1HNXM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnxM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnxM02
4PDGA 1NNJA 5ITXE 1PM5A 1HNZM 3GQ3A 2UUCM 4ITQA 4DV5M 1J5EM 3U6MA 4DR1M 2OQ4A 2F5PA 2UUAM 2UU9M 3W0FA 1N33M 1MU5A 3JR4A 4DR3M 1K3XA 4DR2M 4JI1M 4G4NA 2OPFA 1R2ZA 4B3TM 4DR5M 2E5LM 5ITYA 3U6OA 3SBJA 2HKJA 1IBKM 1R2YA 1Z5AA 1L2CA 3SARA 4LF7M 4NRWA 4AQYM 4G4OA 3A45A 3JR5A 3GPPA 4JI6M 3GPYA 4DV1M 5FLXS 4JI0M 2XZUA 1Q39A 3A42A 1N32M 1HR0M 1PJIA 4DV4M 1HNXM 1Z59A 1L1TA 2F4VM 1TDZA 4MB7A 3U6SA 3OTOM 4LF6M 3U6PA 2VQEM 4JI4M 5ITXA 4DV7M 1IBLM 3U6CA 1I94M 3TWKA 5A2QS 2ZM6M 5ITUA 5ITRA 1Z5CA 1EE8A 1K3WA 3TWMA 1XMOM 1Z5BA 2EA0A 4JI3M 4DV0M 4KHPM 4B3RM 4LF8M 3JAMS 2ZBKB 4PDIA 2UXBM 1TDHA 2UUBM 4JI8M 4JI7M 4LF9M 3GO8A 5ITQA 4GKKM 1FJGM 3GQ5A 4K0KM 4B3SM 2F5QA 3C58A 4X66M 2F5NA 4DV6M 4LFBM 2F5SA 3J80S 4DV2M 4PD2A 4G4RA 4X64M 4DV3M 4LF5M 3DOAA 1XNQM 4DR4M 2UXDM 3U6QA 2Q2EB 5BR8M 3J81S 4JI5M 3U6LA 4NRVA 5LMNM 3GPUA 2HHHM 3TWLA 4YHHM 4G4QA 4GKJM 4DUZM 3SAWA 4JYAM 4LFAM 4CISA 4LFCM 4JV5M 3VK7A 3T1YM 3SASA 1Q3CA 2VQFM 5ITTA 4PCZA 3SAUA 5IT9S 4YY3M 2F5OA 3SATA 1N36M 1HNWM 4B3MM 4LF4M 1XC8A 2UXCM 1L2BA 1L1ZA 2XZFA 1MX0A 1N34M 1KFVA 3T1HM 3VK8A 1Q3BA 1XNRM 3A46A 4X65M 4OX9M 1K82A 4DR7M 5LMUM 1PJJA 4NXNM 4JI2M 3U6DA 4X62M 3GP1A 1L2DA 3GPXA 3U6EA 5IWAM 4DUYM 1IBMM 3SAVA 4NXMM 3J7AS 4DR6M 1XMQM 3GQ4A
chains in the Genus database with same CATH superfamily
4PDGA 1NNJA 1OFIA 3MMPA 4I5SA 4UN2B 4R7GA 3LVVA 4MGZE 1N75A 1TF0B 4ZPXA 2QBYB 3LCUA 2KA6B 1N77A 2LTUA 5E6JA 3FE3A 1V33A 4IJFA 1SXJD 4DR1M 3W0FA 1TH4A 2G3QA 2O01F 3UK6A 2LHGA 3GLHB 1SXJB 4IBBA 4I8OA 2G5GX 3NBIA 4DR2M 3UGJA 1HQYE 4G4NA 5EXPA 1BVSA 3MHVC 3DA1A 1TGUA 4B3TM 2QP9X 2RKOA 2HAKA 1JR3E 3M6AA 3LVWA 3IECA 3GLGA 2E5LM 4LJ4A 2XSZA 1E32A 1D0LA 1Z5AA 2KW0A 4XK8F 4XBOA 3SARA 1GO5A 2KRUA 3A45A 3VLFB 3JR5A 1GJTA 2MR9A 3B9PA 1DGBA 1KYIA 4JI0M 4IBGA 1HR0M 2FS1A 4HL4A 4LJ5A 1H6UA 3FUXA 4DV4M 2QENA 5IREB 3CTWB 1C7YA 1L1TA 3J7BA 2F4VM 1TDZA 2EJSA 1ZQ9A 2G8LA 1D2NA 2FOIC 1A5TA 4LJ7A 3U6SA 3L25A 3AL0C 3RGSA 2FH0A 3I4YA 2C96A 3KVWA 3HU1A 5ITUA 3KOXE 5DYGA 1S3SA 3TWMA 2XSZD 3B7NA 3E4RA 2HCBA 4QNRA 4JI3M 1R6BX 2ZAMA 3SFZA 3F92A 4R71A 4KHPM 3HU3A 3VKHA 2ZBKB 2X4AA 3PNVA 4JI8M 2YFQA 4LF9M 1R7RA 1IXSA 2VF8A 5KO3A 3U61B 2R62A 3C3EA 1FJGM 1GJSA 8CATA 4TUWA 2BWEA 2N35A 3RGPA 1VG5A 3C58A 1G59A 2K0BX 5L8RF 3R8FA 3PXGA 3I04M 1WXQA 4IBEA 4DV2M 4LFBM 4PD2A 4MGYE 2GNOA 3VDPA 3FUWA 3NBXX 1VQ1A 1RU3A 5KPTA 3J81S 4CJ6A 2RRUA 1DGHB 3FRIA 2OO9A 4G6ZA 4R3DA 5JI2E 2BJVA 4FCVA 2JZ0A 4IJEA 4DUZM 3SAWA 2DNAA 4RF0A 3V76A 4LFAM 2V1UA 2LVNC 4LFCM 3WHLA 4JYAM 3SASA 1NHGC 4FWHA 4PCZA 2VQFM 1SG9A 3PNYA 4FD2A 3T38A 3VKGA 2LNHC 3W67A 1JB0F 3U5ZA 1PJSA 4P17A 2VIIA 2JY8A 4HEOA 4B3MM 1GLNA 1E94E 2JXNA 3GLGE 2AHMA 1ZAEA 3K9OA 1MX0A 1N34M 1KFVA 4AKIA 2DWMA 2R4EA 1Q3BA 3FTDA 5EP3A 3SHGB 2CHQA 5KPRA 5DYIA 1ZMVA 4X65M 2VF7A 3VFDA 3U6DA 4LJ6A 2JUJA 3CGWA 5IWAM 3U6EA 3C3DA 4NXMM 2WSFF 3SAVA 4QOZC 4F1IA 3GRUA 1XMQM 2FNAA 1WGLA 3GQ4A 1W5TA 4B7GA 2R0IA 3HHXA 4RF1A 1HNZM 3KSXA 3GRVA 4IBJA 2JA2A 4GRIA 2J7OA 4MH0E 1JR3D 5E26A 1QUTA 1J5EM 2CFOA 2DHRA 1XB2B 2OQ4A 2MROB 3HWSA 2R4JA 4OVZA 4L15A 3HHZA 4NSRA 3AKZA 2XEPA 1IXRC 3JR4A 4DR3M 3J27B 2QPAA 3AOGA 5FTLA 2RGOA 5BPVA 4JI1M 4FCWA 3HX3A 1IY2A 3I4VA 4KLNA 2M5ZA 2KHHA 1IN7A 3U6OA 1ZV1A 2HKJA 2O5RA 1R2YA 3HHYA 3SC3A 4LF7M 2DZNB 3L2AA 4KODA 4GMQA 2R18A 3BBZA 3KSJA 1W5SA 4JI6M 1XXHA 3IG8A 2XFSA 3BXWA 5EP2A 3E21A 3K92A 1Z6TA 3A42A 3TQSA 3KFUG 3HU2A 1Z59A 2EKFA 4FVMA 2L7IA 2DKLA 3OTOM 4LJAA 1VEJA 2L2DA 4OVZB 4LF6M 2VQEM 1IBLM 2XFTA 4L4UA 3M0EA 4QHSA 3GRRA 2KNAA 4LGYA 4FCTA 2NQ8C 2O25A 1NJFA 4AW4A 1VEGA 2QCUA 1XMOM 1IY1A 1Z5BA 3FTCA 3QYBA 4M0DA 1QAMA 2R46A 5GKNA 2I7NA 2FE8A 3T6PA 5H37D 3B74A 4DV0M 2LWXA 3KXEC 2X49A 4B3RM 1GL7A 4LJ9A 4PDIA 1TDHA 3L27A 1Q02A 4JI7M 2R6FA 1OFHA 2R65A 4GKKM 4HLQA 4BB9A 4K0KM 4REZA 3MK6A 1TH3A 4GH9A 2GQFA 2F5QA 5FTMA 3KOZE 1EIJA 3H4MA 1R4GA 2KNZA 1G71A 2KNVA 2F5NA 4AKGA 2J7NA 3SMSA 3TE6A 1IN8A 3AOEC 3J80S 2DZOB 2DWNA 3AFHA 4M9XA 1XNQM 1GABA 1G8PA 4Z6YA 3U6QA 2QQ8A 4MM3B 2FFJA 2V1CA 1QYRA 4NRVA 5LMNM 2QHOB 1G4AE 3I51A 4FWDA 3LQRA 3GLGB 3VK7A 3D8LA 5ITTA 4YY3M 1OJLA 5DFLA 4MGKE 1IN6A 2K47A 1NV9A 3HJSA 4A3VB 3RE8A 1HNWM 2DAEA 1AIPC 5KPZA 2R44A 2Z7JA 3KDSE 1XC8A 1L1ZA 2DWZB 4LJ8A 4LZZA 2D7HA 3FTFA 2C5RA 1OTRA 2A5YB 2W82A 3T1HM 3VK8A 5KQDA 1LV7A 3GLFA 1PRBA 1ZMUA 1XXHE 3RFWA 2L4EA 4IBFA 1NY5A 3FUVA 4F2LA 1E9RA 4NC6A 3K9PA 3GP1A 1L2DA 2APLA 4S12A 3GPXA 2KZUA 3W68A 1OIPA 2DENA 1OAOC 4MGIE 2DZLA 4M9ZA 1GVNA 1UM8A 3K8ZA 3ZC7B 5EQTA 2LH0A 1VEKA 3E9SA 1SXJC 3GQ3A 3ZH9B 3GLIE 4NSOB 2UUCM 4ITQA 2R45A 4OU7A 1IXSB 1ORYB 3TPZA 1YUBA 2K6BA 2MJ5B 3U6MA 1HT1E 3BOSA 4L78A 4BBAA 2F5PA 4IBKA 2UU9M 3M7GA 1IN5A 3FTEA 2BWBA 1MU5A 4QOSA 1QAOA 1QDTA 1K3XA 1IY0A 1WHCA 4LZJA 1DO0A 1PJQA 2WSCF 3CF0A 2LVQD 1MJGM 4XGIA 3HY5A 4B7HA 1HQCA 4DBGB 2OPFA 1R2ZA 3K1JA 2EO2A 2CE7A 4M9SA 4Y28F 3SBJA 3WHKA 3I01M 1IBKM 5IZ7D 1G41A 3U60A 1TR8A 4Z8XA 1AUAA 2C99A 3DZDA 4G4OA 1IFYA 3R9XB 4DV1M 1QDRA 5F3WA 2EUCA 2CV2A 4GITA 1N32M 4IBIA 3AV0A 3U5ZB 2JNHA 1L8QA 1HNXM 2LHCA 5EJCA 4IBDA 3HKPA 1NVMA 1P3QQ 5ITXA 4JI4M 1D0MA 3B7QA 2MGWA 4WURA 5C1BA 2CWBA 3TWKA 5A2QS 1J09A 2ZM6M 1C1KA 5ITRA 2HWJA 2L6OA 4KT0F 1Z5CA 1EE8A 1K3WA 1QANA 4RNAA 1T6OA 1OIZA 2J5YA 3Q8GA 1TH2A 2KRKA 2MH8A 3NWLA 4FW9A 1XHBA 2Y0TA 5KQ8A 3SHFA 3KOWE 4WP2A 1GKIA 1KSFX 3GLFE 4WW0A 2UXBM 2KXEA 2ZANA 2QBYA 3K2LA 4D82A 5ITQA 1OQYA 3GRYA 1IM2A 2Y0QA 2EKKA 1CUKA 1DGGA 2BNKA 4B3SM 2XGNA 4I4LA 5EP1A 4AG6A 2DAKA 2JZ1A 4X66M 4PT5A 5C18A 2JY6B 1SXJA 1T3TA 2ZAOA 3GLHA 3H4JA 4GC9A 4LF5M 4G4RA 4X64M 3DOAA 2UXDM 2DXIA 1XWIA 4RKUF 1HJPA 2DAIA 4AI6A 2Q2EB 2XF3A 5JI3E 3W0LB 5BR8M 3GLIA 3PVSA 2QSFX 4G3OA 4JXJA 4GKJM 3FRHA 3KOYE 4FWGA 3L29A 4YHHM 3GPUA 1DO2A 4NL4H 1NV8A 7CATA 4IIWA 4CISA 2C98A 3T1YM 4B7FA 2ZTCA 3SATA 2F5OA 2B3TA 3QAUA 1N36M 1XXHB 2I7PA 4BLCA 3A98B 3LCVB 4GC5A 2OOBA 3KS4A 3HHWA 1YSYA 4CHTB 1WJ7A 1UFZA 2XH9A 4II7A 3E46A 2Z8YM 3UZUA 1XNRM 2D7EA 1NHWC 3IG5A 1NY6A 3UMMA 2Y20A 4OX9M 4DR7M 3CF2A 5LMUM 1PJTA 4L8RC 3L28A 3FYDA 5FSWA 4X62M 3Q8XA 3GLIB 1WIVA 1OKSA 4DUYM 1IBMM 3T15A 3J7AS 4MGHA 1MN3A 3FYCA 1J7KA 4LRTA 2L4FA 3QWLA 2RGHA 5ITXE 1PM5A 2CV0A 2CRUA 3U61A 1IQPA 3KW6A 4M0WA 2DAGA 1YLAA 4DV5M 2LVPC 1IXZA 4LRSA 1QAQA 4GHLA 2LVOC 2YR0A 2UUAM 1N33M 1QZEA 1NSFA 4KO8A 3LMMA 2QNJA 1FNNA 2VDBB 4CGYB 2YQZA 3D8BA 1QUSA 3MJ5A 3SYLA 3B89A 4EIWA 1HT2E 3KP0E 5EXTA 1WR1B 3SMPA 1WGNA 1DGHA 1V92A 4GIPA 2QZ4A 3C9PA 4DR5M 2P5TA 3GLHE 1LTMA 1SXJE 5ITYA 3KS8A 1EFUB 4NRWA 1L2CA 2D7GA 2X8AA 1QQWA 2CP8A 3SYKA 3FD9A 3GPPA 3QYEA 3GPYA 4AQYM 2YNMD 5FLXS 4P16A 3FKEA 2XZUA 2DAMA 4GHAA 1Q39A 1QZMA 1PJIA 4CIZA 3AJIB 5DNYA 2ZTDA 4AZFA 4MB7A 3UJNA 2JWSA 5EP4A 2Y21A 2KZSA 3U6PA 3LQQA 1D0KA 2DHYA 3VDUA 4DV7M 1Y8GA 3U6CA 1I94M 3L26A 2C9OA 3GLFB 3HJQA 1ZMWA 2L7HA 3HGIA 1F4IA 3HJ8A 4LG2A 1NO1A 4I81A 2ERCA 5EXSA 3EIEA 2EA0A 2Z4RA 1DGFA 1QVRA 1G3IA 2C9CA 3AOEA 1GL6A 2H1RA 4ANRA 4LF8M 4IBCA 3JAMS 2CHVA 2L09A 2UUBM 3J2PB 3GO8A 2LBCA 1YE9A 3GQ5A 1V34A 2WZJA 4W5WA 1IN4A 2K9DA 4D80A 1JR3A 1E9SA 2CUZA 2BJWA 2DVWB 4DV6M 4JN6A 4B08A 2F5SA 3IHPA 3DFZA 4DV3M 1X37A 2DWLA 3FUUA 4OW0A 4DR4M 1T43A 5FTNA 4AKHA 3HZJA 1OAIA 4JI5M 3U6LA 2JY7A 4Q7JA 2HHHM 4NOOB 3TWLA 4G4QA 2Z4SA 2DI0A 4D81A 3ZCBB 4JV5M 3CF6E 2H5XA 1VDLA 3U60B 1Q3CA 2JY5A 3SAUA 5IT9S 4LCBA 2CV1A 5FTKA 4L16A 4GEWA 4QNMA 2V6ZM 3TL4X 4QHTA 2M60A 1NNUC 1I4WA 2LXEA 5EXXA 2WSEF 2LVAA 3FUTA 3ILKA 4LF4M 2KEBA 2UXCM 1L2BA 2XZFA 3EIHA 2OOAA 3B7ZA 2XLJA 3PFIA 1PGYA 4LGMA 4AG5A 5FTJA 1NJGA 1VDDA 4LY6A 3A46A 3KP1E 2HL7A 2KDLA 2CHGA 3ZQJA 1TTEA 3LW5F 1K82A 1N78A 1PJJA 4NXNM 4JI2M 2Z3XA 3THGA 1DV0A 2JP7A 1JQJC 4DR6M 2CEAA 4L6V6 1R5LA
chains in the Genus database with same CATH topology
4PDGA 1NNJA 1OFIA 4I5SA 4R7GA 3LVVA 4MGZE 1N75A 4ZPXA 2QBYB 2KA6B 1N77A 5E6JA 4IJFA 1SXJD 4DR1M 3W0FA 1TH4A 3UK6A 3GLHB 1SXJB 4IBBA 4I8OA 2G5GX 3NBIA 4DR2M 3UGJA 1HQYE 4G4NA 5EXPA 3MHVC 3DA1A 1TGUA 4B3TM 2QP9X 2RKOA 3M6AA 3LVWA 3GLGA 2E5LM 4LJ4A 2XSZA 1E32A 1Z5AA 2KW0A 3SARA 4XBOA 2KRUA 3A45A 3VLFB 3JR5A 3B9PA 1DGBA 1KYIA 4JI0M 4IBGA 1HR0M 4HL4A 4LJ5A 1H6UA 3FUXA 4DV4M 2QENA 5IREB 3CTWB 1L1TA 3J7BA 2F4VM 1TDZA 1ZQ9A 2G8LA 1D2NA 2FOIC 4LJ7A 3U6SA 3L25A 3AL0C 3RGSA 3I4YA 2C96A 3KVWA 3HU1A 5ITUA 3KOXE 5DYGA 1S3SA 3TWMA 2XSZD 3E4RA 2HCBA 4QNRA 4JI3M 1R6BX 2ZAMA 3SFZA 4KHPM 3HU3A 3VKHA 2ZBKB 2X4AA 3PNVA 4JI8M 2YFQA 4LF9M 1R7RA 5KO3A 3U61B 2R62A 1FJGM 8CATA 4TUWA 3RGPA 3C58A 1G59A 3R8FA 3PXGA 1WXQA 4IBEA 4DV2M 4LFBM 4PD2A 4MGYE 3VDPA 3FUWA 5KPTA 3J81S 1DGHB 4G6ZA 4R3DA 5JI2E 2BJVA 4FCVA 4IJEA 4DUZM 3SAWA 4RF0A 2V1UA 4JYAM 4LFAM 4LFCM 3WHLA 3SASA 1NHGC 4FWHA 4PCZA 2VQFM 3PNYA 4FD2A 3T38A 3VKGA 2LNHC 3U5ZA 2VIIA 4B3MM 1GLNA 1E94E 2AHMA 1ZAEA 1MX0A 1N34M 1KFVA 4AKIA 2DWMA 2R4EA 1Q3BA 3FTDA 5EP3A 3SHGB 2CHQA 5KPRA 5DYIA 4X65M 3VFDA 3U6DA 4LJ6A 3U6EA 5IWAM 4NXMM 3SAVA 4QOZC 3GRUA 1XMQM 2FNAA 3GQ4A 1W5TA 4B7GA 3HHXA 4RF1A 1HNZM 3KSXA 3GRVA 4IBJA 2JA2A 4GRIA 2J7OA 4MH0E 1JR3D 5E26A 1J5EM 2CFOA 2DHRA 2OQ4A 3HWSA 2R4JA 4OVZA 4L15A 3HHZA 4NSRA 3AKZA 2XEPA 1IXRC 3JR4A 4DR3M 3J27B 2QPAA 3AOGA 5FTLA 2RGOA 5BPVA 4JI1M 4FCWA 1IY2A 3I4VA 4KLNA 2M5ZA 1IN7A 3U6OA 2HKJA 2O5RA 1R2YA 3HHYA 3SC3A 4LF7M 2DZNB 3L2AA 4KODA 4GMQA 2R18A 3KSJA 1W5SA 4JI6M 1XXHA 3IG8A 2XFSA 5EP2A 3K92A 1Z6TA 3A42A 3TQSA 3KFUG 3HU2A 1Z59A 4FVMA 2L7IA 3OTOM 4LJAA 4LF6M 4OVZB 2VQEM 1IBLM 2XFTA 4L4UA 3M0EA 4QHSA 3GRRA 4LGYA 4FCTA 2NQ8C 1NJFA 4AW4A 2QCUA 1XMOM 1IY1A 1Z5BA 3FTCA 4M0DA 1QAMA 2R46A 5GKNA 2I7NA 2FE8A 5H37D 4DV0M 4B3RM 2LWXA 3KXEC 2X49A 1GL7A 4LJ9A 4PDIA 1TDHA 3L27A 4JI7M 1OFHA 2R65A 4GKKM 4HLQA 4BB9A 4K0KM 4REZA 3MK6A 1TH3A 4GH9A 2F5QA 5FTMA 3KOZE 3H4MA 2F5NA 4AKGA 2J7NA 3SMSA 3TE6A 1IN8A 3AOEC 3J80S 2DZOB 2DWNA 3AFHA 4M9XA 1XNQM 1G8PA 4Z6YA 3U6QA 4MM3B 2FFJA 2V1CA 1QYRA 4NRVA 5LMNM 1G4AE 3I51A 4FWDA 3LQRA 3GLGB 3VK7A 3D8LA 5ITTA 4YY3M 1OJLA 4MGKE 1IN6A 2K47A 3HJSA 4A3VB 3RE8A 1HNWM 5KPZA 2Z7JA 3KDSE 1XC8A 1L1ZA 2DWZB 4LJ8A 4LZZA 2D7HA 3FTFA 2C5RA 2A5YB 2W82A 3T1HM 3VK8A 5KQDA 1LV7A 3GLFA 3RFWA 4IBFA 1NY5A 3FUVA 1E9RA 3GP1A 1L2DA 4S12A 3GPXA 2KZUA 4MGIE 4M9ZA 1GVNA 1UM8A 3K8ZA 3ZC7B 5EQTA 2LH0A 3E9SA 1SXJC 3GQ3A 3ZH9B 4NSOB 2UUCM 4ITQA 2R45A 4OU7A 1IXSB 1ORYB 3TPZA 1YUBA 3U6MA 1HT1E 3BOSA 4L78A 4BBAA 2F5PA 4IBKA 2UU9M 3M7GA 1IN5A 3FTEA 1MU5A 4QOSA 1QAOA 1K3XA 1IY0A 4LZJA 1DO0A 3CF0A 4XGIA 4B7HA 2OPFA 1HQCA 1R2ZA 3K1JA 2EO2A 2CE7A 4M9SA 3SBJA 3WHKA 1IBKM 5IZ7D 1G41A 3U60A 4Z8XA 2C99A 3DZDA 4G4OA 3R9XB 4DV1M 5F3WA 2EUCA 2CV2A 4GITA 1N32M 4IBIA 3AV0A 3U5ZB 1L8QA 1HNXM 5EJCA 4IBDA 3HKPA 1NVMA 4JI4M 5ITXA 4WURA 5C1BA 3TWKA 5A2QS 1J09A 2ZM6M 1C1KA 5ITRA 2L6OA 1Z5CA 1EE8A 1K3WA 1QANA 4RNAA 4FW9A 1TH2A 2KRKA 3NWLA 1XHBA 2Y0TA 5KQ8A 3SHFA 3KOWE 1GKIA 1KSFX 4WW0A 2UXBM 2KXEA 2ZANA 2QBYA 3K2LA 4D82A 5ITQA 3GRYA 1IM2A 2Y0QA 1DGGA 2BNKA 4B3SM 2XGNA 4I4LA 5EP1A 4AG6A 4X66M 4PT5A 5C18A 2ZAOA 1SXJA 1T3TA 3GLHA 4GC9A 4LF5M 4G4RA 4X64M 3DOAA 2UXDM 2DXIA 1XWIA 4AI6A 2Q2EB 2XF3A 5JI3E 3W0LB 5BR8M 3GLIA 3PVSA 4JXJA 4GKJM 3KOYE 4FWGA 4YHHM 3L29A 3GPUA 4NL4H 7CATA 4IIWA 4CISA 2C98A 3T1YM 4B7FA 3SATA 2F5OA 3QAUA 1N36M 1XXHB 2I7PA 4BLCA 3A98B 4GC5A 3KS4A 3HHWA 1YSYA 4CHTB 4II7A 2XH9A 3UZUA 1XNRM 2D7EA 1NHWC 3IG5A 1NY6A 3UMMA 2Y20A 4OX9M 4DR7M 3CF2A 5LMUM 4L8RC 3L28A 3FYDA 5FSWA 4X62M 3Q8XA 3GLIB 4DUYM 1IBMM 3T15A 3J7AS 4MGHA 3FYCA 1J7KA 4LRTA 3QWLA 2RGHA 5ITXE 1PM5A 2CV0A 3U61A 1IQPA 3KW6A 4M0WA 4DV5M 1IXZA 4LRSA 1QAQA 4GHLA 2YR0A 2UUAM 1N33M 1NSFA 4KO8A 3LMMA 1FNNA 4CGYB 2YQZA 3D8BA 3MJ5A 3SYLA 4EIWA 1HT2E 3KP0E 5EXTA 3SMPA 1DGHA 4GIPA 2QZ4A 4DR5M 2P5TA 1SXJE 5ITYA 3KS8A 4NRWA 1L2CA 2D7GA 2X8AA 1QQWA 3SYKA 4AQYM 3FD9A 3GPPA 3GPYA 2YNMD 5FLXS 4P16A 3FKEA 2XZUA 4GHAA 1Q39A 1QZMA 1PJIA 3AJIB 5DNYA 4AZFA 4MB7A 3UJNA 5EP4A 2Y21A 2KZSA 3U6PA 3LQQA 3VDUA 4DV7M 3U6CA 1I94M 3L26A 2C9OA 3GLFB 3HJQA 2L7HA 3HGIA 3HJ8A 4LG2A 5EXSA 4I81A 2ERCA 3EIEA 2EA0A 2Z4RA 1DGFA 1QVRA 1G3IA 2C9CA 3AOEA 1GL6A 2H1RA 4LF8M 4IBCA 3JAMS 2CHVA 2L09A 2UUBM 3J2PB 3GO8A 1YE9A 3GQ5A 4W5WA 1IN4A 4D80A 1JR3A 1E9SA 2CUZA 2BJWA 2DVWB 4DV6M 4JN6A 4B08A 2F5SA 3DFZA 4DV3M 1X37A 2DWLA 3FUUA 4OW0A 4DR4M 5FTNA 4AKHA 4JI5M 3U6LA 2HHHM 4NOOB 3TWLA 4G4QA 2Z4SA 4D81A 3ZCBB 4JV5M 3CF6E 3U60B 1Q3CA 3SAUA 5IT9S 4LCBA 2CV1A 5FTKA 4L16A 4QNMA 2V6ZM 3TL4X 4QHTA 2M60A 1NNUC 1I4WA 2LXEA 5EXXA 3FUTA 3ILKA 4LF4M 2KEBA 2UXCM 1L2BA 2XZFA 3EIHA 2XLJA 3PFIA 4LGMA 4AG5A 5FTJA 1NJGA 1VDDA 4LY6A 3A46A 3KP1E 2HL7A 2CHGA 1K82A 1N78A 1PJJA 4NXNM 4JI2M 2Z3XA 3THGA 1JQJC 4DR6M 2CEAA 1DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDG A;  1NNJ A;  5ITX E;  1PM5 A;  1HNZ M;  3GQ3 A;  2UUC M;  4ITQ A;  4DV5 M;  1J5E M;  3U6M A;  4DR1 M;  2OQ4 A;  2F5P A;  2UUA M;  2UU9 M;  3W0F A;  1N33 M;  1MU5 A;  3JR4 A;  4DR3 M;  1K3X A;  4DR2 M;  4JI1 M;  4G4N A;  2OPF A;  1R2Z A;  4B3T M;  4DR5 M;  2E5L M;  5ITY A;  3U6O A;  3SBJ A;  2HKJ A;  1IBK M;  1R2Y A;  1Z5A A;  1L2C A;  3SAR A;  4LF7 M;  4NRW A;  4AQY M;  4G4O A;  3A45 A;  3JR5 A;  3GPP A;  4JI6 M;  3GPY A;  4DV1 M;  5FLX S;  4JI0 M;  2XZU A;  1Q39 A;  3A42 A;  1N32 M;  1HR0 M;  1PJI A;  4DV4 M;  1HNX M;  1Z59 A;  1L1T A;  2F4V M;  1TDZ A;  4MB7 A;  3U6S A;  3OTO M;  4LF6 M;  3U6P A;  2VQE M;  4JI4 M;  5ITX A;  4DV7 M;  1IBL M;  3U6C A;  1I94 M;  3TWK A;  5A2Q S;  2ZM6 M;  5ITU A;  5ITR A;  1Z5C A;  1EE8 A;  1K3W A;  3TWM A;  1XMO M;  1Z5B A;  2EA0 A;  4JI3 M;  4DV0 M;  4KHP M;  4B3R M;  4LF8 M;  3JAM S;  2ZBK B;  4PDI A;  2UXB M;  1TDH A;  2UUB M;  4JI8 M;  4JI7 M;  4LF9 M;  3GO8 A;  5ITQ A;  4GKK M;  1FJG M;  3GQ5 A;  4K0K M;  4B3S M;  2F5Q A;  3C58 A;  4X66 M;  2F5N A;  4DV6 M;  4LFB M;  2F5S A;  3J80 S;  4DV2 M;  4PD2 A;  4G4R A;  4X64 M;  4DV3 M;  4LF5 M;  3DOA A;  1XNQ M;  4DR4 M;  2UXD M;  3U6Q A;  2Q2E B;  5BR8 M;  3J81 S;  4JI5 M;  3U6L A;  4NRV A;  5LMN M;  3GPU A;  2HHH M;  3TWL A;  4YHH M;  4G4Q A;  4GKJ M;  4DUZ M;  3SAW A;  4JYA M;  4LFA M;  4CIS A;  4LFC M;  4JV5 M;  3VK7 A;  3T1Y M;  3SAS A;  1Q3C A;  2VQF M;  5ITT A;  4PCZ A;  3SAU A;  5IT9 S;  4YY3 M;  2F5O A;  3SAT A;  1N36 M;  1HNW M;  4B3M M;  4LF4 M;  1XC8 A;  2UXC M;  1L2B A;  1L1Z A;  2XZF A;  1MX0 A;  1N34 M;  1KFV A;  3T1H M;  3VK8 A;  1Q3B A;  1XNR M;  3A46 A;  4X65 M;  4OX9 M;  1K82 A;  4DR7 M;  5LMU M;  1PJJ A;  4NXN M;  4JI2 M;  3U6D A;  4X62 M;  3GP1 A;  1L2D A;  3GPX A;  3U6E A;  5IWA M;  4DUY M;  1IBM M;  3SAV A;  4NXM M;  3J7A S;  4DR6 M;  1XMQ M;  3GQ4 A; 
#chains in the Genus database with same CATH topology
 4PDG A;  1NNJ A;  1OFI A;  3MMP A;  4I5S A;  4UN2 B;  4R7G A;  3LVV A;  4MGZ E;  1N75 A;  1TF0 B;  4ZPX A;  2QBY B;  3LCU A;  2KA6 B;  1N77 A;  2LTU A;  5E6J A;  3FE3 A;  1V33 A;  4IJF A;  1SXJ D;  4DR1 M;  3W0F A;  1TH4 A;  2G3Q A;  2O01 F;  3UK6 A;  2LHG A;  3GLH B;  1SXJ B;  4IBB A;  4I8O A;  2G5G X;  3NBI A;  4DR2 M;  3UGJ A;  1HQY E;  4G4N A;  5EXP A;  1BVS A;  3MHV C;  3DA1 A;  1TGU A;  4B3T M;  2QP9 X;  2RKO A;  2HAK A;  1JR3 E;  3M6A A;  3LVW A;  3IEC A;  3GLG A;  2E5L M;  4LJ4 A;  2XSZ A;  1E32 A;  1D0L A;  1Z5A A;  2KW0 A;  4XK8 F;  4XBO A;  3SAR A;  1GO5 A;  2KRU A;  3A45 A;  3VLF B;  3JR5 A;  1GJT A;  2MR9 A;  3B9P A;  1DGB A;  1KYI A;  4JI0 M;  4IBG A;  1HR0 M;  2FS1 A;  4HL4 A;  4LJ5 A;  1H6U A;  3FUX A;  4DV4 M;  2QEN A;  5IRE B;  3CTW B;  1C7Y A;  1L1T A;  3J7B A;  2F4V M;  1TDZ A;  2EJS A;  1ZQ9 A;  2G8L A;  1D2N A;  2FOI C;  1A5T A;  4LJ7 A;  3U6S A;  3L25 A;  3AL0 C;  3RGS A;  2FH0 A;  3I4Y A;  2C96 A;  3KVW A;  3HU1 A;  5ITU A;  3KOX E;  5DYG A;  1S3S A;  3TWM A;  2XSZ D;  3B7N A;  3E4R A;  2HCB A;  4QNR A;  4JI3 M;  1R6B X;  2ZAM A;  3SFZ A;  3F92 A;  4R71 A;  4KHP M;  3HU3 A;  3VKH A;  2ZBK B;  2X4A A;  3PNV A;  4JI8 M;  2YFQ A;  4LF9 M;  1R7R A;  1IXS A;  2VF8 A;  5KO3 A;  3U61 B;  2R62 A;  3C3E A;  1FJG M;  1GJS A;  8CAT A;  4TUW A;  2BWE A;  2N35 A;  3RGP A;  1VG5 A;  3C58 A;  1G59 A;  2K0B X;  5L8R F;  3R8F A;  3PXG A;  3I04 M;  1WXQ A;  4IBE A;  4DV2 M;  4LFB M;  4PD2 A;  4MGY E;  2GNO A;  3VDP A;  3FUW A;  3NBX X;  1VQ1 A;  1RU3 A;  5KPT A;  3J81 S;  4CJ6 A;  2RRU A;  1DGH B;  3FRI A;  2OO9 A;  4G6Z A;  4R3D A;  5JI2 E;  2BJV A;  4FCV A;  2JZ0 A;  4IJE A;  4DUZ M;  3SAW A;  2DNA A;  4RF0 A;  3V76 A;  4LFA M;  2V1U A;  2LVN C;  4LFC M;  3WHL A;  4JYA M;  3SAS A;  1NHG C;  4FWH A;  4PCZ A;  2VQF M;  1SG9 A;  3PNY A;  4FD2 A;  3T38 A;  3VKG A;  2LNH C;  3W67 A;  1JB0 F;  3U5Z A;  1PJS A;  4P17 A;  2VII A;  2JY8 A;  4HEO A;  4B3M M;  1GLN A;  1E94 E;  2JXN A;  3GLG E;  2AHM A;  1ZAE A;  3K9O A;  1MX0 A;  1N34 M;  1KFV A;  4AKI A;  2DWM A;  2R4E A;  1Q3B A;  3FTD A;  5EP3 A;  3SHG B;  2CHQ A;  5KPR A;  5DYI A;  1ZMV A;  4X65 M;  2VF7 A;  3VFD A;  3U6D A;  4LJ6 A;  2JUJ A;  3CGW A;  5IWA M;  3U6E A;  3C3D A;  4NXM M;  2WSF F;  3SAV A;  4QOZ C;  4F1I A;  3GRU A;  1XMQ M;  2FNA A;  1WGL A;  3GQ4 A;  1W5T A;  4B7G A;  2R0I A;  3HHX A;  4RF1 A;  1HNZ M;  3KSX A;  3GRV A;  4IBJ A;  2JA2 A;  4GRI A;  2J7O A;  4MH0 E;  1JR3 D;  5E26 A;  1QUT A;  1J5E M;  2CFO A;  2DHR A;  1XB2 B;  2OQ4 A;  2MRO B;  3HWS A;  2R4J A;  4OVZ A;  4L15 A;  3HHZ A;  4NSR A;  3AKZ A;  2XEP A;  1IXR C;  3JR4 A;  4DR3 M;  3J27 B;  2QPA A;  3AOG A;  5FTL A;  2RGO A;  5BPV A;  4JI1 M;  4FCW A;  3HX3 A;  1IY2 A;  3I4V A;  4KLN A;  2M5Z A;  2KHH A;  1IN7 A;  3U6O A;  1ZV1 A;  2HKJ A;  2O5R A;  1R2Y A;  3HHY A;  3SC3 A;  4LF7 M;  2DZN B;  3L2A A;  4KOD A;  4GMQ A;  2R18 A;  3BBZ A;  3KSJ A;  1W5S A;  4JI6 M;  1XXH A;  3IG8 A;  2XFS A;  3BXW A;  5EP2 A;  3E21 A;  3K92 A;  1Z6T A;  3A42 A;  3TQS A;  3KFU G;  3HU2 A;  1Z59 A;  2EKF A;  4FVM A;  2L7I A;  2DKL A;  3OTO M;  4LJA A;  1VEJ A;  2L2D A;  4OVZ B;  4LF6 M;  2VQE M;  1IBL M;  2XFT A;  4L4U A;  3M0E A;  4QHS A;  3GRR A;  2KNA A;  4LGY A;  4FCT A;  2NQ8 C;  2O25 A;  1NJF A;  4AW4 A;  1VEG A;  2QCU A;  1XMO M;  1IY1 A;  1Z5B A;  3FTC A;  3QYB A;  4M0D A;  1QAM A;  2R46 A;  5GKN A;  2I7N A;  2FE8 A;  3T6P A;  5H37 D;  3B74 A;  4DV0 M;  2LWX A;  3KXE C;  2X49 A;  4B3R M;  1GL7 A;  4LJ9 A;  4PDI A;  1TDH A;  3L27 A;  1Q02 A;  4JI7 M;  2R6F A;  1OFH A;  2R65 A;  4GKK M;  4HLQ A;  4BB9 A;  4K0K M;  4REZ A;  3MK6 A;  1TH3 A;  4GH9 A;  2GQF A;  2F5Q A;  5FTM A;  3KOZ E;  1EIJ A;  3H4M A;  1R4G A;  2KNZ A;  1G71 A;  2KNV A;  2F5N A;  4AKG A;  2J7N A;  3SMS A;  3TE6 A;  1IN8 A;  3AOE C;  3J80 S;  2DZO B;  2DWN A;  3AFH A;  4M9X A;  1XNQ M;  1GAB A;  1G8P A;  4Z6Y A;  3U6Q A;  2QQ8 A;  4MM3 B;  2FFJ A;  2V1C A;  1QYR A;  4NRV A;  5LMN M;  2QHO B;  1G4A E;  3I51 A;  4FWD A;  3LQR A;  3GLG B;  3VK7 A;  3D8L A;  5ITT A;  4YY3 M;  1OJL A;  5DFL A;  4MGK E;  1IN6 A;  2K47 A;  1NV9 A;  3HJS A;  4A3V B;  3RE8 A;  1HNW M;  2DAE A;  1AIP C;  5KPZ A;  2R44 A;  2Z7J A;  3KDS E;  1XC8 A;  1L1Z A;  2DWZ B;  4LJ8 A;  4LZZ A;  2D7H A;  3FTF A;  2C5R A;  1OTR A;  2A5Y B;  2W82 A;  3T1H M;  3VK8 A;  5KQD A;  1LV7 A;  3GLF A;  1PRB A;  1ZMU A;  1XXH E;  3RFW A;  2L4E A;  4IBF A;  1NY5 A;  3FUV A;  4F2L A;  1E9R A;  4NC6 A;  3K9P A;  3GP1 A;  1L2D A;  2APL A;  4S12 A;  3GPX A;  2KZU A;  3W68 A;  1OIP A;  2DEN A;  1OAO C;  4MGI E;  2DZL A;  4M9Z A;  1GVN A;  1UM8 A;  3K8Z A;  3ZC7 B;  5EQT A;  2LH0 A;  1VEK A;  3E9S A;  1SXJ C;  3GQ3 A;  3ZH9 B;  3GLI E;  4NSO B;  2UUC M;  4ITQ A;  2R45 A;  4OU7 A;  1IXS B;  1ORY B;  3TPZ A;  1YUB A;  2K6B A;  2MJ5 B;  3U6M A;  1HT1 E;  3BOS A;  4L78 A;  4BBA A;  2F5P A;  4IBK A;  2UU9 M;  3M7G A;  1IN5 A;  3FTE A;  2BWB A;  1MU5 A;  4QOS A;  1QAO A;  1QDT A;  1K3X A;  1IY0 A;  1WHC A;  4LZJ A;  1DO0 A;  1PJQ A;  2WSC F;  3CF0 A;  2LVQ D;  1MJG M;  4XGI A;  3HY5 A;  4B7H A;  1HQC A;  4DBG B;  2OPF A;  1R2Z A;  3K1J A;  2EO2 A;  2CE7 A;  4M9S A;  4Y28 F;  3SBJ A;  3WHK A;  3I01 M;  1IBK M;  5IZ7 D;  1G41 A;  3U60 A;  1TR8 A;  4Z8X A;  1AUA A;  2C99 A;  3DZD A;  4G4O A;  1IFY A;  3R9X B;  4DV1 M;  1QDR A;  5F3W A;  2EUC A;  2CV2 A;  4GIT A;  1N32 M;  4IBI A;  3AV0 A;  3U5Z B;  2JNH A;  1L8Q A;  1HNX M;  2LHC A;  5EJC A;  4IBD A;  3HKP A;  1NVM A;  1P3Q Q;  5ITX A;  4JI4 M;  1D0M A;  3B7Q A;  2MGW A;  4WUR A;  5C1B A;  2CWB A;  3TWK A;  5A2Q S;  1J09 A;  2ZM6 M;  1C1K A;  5ITR A;  2HWJ A;  2L6O A;  4KT0 F;  1Z5C A;  1EE8 A;  1K3W A;  1QAN A;  4RNA A;  1T6O A;  1OIZ A;  2J5Y A;  3Q8G A;  1TH2 A;  2KRK A;  2MH8 A;  3NWL A;  4FW9 A;  1XHB A;  2Y0T A;  5KQ8 A;  3SHF A;  3KOW E;  4WP2 A;  1GKI A;  1KSF X;  3GLF E;  4WW0 A;  2UXB M;  2KXE A;  2ZAN A;  2QBY A;  3K2L A;  4D82 A;  5ITQ A;  1OQY A;  3GRY A;  1IM2 A;  2Y0Q A;  2EKK A;  1CUK A;  1DGG A;  2BNK A;  4B3S M;  2XGN A;  4I4L A;  5EP1 A;  4AG6 A;  2DAK A;  2JZ1 A;  4X66 M;  4PT5 A;  5C18 A;  2JY6 B;  1SXJ A;  1T3T A;  2ZAO A;  3GLH A;  3H4J A;  4GC9 A;  4LF5 M;  4G4R A;  4X64 M;  3DOA A;  2UXD M;  2DXI A;  1XWI A;  4RKU F;  1HJP A;  2DAI A;  4AI6 A;  2Q2E B;  2XF3 A;  5JI3 E;  3W0L B;  5BR8 M;  3GLI A;  3PVS A;  2QSF X;  4G3O A;  4JXJ A;  4GKJ M;  3FRH A;  3KOY E;  4FWG A;  3L29 A;  4YHH M;  3GPU A;  1DO2 A;  4NL4 H;  1NV8 A;  7CAT A;  4IIW A;  4CIS A;  2C98 A;  3T1Y M;  4B7F A;  2ZTC A;  3SAT A;  2F5O A;  2B3T A;  3QAU A;  1N36 M;  1XXH B;  2I7P A;  4BLC A;  3A98 B;  3LCV B;  4GC5 A;  2OOB A;  3KS4 A;  3HHW A;  1YSY A;  4CHT B;  1WJ7 A;  1UFZ A;  2XH9 A;  4II7 A;  3E46 A;  2Z8Y M;  3UZU A;  1XNR M;  2D7E A;  1NHW C;  3IG5 A;  1NY6 A;  3UMM A;  2Y20 A;  4OX9 M;  4DR7 M;  3CF2 A;  5LMU M;  1PJT A;  4L8R C;  3L28 A;  3FYD A;  5FSW A;  4X62 M;  3Q8X A;  3GLI B;  1WIV A;  1OKS A;  4DUY M;  1IBM M;  3T15 A;  3J7A S;  4MGH A;  1MN3 A;  3FYC A;  1J7K A;  4LRT A;  2L4F A;  3QWL A;  2RGH A;  5ITX E;  1PM5 A;  2CV0 A;  2CRU A;  3U61 A;  1IQP A;  3KW6 A;  4M0W A;  2DAG A;  1YLA A;  4DV5 M;  2LVP C;  1IXZ A;  4LRS A;  1QAQ A;  4GHL A;  2LVO C;  2YR0 A;  2UUA M;  1N33 M;  1QZE A;  1NSF A;  4KO8 A;  3LMM A;  2QNJ A;  1FNN A;  2VDB B;  4CGY B;  2YQZ A;  3D8B A;  1QUS A;  3MJ5 A;  3SYL A;  3B89 A;  4EIW A;  1HT2 E;  3KP0 E;  5EXT A;  1WR1 B;  3SMP A;  1WGN A;  1DGH A;  1V92 A;  4GIP A;  2QZ4 A;  3C9P A;  4DR5 M;  2P5T A;  3GLH E;  1LTM A;  1SXJ E;  5ITY A;  3KS8 A;  1EFU B;  4NRW A;  1L2C A;  2D7G A;  2X8A A;  1QQW A;  2CP8 A;  3SYK A;  3FD9 A;  3GPP A;  3QYE A;  3GPY A;  4AQY M;  2YNM D;  5FLX S;  4P16 A;  3FKE A;  2XZU A;  2DAM A;  4GHA A;  1Q39 A;  1QZM A;  1PJI A;  4CIZ A;  3AJI B;  5DNY A;  2ZTD A;  4AZF A;  4MB7 A;  3UJN A;  2JWS A;  5EP4 A;  2Y21 A;  2KZS A;  3U6P A;  3LQQ A;  1D0K A;  2DHY A;  3VDU A;  4DV7 M;  1Y8G A;  3U6C A;  1I94 M;  3L26 A;  2C9O A;  3GLF B;  3HJQ A;  1ZMW A;  2L7H A;  3HGI A;  1F4I A;  3HJ8 A;  4LG2 A;  1NO1 A;  4I81 A;  2ERC A;  5EXS A;  3EIE A;  2EA0 A;  2Z4R A;  1DGF A;  1QVR A;  1G3I A;  2C9C A;  3AOE A;  1GL6 A;  2H1R A;  4ANR A;  4LF8 M;  4IBC A;  3JAM S;  2CHV A;  2L09 A;  2UUB M;  3J2P B;  3GO8 A;  2LBC A;  1YE9 A;  3GQ5 A;  1V34 A;  2WZJ A;  4W5W A;  1IN4 A;  2K9D A;  4D80 A;  1JR3 A;  1E9S A;  2CUZ A;  2BJW A;  2DVW B;  4DV6 M;  4JN6 A;  4B08 A;  2F5S A;  3IHP A;  3DFZ A;  4DV3 M;  1X37 A;  2DWL A;  3FUU A;  4OW0 A;  4DR4 M;  1T43 A;  5FTN A;  4AKH A;  3HZJ A;  1OAI A;  4JI5 M;  3U6L A;  2JY7 A;  4Q7J A;  2HHH M;  4NOO B;  3TWL A;  4G4Q A;  2Z4S A;  2DI0 A;  4D81 A;  3ZCB B;  4JV5 M;  3CF6 E;  2H5X A;  1VDL A;  3U60 B;  1Q3C A;  2JY5 A;  3SAU A;  5IT9 S;  4LCB A;  2CV1 A;  5FTK A;  4L16 A;  4GEW A;  4QNM A;  2V6Z M;  3TL4 X;  4QHT A;  2M60 A;  1NNU C;  1I4W A;  2LXE A;  5EXX A;  2WSE F;  2LVA A;  3FUT A;  3ILK A;  4LF4 M;  2KEB A;  2UXC M;  1L2B A;  2XZF A;  3EIH A;  2OOA A;  3B7Z A;  2XLJ A;  3PFI A;  1PGY A;  4LGM A;  4AG5 A;  5FTJ A;  1NJG A;  1VDD A;  4LY6 A;  3A46 A;  3KP1 E;  2HL7 A;  2KDL A;  2CHG A;  3ZQJ A;  1TTE A;  3LW5 F;  1K82 A;  1N78 A;  1PJJ A;  4NXN M;  4JI2 M;  2Z3X A;  3THG A;  1DV0 A;  2JP7 A;  1JQJ C;  4DR6 M;  2CEA A;  4L6V 6;  1R5L A; 
#chains in the Genus database with same CATH homology
 4PDG A;  1NNJ A;  1OFI A;  4I5S A;  4R7G A;  3LVV A;  4MGZ E;  1N75 A;  4ZPX A;  2QBY B;  2KA6 B;  1N77 A;  5E6J A;  4IJF A;  1SXJ D;  4DR1 M;  3W0F A;  1TH4 A;  3UK6 A;  3GLH B;  1SXJ B;  4IBB A;  4I8O A;  2G5G X;  3NBI A;  4DR2 M;  3UGJ A;  1HQY E;  4G4N A;  5EXP A;  3MHV C;  3DA1 A;  1TGU A;  4B3T M;  2QP9 X;  2RKO A;  3M6A A;  3LVW A;  3GLG A;  2E5L M;  4LJ4 A;  2XSZ A;  1E32 A;  1Z5A A;  2KW0 A;  3SAR A;  4XBO A;  2KRU A;  3A45 A;  3VLF B;  3JR5 A;  3B9P A;  1DGB A;  1KYI A;  4JI0 M;  4IBG A;  1HR0 M;  4HL4 A;  4LJ5 A;  1H6U A;  3FUX A;  4DV4 M;  2QEN A;  5IRE B;  3CTW B;  1L1T A;  3J7B A;  2F4V M;  1TDZ A;  1ZQ9 A;  2G8L A;  1D2N A;  2FOI C;  4LJ7 A;  3U6S A;  3L25 A;  3AL0 C;  3RGS A;  3I4Y A;  2C96 A;  3KVW A;  3HU1 A;  5ITU A;  3KOX E;  5DYG A;  1S3S A;  3TWM A;  2XSZ D;  3E4R A;  2HCB A;  4QNR A;  4JI3 M;  1R6B X;  2ZAM A;  3SFZ A;  4KHP M;  3HU3 A;  3VKH A;  2ZBK B;  2X4A A;  3PNV A;  4JI8 M;  2YFQ A;  4LF9 M;  1R7R A;  5KO3 A;  3U61 B;  2R62 A;  1FJG M;  8CAT A;  4TUW A;  3RGP A;  3C58 A;  1G59 A;  3R8F A;  3PXG A;  1WXQ A;  4IBE A;  4DV2 M;  4LFB M;  4PD2 A;  4MGY E;  3VDP A;  3FUW A;  5KPT A;  3J81 S;  1DGH B;  4G6Z A;  4R3D A;  5JI2 E;  2BJV A;  4FCV A;  4IJE A;  4DUZ M;  3SAW A;  4RF0 A;  2V1U A;  4JYA M;  4LFA M;  4LFC M;  3WHL A;  3SAS A;  1NHG C;  4FWH A;  4PCZ A;  2VQF M;  3PNY A;  4FD2 A;  3T38 A;  3VKG A;  2LNH C;  3U5Z A;  2VII A;  4B3M M;  1GLN A;  1E94 E;  2AHM A;  1ZAE A;  1MX0 A;  1N34 M;  1KFV A;  4AKI A;  2DWM A;  2R4E A;  1Q3B A;  3FTD A;  5EP3 A;  3SHG B;  2CHQ A;  5KPR A;  5DYI A;  4X65 M;  3VFD A;  3U6D A;  4LJ6 A;  3U6E A;  5IWA M;  4NXM M;  3SAV A;  4QOZ C;  3GRU A;  1XMQ M;  2FNA A;  3GQ4 A;  1W5T A;  4B7G A;  3HHX A;  4RF1 A;  1HNZ M;  3KSX A;  3GRV A;  4IBJ A;  2JA2 A;  4GRI A;  2J7O A;  4MH0 E;  1JR3 D;  5E26 A;  1J5E M;  2CFO A;  2DHR A;  2OQ4 A;  3HWS A;  2R4J A;  4OVZ A;  4L15 A;  3HHZ A;  4NSR A;  3AKZ A;  2XEP A;  1IXR C;  3JR4 A;  4DR3 M;  3J27 B;  2QPA A;  3AOG A;  5FTL A;  2RGO A;  5BPV A;  4JI1 M;  4FCW A;  1IY2 A;  3I4V A;  4KLN A;  2M5Z A;  1IN7 A;  3U6O A;  2HKJ A;  2O5R A;  1R2Y A;  3HHY A;  3SC3 A;  4LF7 M;  2DZN B;  3L2A A;  4KOD A;  4GMQ A;  2R18 A;  3KSJ A;  1W5S A;  4JI6 M;  1XXH A;  3IG8 A;  2XFS A;  5EP2 A;  3K92 A;  1Z6T A;  3A42 A;  3TQS A;  3KFU G;  3HU2 A;  1Z59 A;  4FVM A;  2L7I A;  3OTO M;  4LJA A;  4LF6 M;  4OVZ B;  2VQE M;  1IBL M;  2XFT A;  4L4U A;  3M0E A;  4QHS A;  3GRR A;  4LGY A;  4FCT A;  2NQ8 C;  1NJF A;  4AW4 A;  2QCU A;  1XMO M;  1IY1 A;  1Z5B A;  3FTC A;  4M0D A;  1QAM A;  2R46 A;  5GKN A;  2I7N A;  2FE8 A;  5H37 D;  4DV0 M;  4B3R M;  2LWX A;  3KXE C;  2X49 A;  1GL7 A;  4LJ9 A;  4PDI A;  1TDH A;  3L27 A;  4JI7 M;  1OFH A;  2R65 A;  4GKK M;  4HLQ A;  4BB9 A;  4K0K M;  4REZ A;  3MK6 A;  1TH3 A;  4GH9 A;  2F5Q A;  5FTM A;  3KOZ E;  3H4M A;  2F5N A;  4AKG A;  2J7N A;  3SMS A;  3TE6 A;  1IN8 A;  3AOE C;  3J80 S;  2DZO B;  2DWN A;  3AFH A;  4M9X A;  1XNQ M;  1G8P A;  4Z6Y A;  3U6Q A;  4MM3 B;  2FFJ A;  2V1C A;  1QYR A;  4NRV A;  5LMN M;  1G4A E;  3I51 A;  4FWD A;  3LQR A;  3GLG B;  3VK7 A;  3D8L A;  5ITT A;  4YY3 M;  1OJL A;  4MGK E;  1IN6 A;  2K47 A;  3HJS A;  4A3V B;  3RE8 A;  1HNW M;  5KPZ A;  2Z7J A;  3KDS E;  1XC8 A;  1L1Z A;  2DWZ B;  4LJ8 A;  4LZZ A;  2D7H A;  3FTF A;  2C5R A;  2A5Y B;  2W82 A;  3T1H M;  3VK8 A;  5KQD A;  1LV7 A;  3GLF A;  3RFW A;  4IBF A;  1NY5 A;  3FUV A;  1E9R A;  3GP1 A;  1L2D A;  4S12 A;  3GPX A;  2KZU A;  4MGI E;  4M9Z A;  1GVN A;  1UM8 A;  3K8Z A;  3ZC7 B;  5EQT A;  2LH0 A;  3E9S A;  1SXJ C;  3GQ3 A;  3ZH9 B;  4NSO B;  2UUC M;  4ITQ A;  2R45 A;  4OU7 A;  1IXS B;  1ORY B;  3TPZ A;  1YUB A;  3U6M A;  1HT1 E;  3BOS A;  4L78 A;  4BBA A;  2F5P A;  4IBK A;  2UU9 M;  3M7G A;  1IN5 A;  3FTE A;  1MU5 A;  4QOS A;  1QAO A;  1K3X A;  1IY0 A;  4LZJ A;  1DO0 A;  3CF0 A;  4XGI A;  4B7H A;  2OPF A;  1HQC A;  1R2Z A;  3K1J A;  2EO2 A;  2CE7 A;  4M9S A;  3SBJ A;  3WHK A;  1IBK M;  5IZ7 D;  1G41 A;  3U60 A;  4Z8X A;  2C99 A;  3DZD A;  4G4O A;  3R9X B;  4DV1 M;  5F3W A;  2EUC A;  2CV2 A;  4GIT A;  1N32 M;  4IBI A;  3AV0 A;  3U5Z B;  1L8Q A;  1HNX M;  5EJC A;  4IBD A;  3HKP A;  1NVM A;  4JI4 M;  5ITX A;  4WUR A;  5C1B A;  3TWK A;  5A2Q S;  1J09 A;  2ZM6 M;  1C1K A;  5ITR A;  2L6O A;  1Z5C A;  1EE8 A;  1K3W A;  1QAN A;  4RNA A;  4FW9 A;  1TH2 A;  2KRK A;  3NWL A;  1XHB A;  2Y0T A;  5KQ8 A;  3SHF A;  3KOW E;  1GKI A;  1KSF X;  4WW0 A;  2UXB M;  2KXE A;  2ZAN A;  2QBY A;  3K2L A;  4D82 A;  5ITQ A;  3GRY A;  1IM2 A;  2Y0Q A;  1DGG A;  2BNK A;  4B3S M;  2XGN A;  4I4L A;  5EP1 A;  4AG6 A;  4X66 M;  4PT5 A;  5C18 A;  2ZAO A;  1SXJ A;  1T3T A;  3GLH A;  4GC9 A;  4LF5 M;  4G4R A;  4X64 M;  3DOA A;  2UXD M;  2DXI A;  1XWI A;  4AI6 A;  2Q2E B;  2XF3 A;  5JI3 E;  3W0L B;  5BR8 M;  3GLI A;  3PVS A;  4JXJ A;  4GKJ M;  3KOY E;  4FWG A;  4YHH M;  3L29 A;  3GPU A;  4NL4 H;  7CAT A;  4IIW A;  4CIS A;  2C98 A;  3T1Y M;  4B7F A;  3SAT A;  2F5O A;  3QAU A;  1N36 M;  1XXH B;  2I7P A;  4BLC A;  3A98 B;  4GC5 A;  3KS4 A;  3HHW A;  1YSY A;  4CHT B;  4II7 A;  2XH9 A;  3UZU A;  1XNR M;  2D7E A;  1NHW C;  3IG5 A;  1NY6 A;  3UMM A;  2Y20 A;  4OX9 M;  4DR7 M;  3CF2 A;  5LMU M;  4L8R C;  3L28 A;  3FYD A;  5FSW A;  4X62 M;  3Q8X A;  3GLI B;  4DUY M;  1IBM M;  3T15 A;  3J7A S;  4MGH A;  3FYC A;  1J7K A;  4LRT A;  3QWL A;  2RGH A;  5ITX E;  1PM5 A;  2CV0 A;  3U61 A;  1IQP A;  3KW6 A;  4M0W A;  4DV5 M;  1IXZ A;  4LRS A;  1QAQ A;  4GHL A;  2YR0 A;  2UUA M;  1N33 M;  1NSF A;  4KO8 A;  3LMM A;  1FNN A;  4CGY B;  2YQZ A;  3D8B A;  3MJ5 A;  3SYL A;  4EIW A;  1HT2 E;  3KP0 E;  5EXT A;  3SMP A;  1DGH A;  4GIP A;  2QZ4 A;  4DR5 M;  2P5T A;  1SXJ E;  5ITY A;  3KS8 A;  4NRW A;  1L2C A;  2D7G A;  2X8A A;  1QQW A;  3SYK A;  4AQY M;  3FD9 A;  3GPP A;  3GPY A;  2YNM D;  5FLX S;  4P16 A;  3FKE A;  2XZU A;  4GHA A;  1Q39 A;  1QZM A;  1PJI A;  3AJI B;  5DNY A;  4AZF A;  4MB7 A;  3UJN A;  5EP4 A;  2Y21 A;  2KZS A;  3U6P A;  3LQQ A;  3VDU A;  4DV7 M;  3U6C A;  1I94 M;  3L26 A;  2C9O A;  3GLF B;  3HJQ A;  2L7H A;  3HGI A;  3HJ8 A;  4LG2 A;  5EXS A;  4I81 A;  2ERC A;  3EIE A;  2EA0 A;  2Z4R A;  1DGF A;  1QVR A;  1G3I A;  2C9C A;  3AOE A;  1GL6 A;  2H1R A;  4LF8 M;  4IBC A;  3JAM S;  2CHV A;  2L09 A;  2UUB M;  3J2P B;  3GO8 A;  1YE9 A;  3GQ5 A;  4W5W A;  1IN4 A;  4D80 A;  1JR3 A;  1E9S A;  2CUZ A;  2BJW A;  2DVW B;  4DV6 M;  4JN6 A;  4B08 A;  2F5S A;  3DFZ A;  4DV3 M;  1X37 A;  2DWL A;  3FUU A;  4OW0 A;  4DR4 M;  5FTN A;  4AKH A;  4JI5 M;  3U6L A;  2HHH M;  4NOO B;  3TWL A;  4G4Q A;  2Z4S A;  4D81 A;  3ZCB B;  4JV5 M;  3CF6 E;  3U60 B;  1Q3C A;  3SAU A;  5IT9 S;  4LCB A;  2CV1 A;  5FTK A;  4L16 A;  4QNM A;  2V6Z M;  3TL4 X;  4QHT A;  2M60 A;  1NNU C;  1I4W A;  2LXE A;  5EXX A;  3FUT A;  3ILK A;  4LF4 M;  2KEB A;  2UXC M;  1L2B A;  2XZF A;  3EIH A;  2XLJ A;  3PFI A;  4LGM A;  4AG5 A;  5FTJ A;  1NJG A;  1VDD A;  4LY6 A;  3A46 A;  3KP1 E;  2HL7 A;  2CHG A;  1K82 A;  1N78 A;  1PJJ A;  4NXN M;  4JI2 M;  2Z3X A;  3THG A;  1JQJ C;  4DR6 M;  2CEA A;  1DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...