1HNXM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnxM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnxM02
3OTOM 4NXMM 4PD2A 3U6PA 1Z59A 2F5NA 1N36M 4DR7M 4GKKM 4DUZM 4JI0M 2F4VM 5ITRA 1TDZA 4B3TM 1N34M 4NRVA 3GPUA 4JI8M 4DR3M 1IBKM 2HKJA 4G4OA 2OPFA 4PDIA 4DV4M 1Z5BA 3U6LA 3JR5A 4DR6M 5FLXS 2UUCM 4G4NA 4B3RM 4LF5M 3SARA 3J80S 4JYAM 2UU9M 5A2QS 1R2ZA 4DR5M 4DV2M 1R2YA 5LMNM 4DR1M 2UUBM 1XNRM 3TWKA 4ITQA 4NXNM 4DV6M 1NNJA 3C58A 4LF6M 3J81S 1L2DA 1L2CA 1PJIA 4JI3M 3GQ3A 3GO8A 1L2BA 2UXBM 2UXDM 2UXCM 4K0KM 3JR4A 4OX9M 3U6QA 2ZBKB 4CISA 2F5SA 3GPPA 3U6DA 1L1TA 5ITXA 3U6OA 1J5EM 2F5OA 1MU5A 5IT9S 3SBJA 1FJGM 4PCZA 1K3XA 3U6EA 1Z5CA 4JI4M 4JI6M 5ITXE 1Z5AA 3W0FA 3A46A 2E5LM 5ITYA 2OQ4A 4DV1M 1PJJA 1HNXM 4B3MM 3VK8A 4JI2M 1HR0M 4LF4M 4JV5M 2XZFA 4LF7M 4JI5M 1XMOM 4MB7A 5IWAM 1EE8A 4DV3M 1PM5A 1IBLM 4DR2M 1L1ZA 4DR4M 5ITUA 3U6SA 3GQ4A 4DUYM 3SAVA 4LFBM 4DV0M 4B3SM 4X66M 3T1HM 5ITQA 1Q3CA 2VQEM 1N32M 4LF9M 1XNQM 4JI7M 2EA0A 3SAUA 2Q2EB 1TDHA 2ZM6M 3T1YM 1I94M 1HNZM 3J7AS 1XC8A 3SASA 4YY3M 3GQ5A 1HNWM 2F5QA 3JAMS 2VQFM 4NRWA 4GKJM 1K82A 1IBMM 4LFCM 3SATA 1Q39A 1XMQM 4G4QA 5ITTA 5BR8M 1MX0A 2HHHM 3SAWA 4DV7M 3VK7A 3GPYA 3A42A 4LFAM 2XZUA 1Q3BA 4X65M 4AQYM 4KHPM 4X64M 1N33M 3A45A 3U6CA 2UUAM 3GP1A 4PDGA 3GPXA 3TWLA 4DV5M 1K3WA 4YHHM 4LF8M 5LMUM 3TWMA 3U6MA 3DOAA 4JI1M 4G4RA 1KFVA 4X62M 2F5PA
chains in the Genus database with same CATH superfamily
3U6PA 1QDRA 2C9CA 3RE8A 2CHGA 3GLFE 3I04M 1IN7A 4AKGA 3GRYA 4B3TM 4UN2B 3GPUA 1J7KA 3FTFA 2MGWA 2DAIA 2JWSA 3I01M 1LTMA 2OPFA 3L27A 4OW0A 1VDDA 4DV4M 1NY5A 3JR5A 3TQSA 1G71A 3GLHB 3B7NA 2I7NA 5FTNA 1IY0A 3K8ZA 1D0LA 3J80S 1D0MA 2UU9M 3TPZA 1IXSB 4QOZC 1PJTA 1R2YA 3FE3A 4DR1M 2CHVA 4ANRA 1ZMUA 3KVWA 3KSJA 4CGYB 4F2LA 2M5ZA 1DO2A 4IBCA 2DWNA 1R4GA 3E21A 3KW6A 3LQRA 1WGLA 2EKFA 1E32A 1VEKA 3HX3A 1DGHA 3M7GA 5FTLA 2BWEA 4CIZA 3GO8A 3HJ8A 4II7A 4FCVA 1NV8A 2UXCM 4L15A 3J7BA 4OX9M 3HWSA 1C1KA 3SYKA 1PRBA 2HL7A 1IM2A 5EXSA 4TUWA 3GPPA 5JI3E 3ZH9B 4XBOA 3SBJA 3MK6A 4PCZA 5E26A 2YR0A 3GLHE 4NOOB 4Z8XA 2CP8A 2JXNA 3L28A 1Z5AA 5ITXE 1GABA 3W0FA 3GLFA 2HWJA 2X8AA 3W67A 2CWBA 2QP9X 3SFZA 4LF7M 2XF3A 4GIPA 4AKIA 1T43A 2KDLA 3TE6A 8CATA 4R71A 2L4FA 2MR9A 3FTCA 3PNVA 1NNUC 5EP4A 3T15A 3SHGB 1MN3A 3LW5F 4DUYM 3GLGB 2QNJA 1GKIA 1GJTA 2FNAA 2V1UA 2KHHA 2CV0A 3GLIE 2CFOA 2EA0A 3HHZA 2QPAA 4QNMA 2MH8A 4B7HA 2YFQA 3QAUA 1GL6A 3SASA 2ERCA 2QSFX 4B08A 1GJSA 3J27B 1VDLA 5DNYA 2DNAA 1E9RA 3AOEA 1BVSA 1SXJA 4FWHA 3HJSA 1N77A 2XFTA 3CF2A 1K82A 3SATA 2JZ0A 1TGUA 1G4AE 1IN4A 4D80A 1OAOC 2XSZA 2NQ8C 5FTKA 1QDTA 4IBKA 5BPVA 3IG5A 1NJFA 3Q8XA 2G8LA 4GEWA 5EP2A 1N75A 2EO2A 1WR1B 3ZCBB 2K6BA 3VFDA 5DYIA 4AQYM 1QANA 2K47A 3QYEA 4KHPM 2DHRA 3GLHA 2C9OA 3J2PB 1JQJC 3FTDA 3IECA 3HU2A 3K92A 5KPRA 1XXHA 1HJPA 1YE9A 3GPXA 2DWZB 3AOGA 1QAMA 3GLIB 4YHHM 5L8RF 4LJ4A 4MM3B 3AOEC 1NVMA 3HJQA 5LMUM 7CATA 2QQ8A 1KFVA 3OTOM 4M9XA 3PFIA 2XSZD 4IBBA 4DR7M 1N36M 4HL4A 4IBJA 4GKKM 4DUZM 3M6AA 1SXJC 2MROB 1VEGA 1N34M 2FOIC 2R0IA 4JI8M 3L25A 1IY1A 2HKJA 1DGHB 2KNZA 2R65A 5DYGA 3K2LA 4NC6A 3LVVA 4IBIA 4REZA 4FWGA 2UUCM 4BBAA 4M0DA 3KFUG 2KRKA 3FUUA 1H6UA 3J81S 2DAEA 3AFHA 1XNRM 2UUBM 1J09A 3B74A 3FUVA 4RKUF 4ITQA 4OU7A 3C58A 4LF6M 1AUAA 3SMPA 2KEBA 4JI3M 3R8FA 2Z8YM 1L2BA 3H4JA 3VDPA 3QWLA 3KP0E 3LCVB 1G3IA 1IN6A 3BXWA 3MJ5A 2V6ZM 4MGZE 1I4WA 3KOYE 2RGOA 4I5SA 3FYDA 3GLGE 1V33A 4CISA 3CF6E 2F5SA 3U6DA 1L1TA 1UFZA 2DKLA 2RGHA 3THGA 4FWDA 1OTRA 4QOSA 3MMPA 3VDUA 1FJGM 1ZV1A 4OVZB 3U6EA 2H5XA 4XK8F 5C1BA 4JI4M 4JI6M 1JR3E 3GRUA 2Z3XA 4JI2M 1HNXM 2LHCA 2R18A 1XWIA 3HU3A 1HR0M 1Y8GA 4QNRA 3RFWA 2LVQD 2L2DA 3L26A 3W68A 1ZMVA 2WSFF 4IBDA 2C5RA 1XMOM 3FUWA 4IBEA 1R6BX 4KLNA 1D2NA 2FFJA 1KYIA 1WJ7A 1EE8A 3QYBA 1LV7A 2EKKA 3U6SA 3GLIA 3ZC7B 3SAVA 4M9SA 1OAIA 3SMSA 5ITQA 1Q3CA 2D7GA 2VQEM 1GL7A 2JY5A 4IBGA 5E6JA 4JI7M 1G41A 1SXJB 3SAUA 2Q2EB 1TDHA 3U61B 1EIJA 4JN6A 4M9ZA 1HNZM 4CJ6A 1WIVA 4XGIA 4RF0A 2LVPC 4YY3M 3GRVA 2YNMD 1HNWM 4WW0A 3JAMS 2LBCA 3PXGA 1YSYA 1VEJA 5KPTA 1V34A 2O01F 5H37D 4LFCM 1NHWC 3PVSA 1TH3A 2Z4SA 1XMQM 2WSEF 3I4VA 4NSRA 1IXRC 3I51A 2MJ5B 5BR8M 1IQPA 2R62A 2HHHM 4DV7M 4LZZA 3D8BA 4A3VB 2B3TA 3VK7A 3GPYA 2DXIA 2CUZA 2JY8A 3K1JA 4L8RC 2JZ1A 5EJCA 4M0WA 2DZNB 3L29A 3C3EA 5KQ8A 3SC3A 4X65M 4I4LA 1JR3A 2K0BX 2LHGA 2DENA 3B89A 3B7ZA 4I81A 4PDGA 3U6CA 1GLNA 4KO8A 1NY6A 1K3WA 3FUXA 3TWMA 1NHGC 1XXHE 1Q02A 4G6ZA 5EP1A 2D7HA 3Q8GA 2F5NA 2DAKA 2BWBA 4MGKE 1ORYB 3SHFA 1IY2A 1P3QQ 2D7EA 3VLFB 1TDZA 2HCBA 1SG9A 2DVWB 2KXEA 3HKPA 3EIEA 4DR3M 1E94E 4NL4H 1IBKM 4G4OA 3HHXA 1A5TA 3KSXA 4PDIA 2KNAA 1Z5BA 4P17A 3U6LA 2L09A 3HU1A 3TL4X 5FLXS 2DAGA 3KOXE 4G4NA 4B3RM 1IN8A 1E9SA 2I7PA 3D8LA 4LF5M 4LJAA 4NSOB 4Q7JA 5FTJA 3SARA 4GHAA 3A98B 4FD2A 2AHMA 1R2ZA 2EJSA 2ZAOA 3DFZA 1R7RA 2DAMA 2KZUA 4QHSA 3FRIA 2RRUA 2CE7A 4DR5M 4DV2M 2QENA 3K9PA 3CTWB 3PNYA 3TWKA 1GO5A 1TF0B 4LRSA 4IBFA 4NXNM 1D0KA 1DGBA 3BOSA 2C99A 1L2DA 2VIIA 3GQ3A 3UJNA 4DBGB 2R44A 2UXBM 3UK6A 1L8QA 5FSWA 4K0KM 3JR4A 1NJGA 1PGYA 2G3QA 3V76A 2R46A 2JA2A 5FTMA 2ZBKB 1JR3D 4LJ6A 1OJLA 2R4EA 2QBYA 2O25A 2QBYB 3AV0A 2JNHA 2XGNA 3FD9A 1QVRA 4LY6A 4WP2A 5KQDA 2F5OA 5IT9S 3R9XB 4LJ9A 1K3XA 3VKGA 3KOZE 3U60B 2DI0A 2Z4RA 1PJQA 2C98A 3DA1A 5GKNA 1OIZA 5KO3A 2L6OA 2Y0QA 5ITYA 3M0EA 1HQCA 1PJJA 1WGNA 2L7IA 3H4MA 4L4UA 3VK8A 4B3MM 4LF4M 2DWMA 2XZFA 2OO9A 4JI5M 4MB7A 4LGYA 5IWAM 4GH9A 2OOAA 3NBXX 2CRUA 1EFUB 1IN5A 2GQFA 5IZ7D 1XHBA 1PM5A 2BJVA 2Y0TA 2XH9A 4LGMA 1QAQA 4RF1A 4DR4M 2DHYA 2KNVA 1ZMWA 4FCTA 4LRTA 2JUJA 4MH0E 4AZFA 3VKHA 4DV0M 2BJWA 1QUTA 3C3DA 3KP1E 4GC9A 4FW9A 3T1HM 1XB2B 4S12A 1OFIA 3HHWA 3KS4A 1I94M 1QUSA 3E46A 3KS8A 1XC8A 4GC5A 1NV9A 4WURA 1SXJE 5EXPA 3GQ5A 1DGGA 2F5QA 3LQQA 5EXTA 1X37A 4NRWA 2L4EA 1DO0A 4GKJM 3MHVC 2KA6B 4LCBA 2FH0A 1IBMM 3FRHA 1OIPA 2CV1A 2C96A 4G4QA 1DV0A 3GLGA 2ZANA 5ITTA 1MX0A 2P5TA 3SAWA 2ZTDA 2X49A 2XLJA 3E9SA 2CEAA 2R6FA 4MGHA 3W0LB 3RGPA 4F1IA 3BBZA 1S3SA 1N33M 3A45A 3HGIA 2XFSA 2UUAM 3GP1A 3GRRA 3AL0C 4HEOA 4AI6A 1Z6TA 4DV5M 1R5LA 2G5GX 2KW0A 2J7NA 4I8OA 4Y28F 2QHOB 3DOAA 4FVMA 1YLAA 4G4RA 3ILKA 4IJEA 4JI1M 4LF9M 1QAOA 2JY7A 2F5PA 1NSFA 4PD2A 5JI2E 4NXMM 1Z59A 1OFHA 4Z6YA 2LXEA 4MGIE 4JI0M 3B9PA 1G59A 5C18A 2F4VM 5ITRA 1CUKA 3KDSE 4NRVA 1WHCA 1SXJD 3FKEA 1IXZA 4X62M 3U60A 3DZDA 2APLA 1V92A 1G8PA 4DR6M 5EQTA 4FCWA 3FYCA 3U5ZB 3U5ZA 2VDBB 2FE8A 3IHPA 4KODA 4IJFA 2LVAA 3WHLA 4D82A 4PT5A 4JYAM 2GNOA 5A2QS 2X4AA 3FTEA 1YUBA 1T3TA 2HAKA 1OQYA 5LMNM 3NBIA 1L2CA 4GHLA 4CHTB 3C9PA 1MJGM 4DV6M 1NNJA 4EIWA 2BNKA 4R3DA 4LJ8A 4B7FA 2LH0A 4ZPXA 1OKSA 1ZAEA 4P16A 1IXSA 5EXXA 4GITA 2UXDM 2QZ4A 1T6OA 3LMMA 3LVWA 5KPZA 1N78A 4L16A 3U6QA 2LVOC 2R4JA 2VF8A 4IIWA 3U61A 4RNAA 5ITXA 3U6OA 1J5EM 2L7HA 1JB0F 2Y20A 1PJSA 2YQZA 4AKHA 1MU5A 4MGYE 1TH4A 1Z5CA 1TR8A 4L6V6 4B7GA 2Y21A 3E4RA 2ZTCA 3A46A 2E5LM 2OQ4A 2JP7A 4GMQA 4DV1M 2CV2A 2LNHC 1FNNA 2R45A 3FUTA 1VG5A 3KXEC 1TTEA 2LVNC 1C7YA 2A5YB 2KRUA 4JV5M 2K9DA 3F92A 1QZMA 1UM8A 2H1RA 3CF0A 1QQWA 1KSFX 2M60A 2J7OA 1WXQA 3CGWA 4JXJA 4DV3M 3EIHA 1IBLM 4LJ5A 4DR2M 1L1ZA 1ZQ9A 3L2AA 4HLQA 5ITUA 4W5WA 3GQ4A 3HHYA 2DWLA 4LZJA 4D81A 2EUCA 4LFBM 4B3SM 4X66M 1XXHB 3ZQJA 1N32M 1HQYE 1QYRA 4AW4A 3T38A 2WSCF 4L78A 2W82A 4AG5A 1XNQM 2KZSA 1HT1E 1HT2E 5IREB 2ZM6M 3T1YM 3AKZA 2J5YA 2LTUA 3J7AS 3IG8A 3NWLA 2XEPA 4AG6A 2CHQA 2LWXA 4GRIA 3RGSA 2DZLA 3GLFB 2FS1A 1QZEA 1GVNA 2VQFM 4QHTA 4BB9A 4G3OA 1PJIA 1DGFA 1W5TA 4R7GA 3UMMA 1IFYA 3HZJA 1Q39A 3B7QA 5F3WA 2WZJA 2ZAMA 2QCUA 4LJ7A 2RKOA 3K9OA 3KOWE 4KT0F 3SYLA 3UZUA 1NO1A 3A42A 3LCUA 4LFAM 3T6PA 2XZUA 1Q3BA 4X64M 3I4YA 5EP3A 3WHKA 3AJIB 1AIPC 2N35A 1VQ1A 1RU3A 2O5RA 5DFLA 3TWLA 4LF8M 1F4IA 1TH2A 3HY5A 4LG2A 2DZOB 1W5SA 4BLCA 3U6MA 3UGJA 2VF7A 4OVZA 2JY6B 2Z7JA 2OOBA 2V1CA
chains in the Genus database with same CATH topology
3U6PA 2C9CA 3RE8A 2CHGA 1IN7A 4AKGA 3GRYA 4B3TM 3GPUA 1J7KA 3FTFA 2OPFA 3L27A 4OW0A 1VDDA 4DV4M 1NY5A 3JR5A 3TQSA 3GLHB 2I7NA 5FTNA 1IY0A 3K8ZA 3J80S 2UU9M 3TPZA 1IXSB 4QOZC 1R2YA 4DR1M 2CHVA 3KVWA 3KSJA 4CGYB 2M5ZA 1DO2A 4IBCA 2DWNA 3LQRA 3KW6A 3J81S 5FTLA 3M7GA 1E32A 1PJIA 1L2CA 1DGHA 3GO8A 3HJ8A 4II7A 4FCVA 2UXCM 4L15A 3J7BA 4OX9M 3HWSA 1C1KA 3SYKA 5EXSA 2HL7A 1IM2A 4TUWA 3GPPA 5JI3E 3ZH9B 4XBOA 3SBJA 3MK6A 4PCZA 5E26A 2YR0A 4NOOB 4Z8XA 5ITXE 3L28A 1Z5AA 3W0FA 3GLFA 2X8AA 2QP9X 3SFZA 4LF7M 2XF3A 4GIPA 4AKIA 3TE6A 8CATA 3FTCA 3PNVA 1NNUC 5EP4A 3T15A 3SHGB 4DUYM 3GLGB 1GKIA 2FNAA 2V1UA 2CV0A 2CFOA 2EA0A 3HHZA 2QPAA 4QNMA 4B7HA 2YFQA 3QAUA 1GL6A 3SASA 2ERCA 4B08A 3J27B 5DNYA 1E9RA 3AOEA 1SXJA 4FWHA 3HJSA 1N77A 2XFTA 3CF2A 1K82A 3SATA 1TGUA 1G4AE 1IN4A 4D80A 2XSZA 2NQ8C 5FTKA 5BPVA 4IBKA 3IG5A 1NJFA 3Q8XA 2G8LA 5EP2A 1N75A 2EO2A 3ZCBB 3VFDA 5DYIA 4AQYM 1QANA 2K47A 4KHPM 3K92A 2DHRA 3GLHA 2C9OA 3J2PB 1JQJC 3FTDA 3HU2A 5KPRA 1XXHA 1YE9A 3GPXA 2DWZB 3AOGA 1QAMA 3GLIB 4YHHM 4LJ4A 4MM3B 3AOEC 1NVMA 3HJQA 5LMUM 7CATA 1KFVA 3OTOM 4M9XA 3PFIA 2XSZD 4IBBA 4DR7M 1N36M 4HL4A 4IBJA 4GKKM 4DUZM 3M6AA 1SXJC 1N34M 2FOIC 4JI8M 3L25A 1IY1A 2HKJA 1DGHB 2R65A 5DYGA 3K2LA 3LVVA 4IBIA 4REZA 4FWGA 2UUCM 4BBAA 4M0DA 3KFUG 2KRKA 3FUUA 1H6UA 3AFHA 1XNRM 2UUBM 1J09A 3FUVA 4ITQA 4OU7A 3C58A 4LF6M 3SMPA 2KEBA 4JI3M 3R8FA 1L2BA 3VDPA 3QWLA 3KP0E 1G3IA 1IN6A 3MJ5A 2V6ZM 4MGZE 1I4WA 3KOYE 2RGOA 4I5SA 3FYDA 4CISA 3CF6E 2F5SA 3U6DA 1L1TA 2RGHA 3THGA 4FWDA 4QOSA 1FJGM 3VDUA 4OVZB 3U6EA 4JI4M 5C1BA 4JI6M 2Z3XA 4JI2M 1HNXM 2R18A 1XWIA 3HU3A 1HR0M 3RFWA 4QNRA 3L26A 2C5RA 1XMOM 4IBDA 3FUWA 4IBEA 1R6BX 4KLNA 1D2NA 2FFJA 1KYIA 1EE8A 1LV7A 3U6SA 3GLIA 3ZC7B 3SAVA 4M9SA 3SMSA 5ITQA 1Q3CA 2D7GA 2VQEM 1GL7A 4IBGA 5E6JA 4JI7M 1G41A 1SXJB 3SAUA 2Q2EB 1TDHA 3U61B 4JN6A 4M9ZA 1HNZM 4XGIA 4RF0A 4YY3M 3GRVA 2YNMD 1HNWM 4WW0A 3JAMS 3PXGA 1YSYA 5KPTA 5H37D 4LFCM 1NHWC 3PVSA 1TH3A 2Z4SA 1XMQM 4NSRA 3I4VA 1IXRC 3I51A 5BR8M 1IQPA 2R62A 2HHHM 4DV7M 4LZZA 3D8BA 4A3VB 3VK7A 3GPYA 2DXIA 2CUZA 3K1JA 4L8RC 5EJCA 4M0WA 2DZNB 3L29A 5KQ8A 3SC3A 4X65M 4I4LA 1JR3A 4I81A 3U6CA 4PDGA 1GLNA 4KO8A 1NY6A 1K3WA 3FUXA 3TWMA 1NHGC 4G6ZA 5EP1A 2D7HA 2F5NA 4MGKE 1ORYB 3SHFA 1IY2A 3VLFB 2D7EA 1TDZA 2HCBA 2DVWB 2KXEA 3HKPA 3EIEA 4DR3M 1E94E 4NL4H 1IBKM 4G4OA 3HHXA 3KSXA 4PDIA 1Z5BA 3U6LA 2L09A 3HU1A 3TL4X 5FLXS 4G4NA 3KOXE 4B3RM 1IN8A 1E9SA 2I7PA 3D8LA 4LF5M 4LJAA 4NSOB 5FTJA 3SARA 4GHAA 3A98B 4FD2A 2AHMA 1R2ZA 2ZAOA 3DFZA 4QHSA 1R7RA 2KZUA 4DR5M 2CE7A 4DV2M 2QENA 3CTWB 3PNYA 3TWKA 4LRSA 4IBFA 4NXNM 3BOSA 1DGBA 2C99A 1L2DA 2VIIA 3GQ3A 3UJNA 2UXBM 3UK6A 1L8QA 5FSWA 4K0KM 3JR4A 1NJGA 2R46A 2JA2A 5FTMA 2ZBKB 1JR3D 4LJ6A 1OJLA 2R4EA 2QBYA 2QBYB 3AV0A 2XGNA 3FD9A 4LY6A 1QVRA 5KQDA 2F5OA 5IT9S 3R9XB 4LJ9A 1K3XA 3VKGA 3KOZE 3U60B 2Z4RA 2C98A 3DA1A 5GKNA 5KO3A 2L6OA 2Y0QA 5ITYA 3M0EA 1HQCA 1PJJA 4B3MM 2L7IA 3H4MA 4L4UA 3VK8A 4LF4M 2DWMA 2XZFA 4JI5M 4MB7A 4LGYA 5IWAM 4GH9A 1IN5A 5IZ7D 1XHBA 1PM5A 2BJVA 2Y0TA 2XH9A 4LGMA 1QAQA 4RF1A 4DR4M 4FCTA 4AZFA 4LRTA 3VKHA 4MH0E 4DV0M 2BJWA 3KP1E 4GC9A 3T1HM 4FW9A 4S12A 1OFIA 3HHWA 3KS4A 1I94M 3KS8A 1XC8A 4GC5A 4WURA 1SXJE 5EXPA 3GQ5A 1DGGA 2F5QA 3LQQA 5EXTA 1X37A 4NRWA 1DO0A 4GKJM 3MHVC 2KA6B 4LCBA 1IBMM 2CV1A 2C96A 4G4QA 3GLGA 2ZANA 5ITTA 1MX0A 2P5TA 3SAWA 2X49A 2XLJA 3E9SA 2CEAA 3W0LB 4MGHA 3RGPA 1S3SA 1N33M 3A45A 3HGIA 2XFSA 2UUAM 3GP1A 3GRRA 3AL0C 4AI6A 1Z6TA 4DV5M 2G5GX 2KW0A 2J7NA 4I8OA 3DOAA 4FVMA 4JI1M 4G4RA 3ILKA 4IJEA 4LF9M 1QAOA 2F5PA 1NSFA 4PD2A 5JI2E 4NXMM 1Z59A 1OFHA 4Z6YA 2LXEA 4MGIE 4JI0M 3B9PA 1G59A 5C18A 2F4VM 5ITRA 3KDSE 4NRVA 1SXJD 3FKEA 1IXZA 4X62M 3U60A 3DZDA 1G8PA 4DR6M 5EQTA 4FCWA 3FYCA 3U5ZB 3U5ZA 2FE8A 4KODA 4IJFA 3WHLA 4D82A 4PT5A 4JYAM 5A2QS 2X4AA 3FTEA 1YUBA 1T3TA 5LMNM 3NBIA 4GHLA 4CHTB 4DV6M 1NNJA 4EIWA 2BNKA 4R3DA 4LJ8A 4B7FA 2LH0A 4ZPXA 1ZAEA 4P16A 5EXXA 4GITA 2UXDM 2QZ4A 3LMMA 3LVWA 5KPZA 1N78A 4L16A 3U6QA 2R4JA 4IIWA 3U61A 4RNAA 5ITXA 3U6OA 1J5EM 2L7HA 4AKHA 2Y20A 2YQZA 1MU5A 4MGYE 1TH4A 1Z5CA 4B7GA 2Y21A 3E4RA 3A46A 2E5LM 2OQ4A 4GMQA 4DV1M 2CV2A 2LNHC 1FNNA 2R45A 3FUTA 3KXEC 2A5YB 2KRUA 4JV5M 1QZMA 1UM8A 2H1RA 3CF0A 1QQWA 1KSFX 2M60A 2J7OA 1WXQA 4JXJA 4DV3M 3EIHA 1IBLM 4LJ5A 4DR2M 2Z7JA 1ZQ9A 3L2AA 4HLQA 5ITUA 4W5WA 3GQ4A 3HHYA 1L1ZA 4LZJA 2DWLA 4D81A 2EUCA 4LFBM 4B3SM 4X66M 1XXHB 1N32M 1HQYE 1QYRA 4AW4A 3T38A 4L78A 2W82A 4AG5A 1XNQM 2KZSA 1HT1E 1HT2E 5IREB 2ZM6M 3T1YM 3AKZA 3J7AS 3IG8A 3NWLA 2XEPA 4AG6A 2CHQA 2LWXA 4GRIA 3RGSA 3GLFB 1GVNA 2VQFM 4QHTA 4BB9A 1DGFA 1W5TA 4R7GA 3UMMA 1Q39A 5F3WA 2ZAMA 2QCUA 4LJ7A 2RKOA 3KOWE 3SYLA 3UZUA 3A42A 4LFAM 2XZUA 1Q3BA 4X64M 3I4YA 5EP3A 3WHKA 3AJIB 2O5RA 3TWLA 4LF8M 1TH2A 4LG2A 2DZOB 1W5SA 4BLCA 3U6MA 3UGJA 4OVZA 3GRUA 2V1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO M;  4NXM M;  4PD2 A;  3U6P A;  1Z59 A;  2F5N A;  1N36 M;  4DR7 M;  4GKK M;  4DUZ M;  4JI0 M;  2F4V M;  5ITR A;  1TDZ A;  4B3T M;  1N34 M;  4NRV A;  3GPU A;  4JI8 M;  4DR3 M;  1IBK M;  2HKJ A;  4G4O A;  2OPF A;  4PDI A;  4DV4 M;  1Z5B A;  3U6L A;  3JR5 A;  4DR6 M;  5FLX S;  2UUC M;  4G4N A;  4B3R M;  4LF5 M;  3SAR A;  3J80 S;  4JYA M;  2UU9 M;  5A2Q S;  1R2Z A;  4DR5 M;  4DV2 M;  1R2Y A;  5LMN M;  4DR1 M;  2UUB M;  1XNR M;  3TWK A;  4ITQ A;  4NXN M;  4DV6 M;  1NNJ A;  3C58 A;  4LF6 M;  3J81 S;  1L2D A;  1L2C A;  1PJI A;  4JI3 M;  3GQ3 A;  3GO8 A;  1L2B A;  2UXB M;  2UXD M;  2UXC M;  4K0K M;  3JR4 A;  4OX9 M;  3U6Q A;  2ZBK B;  4CIS A;  2F5S A;  3GPP A;  3U6D A;  1L1T A;  5ITX A;  3U6O A;  1J5E M;  2F5O A;  1MU5 A;  5IT9 S;  3SBJ A;  1FJG M;  4PCZ A;  1K3X A;  3U6E A;  1Z5C A;  4JI4 M;  4JI6 M;  5ITX E;  1Z5A A;  3W0F A;  3A46 A;  2E5L M;  5ITY A;  2OQ4 A;  4DV1 M;  1PJJ A;  1HNX M;  4B3M M;  3VK8 A;  4JI2 M;  1HR0 M;  4LF4 M;  4JV5 M;  2XZF A;  4LF7 M;  4JI5 M;  1XMO M;  4MB7 A;  5IWA M;  1EE8 A;  4DV3 M;  1PM5 A;  1IBL M;  4DR2 M;  1L1Z A;  4DR4 M;  5ITU A;  3U6S A;  3GQ4 A;  4DUY M;  3SAV A;  4LFB M;  4DV0 M;  4B3S M;  4X66 M;  3T1H M;  5ITQ A;  1Q3C A;  2VQE M;  1N32 M;  4LF9 M;  1XNQ M;  4JI7 M;  2EA0 A;  3SAU A;  2Q2E B;  1TDH A;  2ZM6 M;  3T1Y M;  1I94 M;  1HNZ M;  3J7A S;  1XC8 A;  3SAS A;  4YY3 M;  3GQ5 A;  1HNW M;  2F5Q A;  3JAM S;  2VQF M;  4NRW A;  4GKJ M;  1K82 A;  1IBM M;  4LFC M;  3SAT A;  1Q39 A;  1XMQ M;  4G4Q A;  5ITT A;  5BR8 M;  1MX0 A;  2HHH M;  3SAW A;  4DV7 M;  3VK7 A;  3GPY A;  3A42 A;  4LFA M;  2XZU A;  1Q3B A;  4X65 M;  4AQY M;  4KHP M;  4X64 M;  1N33 M;  3A45 A;  3U6C A;  2UUA M;  3GP1 A;  4PDG A;  3GPX A;  3TWL A;  4DV5 M;  1K3W A;  4YHH M;  4LF8 M;  5LMU M;  3TWM A;  3U6M A;  3DOA A;  4JI1 M;  4G4R A;  1KFV A;  4X62 M;  2F5P A; 
#chains in the Genus database with same CATH topology
 3U6P A;  1QDR A;  2C9C A;  3RE8 A;  2CHG A;  3GLF E;  3I04 M;  1IN7 A;  4AKG A;  3GRY A;  4B3T M;  4UN2 B;  3GPU A;  1J7K A;  3FTF A;  2MGW A;  2DAI A;  2JWS A;  3I01 M;  1LTM A;  2OPF A;  3L27 A;  4OW0 A;  1VDD A;  4DV4 M;  1NY5 A;  3JR5 A;  3TQS A;  1G71 A;  3GLH B;  3B7N A;  2I7N A;  5FTN A;  1IY0 A;  3K8Z A;  1D0L A;  3J80 S;  1D0M A;  2UU9 M;  3TPZ A;  1IXS B;  4QOZ C;  1PJT A;  1R2Y A;  3FE3 A;  4DR1 M;  2CHV A;  4ANR A;  1ZMU A;  3KVW A;  3KSJ A;  4CGY B;  4F2L A;  2M5Z A;  1DO2 A;  4IBC A;  2DWN A;  1R4G A;  3E21 A;  3KW6 A;  3LQR A;  1WGL A;  2EKF A;  1E32 A;  1VEK A;  3HX3 A;  1DGH A;  3M7G A;  5FTL A;  2BWE A;  4CIZ A;  3GO8 A;  3HJ8 A;  4II7 A;  4FCV A;  1NV8 A;  2UXC M;  4L15 A;  3J7B A;  4OX9 M;  3HWS A;  1C1K A;  3SYK A;  1PRB A;  2HL7 A;  1IM2 A;  5EXS A;  4TUW A;  3GPP A;  5JI3 E;  3ZH9 B;  4XBO A;  3SBJ A;  3MK6 A;  4PCZ A;  5E26 A;  2YR0 A;  3GLH E;  4NOO B;  4Z8X A;  2CP8 A;  2JXN A;  3L28 A;  1Z5A A;  5ITX E;  1GAB A;  3W0F A;  3GLF A;  2HWJ A;  2X8A A;  3W67 A;  2CWB A;  2QP9 X;  3SFZ A;  4LF7 M;  2XF3 A;  4GIP A;  4AKI A;  1T43 A;  2KDL A;  3TE6 A;  8CAT A;  4R71 A;  2L4F A;  2MR9 A;  3FTC A;  3PNV A;  1NNU C;  5EP4 A;  3T15 A;  3SHG B;  1MN3 A;  3LW5 F;  4DUY M;  3GLG B;  2QNJ A;  1GKI A;  1GJT A;  2FNA A;  2V1U A;  2KHH A;  2CV0 A;  3GLI E;  2CFO A;  2EA0 A;  3HHZ A;  2QPA A;  4QNM A;  2MH8 A;  4B7H A;  2YFQ A;  3QAU A;  1GL6 A;  3SAS A;  2ERC A;  2QSF X;  4B08 A;  1GJS A;  3J27 B;  1VDL A;  5DNY A;  2DNA A;  1E9R A;  3AOE A;  1BVS A;  1SXJ A;  4FWH A;  3HJS A;  1N77 A;  2XFT A;  3CF2 A;  1K82 A;  3SAT A;  2JZ0 A;  1TGU A;  1G4A E;  1IN4 A;  4D80 A;  1OAO C;  2XSZ A;  2NQ8 C;  5FTK A;  1QDT A;  4IBK A;  5BPV A;  3IG5 A;  1NJF A;  3Q8X A;  2G8L A;  4GEW A;  5EP2 A;  1N75 A;  2EO2 A;  1WR1 B;  3ZCB B;  2K6B A;  3VFD A;  5DYI A;  4AQY M;  1QAN A;  2K47 A;  3QYE A;  4KHP M;  2DHR A;  3GLH A;  2C9O A;  3J2P B;  1JQJ C;  3FTD A;  3IEC A;  3HU2 A;  3K92 A;  5KPR A;  1XXH A;  1HJP A;  1YE9 A;  3GPX A;  2DWZ B;  3AOG A;  1QAM A;  3GLI B;  4YHH M;  5L8R F;  4LJ4 A;  4MM3 B;  3AOE C;  1NVM A;  3HJQ A;  5LMU M;  7CAT A;  2QQ8 A;  1KFV A;  3OTO M;  4M9X A;  3PFI A;  2XSZ D;  4IBB A;  4DR7 M;  1N36 M;  4HL4 A;  4IBJ A;  4GKK M;  4DUZ M;  3M6A A;  1SXJ C;  2MRO B;  1VEG A;  1N34 M;  2FOI C;  2R0I A;  4JI8 M;  3L25 A;  1IY1 A;  2HKJ A;  1DGH B;  2KNZ A;  2R65 A;  5DYG A;  3K2L A;  4NC6 A;  3LVV A;  4IBI A;  4REZ A;  4FWG A;  2UUC M;  4BBA A;  4M0D A;  3KFU G;  2KRK A;  3FUU A;  1H6U A;  3J81 S;  2DAE A;  3AFH A;  1XNR M;  2UUB M;  1J09 A;  3B74 A;  3FUV A;  4RKU F;  4ITQ A;  4OU7 A;  3C58 A;  4LF6 M;  1AUA A;  3SMP A;  2KEB A;  4JI3 M;  3R8F A;  2Z8Y M;  1L2B A;  3H4J A;  3VDP A;  3QWL A;  3KP0 E;  3LCV B;  1G3I A;  1IN6 A;  3BXW A;  3MJ5 A;  2V6Z M;  4MGZ E;  1I4W A;  3KOY E;  2RGO A;  4I5S A;  3FYD A;  3GLG E;  1V33 A;  4CIS A;  3CF6 E;  2F5S A;  3U6D A;  1L1T A;  1UFZ A;  2DKL A;  2RGH A;  3THG A;  4FWD A;  1OTR A;  4QOS A;  3MMP A;  3VDU A;  1FJG M;  1ZV1 A;  4OVZ B;  3U6E A;  2H5X A;  4XK8 F;  5C1B A;  4JI4 M;  4JI6 M;  1JR3 E;  3GRU A;  2Z3X A;  4JI2 M;  1HNX M;  2LHC A;  2R18 A;  1XWI A;  3HU3 A;  1HR0 M;  1Y8G A;  4QNR A;  3RFW A;  2LVQ D;  2L2D A;  3L26 A;  3W68 A;  1ZMV A;  2WSF F;  4IBD A;  2C5R A;  1XMO M;  3FUW A;  4IBE A;  1R6B X;  4KLN A;  1D2N A;  2FFJ A;  1KYI A;  1WJ7 A;  1EE8 A;  3QYB A;  1LV7 A;  2EKK A;  3U6S A;  3GLI A;  3ZC7 B;  3SAV A;  4M9S A;  1OAI A;  3SMS A;  5ITQ A;  1Q3C A;  2D7G A;  2VQE M;  1GL7 A;  2JY5 A;  4IBG A;  5E6J A;  4JI7 M;  1G41 A;  1SXJ B;  3SAU A;  2Q2E B;  1TDH A;  3U61 B;  1EIJ A;  4JN6 A;  4M9Z A;  1HNZ M;  4CJ6 A;  1WIV A;  4XGI A;  4RF0 A;  2LVP C;  4YY3 M;  3GRV A;  2YNM D;  1HNW M;  4WW0 A;  3JAM S;  2LBC A;  3PXG A;  1YSY A;  1VEJ A;  5KPT A;  1V34 A;  2O01 F;  5H37 D;  4LFC M;  1NHW C;  3PVS A;  1TH3 A;  2Z4S A;  1XMQ M;  2WSE F;  3I4V A;  4NSR A;  1IXR C;  3I51 A;  2MJ5 B;  5BR8 M;  1IQP A;  2R62 A;  2HHH M;  4DV7 M;  4LZZ A;  3D8B A;  4A3V B;  2B3T A;  3VK7 A;  3GPY A;  2DXI A;  2CUZ A;  2JY8 A;  3K1J A;  4L8R C;  2JZ1 A;  5EJC A;  4M0W A;  2DZN B;  3L29 A;  3C3E A;  5KQ8 A;  3SC3 A;  4X65 M;  4I4L A;  1JR3 A;  2K0B X;  2LHG A;  2DEN A;  3B89 A;  3B7Z A;  4I81 A;  4PDG A;  3U6C A;  1GLN A;  4KO8 A;  1NY6 A;  1K3W A;  3FUX A;  3TWM A;  1NHG C;  1XXH E;  1Q02 A;  4G6Z A;  5EP1 A;  2D7H A;  3Q8G A;  2F5N A;  2DAK A;  2BWB A;  4MGK E;  1ORY B;  3SHF A;  1IY2 A;  1P3Q Q;  2D7E A;  3VLF B;  1TDZ A;  2HCB A;  1SG9 A;  2DVW B;  2KXE A;  3HKP A;  3EIE A;  4DR3 M;  1E94 E;  4NL4 H;  1IBK M;  4G4O A;  3HHX A;  1A5T A;  3KSX A;  4PDI A;  2KNA A;  1Z5B A;  4P17 A;  3U6L A;  2L09 A;  3HU1 A;  3TL4 X;  5FLX S;  2DAG A;  3KOX E;  4G4N A;  4B3R M;  1IN8 A;  1E9S A;  2I7P A;  3D8L A;  4LF5 M;  4LJA A;  4NSO B;  4Q7J A;  5FTJ A;  3SAR A;  4GHA A;  3A98 B;  4FD2 A;  2AHM A;  1R2Z A;  2EJS A;  2ZAO A;  3DFZ A;  1R7R A;  2DAM A;  2KZU A;  4QHS A;  3FRI A;  2RRU A;  2CE7 A;  4DR5 M;  4DV2 M;  2QEN A;  3K9P A;  3CTW B;  3PNY A;  3TWK A;  1GO5 A;  1TF0 B;  4LRS A;  4IBF A;  4NXN M;  1D0K A;  1DGB A;  3BOS A;  2C99 A;  1L2D A;  2VII A;  3GQ3 A;  3UJN A;  4DBG B;  2R44 A;  2UXB M;  3UK6 A;  1L8Q A;  5FSW A;  4K0K M;  3JR4 A;  1NJG A;  1PGY A;  2G3Q A;  3V76 A;  2R46 A;  2JA2 A;  5FTM A;  2ZBK B;  1JR3 D;  4LJ6 A;  1OJL A;  2R4E A;  2QBY A;  2O25 A;  2QBY B;  3AV0 A;  2JNH A;  2XGN A;  3FD9 A;  1QVR A;  4LY6 A;  4WP2 A;  5KQD A;  2F5O A;  5IT9 S;  3R9X B;  4LJ9 A;  1K3X A;  3VKG A;  3KOZ E;  3U60 B;  2DI0 A;  2Z4R A;  1PJQ A;  2C98 A;  3DA1 A;  5GKN A;  1OIZ A;  5KO3 A;  2L6O A;  2Y0Q A;  5ITY A;  3M0E A;  1HQC A;  1PJJ A;  1WGN A;  2L7I A;  3H4M A;  4L4U A;  3VK8 A;  4B3M M;  4LF4 M;  2DWM A;  2XZF A;  2OO9 A;  4JI5 M;  4MB7 A;  4LGY A;  5IWA M;  4GH9 A;  2OOA A;  3NBX X;  2CRU A;  1EFU B;  1IN5 A;  2GQF A;  5IZ7 D;  1XHB A;  1PM5 A;  2BJV A;  2Y0T A;  2XH9 A;  4LGM A;  1QAQ A;  4RF1 A;  4DR4 M;  2DHY A;  2KNV A;  1ZMW A;  4FCT A;  4LRT A;  2JUJ A;  4MH0 E;  4AZF A;  3VKH A;  4DV0 M;  2BJW A;  1QUT A;  3C3D A;  3KP1 E;  4GC9 A;  4FW9 A;  3T1H M;  1XB2 B;  4S12 A;  1OFI A;  3HHW A;  3KS4 A;  1I94 M;  1QUS A;  3E46 A;  3KS8 A;  1XC8 A;  4GC5 A;  1NV9 A;  4WUR A;  1SXJ E;  5EXP A;  3GQ5 A;  1DGG A;  2F5Q A;  3LQQ A;  5EXT A;  1X37 A;  4NRW A;  2L4E A;  1DO0 A;  4GKJ M;  3MHV C;  2KA6 B;  4LCB A;  2FH0 A;  1IBM M;  3FRH A;  1OIP A;  2CV1 A;  2C96 A;  4G4Q A;  1DV0 A;  3GLG A;  2ZAN A;  5ITT A;  1MX0 A;  2P5T A;  3SAW A;  2ZTD A;  2X49 A;  2XLJ A;  3E9S A;  2CEA A;  2R6F A;  4MGH A;  3W0L B;  3RGP A;  4F1I A;  3BBZ A;  1S3S A;  1N33 M;  3A45 A;  3HGI A;  2XFS A;  2UUA M;  3GP1 A;  3GRR A;  3AL0 C;  4HEO A;  4AI6 A;  1Z6T A;  4DV5 M;  1R5L A;  2G5G X;  2KW0 A;  2J7N A;  4I8O A;  4Y28 F;  2QHO B;  3DOA A;  4FVM A;  1YLA A;  4G4R A;  3ILK A;  4IJE A;  4JI1 M;  4LF9 M;  1QAO A;  2JY7 A;  2F5P A;  1NSF A;  4PD2 A;  5JI2 E;  4NXM M;  1Z59 A;  1OFH A;  4Z6Y A;  2LXE A;  4MGI E;  4JI0 M;  3B9P A;  1G59 A;  5C18 A;  2F4V M;  5ITR A;  1CUK A;  3KDS E;  4NRV A;  1WHC A;  1SXJ D;  3FKE A;  1IXZ A;  4X62 M;  3U60 A;  3DZD A;  2APL A;  1V92 A;  1G8P A;  4DR6 M;  5EQT A;  4FCW A;  3FYC A;  3U5Z B;  3U5Z A;  2VDB B;  2FE8 A;  3IHP A;  4KOD A;  4IJF A;  2LVA A;  3WHL A;  4D82 A;  4PT5 A;  4JYA M;  2GNO A;  5A2Q S;  2X4A A;  3FTE A;  1YUB A;  1T3T A;  2HAK A;  1OQY A;  5LMN M;  3NBI A;  1L2C A;  4GHL A;  4CHT B;  3C9P A;  1MJG M;  4DV6 M;  1NNJ A;  4EIW A;  2BNK A;  4R3D A;  4LJ8 A;  4B7F A;  2LH0 A;  4ZPX A;  1OKS A;  1ZAE A;  4P16 A;  1IXS A;  5EXX A;  4GIT A;  2UXD M;  2QZ4 A;  1T6O A;  3LMM A;  3LVW A;  5KPZ A;  1N78 A;  4L16 A;  3U6Q A;  2LVO C;  2R4J A;  2VF8 A;  4IIW A;  3U61 A;  4RNA A;  5ITX A;  3U6O A;  1J5E M;  2L7H A;  1JB0 F;  2Y20 A;  1PJS A;  2YQZ A;  4AKH A;  1MU5 A;  4MGY E;  1TH4 A;  1Z5C A;  1TR8 A;  4L6V 6;  4B7G A;  2Y21 A;  3E4R A;  2ZTC A;  3A46 A;  2E5L M;  2OQ4 A;  2JP7 A;  4GMQ A;  4DV1 M;  2CV2 A;  2LNH C;  1FNN A;  2R45 A;  3FUT A;  1VG5 A;  3KXE C;  1TTE A;  2LVN C;  1C7Y A;  2A5Y B;  2KRU A;  4JV5 M;  2K9D A;  3F92 A;  1QZM A;  1UM8 A;  2H1R A;  3CF0 A;  1QQW A;  1KSF X;  2M60 A;  2J7O A;  1WXQ A;  3CGW A;  4JXJ A;  4DV3 M;  3EIH A;  1IBL M;  4LJ5 A;  4DR2 M;  1L1Z A;  1ZQ9 A;  3L2A A;  4HLQ A;  5ITU A;  4W5W A;  3GQ4 A;  3HHY A;  2DWL A;  4LZJ A;  4D81 A;  2EUC A;  4LFB M;  4B3S M;  4X66 M;  1XXH B;  3ZQJ A;  1N32 M;  1HQY E;  1QYR A;  4AW4 A;  3T38 A;  2WSC F;  4L78 A;  2W82 A;  4AG5 A;  1XNQ M;  2KZS A;  1HT1 E;  1HT2 E;  5IRE B;  2ZM6 M;  3T1Y M;  3AKZ A;  2J5Y A;  2LTU A;  3J7A S;  3IG8 A;  3NWL A;  2XEP A;  4AG6 A;  2CHQ A;  2LWX A;  4GRI A;  3RGS A;  2DZL A;  3GLF B;  2FS1 A;  1QZE A;  1GVN A;  2VQF M;  4QHT A;  4BB9 A;  4G3O A;  1PJI A;  1DGF A;  1W5T A;  4R7G A;  3UMM A;  1IFY A;  3HZJ A;  1Q39 A;  3B7Q A;  5F3W A;  2WZJ A;  2ZAM A;  2QCU A;  4LJ7 A;  2RKO A;  3K9O A;  3KOW E;  4KT0 F;  3SYL A;  3UZU A;  1NO1 A;  3A42 A;  3LCU A;  4LFA M;  3T6P A;  2XZU A;  1Q3B A;  4X64 M;  3I4Y A;  5EP3 A;  3WHK A;  3AJI B;  1AIP C;  2N35 A;  1VQ1 A;  1RU3 A;  2O5R A;  5DFL A;  3TWL A;  4LF8 M;  1F4I A;  1TH2 A;  3HY5 A;  4LG2 A;  2DZO B;  1W5S A;  4BLC A;  3U6M A;  3UGJ A;  2VF7 A;  4OVZ A;  2JY6 B;  2Z7J A;  2OOB A;  2V1C A; 
#chains in the Genus database with same CATH homology
 3U6P A;  2C9C A;  3RE8 A;  2CHG A;  1IN7 A;  4AKG A;  3GRY A;  4B3T M;  3GPU A;  1J7K A;  3FTF A;  2OPF A;  3L27 A;  4OW0 A;  1VDD A;  4DV4 M;  1NY5 A;  3JR5 A;  3TQS A;  3GLH B;  2I7N A;  5FTN A;  1IY0 A;  3K8Z A;  3J80 S;  2UU9 M;  3TPZ A;  1IXS B;  4QOZ C;  1R2Y A;  4DR1 M;  2CHV A;  3KVW A;  3KSJ A;  4CGY B;  2M5Z A;  1DO2 A;  4IBC A;  2DWN A;  3LQR A;  3KW6 A;  3J81 S;  5FTL A;  3M7G A;  1E32 A;  1PJI A;  1L2C A;  1DGH A;  3GO8 A;  3HJ8 A;  4II7 A;  4FCV A;  2UXC M;  4L15 A;  3J7B A;  4OX9 M;  3HWS A;  1C1K A;  3SYK A;  5EXS A;  2HL7 A;  1IM2 A;  4TUW A;  3GPP A;  5JI3 E;  3ZH9 B;  4XBO A;  3SBJ A;  3MK6 A;  4PCZ A;  5E26 A;  2YR0 A;  4NOO B;  4Z8X A;  5ITX E;  3L28 A;  1Z5A A;  3W0F A;  3GLF A;  2X8A A;  2QP9 X;  3SFZ A;  4LF7 M;  2XF3 A;  4GIP A;  4AKI A;  3TE6 A;  8CAT A;  3FTC A;  3PNV A;  1NNU C;  5EP4 A;  3T15 A;  3SHG B;  4DUY M;  3GLG B;  1GKI A;  2FNA A;  2V1U A;  2CV0 A;  2CFO A;  2EA0 A;  3HHZ A;  2QPA A;  4QNM A;  4B7H A;  2YFQ A;  3QAU A;  1GL6 A;  3SAS A;  2ERC A;  4B08 A;  3J27 B;  5DNY A;  1E9R A;  3AOE A;  1SXJ A;  4FWH A;  3HJS A;  1N77 A;  2XFT A;  3CF2 A;  1K82 A;  3SAT A;  1TGU A;  1G4A E;  1IN4 A;  4D80 A;  2XSZ A;  2NQ8 C;  5FTK A;  5BPV A;  4IBK A;  3IG5 A;  1NJF A;  3Q8X A;  2G8L A;  5EP2 A;  1N75 A;  2EO2 A;  3ZCB B;  3VFD A;  5DYI A;  4AQY M;  1QAN A;  2K47 A;  4KHP M;  3K92 A;  2DHR A;  3GLH A;  2C9O A;  3J2P B;  1JQJ C;  3FTD A;  3HU2 A;  5KPR A;  1XXH A;  1YE9 A;  3GPX A;  2DWZ B;  3AOG A;  1QAM A;  3GLI B;  4YHH M;  4LJ4 A;  4MM3 B;  3AOE C;  1NVM A;  3HJQ A;  5LMU M;  7CAT A;  1KFV A;  3OTO M;  4M9X A;  3PFI A;  2XSZ D;  4IBB A;  4DR7 M;  1N36 M;  4HL4 A;  4IBJ A;  4GKK M;  4DUZ M;  3M6A A;  1SXJ C;  1N34 M;  2FOI C;  4JI8 M;  3L25 A;  1IY1 A;  2HKJ A;  1DGH B;  2R65 A;  5DYG A;  3K2L A;  3LVV A;  4IBI A;  4REZ A;  4FWG A;  2UUC M;  4BBA A;  4M0D A;  3KFU G;  2KRK A;  3FUU A;  1H6U A;  3AFH A;  1XNR M;  2UUB M;  1J09 A;  3FUV A;  4ITQ A;  4OU7 A;  3C58 A;  4LF6 M;  3SMP A;  2KEB A;  4JI3 M;  3R8F A;  1L2B A;  3VDP A;  3QWL A;  3KP0 E;  1G3I A;  1IN6 A;  3MJ5 A;  2V6Z M;  4MGZ E;  1I4W A;  3KOY E;  2RGO A;  4I5S A;  3FYD A;  4CIS A;  3CF6 E;  2F5S A;  3U6D A;  1L1T A;  2RGH A;  3THG A;  4FWD A;  4QOS A;  1FJG M;  3VDU A;  4OVZ B;  3U6E A;  4JI4 M;  5C1B A;  4JI6 M;  2Z3X A;  4JI2 M;  1HNX M;  2R18 A;  1XWI A;  3HU3 A;  1HR0 M;  3RFW A;  4QNR A;  3L26 A;  2C5R A;  1XMO M;  4IBD A;  3FUW A;  4IBE A;  1R6B X;  4KLN A;  1D2N A;  2FFJ A;  1KYI A;  1EE8 A;  1LV7 A;  3U6S A;  3GLI A;  3ZC7 B;  3SAV A;  4M9S A;  3SMS A;  5ITQ A;  1Q3C A;  2D7G A;  2VQE M;  1GL7 A;  4IBG A;  5E6J A;  4JI7 M;  1G41 A;  1SXJ B;  3SAU A;  2Q2E B;  1TDH A;  3U61 B;  4JN6 A;  4M9Z A;  1HNZ M;  4XGI A;  4RF0 A;  4YY3 M;  3GRV A;  2YNM D;  1HNW M;  4WW0 A;  3JAM S;  3PXG A;  1YSY A;  5KPT A;  5H37 D;  4LFC M;  1NHW C;  3PVS A;  1TH3 A;  2Z4S A;  1XMQ M;  4NSR A;  3I4V A;  1IXR C;  3I51 A;  5BR8 M;  1IQP A;  2R62 A;  2HHH M;  4DV7 M;  4LZZ A;  3D8B A;  4A3V B;  3VK7 A;  3GPY A;  2DXI A;  2CUZ A;  3K1J A;  4L8R C;  5EJC A;  4M0W A;  2DZN B;  3L29 A;  5KQ8 A;  3SC3 A;  4X65 M;  4I4L A;  1JR3 A;  4I81 A;  3U6C A;  4PDG A;  1GLN A;  4KO8 A;  1NY6 A;  1K3W A;  3FUX A;  3TWM A;  1NHG C;  4G6Z A;  5EP1 A;  2D7H A;  2F5N A;  4MGK E;  1ORY B;  3SHF A;  1IY2 A;  3VLF B;  2D7E A;  1TDZ A;  2HCB A;  2DVW B;  2KXE A;  3HKP A;  3EIE A;  4DR3 M;  1E94 E;  4NL4 H;  1IBK M;  4G4O A;  3HHX A;  3KSX A;  4PDI A;  1Z5B A;  3U6L A;  2L09 A;  3HU1 A;  3TL4 X;  5FLX S;  4G4N A;  3KOX E;  4B3R M;  1IN8 A;  1E9S A;  2I7P A;  3D8L A;  4LF5 M;  4LJA A;  4NSO B;  5FTJ A;  3SAR A;  4GHA A;  3A98 B;  4FD2 A;  2AHM A;  1R2Z A;  2ZAO A;  3DFZ A;  4QHS A;  1R7R A;  2KZU A;  4DR5 M;  2CE7 A;  4DV2 M;  2QEN A;  3CTW B;  3PNY A;  3TWK A;  4LRS A;  4IBF A;  4NXN M;  3BOS A;  1DGB A;  2C99 A;  1L2D A;  2VII A;  3GQ3 A;  3UJN A;  2UXB M;  3UK6 A;  1L8Q A;  5FSW A;  4K0K M;  3JR4 A;  1NJG A;  2R46 A;  2JA2 A;  5FTM A;  2ZBK B;  1JR3 D;  4LJ6 A;  1OJL A;  2R4E A;  2QBY A;  2QBY B;  3AV0 A;  2XGN A;  3FD9 A;  4LY6 A;  1QVR A;  5KQD A;  2F5O A;  5IT9 S;  3R9X B;  4LJ9 A;  1K3X A;  3VKG A;  3KOZ E;  3U60 B;  2Z4R A;  2C98 A;  3DA1 A;  5GKN A;  5KO3 A;  2L6O A;  2Y0Q A;  5ITY A;  3M0E A;  1HQC A;  1PJJ A;  4B3M M;  2L7I A;  3H4M A;  4L4U A;  3VK8 A;  4LF4 M;  2DWM A;  2XZF A;  4JI5 M;  4MB7 A;  4LGY A;  5IWA M;  4GH9 A;  1IN5 A;  5IZ7 D;  1XHB A;  1PM5 A;  2BJV A;  2Y0T A;  2XH9 A;  4LGM A;  1QAQ A;  4RF1 A;  4DR4 M;  4FCT A;  4AZF A;  4LRT A;  3VKH A;  4MH0 E;  4DV0 M;  2BJW A;  3KP1 E;  4GC9 A;  3T1H M;  4FW9 A;  4S12 A;  1OFI A;  3HHW A;  3KS4 A;  1I94 M;  3KS8 A;  1XC8 A;  4GC5 A;  4WUR A;  1SXJ E;  5EXP A;  3GQ5 A;  1DGG A;  2F5Q A;  3LQQ A;  5EXT A;  1X37 A;  4NRW A;  1DO0 A;  4GKJ M;  3MHV C;  2KA6 B;  4LCB A;  1IBM M;  2CV1 A;  2C96 A;  4G4Q A;  3GLG A;  2ZAN A;  5ITT A;  1MX0 A;  2P5T A;  3SAW A;  2X49 A;  2XLJ A;  3E9S A;  2CEA A;  3W0L B;  4MGH A;  3RGP A;  1S3S A;  1N33 M;  3A45 A;  3HGI A;  2XFS A;  2UUA M;  3GP1 A;  3GRR A;  3AL0 C;  4AI6 A;  1Z6T A;  4DV5 M;  2G5G X;  2KW0 A;  2J7N A;  4I8O A;  3DOA A;  4FVM A;  4JI1 M;  4G4R A;  3ILK A;  4IJE A;  4LF9 M;  1QAO A;  2F5P A;  1NSF A;  4PD2 A;  5JI2 E;  4NXM M;  1Z59 A;  1OFH A;  4Z6Y A;  2LXE A;  4MGI E;  4JI0 M;  3B9P A;  1G59 A;  5C18 A;  2F4V M;  5ITR A;  3KDS E;  4NRV A;  1SXJ D;  3FKE A;  1IXZ A;  4X62 M;  3U60 A;  3DZD A;  1G8P A;  4DR6 M;  5EQT A;  4FCW A;  3FYC A;  3U5Z B;  3U5Z A;  2FE8 A;  4KOD A;  4IJF A;  3WHL A;  4D82 A;  4PT5 A;  4JYA M;  5A2Q S;  2X4A A;  3FTE A;  1YUB A;  1T3T A;  5LMN M;  3NBI A;  4GHL A;  4CHT B;  4DV6 M;  1NNJ A;  4EIW A;  2BNK A;  4R3D A;  4LJ8 A;  4B7F A;  2LH0 A;  4ZPX A;  1ZAE A;  4P16 A;  5EXX A;  4GIT A;  2UXD M;  2QZ4 A;  3LMM A;  3LVW A;  5KPZ A;  1N78 A;  4L16 A;  3U6Q A;  2R4J A;  4IIW A;  3U61 A;  4RNA A;  5ITX A;  3U6O A;  1J5E M;  2L7H A;  4AKH A;  2Y20 A;  2YQZ A;  1MU5 A;  4MGY E;  1TH4 A;  1Z5C A;  4B7G A;  2Y21 A;  3E4R A;  3A46 A;  2E5L M;  2OQ4 A;  4GMQ A;  4DV1 M;  2CV2 A;  2LNH C;  1FNN A;  2R45 A;  3FUT A;  3KXE C;  2A5Y B;  2KRU A;  4JV5 M;  1QZM A;  1UM8 A;  2H1R A;  3CF0 A;  1QQW A;  1KSF X;  2M60 A;  2J7O A;  1WXQ A;  4JXJ A;  4DV3 M;  3EIH A;  1IBL M;  4LJ5 A;  4DR2 M;  2Z7J A;  1ZQ9 A;  3L2A A;  4HLQ A;  5ITU A;  4W5W A;  3GQ4 A;  3HHY A;  1L1Z A;  4LZJ A;  2DWL A;  4D81 A;  2EUC A;  4LFB M;  4B3S M;  4X66 M;  1XXH B;  1N32 M;  1HQY E;  1QYR A;  4AW4 A;  3T38 A;  4L78 A;  2W82 A;  4AG5 A;  1XNQ M;  2KZS A;  1HT1 E;  1HT2 E;  5IRE B;  2ZM6 M;  3T1Y M;  3AKZ A;  3J7A S;  3IG8 A;  3NWL A;  2XEP A;  4AG6 A;  2CHQ A;  2LWX A;  4GRI A;  3RGS A;  3GLF B;  1GVN A;  2VQF M;  4QHT A;  4BB9 A;  1DGF A;  1W5T A;  4R7G A;  3UMM A;  1Q39 A;  5F3W A;  2ZAM A;  2QCU A;  4LJ7 A;  2RKO A;  3KOW E;  3SYL A;  3UZU A;  3A42 A;  4LFA M;  2XZU A;  1Q3B A;  4X64 M;  3I4Y A;  5EP3 A;  3WHK A;  3AJI B;  2O5R A;  3TWL A;  4LF8 M;  1TH2 A;  4LG2 A;  2DZO B;  1W5S A;  4BLC A;  3U6M A;  3UGJ A;  4OVZ A;  3GRU A;  2V1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...