A;  3HVR A;  2VPZ B;  4K50 A;  3PKM A;  3DDI A;  4IDK A;  4IO1 A;  3PRD A;  3NOG A;  2EK6 A;  4MIA A;  1S1W A;  1YIJ S;  3G71 S;  2NUH A;  3EGN A;  2BR0 A;  4Y0F A;  1XC9 A;  1HBO B;  1LXJ A;  5GMD A;  4J37 A;  3ENV A;  3A8K A;  4LSZ B;  3ZZR A;  1NK4 A;  3PNI A;  1MMD A;  1S6O A;  4NI2 B;  1ZYQ A;  4RWW A;  2RD5 C;  2R2R A;  1GAO A;  1R6V A;  3E51 A;  4O3P A;  4Z7C A;  4FPI A;  5E3Q A;  1FRX A;  2I38 A;  2ILY A;  4KFB A;  1SC3 B;  4RW7 B;  4ED5 A;  5BXI A;  1HYS B;  1X9S A;  2HQ3 A;  2QN6 B;  1R89 A;  3NMA A;  1TMJ A;  1RAJ A;  3KOA A;  2QLX A;  2ZC4 A;  4RLE A;  2VD3 A;  3W1Y C;  2D9O A;  2PT0 A;  4X4O A;  4RUA A;  3LGM A;  5AJ3 J;  4K4Y A;  1ZPW X;  2CQD A;  1I6J A;  3R8Y A;  2QA2 A;  4EI2 A;  3HK2 A;  2VPW B;  3OFH A;  1N4L A;  1H2T Z;  1VQY A;  1SKR A;  1LW0 A;  2B5J B;  2E5J A;  1M5H A;  1S6P A;  3AD8 C;  2A2D A;  2JLE A;  3D3C J;  4ECX A;  4LMZ A;  2MLX A;  3A8I A;  4C0H A;  3F56 A;  4F67 A;  3GZ7 A;  2ZJR Q;  3MDF A;  5F8I A;  2KM8 B;  4JI3 F;  2N4D A;  1REG X;  1TMM A;  2OML A;  4I6Y A;  4LJM A;  1IKY A;  4ED4 A;  4TQR A;  3AOA A;  3CC2 S;  4EWT A;  1B4S A;  2ZIT A;  2GIQ A;  4H54 A;  3V6J A;  5GAG I;  3ILL A;  5DZ7 A;  2BAB A;  3NS5 A;  3OQ2 A;  1VJQ A;  3OTB A;  4RBT A;  3MAQ A;  1HBM A;  1WSR A;  2DR8 A;  2M52 A;  3W62 A;  2QX0 A;  2R8J A;  3NNC A;  4JYA F;  1RHJ B;  3M8Y A;  3RU0 A;  1U4B A;  1APS A;  1R6Y A;  1IR1 A;  1VI7 A;  4LRD A;  3VAJ A;  4ED1 A;  5H9E J;  1IBK F;  5ETN A;  3MM5 A;  1HBU A;  2CPY A;  2HG4 A;  1SQF A;  3D5M A;  1KC8 T;  4DUZ J;  4X2B A;  4WU3 A;  1Y5N B;  4F0H A;  2N3O A;  4UST A;  5L9X A;  1JJC B;  5E2Q A;  2ZHB A;  3LPY A;  1M5P C;  3EGZ A;  2HNY B;  4D3G A;  1SV5 A;  4PUO B;  5K8P A;  3GSI A;  4LVO P;  2HHU A;  4ZJQ A;  1IBL F;  4O4G A;  4B02 A;  5KT3 A;  2OKQ A;  2HVE A;  2VJV A;  1YKW A;  5LMN J;  2Y1J A;  2P9G A;  4XDC A;  4URG A;  4PZV A;  3VAG A;  2E5L J;  3CGI A;  3DRX A;  4JI4 J;  7AT1 B;  2OPP B;  9ATC B;  2BJ8 A;  5IT0 A;  4NML A;  2VHG A;  4BDP A;  2E9R X;  4KHR A;  1Y3J A;  1LWF B;  3QLH B;  1VK3 A;  4MIB A;  3KK2 A;  3PYF A;  4ECS A;  1YRU A;  5BR8 J;  1OWX A;  3H4D A;  2KFN A;  5LL6 d;  2LLZ A;  3KG4 A;  1RTJ B;  4GVB A;  4W90 B;  1DTQ B;  1H72 C;  1UVJ A;  2DXD A;  3DOM B;  4GKK F;  4EBD A;  5KFH A;  2XNQ A;  3FCH A;  1AUS L;  4YB6 A;  3RGI A;  1T05 B;  1RP5 A;  4UF4 A;  1T9U A;  1R8C A;  1V9O A;  4ZVT B;  2CQ1 A;  2J76 E;  3RBD A;  4DR7 F;  2AZ3 A;  2CPI A;  2H54 B;  2PE8 A;  2V63 A;  3H40 A;  5I3Q A;  2Z0G A;  4X62 F;  1HD1 A;  7FD1 A;  1Z4U A;  4I7F B;  2HAF A;  2HS3 A;  1JLA A;  4DR1 J;  3QZ7 A;  3GV5 B;  2HBQ B;  1RBL A;  4M5M A;  2GZO A;  4OZ1 A;  4G1P A;  1TV6 A;  5E3A A;  1WEX A;  2OGU A;  2OUG A;  2V8D A;  4JBC A;  4NRT A;  3ZTQ A;  1TUG B;  3ZZY A;  4Z37 A;  3V4I A;  4GKJ F;  1NEE A;  3DGP A;  4QYZ J;  5HBM B;  2M9K A;  4ZVU B;  4ICL B;  4JB8 B;  2OPR A;  2VFR A;  2HGM A;  3P6Y C;  2VAS A;  3NNH A;  4F4W A;  3VZI A;  1IR2 A;  2I6W A;  1UFK A;  4HL9 A;  1PSD A;  4W92 B;  2R7U A;  3SIP B;  1P6T A;  5L1L A;  5GAG U;  2C2M B;  3KTQ A;  4FF1 A;  1SL0 A;  1LW2 A;  2NZC A;  4ZVR B;  2QLF B;  2CIM A;  2YX4 A;  1L3T A;  1N52 B;  5KFJ A;  1RHQ B;  2YX7 A;  4K5S A;  4NLO A;  5G0R A;  2AJQ A;  2Z4P A;  1S9F A;  1J27 A;  3Q8S B;  1VC6 A;  3DU5 A;  4ZCL A;  4HKQ A;  1CLF A;  1WEY A;  5LXR A;  5A2Q Y;  3PW0 A;  4ED0 A;  2RU3 A;  2XY7 A;  5ETM A;  1RJJ A;  1R0C B;  2MQN A;  1SUQ A;  2XMW A;  3RB0 A;  3FNN A;  2G1H A;  3MCM A;  5F9L A;  5CZX A;  2GHW A;  1QSL A;  2G2O A;  1P1L A;  1K44 A;  2AWZ A;  2DNZ A;  4MYT A;  1OQ6 A;  1XMB A;  2M88 A;  3OFF A;  4C8M A;  2F4V F;  5D77 A;  4DFJ A;  1R8B A;  1G1X A;  4KH0 B;  2YNI A;  3KWM A;  1HPZ B;  1OO0 B;  4UUW A;  4LQ9 A;  3QIP A;  1HQU A;  3EX7 B;  2L41 A;  1R8H A;  3J7A 1;  1U6Z A;  4C3M A;  4DU8 A;  3QWU A;  1ARO P;  2BZ2 A;  3RG6 A;  1H7W A;  1WEL A;  3M8Z A;  4C48 A;  1EQM A;  4Y34 A;  5CCL A;  4LQ3 A;  5ETL A;  1KTQ A;  2BQR A;  3DRR A;  3D4J A;  1XJW B;  5EWG A;  1UA0 A;  2CQ3 A;  2DY1 A;  2H4Y B;  3QGP A;  1EX8 A;  4OYX A;  1NHV A;  2FZK B;  4DCO B;  4JV2 A;  1U6B A;  1CS4 B;  2RSQ A;  3RR7 A;  5F8N A;  4KR0 B;  4PWW A;  5J2P B;  1NZ8 A;  4I6A A;  3TP2 A;  2MQP A;  2HHX A;  3HCX A;  2VOD A;  1FKO A;  4IH5 A;  2AU0 A;  3DI6 B;  2R2T A;  4DWI A;  1FI4 A;  3HI9 A;  1JIH A;  4X65 F;  4IQM A;  4XPC A;  4Q8E A;  2BEF A;  1K1S A;  3DC2 A;  3VTI A;  4A8S A;  4JI1 J;  4GO5 X;  1KNZ A;  2HHW A;  3N5F A;  4OLO A;  2MKY A;  4L74 A;  1K73 T;  3TZY A;  2O5D A;  1T8E A;  3V6D A;  3CNQ P;  1EIY B;  4LF8 J;  3QAE A;  3T5J A;  1NKE A;  2C3M A;  3W64 A;  1QUV A;  2YWF A;  1JLQ B;  2Z57 B;  3HHL C;  3K17 A;  1EB0 A;  1GXT A;  2VBX A;  4DV7 J;  3H59 A;  5J1P A;  3M9O B;  2R7Q A;  2W8K A;  4ECU A;  2P9C A;  3M8Q A;  4DPT A;  4UZB A;  4B9N A;  3TZZ A;  1W7W A;  2HZC A;  3HUL A;  4PXC A;  1CG2 A;  4QWE A;  2HUR A;  2YQ3 A;  1SIW B;  1UL3 A;  1RLC L;  1S12 A;  4U9R A;  2FY8 A;  1RXO B;  2DNG A;  4LRC A;  4IOB A;  3TR5 A;  3P49 B;  2KVQ E;  2HS0 A;  1U24 A;  3VQT A;  1WAC A;  3H2V E;  1F5B A;  4G1Q B;  4ZS6 A;  4BWJ A;  1U48 A;  1O0P A;  1GXL A;  2UUA J;  1U0H B;  2K3I A;  2CQI A;  1NH8 A;  4LBP A;  2A2C A;  2RH3 A;  4OHW A;  5F9N A;  1TR0 A;  1A0O B;  1WOP A;  2RF2 B;  1PC4 A;  2ZD1 A;  1TL7 A;  2IM1 A;  3HKZ D;  4E0D A;  2LDI A;  1S6P B;  2LCW A;  2QMX A;  5DQI A;  4P73 A;  1IR0 A;  1JLB A;  2H65 B;  5AT1 B;  4B3T J;  4KFB B;  4DV3 F;  5K9F A;  4G6V B;  1OPI A;  3CDE A;  5LOQ A;  1YIT S;  2KT2 A;  5HQ8 A;  3OV7 A;  1HIY A;  4X4S A;  3UD3 P;  1M5V C;  4I68 A;  2DGT A;  3C14 A;  3IC1 A;  4NAS A;  2HHQ A;  4X66 J;  1TL1 B;  2YPZ A;  3BN7 A;  3W66 A;  4HR2 A;  5D3G B;  1HBM B;  4OI6 A;  5K8O A;  4LF7 F;  3DRS A;  4NXM J;  2L08 A;  3MM7 A;  4IFY B;  1VMB A;  4CRJ A;  4OX9 J;  3ZZP A;  1S1V A;  2E7X A;  3TJA A;  4Q45 A;  4YR3 A;  2XHW A;  2OLW A;  1DRZ A;  1E6Y A;  1OY6 A;  4OI2 A;  2R8G A;  2ADC A;  3SCJ E;  3BYR A;  3J7Y I;  4LF5 F;  3SZ2 A;  5H9F J;  1CJU A;  2RB7 A;  4AFF A;  5KFC A;  3CCE S;  1TTH B;  5KT5 A;  5THW A;  3JB9 k;  2EFN A;  2O67 A;  2VH7 A;  3RJM B;  3T19 A;  4UY8 5;  2PII A;  2XNR A;  2MSS A;  2OEM A;  1U2R A;  2BOA A;  1RKI A;  3R5C A;  1FEE A;  5A6P A;  2MKC A;  4M5J A;  1YQH A;  3JYT A;  2DH7 A;  3OT9 A;  1PJ7 A;  4A8Q A;  1DLO B;  2W2M P;  1KOH A;  1F2H A;  3DNC A;  1LXN A;  3OTC A;  1LQ9 A;  3QLH A;  3R5J B;  4NLV A;  3TA0 A;  3KK2 B;  3RAX A;  2VKZ G;  2DT9 A;  4EMD A;  1PAE X;  5BJR A;  1NJZ A;  3G9C A;  2DNR A;  4UUX A;  1CS4 A;  4X4N A;  2OEJ A;  3LGH A;  3DGV A;  1O6X A;  1U02 A;  3N9U C;  1JJ2 R;  1WJ9 A;  2KJW A;  5E5N A;  3Q24 A;  1J5E J;  1RTD A;  2EBE A;  3R5D A;  4EBE A;  3W2V A;  5J2M A;  1KHV A;  4DV6 F;  3BS9 A;  1NK5 A;  2CQ0 A;  3IS9 A;  4OX7 A;  4C6A A;  1T9V A;  4CTA A;  1FDA A;  2DTJ A;  4JI5 F;  4ZPC A;  4QR0 A;  4DN9 A;  4I4B A;  3LTO A;  4NYO A;  2IJN A;  2D9P A;  4NX9 A;  8AT1 B;  2V2Z A;  3OR1 A;  4C8Z A;  3CJ8 A;  1U1P A;  4ES2 A;  3PR5 B;  3M9N B;  2CJA A;  2MZ1 A;  2HFN A;  4OIX A;  2PMZ D;  2UXB F;  1WC4 A;  1ZH5 A;  1F3F A;  3KLF B;  2EC0 A;  5D0H A;  3NRB A;  2EXU A;  4WP9 A;  5K20 B;  3RUB L;  5KG7 A;  4LIW A;  4N7T A;  3W3S A;  1RT3 B;  2H5E A;  1FXL A;  3FMB A;  2LQB A;  1R0A B;  3U1L A;  2CYY A;  3OJU A;  2AP6 A;  3KNA A;  2W9A A;  2V9W A;  5E33 A;  4DPY A;  5IV4 A;  3QZ8 A;  2CKW A;  3EZU A;  3V4I B;  4L6V 3;  3TAM B;  5A8K B;  4K4V A;  3GFZ A;  1W2B R;  3GJT B;  3O5T B;  3T41 A;  2MQQ A;  3BF4 A;  1JXV A;  1Q8L A;  3QJJ A;  2UUC J;  1LK5 A;  3GFY A;  3O1L A;  2XY6 A;  3K2Y A;  1FNM A;  4A8K A;  4CWB A;  1OMS A;  2RS2 A;  4IRC A;  2VOO A;  2NLW A;  4CLP A;  2WVE A;  4OZJ A;  3O3L A;  2P5V A;  5HMW A;  1YJ9 S;  3EM1 A;  4C8L A;  3C14 B;  1SL2 A;  3Q0A A;  2YKM B;  2XLJ A;  5HMY A;  3E3X A;  1PO6 A;  4L76 A;  2YPY A;  3M1V A;  2GV1 A;  2DR9 A;  1A9N B;  3MMC A;  3IP0 A;  4HAC B;  3RYL A;  5C24 B;  2HFU A;  1IBK J;  3KK3 A;  1B7F A;  2RHS B;  1H73 A;  1ZPV A;  4HTI A;  5J2Q B;  4CM0 A;  4QZV B;  1AXQ A;  4N8N A;  1UVM A;  3HM9 A;  3BO3 A;  3MF5 A;  2EW9 A;  1N56 A;  1WOR A;  1GMW A;  4OYO A;  2UV8 A;  4F2S A;  1KQS R;  1VDH A;  1S79 A;  5KFF A;  2OTL S;  2DY9 A;  2UUB F;  1M1K T;  3PHT A;  4DV3 J;  2EWH A;  4JV5 J;  1XER A;  1FT8 A;  2X1B A;  1DTT B;  3CIZ A;  4WYL A;  1SJQ A;  4C98 A;  1NAQ A;  4EO8 A;  2U1A A;  2IA6 A;  2ZWP A;  4B3S F;  3Q2S C;  2C42 A;  2D1C A;  5E41 A;  2FDN A;  3Q86 A;  3HP6 A;  1F6T A;  2FZC B;  4JI0 F;  1XR6 A;  4MKV A;  2Y0B B;  3HVT B;  4CM2 A;  3FSX A;  3HFV A;  3D66 A;  1WEZ A;  5D0E A;  4ZPD A;  1VBY A;  4PQU B;  1PAU B;  4JI7 J;  3M6U A;  4AND A;  2LA4 A;  3PJX A;  5HI7 A;  4L73 A;  5C25 A;  5LJ5 Y;  3OJS A;  3BQ0 A;  2RIJ A;  1VQS A;  4FYV B;  3MR2 A;  1ZM9 A;  2DNM A;  4CH7 A;  2ZH7 A;  4QIW D;  2V4J A;  4ECV A;  3B8H A;  3D6H B;  4ZPB A;  2RDI A;  2ROP A;  4ZP8 A;  2HNZ A;  4DSJ A;  2R8I A;  1RTD B;  3ZZ0 A;  2G0J A;  4P52 A;  1CSJ A;  4RW9 A;  1FES A;  3UDE A;  3UI3 A;  4DZD A;  1QAY A;  3O2I A;  4EFA C;  2YWE A;  2N7C A;  2PN6 A;  4Z7Y A;  1ZA2 B;  4DXL A;  4U96 A;  4CT9 A;  5LSO A;  2DPI A;  4V19 X;  3K59 A;  1YRX A;  3MUV P;  2OH2 A;  3UN2 A;  3C16 B;  5GAD U;  2XY5 A;  1FDN A;  1EP4 A;  4JI1 F;  1PKU A;  1XNR J;  1KQK A;  4M5G A;  1CQM A;  1V6H A;  2F8M A;  4IR1 A;  1FDD A;  4KGV B;  2M5Y A;  5HLF B;  2CJX B;  3BN4 A;  3N79 A;  1JMT A;  1GX5 A;  3GCX P;  5JMN A;  2D3O 1;  1T3N A;  2UXD F;  1VIX A;  1LFP A;  3ENW A;  2AEJ A;  4KQZ A;  1VHF A;  5CAB A;  3QT8 A;  2HHH F;  4B3O A;  2BRK A;  5FLX U;  2FJB B;  2E7V A;  4TY9 A;  2RS8 A;  1FKA F;  2DRD A;  3MPW A;  3R5G A;  2DCU B;  3I9V 9;  2VFU A;  1UJ4 A;  1UVL A;  2RQK A;  2WSE C;  3V81 B;  1NK6 A;  1VC5 A;  2K2P A;  4TXS A;  3CCU S;  3T3F A;  1P9Q C;  2D74 B;  3R1H A;  1FVQ A;  2NSC A;  3BPD A;  3NGR A;  1S72 S;  3ETO A;  1WC3 A;  2FGO A;  2RKI A;  2P8I A;  3FEZ A;  2FYX A;  2CPH A;  4O0I A;  2QIF A;  4NEY A;  4TU7 A;  5C42 A;  2VL1 A;  1SBR A;  1FJE B;  1VQ6 S;  2ZH3 A;  1FE4 A;  2YKO A;  3CCZ A;  3ZZU A;  4DI6 A;  2W4D A;  3DN9 A;  1S97 A;  3I0R A;  3RBX A;  4P74 A;  2XLI A;  3CUL A;  2Q1L A;  4ANE A;  1UCN A;  2BAN B;  2CJQ A;  3CIM A;  4HH0 A;  4LBI A;  3SI8 A;  1QSY A;  1RAD B;  2F9D A;  4J5O A;  3AAW B;  3KMS A;  1KS2 A;  1VK8 A;  4MKY A;  1TL3 A;  4CT8 A;  4DX8 H;  5HL7 Q;  3L95 X;  3EJM A;  3CCM S;  4ECR A;  4ZPV R;  4K5R A;  1IUJ A;  2HK3 A;  1VGY A;  3LF0 A;  2DNN A;  3CJK B;  4ES3 A;  5AE2 A;  1Z2L A;  5ITH A;  2P2C B;  2ZOF A;  3L7U A;  5D6G A;  3CDU A;  3LUY A;  2DK2 A;  3GMG A;  2FHJ A;  4F26 A;  1GH8 A;  2EVZ A;  1XNQ J;  1X4A A;  3UVJ B;  1KFD A;  1F1B B;  1EJ7 L;  2JJ4 D;  3JYT B;  1SH2 A;  1T94 A;  4KB7 A;  3BSN A;  2CQ4 A;  3C8Y A;  2HQG A;  1ICE B;  1KLM A;  3QQC D;  3KLH B;  1VC0 A;  1SQE A;  4MFB B;  3VVU A;  4ZIW A;  5LMU J;  1ZZN A;  1XMO J;  4IR9 A;  2LMI A;  2JFK A;  2X3G A;  2R4F A;  3ITH A;  3S7R A;  3VZH A;  1EKR A;  3ZNU A;  5L39 A;  3KJV A;  4Y3C A;  1RA6 A;  1JLG B;  4USM A;  1YTY A;  1N5Y B;  4L3N A;  2GCF A;  2Q6B A;  2ZBP A;  3P5T L;  1G3O A;  4MK8 A;  5IQ6 A;  4DR5 J;  4LF9 J;  3HVT A;  4PQU A;  1RWK B;  2BQU A;  3WBZ A;  4X62 J;  2HSE B;  5KT2 A;  4DPO A;  4EYH B;  3HJV A;  3VQS A;  1AFI A;  1YRT A;  1GXU A;  2VKR A;  1RT6 B;  3MUR P;  2LQ5 A;  3L09 A;  3BH7 B;  4TLQ A;  1RU1 A;  1FRM A;  1UET A;  4OX8 A;  2F65 A;  2BM0 A;  4IFV B;  1WF0 A;  5BR8 F;  3BGO P;  3CMQ A;  4HVZ A;  3OR1 B;  3VAM A;  3TOQ A;  2XMM A;  4DSK A;  1WHW A;  1NB2 A;  4MTP A;  3OHB A;  1JJH A;  2YKP A;  4CYU B;  2VFS A;  4X64 F;  2HQI A;  1IM4 A;  1S1T A;  2O66 A;  3DLL Q;  1C0U A;  1NCL A;  3PX6 A;  4N56 A;  1BE4 A;  1BQN A;  1TL5 A;  2HZV A;  1LKZ A;  3LP2 B;  3WC0 A;  4NLT A;  3EYZ A;  4I56 A;  3MEC B;  3G6E S;  2Q79 A;  2XYP B;  4RNF A;  1F9F A;  1JKH A;  2HVH A;  2OTJ S;  5AE3 A;  5CH7 B;  1FKP B;  3NGD A;  3HVW A;  4A4J A;  3OTO F;  4X4T A;  1VBK A;  2VZ9 A;  1V5V A;  3M1V B;  3ELH A;  2DVI A;  4LF4 J;  3MMC B;  4HAC A;  4DS4 A;  4DR4 F;  1R31 A;  3KK3 B;  1U1N A;  1QTM A;  1IKX A;  4DPW A;  1RTH B;  3A3N B;  2L9N A;  1R7I A;  1HBN B;  4M63 A;  2DIS A;  2HVD A;  3G8S A;  3OSP A;  2Y9H A;  4YQW A;  1YJW S;  4LR7 A;  5C2C A;  4ZDN A;  2OPQ A;  2CA9 A;  1JK9 B;  4R0E A;  1JLF A;  1EET B;  1UWB A;  3P8B B;  4KBI A;  4W4M A;  5D15 A;  2HWT A;  3FGV A;  3DLE B;  2GHV C;  4RJV A;  3MM8 A;  3AY0 A;  4RX6 A;  2YWW A;  2DH9 A;  3HMJ G;  1SJ4 P;  4X4V A;  2RKI B;  5D8H B;  1KVI A;  3AXM A;  2WVC A;  4B3R F;  3I9Z A;  3AH6 A;  3D68 A;  4QYR A;  4FZV A;  3H20 A;  1DQA A;  1GT8 A;  3M32 B;  2W9C B;  5H9F K;  4JV0 A;  4FS2 A;  1M0S A;  5HRO A;  3G8Q A;  1N34 J;  1T9T A;  5KG1 A;  4ID5 B;  2R8H A;  2CJK A;  1VRT A;  1RA7 A;  3PXG a;  1NLK L;  5C25 B;  2YNG A;  3KLV A;  2FLO A;  3ISN C;  1NU4 A;  1D9A A;  2E44 A;  3EPG A;  4J9P A;  3BSC A;  2VQE J;  4KPY A;  1AZS A;  3GB0 A;  3C19 A;  4ECZ A;  4F3M A;  3ET6 A;  4OV1 A;  2HNZ B;  4GC6 A;  3F73 A;  2AX1 A;  2DGV A;  3IAS 9;  2B4P A;  2KHC A;  3AJ2 A;  2QTW A;  4RW4 A;  5JJB A;  4PAA A;  2Y1L B;  1NK8 A;  4ILM A;  3NKY A;  1S4F A;  3IMQ J;  4IKA A;  3BKT A;  4NMX A;  4A46 A;  1N32 F;  2B8Q A;  3DDN A;  4FKY A;  2CXE A;  3FSY A;  2FLN A;  1XR5 A;  5HN0 A;  1KLM B;  1PYT A;  2ZBI A;  2ZZT A;  3T1A A;  2XCA A;  3PJW A;  2VPX B;  1T95 A;  3JSR A;  1RU2 A;  3GV8 B;  5U47 A;  1YHQ S;  2LU1 A;  2V4J B;  1SL1 A;  1S10 A;  1ZTW A;  1Q7L B;  2OD4 A;  2YWG A;  1K0T A;  1KQF B;  1S1X B;  2XMV A;  3PHE A;  3TO8 A;  2BJ1 A;  2IYG A;  2RRN A;  2IVF B;  1SQG A;  4OYB A;  1UKU A;  2ZJP Q;  4O3S A;  1XNR F;  1IQT A;  3ENQ A;  1FRJ A;  3HZE A;  2HMI B;  1C4A A;  4DLE A;  4KH1 B;  4LRA A;  2DRA A;  2RQC A;  1TKT A;  2CQH A;  1BY9 A;  3FFI A;  4JI6 J;  4BHQ A;  4R25 A;  3C15 A;  2N4C A;  2ROE A;  2YY3 A;  5MAO A;  1AA1 B;  1TVR A;  2XCP A;  4HYK A;  2MQM A;  4C8K A;  5AJ3 F;  1ZAX A;  3BGL A;  4KE5 A;  1CC7 A;  2LA6 A;  5L9N A;  5F8G A;  3KLE B;  3SV3 A;  1UEK A;  4IH7 A;  4AQY F;  4DX6 A;  1MW7 A;  4ERD A;  3OL7 A;  2MGZ B;  2E1P A;  5KFE A;  1S5Z A;  3NGS A;  2VUG A;  3FSI A;  2YH1 A;  2FHK A;  3RTV A;  1H3D A;  1MG7 A;  2B9E A;  2Z2Z A;  3LAK A;  3UNG C;  1KR4 A;  4ECT A;  1QAX A;  4CO5 A;  5T41 A;  1OSC A;  4DDF A;  1KD1 T;  1WDT A;  4ZLP A;  1VQP S;  2E9T A;  1WSV A;  2J9C A;  4NCA A;  3HHL B;  3LAM A;  1U6F A;  2CNN B;  2EEY A;  4CDI A;  2KJV A;  2M2B A;  2IC3 A;  4OZ3 A;  3PR4 A;  4G1I A;  3BJY A;  4HDG A;  3FUY A;  3LAL A;  4J91 A;  3NGT A;  1N5Q A;  2N82 B;  3GIM A;  3KG1 A;  3TJ8 A;  2Y8Y A;  2B43 A;  3WZ0 A;  1XQI A;  4DUY F;  1J5O B;  2I5J B;  1O51 A;  2ALY B;  1GMV A;  4QIE A;  2AGQ A;  2Q6C A;  1FDB A;  1EHW A;  1RWN B;  2M8H A;  3ILI A;  2K7K A;  2GS8 A;  1IKX B;  4EEY A;  2KU7 A;  2ZVI A;  5I42 B;  1LNQ A;  4DQI A;  3A8J A;  1FCA A;  2GO8 A;  2M0G B;  3CW2 C;  3LGN A;  4ZHR B;  2VV5 A;  5ETV A;  1HNX F;  3OUY A;  2UUB J;  2XMA A;  3KKF A;  1U7L A;  4PQA A;  5CYQ A;  1TZ0 A;  1NPP A;  3BZQ A;  3IRX A;  4DCP B;  3EPI A;  3T1H F;  3POT A;  1S1W B;  1TEL A;  3R7B B;  3VF0 B;  1UW4 A;  1OQ3 A;  2E7W A;  5DQG A;  1D9D A;  3THV A;  4KRW A;  2APO A;  2RT3 A;  3KXD A;  3IBF B;  3ITH B;  4RUC A;  2LXU A;  1Y0H A;  5IXU A;  1U1Q A;  5GAH I;  4J9S A;  4DQR A;  2GFF A;  5M2P A;  3QJP A;  4DR4 J;  3CVK A;  1MU2 B;  4IG0 B;  3IXQ A;  1Q5Y A;  1LWF A;  2W7O A;  2X1A A;  1T7P A;  3NY0 A;  4WP8 A;  1RSC A;  3T6J A;  5KAK A;  3DGP B;  1RTJ A;  1WTF A;  3KDN A;  4QPX A;  3IR5 B;  4FP9 A;  1Q79 A;  2VA3 A;  1HAR A;  2JSX A;  5IC6 B;  4Q43 A;  3MED B;  1MRO B;  2Y1R I;  1UFL A;  1PGZ A;  4N76 A;  1VBX A;  3OVB A;  5HK4 A;  2BA9 A;  5GAE I;  1PBA A;  2GVZ A;  3EGV A;  2GVD A;  3EVO A;  4KGX B;  4RKU C;  2VB6 A;  3PAC A;  4YB5 A;  1R27 B;  4MFB A;  4TVA B;  4ZP6 A;  3SMZ A;  5L38 A;  1HNW J;  1VQM S;  5ETR A;  3BQ2 A;  1URR A;  3LWL A;  3EWG A;  3TA2 A;  4Y2C A;  3TYT A;  3AB2 B;  1HHT P;  5EWE A;  3PO4 A;  2MY7 A;  3LW5 C;  2WTF A;  3HSJ A;  2V9K A;  4CNZ A;  4ECY A;  4CLY A;  2UUT A;  4CLW A;  5LSL A;  3Q22 A;  3Q23 A;  2V67 A;  3VWS A;  4CCH A;  4QYZ K;  2FHO B;  1UA1 A;  2MQL A;  3CF5 Q;  4RO0 A;  2O1P A;  2FY1 A;  2DHS A;  4K59 A;  3G82 A;  2NS1 B;  3BR8 A;  4Y2K A;  4QWC A;  2QSW A;  1RT1 B;  5EUH A;  2QYC A;  4PXE A;  5IQQ A;  3MTK A;  5E3C A;  4WCE Q;  2Z2L A;  3KUH A;  1MN9 A;  3SDE B;  3MHY A;  3PW5 A;  2MY8 A;  2HND B;  4M1K A;  3IWN C;  4B3O B;  2A18 A;  4TN2 A;  4LFC F;  2LXI A;  4J9N A;  4NLS A;  1SJR A;  2IAJ B;  3QIP B;  1NKC A;  2WW8 A;  3D6T B;  3G6X A;  4DR2 J;  2IFX A;  5F8J A;  1T0T V;  1SKU B;  1HBN A;  4OJG A;  2VQF J;  1BQN B;  5HQL A;  1HNW F;  4LRF A;  3O6Q A;  3G96 A;  4F50 A;  3H5X A;  3RB6 A;  3U1N A;  2B9Y A;  2JOQ A;  1FKP A;  2ACY A;  2YKA A;  1R8A A;  3D6M B;  3VVT A;  5CAA A;  2XMJ A;  2ZH6 A;  3DLE A;  5J2P A;  3D7S B;  3OSN A;  2WZ1 A;  2BBE A;  2G13 A;  1SJ1 A;  3DOL B;  4ZN3 A;  3SQG B;  3UR3 C;  4DV0 F;  3T5H A;  3CJ3 A;  4PXB A;  1TK0 A;  3IR7 B;  3SFU A;  1M5S A;  2B3T B;  3FBB A;  4DR3 F;  3R1L A;  2ASJ A;  3QSY B;  3KG0 A;  4X64 J;  2AHO B;  4EK2 A;  1Q82 T;  1MWZ A;  4MIW A;  3M8R A;  4I0W A;  3R3T A;  2OMO A;  2VBZ A;  3FEX B;  2NPI A;  3QRR A;  3FEY B;  1UEU A;  2DNP A;  2KRB A;  4QW9 A;  2E5L F;  3VAL A;  1JLQ A;  1Y7P A;  4DL3 A;  2WCX A;  2HRU A;  3R7S B;  4BS2 A;  3OL9 A;  4DHV A;  4LF6 F;  5KFI A;  3B78 A;  1TAQ A;  1WOO A;  1DAR A;  3ETM A;  4Q44 A;  4IOC Q;  1NJY A;  3UD5 A;  2CJB A;  2IA0 A;  5KFU A;  2RAQ A;  2ZOM A;  1LW2 B;  2MXY A;  3A3O B;  1CJV B;  3OHA A;  1ULR A;  3GON A;  2V8G A;  1KEK A;  2QGF B;  5J1E A;  2MQ8 A;  4I7F A;  3NEK A;  3HSD A;  2QRR A;  4DQP A;  1DHM A;  3D54 A;  5B0F A;  4QWA A;  3K8V A;  3NS7 B;  2ZEJ A;  5DJB A;  4BC7 A;  2AYG A;  2KFY A;  4F8R A;  2G2Z A;  5CYQ B;  5KFV A;  2ZJQ Q;  2XYG B;  1Q81 T;  1F3V A;  1RAG B;  4FKX A;  3DYA A;  3CD5 A;  1F5C A;  1GFW B;  4WE1 B;  4OX9 F;  4DUY J;  2I2Y A;  2VFV A;  2PI5 A;  3PIO Q;  3M8P A;  3VCD A;  5D4P A;  4LF7 J;  1NH7 A;  1FVS A;  3RZA A;  4BLG A;  4CO2 A;  3M8Q B;  4IG0 A;  1TK5 A;  4B9M A;  2JEJ A;  4OYI A;  2CQC A;  4U7C A;  4P2S A;  3G6Y A;  2V2V A;  1RGV A;  2XHC A;  2RDJ A;  2R3V A;  5IWA J;  3PW4 A;  1HMV B;  1URN A;  4BBY A;  2NXE A;  3NAH A;  1KFS A;  4WTY A;  1X8D A;  1TU0 B;  4I2Q B;  4DSL A;  1MRO A;  5DDQ C;  2BOP A;  4U67 Q;  4I64 A;  5L1J A;  5B0C A;  1EAR A;  4AQY J;  1RUS A;  2GIR A;  4NCB A;  3HD2 A;  2HZA A;  2KO1 A;  4HHH A;  4UOC A;  1ZS6 A;  2KN4 A;  2YTC A;  3GJR B;  1NB7 A;  4QCL A;  3PX4 A;  2FVC A;  1M5K C;  3WIU A;  5ETT A;  3MM7 B;  3G87 A;  4IFY A;  3ZFV A;  2UUA F;  1L3U A;  3CJ4 A;  4OI3 A;  4AE5 A;  1S1V B;  4LSL A;  5T14 A;  1RAA B;  4GC7 A;  4I1T A;  1T11 A;  2KT3 A;  1KSP A;  4F3O A;  1BLU A;  1WNE A;  4KHP J;  4K2X A;  4JI2 F;  1RWM B;  5KFZ A;  3VGV A;  2PEB A;  5IS2 A;  2YWH A;  3AA8 A;  3KHL A;  3PTW A;  1B0V A;  2JVR A;  1RAB B;  1S9G B;  5CQG A;  5K14 A;  2GX8 A;  1H6K X;  3VV2 B;  2ERR A;  2VOP A;  4E2F B;  2E5H A;  1ELO A;  1TKT B;  2IVM A;  4PWU A;  4J9O A;  2ILZ A;  2OFH X;  5T7L A;  1G2E A;  1TL1 A;  4KT0 C;  2UXC F;  1OJ4 A;  2DGO A;  1WD6 A;  1CUL A;  4WFZ A;  2E66 A;  1J5O A;  2IVY A;  3PO5 A;  4ITS A;  1FRL A;  3DFE A;  1UP1 A;  3QT5 A;  5EHH A;  4PWD A;  2DGW A;  2DB1 A;  2BKP A;  4NLU A;  1UZD A;  3O44 A;  5C5J A;  1NHK L;  3BGR A;  2J7U A;  3PEH A;  4OZ2 A;  5AXM A;  4CLZ A;  1NZA A;  4HHU A;  3OW2 R;  4IH6 A;  5DLF A;  2HHS A;  3T9Z A;  4U7U K;  3MCS A;  5KFM A;  1FJC A;  2G0I A;  5A2Q U;  1JXE A;  2CAJ A;  4EO6 A;  2IC3 B;  1O8B A;  1C0T A;  4ZJO A;  4J90 A;  3BO2 A;  5FD1 A;  2QLJ B;  4CO0 A;  2KXF A;  4ED3 A;  4FF3 A;  1WC5 A;  5E0O A;  3KFW X;  4DBQ A;  2DNK A;  4U6P A;  4AL5 A;  1WHX A;  1R8P A;  2H48 B;  4USJ C;  3W2V B;  3W8G A;  1VLY A;  2XO6 A;  3UN3 A;  3KHG A;  3GQC A;  2WOM B;  2HFS A;  1TQL A;  2A6M A;  2W01 A;  3BEG B;  2O01 C;  2J7K A;  1S0O A;  2LDY A;  1ZA1 B;  2I0X A;  3H5Y A;  2WSF C;  3K57 A;  3FVY A;  1S99 A;  2RML A;  5L1K A;  2JLF A;  4JI8 F;  4TY8 B;  2CPJ A;  4XPE A;  3JQK A;  4A8F A;  1VQL S;  5FJ4 A;  3WQP A;  1EKS A;  3UQS A;  5M2R A;  3V4M A;  1NO8 A;  4K4Z A;  4NYP A;  2F1F A;  1U45 A;  3SEO A;  5J2M B;  3DHW C;  4ZPA A;  3IS9 B;  5LM7 E;  2VPY B;  1OY9 A;  4WP3 A;  4ZVG A;  4YDD B;  3AHP A;  5EX3 A;  4JI0 J;  1RWO B;  2AYE A;  2OPS A;  2EFO A;  1UW9 A;  3EMT A;  4YR2 A;  2JC1 A;  4C8Y A;  1Q53 A;  1D09 B;  4DV2 F;  3CUN A;  1RZM A;  2PO4 A;  5IM0 B;  5DQH A;  1B0P A;  3IM9 A;  5KFO A;  4DLG A;  4FS1 A;  3E8O A;  4WIQ A;  3DDK A;  1X4F A;  2W2P P;  3CJ2 A;  1RT7 B;  4WE1 A;  2R7T A;  1HI8 A;  4NLY A;  3MED A;  2WBM A;  2DR6 A;  3W9H A;  4WF9 Q;  1WOS A;  3CJ5 A;  2B4V A;  1S9E B;  3HX9 A;  4WK3 A;  5CD4 H;  3ZZO A;  1IKW B;  2IY5 B;  2DNY A;  2VDI A;  2R2S A;  3DRS B;  2HRY A;  3LPE A;  3OXF A;  4OZ5 A;  3CD7 A;  4TU8 A;  2B6A A;  3CC7 S;  2C2R A;  3N01 A;  4MK7 A;  3NMR A;  3ADA C;  3H98 A;  3QSI A;  4OYM A;  1YJR A;  4ZPT R;  4XO0 A;  1I1G A;  4DL6 A;  3HHL D;  2FZG B;  2E1R A;  4PPZ A;  2AYB A;  3K5L A;  2GQ2 A;  2YKM A;  3UE2 A;  5DM6 Q;  1X5O A;  2KDO A;  1GMU A;  4DZ6 A;  5C24 A;  4DX7 A;  3MR3 A;  1B3T A;  1S0N A;  4X4Q A;  4B9T A;  3DLK A;  2B4U A;  3WX4 A;  2BJ7 A;  1HWI A;  2QA4 G;  4DV6 J;  4UOG A;  5DG7 A;  5C7P A;  3BDP A;  3UW1 A;  2LQ8 A;  1QTN B;  2I8E A;  2V8H A;  3Q8P B;  2BJ3 A;  2HK2 A;  3DOL A;  3IFE A;  5D0R A;  3ZNJ 1;  3VAF A;  4NZ7 A;  1MWY A;  2LU2 A;  3KLG A;  3K8W A;  3ZZZ A;  4F4Y A;  2CDR B;  2GJF A;  1HWU A;  2XWY A;  2NXC A;  2W4C A;  2IYI A;  3T5K A;  2QMU B;  1CBK A;  1PYO B;  4JP8 A;  4F36 A;  3HXM A;  2ADB A;  3ILO A;  1FNX H;  4ZVE A;  2OHD A;  2ATC B;  2MMY A;  3FBF A;  1N36 F;  3CCV S;  3NL0 A;  2K1R B;  3M2U B;  4J9M A;  5J2Q A;  2DGQ A;  1X60 A;  3PCO B;  4PWD B;  2NQP A;  1M90 T;  4O3Q A;  4DL5 A;  3PZP A;  3PJ9 A;  4NOH A;  1U8S A;  4ZP7 A;  3L7P A;  3HVA A;  2XZW A;  3GR0 A;  1ZM3 A;  2AJ2 A;  2KXN B;  2DO4 A;  1UMJ A;  3SCL E;  1UVI A;  5BYR A;  1S48 A;  4PG7 A;  1HKA A;  1W26 A;  2RQM A;  4UQT A;  4B9U A;  1C2P A;  2NCK L;  1WI6 A;  3K5O A;  1PBU A;  4HT7 A;  4LF1 A;  2LEC A;  2PFF B;  1XMQ F;  4ZOS A;  1YI2 S;  2XSJ A;  5HJX A;  2R7W A;  1BUX A;  5LMU F;  2IRX A;  1VQ9 S;  3E01 B;  1SC6 A;  1H7X A;  2ZWO A;  3UDL A;  9RUB A;  7FDR A;  4KIA A;  3CDB A;  1FWP A;  3FRY A;  8RUC A;  1XTZ A;  1NSA A;  3EZ5 A;  2KM8 C;  2DD8 S;  2ZKU A;  5J1E B;  1YDL A;  2N7Y A;  5HMX A;  3PW7 A;  2HVZ A;  1NXI A;  3M6X A;  1R0A A;  5J2N B;  1HNX J;  1HYS A;  3QAT A;  1VRU B;  4QIG A;  4I2Q A;  4ES1 A;  5CA5 A;  4OL8 A;  3HF5 A;  3JS9 A;  4AL6 A;  1H38 A;  2GGP B;  3CSK A;  4M5D A;  3ZXW A;  5A8K A;  1R43 A;  2XLK A;  4C4W A;  1U2C A;  2XS5 A;  2MHE A;  1LV5 A;  1MML A;  3MTJ A;  4NZ0 A;  3M8P B;  1T03 A;  4DCJ B;  4ZCI A;  4K4S A;  3TAN A;  1YWX A;  4FXD A;  3TQE A;  2GHP A;  2X3D A;  2W7P A;  1U1R A;  5H1S V;  2QO3 A;  4G65 A;  5CYM A;  1KDN A;  1ZBT A;  5A6W A;  5CXT A;  2UVR A;  2CAD A;  1IKY B;  1RT5 A;  2BE2 A;  2FJD B;  3JQM A;  3NCQ A;  5IWA F;  1BQX A;  2F9J A;  1R0B G;  1HD0 A;  3W5Z A;  1XR7 A;  3LP0 B;  3VAK A;  2C22 A;  1IJF B;  1PIE A;  3J80 Y;  5DM7 Q;  2YBV A;  3QRP A;  1WG5 A;  4MYU A;  3P45 B;  2RRA A;  3IR6 B;  2J6U A;  1PG5 B;  3O8W A;  3MR7 A;  4C9D A;  3NCP A;  5KG5 A;  3MCN A;  3MM5 B;  1YJ7 A;  4DL0 C;  2EG2 A;  2AEF A;  2QT7 A;  4AXI A;  2HHH J;  5IT9 Y;  5A8W A;  1AUD A;  3M7V A;  2A0F B;  1Y11 A;  3AA9 A;  3NWG A;  2BAN A;  2H3E B;  2KT5 A;  2LVW A;  4JI6 F;  3W9I A;  1N8R T;  5MLC V;  3NLC A;  5FII A;  4Y65 A;  2R7S A;  2D41 A;  2AJ0 A;  3H25 A;  3D1O A;  3HKW A;  2OD6 A;  1U0S A;  1DJ0 A;  2IIH A;  1K47 A;  2IDL A;  5KFR A;  4Y28 C;  3DLK B;  4ECQ A;  2XS7 A;  2J8A A;  2C28 A;  5T7L B;  2DHA A;  2OEK A;  4QQB A;  1BWE A;  3DLB A;  4FYW B;  3BQ1 A;  1QVG R;  3UNY A;  4WFN Q;  3FQK A;  4ED2 A;  2OJ3 A;  1KON A;  4A8Y A;  1RTI A;  2WSC C;  4ZJL A;  3GE9 A;  1FTR A;  5B0D A;  2KH9 A;  1BQM A;  2JHE A;  1WG4 A;  3K89 A;  2YNH B;  4UY8 T;  4J9Q A;  1XEZ A;  1EQ0 A;  1VQ4 S;  1YJU A;  2HRT A;  3W61 A;  4X4P A;  4KJI A;  1N0U A;  1FD2 A;  4PPD A;  4QU6 A;  5KFA A;  1S6Q B;  1V3R A;  1RQ0 A;  3A12 A;  1Q95 G;  5B0G A;  2EPI A;  1Q0N A;  3BYP A;  3I4P A;  1SIZ A;  2CQP A;  2HFZ A;  2WB1 D;  5F3Z A;  2JNJ A;  3QFH A;  4ENO A;  4J9R A;  2FPH X;  2PFD A;  1FJ7 A;  2AKW B;  1ACM B;  1U26 A;  2Z56 B;  5DGB A;  4RW9 B;  3TAQ A;  4H4M A;  4FF4 A;  1A6L A;  1CJK B;  4NL5 A;  4NPO A;  2ZHO A;  3HHE A;  4ED7 A;  5ETQ A;  4P7V A;  2KTQ A;  3W5X A;  2F3J A;  4HDH A;  3H2U B;  4FVC A;  4DL2 A;  3D2W A;  2AQ4 A;  1HFE L;  2ZKT A;  3R5A A;  4FXV A;  4OLP A;  4LF8 F;  2GW8 A;  5HBM A;  1Y4Z B;  3G2X A;  2LYV A;  3RRK A;  4Q0B B;  5F0U A;  3ISZ A;  3T5L A;  3EUN A;  3E01 A;  3UWT A;  3GIL A;  1SVD A;  2CUY A;  3DM2 B;  3QO9 B;  4TNO A;  1S9E A;  3QJL A;  4RW6 A;  2WON A;  3TZW A;  1IKW A;  1UTA A;  4Q8F A;  3J7Y U;  1NME B;  4C0B A;  4OYA A;  4EBC A;  5I3U B;  2OSR A;  2XEX A;  2ZBC A;  3TA1 A;  2NUU G;  2KG0 A;  2FJX A;  3JTN A;  4RBV A;  4PG8 A;  2FUG 9;  4HH1 A;  4XTT A;  1NK7 A;  5K5M A;  5IM0 A;  3HLU A;  2Q3P A;  3N6M A;  1IBC B;  3RBE A;  3N6N A;  1SH0 A;  5B08 A;  2CZ9 A;  1JNZ B;  2XMT A;  1JNR B;  2HWH A;  2E1M C;  2J9D A;  3CJK A;  5CD4 A;  4LF2 A;  3C3L A;  3BPS P;  4DFK A;  2LQJ A;  5HMZ A;  1NSQ A;  4CO1 A;  5C2G A;  1I5O B;  5HQM A;  2DO0 A;  1KKH A;  4O44 A;  4PUO A;  2FVR A;  1EET A;  1UWB B;  2OO4 A;  1HQU B;  2RRB A;  3KJQ B;  3I0R B;  1U1O A;  2JFD A;  1Q8I A;  4CLU A;  3KLH A;  4LUB A;  2QE5 A;  2J0W A;  1Q5V A;  1K0V A;  3AB4 B;  3K5P A;  4DN0 A;  5A8R B;  4F0K A;  3MOZ A;  4K4U A;  3PM9 A;  2WW4 A;  2COL A;  3DRR B;  4NA3 A;  3T9N A;  4DFM A;  2ZNZ A;  1VFJ A;  3C2P A;  2R7X A;  4MT1 A;  2IMW P;  1SI9 A;  3D3B J;  4R8U A;  2F5G A;  4F0M A;  3KUE A;  5GVQ A;  4EGL A;  1KOO A;  2DBB A;  2H5I B;  4M5K A;  4OJ3 A;  4K0K F;  1JX4 A;  1RAC B;  2BJ9 A;  3MEG A;  4KTQ A;  2OPQ B;  4YN3 B;  3VR1 A;  5KOW A;  5H9E K;  1U1K A;  3J7Z 5;  1REV A;  4KO0 A;  4WKR A;  3CJQ A;  4QBU A;  5LJ3 Y;  2W2O P;  1YBT A;  4OX6 A;  1UVK A;  1HNZ F;  2DR7 A;  3M2V B;  5F8L A;  2Z30 B;  2KRR A;  4CIO A;  3MAA A;  4J9V A;  3H90 A;  4ZK7 M;  3FBC A;  1TP7 A;  4OZ0 A;  2BDP A;  1LEO A;  3TEG A;  4GKJ J;  1C1C B;  1TKZ A;  2K1R A;  4XK8 C;  2WK4 A;  3FMW A;  4PYD A;  4ELT A;  2P6S A;  4ILR A;  5D0G A;  1HI1 A;  1S1T B;  3AOC A;  3GCW P;  5KFG A;  4ZLN A;  2W9C A;  1VQ7 S;  1FEH A;  1WF1 A;  4M5L A;  4RNO A;  4K7Q A;  3FQL A;  5E3P A;  2RIL A;  5LXY A;  2FVP A;  4RNN A;  3BH6 B;  3I5B A;  3MMA B;  3P3D A;  2B4O A;  2XQC A;  3OLA A;  1SC1 B;  4F02 A;  3D0H E;  4ECW A;  4V1A k;  1WI8 A;  2NXU A;  5J1N A;  4CH0 S;  1ZET A;  2UVU A;  3THT A;  3OTD A;  1VCT A;  4IQX A;  4CLF A;  4RBU A;  3MFH A;  2FLP A;  4LFA F;  4GMK A;  2ASD A;  1CEZ A;  3TX8 A;  1TUW A;  3B4D A;  2F4V J;  3ZTS A;  2KYX A;  3QGG A;  3PVX A;  1S0V A;  2RVJ A;  1HR0 F;  1MN7 A;  1HWJ A;  2VIH A;  1K1Q A;  3UCG A;  2ZH8 A;  1CVJ A;  1K8A T;  1BHN A;  1C0U B;  4USI A;  2W2Q P;  1CJT A;  3Q8Y A;  5A76 A;  5AXK A;  2BMB A;  4S0M A;  2ROG A;  2IM0 A;  1TK8 A;  1RAI B;  2R8K A;  2LEA A;  2MTL A;  5J2N A;  3PEJ A;  2BVZ A;  2DIT A;  1YLX A;  3NNA A;  1GX6 A;  1F9E B;  1VRU A;  2AGO A;  4V19 J;  1G4C A;  2HQC A;  5KG4 A;  3D1H A;  3MM8 B;  3HFZ B;  2GGP A;  2H5J B;  1QE1 A;  4WBF A;  5DZ6 A;  3DM2 A;  3QO9 A;  3LP1 A;  4KAI A;  3W2W B;  3DXB A;  2V50 A;  4ZVO B;  4I2P B;  5A0Y A;  5LT5 A;  4B17 A;  1RAO A;  4DUZ F;  1T03 B;  4UW2 A;  3EDQ B;  2DXE A;  3M32 A;  1RTH A;  1B99 A;  2C3O A;  1NSK L;  2GQC A;  2B9X A;  2Y3Y A;  4K2J A;  2HFO A;  2POK A;  1OY8 A;  3KLI A;  1F0X A;  2NSB A;  3N5B A;  1OIA A;  4ETZ A;  4NLG A;  4LBH A;  1D3W A;  1N54 B;  3FKB A;  4ELU A;  3M9M B;  4KYZ A;  1E6Y B;  4JUZ A;  4X84 A;  1JLF B;  1RT5 B;  2QC3 A;  3K7R A;  1Q78 A;  4ALZ A;  3Q8R B;  3OL8 A;  2VA2 A;  1AW0 A;  4C11 A;  1Q86 T;  3CJS A;  4H4K A;  3FCV A;  3TVK A;  3I0S A;  1CC8 A;  1NND A;  1JLE B;  2F7V A;  2QG9 B;  4ZLL A;  4XDD A;  3GIK A;  3GU0 A;  4MMO A;  2AGP A;  3UDC A;  3EXC X;  3L7O A;  4B08 A;  3FBE A;  4JI7 F;  1N6Q B;  3HT0 A;  4I67 A;  4WK1 A;  2CQ2 A;  4YP3 A;  3RB4 A;  4U7U D;  2Z58 B;  5F8M A;  3UPF A;  1DZ5 A;  4ZMM A;  4PG5 A;  4DMZ A;  2IRU A;  2F8E X;  5CCM A;  2VIC A;  2VG7 A;  2F8H A;  2IJR A;  4FYY B;  2RUG A;  2V4Q A;  1HQ2 A;  3ENA A;  1UJ5 A;  4R8U B;  2ZH2 A;  2CRL A;  4JV5 F;  1S0M A;  3VHQ A;  2J9D E;  3DMJ B;  2X1G A;  3I6P A;  3MGJ A;  4ILL A;  2HQF A;  1HLW A;  3D9B A;  3QBC A;  1SKS A;  3AOD A;  4QWD A;  1FA0 A;  2V68 A;  2R42 A;  3H8Y A;  4J9U E;  5DGA A;  5IT9 U;  2HYI B;  3IO1 A;  1T9Y A;  2GQQ A;  4P7T A;  4F25 A;  4L72 B;  1VQ5 S;  1M1G A;  1VIS A;  1XBW A;  1ZAV A;  2DIV A;  2HHP A;  3FFI B;  3H5U A;  5HJY A;  2ZM6 J;  2FLL A;  3A13 A;  3A3P B;  4TLR A;  2WBR A;  3UR0 A;  1U0H A;  1X5T A;  1N34 F;  1VOM A;  3LO3 A;  4DR2 F;  1EZZ B;  2AJF E;  2HEK A;  2M70 A;  4N8O A;  4O23 A;  3D28 A;  2B9W A;  4RPF A;  2K7J A;  4OYZ A;  1RDR A;  5AE1 A;  2UVV A;  5D3G A;  2H9Z A;  4HEA 9;  2CWK A;  3GIR A;  3KK1 B;  4DV5 F;  2DEI A;  3MCO A;  2B56 A;  4F7V A;  4G3I A;  2NPF A;  4FF2 A;  3CJR A;  3DKD A;  1AFJ A;  2WON B;  1KP6 A;  3QYY A;  4FXW A;  1TKD A;  2R7R A;  3EE3 A;  2CG4 A;  1TFY A;  2FC8 A;  1FER A;  3HHL A;  4ZVS B;  4C3L A;  2V2K A;  3KHH A;  4LF6 J;  2I9S A;  4OQJ A;  5KT7 A;  2GVD B;  1I94 F;  1M1H A;  4C97 A;  3D6F B;  2G1D A;  2HND A;  2X51 A;  2LFV A;  2V8V A;  3PY8 A;  3QFW A;  2V4R A;  3BO4 A;  2CDQ A;  1P1T A;  1RI7 A;  3NG8 A;  4TYA A;  1NJW A;  1B64 A;  2Y0S D;  3TVY A;  4X4U A;  3FDS A;  4TYB A;  1FX4 A;  2M7S A;  2V69 A;  2QLW A;  4URS A;  1OS5 A;  4YUD A;  2MEW A;  5JXS A;  4DR3 J;  4LF4 F;  1HNI B;  2YQ1 A;  1IJE B;  5HAO A;  1QSS A;  4RW6 B;  3OTO J;  1GNK A;  4FYX B;  3G82 B;  5DS7 A;  1PC5 A;  1T9W A;  4NLR A;  3OL6 A;  1VYA A;  3RR8 A;  1FHT A;  2DNQ A;  3GYN A;  3I82 A;  3MM6 A;  3BBC A;  3SSQ A;  2KG1 A;  2UUC F;  3POT B;  4UOF A;  2ATL A;  1YJN S;  1L3K A;  2GMH A;  4NCG B;  2WB4 A;  5K8M A;  2I5J A;  4DR5 F;  3SV4 A;  3LP1 B;  1UEV A;  2JH3 A;  2BE9 B;  3J7Z T;  2VQF F;  2G4B A;  3HSG A;  1HNV B;  2QL9 B;  3GIJ A;  2JC0 A;  1GMW D;  4NE9 C;  5L8R C;  3BRE A;  3C6T A;  3VAI A;  3HJF A;  2NZ4 A;  2LQ9 A;  2BW7 A;  2W9B B;  2NXN A;  3RRG A;  4OZN A;  1QLN A;  4B9L A;  1QM9 A;  2CPE A;  3NCR A;  3OUY B;  4DQS A;  2CFX A;  4OHY A;  2DRB A;  4DF4 A;  2MJN A;  3PX0 A;  5HAN A;  1PIL A;  2MLZ A;  2PMW A;  1QD1 A;  3IRX B;  4WYW A;  4NXN J;  1FXR A;  1SKW A;  2CQB A;  1E6V B;  1RT4 B;  4P75 A;  4CZC A;  3UD4 P;  2CPD A;  5KTQ A;  4UT4 A;  3RRH A;  1Y5L B;  1RHR B;  2DNO A;  3Q2T C;  3BGU A;  3ZTP A;  1IQZ A;  3NXZ A;  4UOH A;  3SQG A;  3F44 A;  1RYR A;  5DRK A;  1NDC A;  1TKZ B;  1UVN A;  2HAI A;  2MKJ A;  2R2U A;  3J81 Y;  2HWI A;  3PRB A;  5GME A;  1WDD A;  3FCW A;  4IG3 B;  4KKO B;  2ALZ A;  1U49 A;  4W98 A;  1C4C A;  3WHI A;  2DNH A;  4UTG A;  2ZZN A;  4OJ1 A;  4FBT A;  3C46 A;  3H4B A;  3FJ2 A;  2CNO B;  1YBA A;  2D3O R;  1HWK A;  2V6A A;  4DR7 J;  2VG5 A;  3JAM Y;  3BDE A;  3NGU A;  2FTR A;  4J7C A;  1J5E F;  3QT6 A;  1I51 B;  1XNQ F;  4YY3 F;  3MAA B;  4HTJ A;  4I6W A;  2ZH4 A;  2DHH A;  3SSR A;  3GPA A;  1RCO B;  1RT3 A;  3IGV A;  2VG6 B;  1N5S A;  4RUB A;  1WKL A;  2OAU A;  5KT6 A;  2EFP A;  2DXF A;  2IAJ A;  3MEE A;  2NR0 A;  4OMF G;  1FXD A;  2C2N A;  3KJF B;  4IDK B;  4DU7 A;  4CH1 A;  1FTC A;  1H98 A;  3MMB A;  3NBP B;  1SB6 A;  2C2O B;  3CME S;  4JI4 F;  1G6B A;  5HAT A;  3GTY X;  3NP5 A;  1HBO A;  1S49 A;  2JLG A;  2GJ2 A;  2UXD J;  2BQ3 A;  1H2V Z;  3DRP B;  1BMQ B;  1RT1 A;  3GLJ A;  3JTO A;  3TJ9 A;  4BC9 A;  2E5G A;  3M2R B;  3U7J A;  4DPX A;  4A47 A;  2JEG A;  3L4B C;  1SJ3 P;  1X9M A;  1EP4 B;  2MHN A;  4LSL B;  5KT4 A;  2DGU A;  4NLP A;  3MR5 A;  3HFK A;  4PG6 A;  4B9V A;  1AT1 B;  1IKV B;  4MKB A;  1W25 A;  2IM2 A;  2H51 B;  1VR6 A;  3MAH A;  1QE1 B;  3VGT A;  4YR0 A;  3K0J A;  1HMV A;  4O0N A;  4P2X A;  3W2W A;  5KOX A;  2ASL A;  3GJQ B;  4HLB A;  2ZH5 A;  2QA4 S;  5KFL A;  3JTP A;  3MPY A;  3GSD A;  3JSB A;  4LSN A;  3Q89 A;  2M3D A;  3FZB A;  4WFY A;  4DPU A;  2AW0 A;  4O3N A;  3WIV A;  1ZM4 A;  2D7S A;  4I69 A;  3CCL S;  3KYL A;  4DS5 A;  1Z2Z A;  2FGC A;  1RE1 B;  4O3O A;  1FRI A;  4RZR A;  3ONQ A;  5FDL B;  1RLD A;  1Y10 A;  4M5N A;  1X4E A;  2MST A;  3RAM A;  4ZCM A;  2VBW A;  2ZM6 F;  3IBW A;  4JYA J;  3I87 A;  2R7O A;  1GTH A;  2UU9 J;  1LK7 A;  3I5A A;  2UXC J;  1N5T A;  2AF6 A;  3NGK A;  2M8D B;  4ELV A;  2ZOG A;  1ZZF A;  2XTJ P;  3BSA A;  3T1Y F;  4HI2 A;  1CJV A;  2V8P A;  2KKH A;  4FPR A;  1H74 A;  1YG0 A;  4I2P A;  5A0Y B;  4NA2 A;  2WAQ D;  4PG4 A;  5D4L A;  4C7Q A;  2H1Y A;  1X7V A;  2PA8 D;  2ZFH A;  2F63 A;  4YFU A;  2CWX A;  1G7C B;  1UAW A;  2XG8 A;  2VU5 A;  4DL7 A;  4F4K A;  3IN5 A;  4ZVF A;  3MPD A;  3PIP Q;  4QPT A;  1PJ6 A;  2VG7 B;  5CYJ A;  1D1U A;  3KMQ A;  3A8E A;  2B7C B;  3BR9 A;  3DLG B;  4KV8 A;  1UZH A;  1UWA A;  2CZ4 A;  3AQP A;  5DDR C;  2X7I A;  1RHM B;  2PA3 A;  1U2F A;  3UCU P;  4URQ U;  5HSP A;  4DV1 J;  3P96 A;  3R6G B;  2ZH9 A;  2FQQ B;  2MZR A;  1DQ9 A;  4WXW A;  1JJ4 A;  1KWM A;  1WHY A;  2GJI A;  4RW7 A;  5IOL A;  4IRD A;  3N4W A;  1RHU B;  1SC4 B;  2AJ1 A;  4HI1 A;  3DOK A;  4TQS A;  1V3Z A;  2C2Z B;  2YVS A;  4DEZ A;  2ZH1 A;  3D1Q A;  1QUP A;  3H42 A;  3GYX B;  1P9Y A;  4ZKA A;  2HVI A;  1RWP B;  3OR2 A;  1XWL A;  4U8V A;  5KFX A;  2OPP A;  1KVJ A;  3CWJ A;  4WZQ A;  3SBM A;  3Q83 A;  2XS2 A;  1TV6 B;  3DMJ A;  2PD1 A;  3LAN A;  4WKY A;  2BE7 D;  2J8S A;  5RUB A;  1SJF A;  5AXN A;  1JQG A;  1BWV A;  3MD1 A;  1S9G A;  1YK9 A;  1IN0 A;  4CLK A;  4ZA1 A;  3PFO A;  2ZE2 B;  3GFH A;  2EKN A;  2EFV A;  3TUZ C;  3G8T A;  3TNV A;  4B9S A;  2VQE F;  2GIF A;  4CO4 A;  2KZZ A;  1IVZ A;  2DKO B;  3LWM A;  2BYC A;  5HLF A;  4K0K J;  1Z1Z A;  3VGU A;  3TZX A;  1CUL B;  3W5Y A;  2J0Q D;  2D3U A;  1KTV A;  1S6U A;  1JB0 C;  3NWR A;  3EVM A;  1WUU A;  2KB2 A;  2B6A B;  3C66 A;  2XI3 A;  3HSZ A;  4MKA A;  5ETK A;  3R5B A;  4B3M J;  1N88 A;  1NK9 A;  1QDU B;  2EC2 A;  3M30 B;  2MDA A;  1U25 A;  2QLB B;  3KJN B;  4B3R J;  1Q8B A;  3NBP A;  4UQG A;  2GMJ A;  3ILJ A;  3X3U A;  4USK A;  4L3K A;  5K14 B;  4ICL A;  2HBY B;  4LFA J;  4DV0 J;  1RT7 A;  2FJE B;  5E7O B;  2C2K B;  2FIU A;  1S57 A;  2QL5 B;  4RU2 A;  3K58 A;  1NDK A;  4YY3 J;  1SV5 B;  2PSZ A;  2IBK A;  1ROF A;  3V2U C;  2DIU A;  1T02 A;  4DX5 A;  3TWZ A;  5JVG Q;  3J7A N;  2PEH A;  1RWW B;  1FWL A;  1WC0 A;  1IKV A;  1LOU A;  1Q4R A;  3MFI A;  3SCK E;  4U95 A;  3K5N A;  1X4B A;  3U02 A;  3W9J A;  2UVW A;  2DH8 A;  2B8P A;  1HBU B;  2QZ8 A;  2ZBR A;  1PJ5 A;  2WVF A;  3CC4 S;  3AJD A;  3DRY A;  2V0N A;  2W2N P;  3BGR B;  3P4U B;  1HNI A;  1RCX B;  1U1L A;  1XMO F;  2GNK A;  4USU A;  3Q8V A;  4JI5 J;  1Q1K A;  1X4C A;  2VON A;  4GVB B;  5B0A A;  1X0P A;  4TY8 A;  4XAK A;  2NRE A;  3CDA A;  3OFE A;  1NSP A;  2HIY A;  1C0T B;  4KSE B;  4YEA A;  1RKJ A;  2ACM A;  3HT3 A;  3NOC A;  1WHV A;  4NXN F;  3BKU A;  4GKK J;  4N5S A;  1YZ7 A;  3HD1 A;  4F4A A;  2A6O A;  2EFQ A;  3PG9 A;  3A1Y G;  1HPZ A;  1N33 F;  2WOM A;  1VQ8 S;  2PGC A;  2MZJ A;  3OXG A;  3KLG B;  4NEZ A;  2IHR 1;  4L75 A;  4E98 A;  2AZ1 A;  2OPS B;  5B7W A;  2QFJ A;  3X1L B;  2BKN A;  4LR9 A;  2KYZ A;  2YXL A;  4N41 A;  4M8L A;  4P2F A;  5HRO B;  2IJF A;  1RWU A;  1U47 A;  1KBR A;  2C3P A;  3OXL A;  4HHJ A;  2GC8 A;  1VRT B;  2UZA A;  5ETP A;  4ZVP B;  3W65 A;  5IFM A;  1IBM F;  1D8Y A;  2OIH A;  2OPR B;  3M2U A;  4GRS A;  2JEF A;  2W4P A;  3LA0 A;  4A8O A;  2NXJ A;  2AJ4 A;  2YH0 A;  4E8U A;  1RT4 A;  1CPZ A;  4UZC A;  3M6V A;  5EDW A;  2XUL A;  3IG1 B;  4MH8 A;  2XMU A;  3DI6 A;  4LRB A;  5DLG A;  1CQN A;  2BJE A;  1O5J A;  4Q2M A;  3N6L A;  4JI8 J;  1YBU A;  2ZUA A;  3MEE B;  3U1M A;  1FD8 A;  3RW6 A;  4WZM A;  3QWP A;  4QOT A;  2GAH C;  4P72 A;  1UPM B;  1P27 B;  4KHM A;  2CZV C;  4IG3 A;  4IYQ A;  4CP5 A;  4IOA Q;  4CLT A;  1KLN A;  1KN6 A;  2KVI A;  5GAE U;  2CJ9 A;  3QGH A;  5GAD I;  1WF2 A;  2V34 A;  4B3M F;  4ED6 A;  3CCJ S;  1SUQ B;  4BWM A;  4ZPW R;  4NXM F;  4C3K A;  2RF2 A;  2ZD1 B;  3MZI A;  3LQV A;  4MJK A;  2HLT A;  1ZAW A;  2NYI A;  1HW8 A;  3N0V A;  3G6V A;  1VLO A;  4AYB D;  1N48 A;  1VIO A;  1Y00 A;  5KG3 A;  2J0S D;  1NKB A;  2MB0 B;  4M95 A;  1F5A A;  1LWC B;  1QAI A;  1HHQ A;  2HPU A;  3CCQ S;  4Y2M A;  4U8Y A;  4Q7A A;  1KHW A;  4LF5 J;  1D9F A;  4NYZ A;  2EG1 A;  2ZE2 A;  4MK9 A;  4ZIT A;  3KUG A;  3G86 A;  4G1Q A;  5KFB A;  4YOE A;  1B0T A;  4M5D B;  3C15 B;  1HA1 A;  2QFI A;  4OHV A;  3CMA S;  3BBB A;  4KY3 A;  3GWC A;  5G4D A;  1B7Y B;  1X4D A;  2OFG X;  4K8R A;  3OLB A;  4K4W A;  3DRP A;  2IDE A;  3FK4 A;  2Y1I A;  2O3D A;  3GP9 A;  3M2R A;  4NA1 A;  4OZL A;  2CPX A;  5D4N A;  4WU2 A;  1L3V A;  5KFP A;  5CZV A;  4FBU A;  3GFX A;  2QJ3 A;  2VFT A;  4YB7 A;  2AT1 B;  2YNI B;  3S8S A;  3RB3 A;  3SFG A;  1FO1 A;  2JX2 A;  1T9X A;  2CNL B;  3CO0 P;  1F9H A;  4ZVQ B;  2L48 A;  1VQK S;  2W24 A;  4NRU A;  1FJG J;  2FB0 A;  2J9E A;  3LP0 A;  5BYS A;  5DDP C;  4JI2 J;  3V6D B;  3GII A;  3CTR A;  3LOU A;  3UO0 A;  2RJZ A;  2FJV A;  1VBZ A;  4DV7 F;  3S6E A;  2L9D A;  2RQ4 A;  4P2M A;  3HZG A;  1RTI B;  2VDH A;  3QRQ A;  3PRV A;  3DLJ A;  5IZH A;  2MZT A;  1BQM B;  1X5S A;  2EKY A;  4Y2I A;  2OEL A;  2PI4 A;  1DLO A;  2MZQ A;  3US5 A;  2W1B A;  5IV3 A;  4QIV A;  2BX6 A;  1FFG B;  5I42 A;  2HLU A;  4ID8 A;  1FWK A;  2XWX A;  5HVF A;  1L5U A;  1PYS B;  4KC5 A;  3I96 A;  2FJA B;  1AZS B;  2WVD A;  1A7G E;  2I1R A;  3R6L B;  4AUK A;  2FHM A;  1H2U X;  6FDR A;  4CI0 B;  3HDS A;  1QJH A;  3MPU B;  2HKE A;  5F3T A;  4KGZ B;  4NZ6 A;  2G0C A;  1YVF A;  4EUV A;  4R5P B;  3CD6 S;  4NLX A;  1RAH B;  5F41 A;  1DFD A;  2VF3 A;  3BV8 A;  3CDW A;  2VBY A;  4PAB A;  1NUE A;  4X4R A;  1UJ6 A;  1S7H A;  1C1B A;  5EWF A;  3Q8U A;  3OR2 B;  2BAC A;  3H5S A;  3VAH A;  2YNH A;  3DLG A;  3MD3 A;  4KV8 B;  4PXD A;  2XI2 A;  2RU9 A;  2UUW A;  2C2D A;  2W25 A;  2C3Y A;  3IAM 9;  5M2U A;  1WC6 A;  2YWK A;  4DR6 F;  2JZ5 A;  1ZTT A;  2V5H G;  2DEJ A;  1Q7Y T;  1GTE A;  4X65 J;  4DL4 A; 
#chains in the Genus database with same CATH homology
 4NEZ A;  2HHH J;  4JYA J;  2UU9 J;  1N36 J;  2UXC J;  4GKJ J;  4LF6 J;  3W1Y C;  5AJ3 J;  4DUY J;  2UUB J;  4LF7 J;  4B3S J;  4LF4 J;  1HR0 J;  1J5E J;  2KL8 A;  3D3C J;  4V1A k;  4DR3 J;  2MEW A;  5IWA J;  1XNR J;  2UXB J;  4JI8 J;  3OTO J;  4DV6 J;  4PWW A;  4DR4 J;  4AQY J;  4DV1 J;  4RJV A;  5IT9 U;  4YHH J;  4JI1 J;  5FLX U;  3T1Y J;  1N33 J;  2MTL A;  4DUZ J;  4LF8 J;  4KHP J;  3R2C J;  1N34 J;  1HNW J;  4LF5 J;  4DV5 J;  4DV7 J;  3JAM U;  3R2D J;  1N32 J;  4NXN J;  2VQE J;  4NEY A;  4KY3 A;  5LMN J;  2E5L J;  1HNZ J;  2KVQ E;  3J81 U;  4JI4 J;  4KYZ A;  2UUC J;  4DV2 J;  3IMQ J;  4K0K J;  4HHU A;  2UUA J;  5BR8 J;  1FJG J;  5A2Q U;  4B3M J;  4DR6 J;  4JI2 J;  1XNQ J;  3J80 U;  4DR7 J;  4DR2 J;  4DV4 J;  4B3R J;  1IBK J;  2VQF J;  4B3T J;  4LFA J;  4DV0 J;  1HNX J;  5LMU J;  4YY3 J;  4DR1 J;  1XMO J;  1IBM J;  4LFB J;  4X66 J;  3J7A N;  4JI6 J;  4LF9 J;  4DR5 J;  4NXM J;  2UXD J;  4OX9 J;  4X62 J;  4DV3 J;  4JV5 J;  1I94 J;  3T1H J;  1XMQ J;  4X64 J;  1IBL J;  4JI5 J;  3D3B J;  4LFC J;  2ZM6 J;  5LM7 E;  4JI3 J;  4JI0 J;  4JI7 J;  2F4V J;  4GKK J;  2MQ8 A;  4X65 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...