1HNXM

Structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1hnxM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 1hnxM02
2HHHM 1J5EM 3T1HM 3JAMS 5LMNM 2XZFA 5ITUA 3GO8A 1IBMM 4JI7M 1HNZM 5IWAM 3OTOM 3J81S 4AQYM 2OPFA 4LF8M 5ITQA 4X65M 3U6OA 2UUAM 2F5PA 2ZM6M 1PJIA 1EE8A 2VQFM 5ITRA 3U6CA 3SAWA 4JI1M 1R2YA 1L2CA 4LFCM 4G4QA 3J80S 3A46A 1N34M 3W0FA 5FLXS 4LF4M 3GPPA 3U6SA 1L2DA 4GKJM 1N33M 1XC8A 4DV2M 2UXDM 3T1YM 1Q3CA 5ITXA 2F5OA 3SBJA 3JR5A 3GP1A 4KHPM 4DV1M 4DR3M 3TWKA 4DR1M 3U6PA 1KFVA 4CISA 5LMUM 4DR7M 2EA0A 2Q2EB 1HNXM 3GQ3A 2UXBM 4PD2A 3U6MA 3A42A 3DOAA 3GQ4A 4DV5M 4DR5M 4NXNM 1Z5CA 4DV0M 4LFBM 3U6EA 4YHHM 4G4NA 4DR2M 4DV3M 4X64M 1I94M 1MX0A 3VK8A 1N36M 2E5LM 4JI0M 4NXMM 4DV7M 1XNQM 5ITXE 3TWMA 1HR0M 1IBLM 3JR4A 3SATA 4JI8M 4DR4M 4B3TM 4JI5M 2F5QA 2UXCM 3VK7A 5BR8M 4G4OA 3J7AS 3A45A 3SASA 1FJGM 5ITYA 4DV6M 2UU9M 1Z5BA 4K0KM 5IT9S 1IBKM 2UUCM 4OX9M 3U6QA 1Q3BA 3U6DA 4DV4M 2F5NA 2F5SA 1R2ZA 1Z5AA 1HNWM 2VQEM 3GPYA 1XMQM 2UUBM 1PJJA 4B3SM 4DUYM 4JV5M 4X62M 1Q39A 4DR6M 4DUZM 1XNRM 4B3MM 4B3RM 3GQ5A 1TDHA 4NRWA 4PDGA 3C58A 4G4RA 1TDZA 4JI2M 4NRVA 3SAUA 4LFAM 1PM5A 1L1TA 4MB7A 4X66M 1L1ZA 4LF9M 4YY3M 4JYAM 3GPXA 2XZUA 4PDIA 1MU5A 1NNJA 2F4VM 5A2QS 3SAVA 1K3XA 4JI4M 4LF7M 2OQ4A 4GKKM 1Z59A 1L2BA 3U6LA 5ITTA 1XMOM 3GPUA 1K82A 1K3WA 4PCZA 1N32M 4ITQA 4LF6M 4JI6M 2ZBKB 2HKJA 3TWLA 4LF5M 3SARA 4JI3M
chains in the Genus database with same CATH superfamily
5KQ8A 3HU2A 2X49A 4R71A 5EP3A 5FTJA 5LMNM 2XLJA 4FW9A 3GRYA 4D81A 1IBMM 4P16A 1VQ1A 1V92A 2OOAA 4IJFA 3J81S 2RGHA 2OPFA 5ITQA 4X65M 4GH9A 4LCBA 1TGUA 3AJIB 3E46A 3A98B 4XK8F 2ZM6M 3GLGA 1G59A 4JI1M 2V6ZM 3SAWA 4R3DA 2JP7A 1NY5A 1YUBA 2C9CA 4G4QA 5E6JA 3A46A 1E32A 3M6AA 5FTLA 1ZQ9A 3GPPA 1OJLA 3PNVA 3U6SA 1L2DA 1IM2A 2R46A 4AKIA 2MGWA 2UXDM 1Q3CA 5H37D 2KXEA 2K9DA 1YSYA 2O01F 4BB9A 2F5OA 3LVVA 4IBFA 3HJQA 3UK6A 2KEBA 2CE7A 2L4EA 4MGZE 4DV1M 4KHPM 2FNAA 2A5YB 1DGBA 4DR1M 2HCBA 3U6PA 3RGPA 2MJ5B 3UZUA 2QENA 2BNKA 2OOBA 4OU7A 3U6MA 3LQRA 4MGIE 1HT1E 4M9XA 2MH8A 4FCWA 3U6EA 3F92A 2J5YA 5C1BA 3HZJA 4GMQA 1MX0A 3GRUA 4BBAA 3TQSA 3UJNA 3VK8A 1KSFX 1OQYA 3KDSE 4JI0M 1CUKA 1XXHB 4QHSA 1XNQM 2JZ0A 2BJVA 3TWMA 3MJ5A 3ZQJA 1QYRA 4JI8M 3KS8A 5DYGA 4B3TM 3FUUA 4HL4A 4JI5M 3HJSA 3DFZA 4Z8XA 1SG9A 3VK7A 4G4OA 3U5ZA 1DV0A 5KQDA 2DZNB 4GRIA 5DYIA 3L26A 2Z3XA 3SASA 2R6FA 3TE6A 5ITYA 2UU9M 1Z5BA 1EFUB 3FYCA 2DZLA 3MHVC 4KODA 2UUCM 4GHAA 5IT9S 4OX9M 1Q3BA 2JY8A 1V34A 3D8LA 2R4JA 2EO2A 5KPZA 2F5NA 4RF1A 2KRUA 2J7OA 2WZJA 2F5SA 1NHGC 3HHYA 1L8QA 1NV9A 1PJJA 4DUYM 4JXJA 1Q39A 3RFWA 4L8RC 1WXQA 1IXSA 1IN5A 4LY6A 4MGYE 4B3MM 3FUTA 2ZTDA 2JNHA 2JZ1A 3C9PA 1ORYB 3BXWA 3W0LB 2VF8A 5IREB 3GLFE 1TDHA 3GLFB 1JR3D 1WHCA 4PDGA 4G4RA 4IJEA 5BPVA 1DO0A 1QZEA 1PM5A 1IY0A 4IBEA 3L29A 2NQ8C 4IBDA 2I7NA 4MB7A 1G41A 4YY3M 4A3VB 1J09A 2V1CA 3FUXA 3KXEC 5KO3A 4PT5A 4GC9A 2KA6B 2RKOA 3CF2A 4L4UA 7CATA 2OQ4A 3D8BA 1L2BA 4MM3B 2LNHC 3WHKA 4S12A 5ITTA 3AOEA 1GL6A 3KP1E 1K3WA 1K82A 2P5TA 4F2LA 3KW6A 2QBYA 3KS4A 1NHWC 1UM8A 3CF0A 1SXJA 3FRHA 2R4EA 2RGOA 2QNJA 2L4FA 4M9SA 2XZFA 2DKLA 3GO8A 1E94E 3HU1A 1PJTA 4DBGB 3KOXE 4NOOB 1GKIA 3U6OA 4REZA 1OTRA 2ZAOA 3J7BA 3H4MA 1EE8A 2WSEF 2CUZA 3GRRA 2K6BA 2VQFM 3NBXX 3KFUG 1R2YA 1L2CA 4IBGA 1QUTA 1D0MA 3LQQA 2GNOA 3J80S 2YQZA 2Z4SA 3AV0A 5FLXS 3VKHA 4GKJM 2ZTCA 1NY6A 1N33M 2JUJA 4DV2M 1QVRA 3EIEA 3T1YM 3EIHA 1DGFA 4GC5A 1N75A 1QDRA 2CP8A 4LZZA 1R6BX 3C3DA 2DI0A 4NSRA 5ITXA 1GJSA 4JN6A 4D82A 1G4AE 1GO5A 3MK6A 4DR3M 3U60A 1DGGA 4OVZA 2C99A 1BVSA 2XFSA 2WSCF 4LJ9A 5JI2E 3M0EA 2BWEA 2W82A 3A42A 4G6ZA 1G71A 3K1JA 2CHGA 3VKGA 5JI3E 3HHXA 1Z5CA 4LFBM 4YHHM 4G4NA 3Q8GA 2DWNA 3TWLA 3WHLA 2R45A 4P17A 1I94M 1IY2A 3VLFB 1N36M 4DV7M 1GABA 4RF0A 2YNMD 1F4IA 3FRIA 3JR4A 3SMSA 3ZH9B 4L16A 5E26A 1NJFA 2KRKA 2CV2A 2F5QA 1VDDA 3B7NA 2DWZB 1OFIA 1WR1B 2DVWB 3FE3A 1X37A 4FWGA 1FJGM 3GLIA 3HHWA 3LVWA 1D2NA 4DV6M 3IG8A 3W68A 2DHYA 2ERCA 1D0LA 8CATA 5GKNA 2Y0TA 1WJ7A 2DENA 3GLHA 3IHPA 4DV4M 1OKSA 1ZAEA 2I7PA 3I04M 2KNVA 2VQEM 1XMQM 2UUBM 4B3SM 1YLAA 3KSXA 3DZDA 4QNMA 3AL0C 1DGHB 2KHHA 4DUZM 3H4JA 2FFJA 2X4AA 3IG5A 3TL4X 1XXHE 1DO2A 2YFQA 1JR3A 3KOWE 4M0DA 1RU3A 2FS1A 2BJWA 3ZC7B 2M5ZA 3K2LA 2KNZA 1OIPA 1TDZA 2N35A 3FTEA 1L1TA 4X66M 1L1ZA 4I4LA 4LF9M 3HKPA 1IFYA 3K9PA 1PJQA 3J2PB 3GPXA 3LCVB 1VEGA 4MGKE 4PDIA 2VIIA 2F4VM 4FD2A 5A2QS 3KSJA 1K3XA 4FVMA 1GLNA 2L7HA 5FTNA 3K92A 2R18A 3B7QA 3FUVA 3PFIA 3I01M 3GPUA 2LXEA 4LZJA 1N32M 2Z7JA 2BWBA 1WGLA 4HEOA 4XGIA 4RNAA 1SXJC 1AIPC 4OW0A 2ZBKB 2KW0A 3KOYE 2FE8A 3SYKA 3T38A 4LF5M 2WSFF 2HHHM 1QANA 5EP1A 4WURA 1J5EM 2DXIA 2JA2A 3T1HM 4WP2A 4I5SA 5FTKA 2JWSA 3UMMA 5KPRA 1HNZM 1MN3A 5IWAM 2C9OA 1NVMA 4LJ4A 4AG5A 4AQYM 1PJSA 4LF8M 1Z6TA 3PXGA 4CIZA 2CV0A 2F5PA 2CHQA 3B74A 2CFOA 3CTWB 1VDLA 4L6V6 5EQTA 3BBZA 2L7IA 3NBIA 3W67A 3QAUA 4LFCM 3MMPA 3FUWA 3W0FA 4LF4M 2JY6B 4LRSA 5EXXA 1NNUC 2CRUA 5DNYA 1DGHA 1XC8A 3HX3A 2Y20A 3M7GA 4IBKA 4L78A 3SHGB 2JY7A 2QPAA 5EJCA 3V76A 1XXHA 4IBIA 1QUSA 3RE8A 4GIPA 3U61B 2ZANA 3GP1A 2LVQD 2V1UA 2J7NA 2XEPA 5EXPA 2JXNA 4DR7M 1KFVA 4QOZC 5LMUM 4AW4A 1NJGA 2Q2EB 2EA0A 1HT2E 2B3TA 4IBCA 4PD2A 1JR3E 4NSOB 3GLGB 2CV1A 2ZAMA 3J27B 2DWMA 4CHTB 1WGNA 2HAKA 1TF0B 4FCTA 3GRVA 1VG5A 3E21A 2R62A 2Z8YM 4ZPXA 1GL7A 1D0KA 4DV3M 4X64M 4WW0A 2E5LM 2DAKA 2Y0QA 4B7FA 4NXMM 2H5XA 4FCVA 3VFDA 1AUAA 5IZ7D 4LRTA 2DNAA 4MGHA 4BLCA 3FTDA 3GLFA 2EUCA 2UXCM 5BR8M 2L6OA 1C1KA 3LW5F 4G3OA 3TPZA 3A45A 3FKEA 2MR9A 1IN8A 1IN4A 1QQWA 1UFZA 2DHRA 4KO8A 4K0KM 3KOZE 1W5TA 1XB2B 4XBOA 3FTFA 1MJGM 1HJPA 1ZV1A 4AI6A 2QSFX 3E4RA 1R2ZA 3GPYA 3AKZA 2M60A 3FTCA 1XHBA 3SYLA 1N77A 4LGYA 4X62M 2R44A 2X8AA 2FOIC 4DR6M 3THGA 3BOSA 2LBCA 2QCUA 2XSZA 1OAOC 3GQ5A 4AKGA 3DA1A 4LJ8A 4QHTA 3I4YA 4GHLA 1S3SA 4TUWA 1IXZA 4LJ5A 3U5ZB 4NRWA 2D7EA 3C58A 3U61A 3L25A 4IIWA 1J7KA 3L28A 2EJSA 2EKKA 1E9SA 1HQCA 1YE9A 4NRVA 4QNRA 4CJ6A 1QZMA 4JI2M 4JYAM 2QP9X 2RRUA 5EP4A 1WIVA 2XZUA 1OFHA 4II7A 1NNJA 2KZUA 3SAVA 3HJ8A 2H1RA 4LF7M 2LTUA 2YR0A 2D7GA 3U6LA 1XMOM 2LVAA 3AFHA 3VDUA 3E9SA 2LHGA 1G3IA 2G5GX 2O5RA 2XF3A 4JI6M 1GJTA 2Y21A 1QDTA 3HHZA 1IXSB 2HWJA 1QAMA 2DZOB 2FH0A 4GEWA 3FYDA 4EIWA 4JI3M 4CGYB 2O25A 4M0WA 1TR8A 2XSZD 1NSFA 1HQYE 3JAMS 1R5LA 1T3TA 2DAEA 2OO9A 4UN2B 3VDPA 5FSWA 2XFTA 4LGMA 5ITUA 3R8FA 5KPTA 3OTOM 4JI7M 1IQPA 2DAIA 1H6UA 3PNYA 2UUAM 4AG6A 3LMMA 2VF7A 3HGIA 1IXRC 2K47A 1TH4A 4B7HA 1QAQA 1PJIA 2CHVA 3B7ZA 5ITRA 2LVOC 3U6CA 3IECA 3NWLA 1Y8GA 3SC3A 2C96A 2QBYB 3AOEC 1N34M 1SXJB 2LVNC 2XH9A 1SXJE 3K9OA 3ZCBB 4M9ZA 1ZMWA 5L8RF 4F1IA 2D7HA 1PGYA 1NO1A 1T6OA 1R4GA 2C98A 1N78A 1VEKA 2R65A 1R7RA 2LVPC 1KYIA 3CGWA 1JQJC 4HLQA 3JR5A 4R7GA 3SBJA 5EXTA 4B7GA 1PRBA 3TWKA 4CISA 3L27A 4W5WA 3AOGA 1HNXM 2HL7A 3C3EA 4MH0E 1IN6A 3GQ3A 3RGSA 2UXBM 3LCUA 2DWLA 4KLNA 2GQFA 1QAOA 2APLA 4IBBA 4Q7JA 2JY5A 3DOAA 3GQ4A 1TTEA 4DV5M 4DR5M 2XGNA 4NXNM 4DV0M 5C18A 3SHFA 3FD9A 2LH0A 3I4VA 1TH3A 4DR2M 1P3QQ 4AZFA 3KP0E 3QYBA 2LHCA 3HWSA 1T43A 4B08A 4Y28F 4RKUF 2QHOB 4NC6A 5ITXE 2AHMA 2CEAA 1HR0M 1IBLM 2VDBB 3SATA 4IBJA 5DFLA 4DR4M 4I81A 1JB0F 3U60B 4OVZB 2QZ4A 5FTMA 4LJ6A 3B89A 1LTMA 2KDLA 3J7AS 3T6PA 1EIJA 5EP2A 1A5TA 3CF6E 2DAGA 3GLGE 4GITA 1IBKM 2K0BX 4QOSA 3U6QA 3U6DA 3Q8XA 1GVNA 1Z5AA 3T15A 1HNWM 4JV5M 1ZMUA 4Z6YA 1V33A 3B9PA 4LJAA 3QYEA 4KT0F 4I8OA 3KVWA 2Z4RA 1W5SA 3PVSA 1FNNA 1I4WA 2MROB 1XNRM 2L09A 4B3RM 1IN7A 4FWHA 4LG2A 1NV8A 1OAIA 1VEJA 4L15A 2C5RA 2G8LA 4FWDA 1G8PA 2G3QA 3K8ZA 4LJ7A 3R9XB 4AKHA 3GLIB 3GLIE 3SAUA 4LFAM 4NL4H 2L2DA 2CWBA 2QQ8A 1LV7A 1TH2A 3UGJA 1MU5A 3SMPA 3GLHB 1E9RA 3GLHE 5EXSA 4JI4M 1OIZA 2KNAA 4GKKM 1Z59A 3L2AA 3ILKA 2LWXA 1IY1A 3HU3A 3I51A 4PCZA 1Q02A 4ANRA 5F3WA 2KZSA 4D80A 2R0IA 1C7YA 2DAMA 4ITQA 4LF6M 3HY5A 2EKFA 1ZMVA 2HKJA 3QWLA 3SFZA 3SARA 1SXJD 1XWIA
chains in the Genus database with same CATH topology
5KQ8A 3HU2A 2X49A 5EP3A 5FTJA 5LMNM 2XLJA 4FW9A 3GRYA 4D81A 1IBMM 4P16A 4IJFA 3J81S 2RGHA 2OPFA 5ITQA 4X65M 4GH9A 4LCBA 1TGUA 3AJIB 3A98B 2ZM6M 3GLGA 1G59A 4JI1M 2V6ZM 3SAWA 4R3DA 1NY5A 1YUBA 2C9CA 4G4QA 5E6JA 3A46A 1E32A 3M6AA 5FTLA 1ZQ9A 3GPPA 1OJLA 3PNVA 3U6SA 1L2DA 1IM2A 2R46A 4AKIA 2UXDM 1Q3CA 5H37D 2KXEA 1YSYA 4BB9A 2F5OA 3LVVA 4IBFA 3HJQA 3UK6A 2KEBA 2CE7A 4DV1M 4MGZE 4KHPM 2FNAA 2A5YB 1DGBA 4DR1M 2HCBA 3U6PA 3RGPA 3UZUA 2QENA 2BNKA 3U6MA 4OU7A 3LQRA 4MGIE 1HT1E 4M9XA 4FCWA 3U6EA 5C1BA 4GMQA 1MX0A 3GRUA 4BBAA 3TQSA 3UJNA 3VK8A 1KSFX 3KDSE 4JI0M 1XXHB 1XNQM 4QHSA 2BJVA 3TWMA 3MJ5A 1QYRA 4JI8M 3KS8A 5DYGA 4B3TM 3FUUA 4HL4A 4JI5M 3HJSA 3DFZA 4Z8XA 3VK7A 4G4OA 3U5ZA 5KQDA 2DZNB 4GRIA 5DYIA 3L26A 2Z3XA 3SASA 3TE6A 5ITYA 2UU9M 1Z5BA 3FYCA 5IT9S 3MHVC 4KODA 2UUCM 4GHAA 4OX9M 1Q3BA 3D8LA 5KPZA 2R4JA 2EO2A 2F5NA 4RF1A 2KRUA 2J7OA 2F5SA 1NHGC 3HHYA 1L8QA 1PJJA 4DUYM 4JXJA 1Q39A 3RFWA 4L8RC 1WXQA 4LY6A 1IN5A 4MGYE 4B3MM 3FUTA 1ORYB 3W0LB 3GLFB 5IREB 1TDHA 1JR3D 4PDGA 4G4RA 4IJEA 5BPVA 1DO0A 1PM5A 1IY0A 4IBEA 3L29A 2NQ8C 4IBDA 2I7NA 4MB7A 1G41A 4YY3M 4A3VB 1J09A 2V1CA 3FUXA 3KXEC 5KO3A 4PT5A 4GC9A 2KA6B 2RKOA 3CF2A 4L4UA 7CATA 2OQ4A 3D8BA 1L2BA 4MM3B 2LNHC 3WHKA 4S12A 5ITTA 3AOEA 1GL6A 3KP1E 1K3WA 1K82A 2P5TA 3KW6A 2QBYA 3KS4A 1NHWC 1UM8A 3CF0A 1SXJA 2R4EA 2RGOA 4M9SA 2XZFA 3GO8A 1E94E 3HU1A 3KOXE 4NOOB 1GKIA 3U6OA 4REZA 2ZAOA 3J7BA 3H4MA 1EE8A 2CUZA 3GRRA 2VQFM 3KFUG 1R2YA 1L2CA 4IBGA 3LQQA 3J80S 2YQZA 2Z4SA 3AV0A 5FLXS 3VKHA 4GKJM 1N33M 1NY6A 4DV2M 1QVRA 3EIEA 3T1YM 3EIHA 1DGFA 4GC5A 1N75A 4LZZA 1R6BX 4NSRA 5ITXA 4JN6A 4D82A 1G4AE 3MK6A 4DR3M 3U60A 1DGGA 4OVZA 2C99A 2XFSA 4LJ9A 5JI2E 3M0EA 2W82A 3A42A 4G6ZA 3K1JA 2CHGA 3VKGA 5JI3E 3HHXA 1Z5CA 4LFBM 4YHHM 4G4NA 3WHLA 2R45A 1I94M 1IY2A 3VLFB 1N36M 4DV7M 4RF0A 2YNMD 3JR4A 3SMSA 3ZH9B 4L16A 5E26A 1NJFA 2KRKA 2CV2A 2F5QA 1VDDA 2DWZB 1OFIA 2DVWB 1X37A 4FWGA 1FJGM 3GLIA 3HHWA 3LVWA 1D2NA 4DV6M 3IG8A 2ERCA 8CATA 5GKNA 2Y0TA 4DV4M 3GLHA 1ZAEA 2I7PA 2VQEM 1XMQM 2UUBM 4B3SM 3KSXA 3DZDA 4QNMA 3AL0C 1DGHB 4DUZM 2FFJA 2X4AA 3IG5A 3TL4X 2YFQA 1DO2A 4M0DA 1JR3A 3KOWE 2BJWA 3ZC7B 2M5ZA 3K2LA 1TDZA 3FTEA 1L1TA 4X66M 1L1ZA 4I4LA 4LF9M 3HKPA 3J2PB 3GPXA 4MGKE 4PDIA 2VIIA 2F4VM 4FD2A 5A2QS 3KSJA 1K3XA 4FVMA 1GLNA 2L7HA 5FTNA 3K92A 2R18A 3FUVA 3GPUA 3PFIA 2LXEA 4LZJA 1N32M 2Z7JA 4XGIA 4RNAA 1SXJC 4OW0A 2ZBKB 3KOYE 2KW0A 2FE8A 3SYKA 3T38A 4LF5M 2HHHM 1QANA 5EP1A 4WURA 1J5EM 2DXIA 2JA2A 3T1HM 4I5SA 5FTKA 3UMMA 5KPRA 1HNZM 5IWAM 2C9OA 1NVMA 4LJ4A 4AG5A 4AQYM 4LF8M 1Z6TA 3PXGA 2CV0A 2F5PA 2CHQA 2CFOA 3CTWB 5EQTA 2L7IA 3NBIA 3QAUA 4LFCM 3FUWA 3W0FA 4LF4M 4LRSA 5EXXA 1NNUC 5DNYA 1DGHA 1XC8A 2Y20A 3M7GA 4IBKA 4L78A 3SHGB 2QPAA 5EJCA 1XXHA 4IBIA 3RE8A 4GIPA 3U61B 2ZANA 3GP1A 2V1UA 2J7NA 2XEPA 5EXPA 4DR7M 1KFVA 4QOZC 5LMUM 4AW4A 1NJGA 2Q2EB 2EA0A 1HT2E 4IBCA 4PD2A 3GLGB 4NSOB 2CV1A 2ZAMA 3J27B 2DWMA 4CHTB 4FCTA 3GRVA 2R62A 4ZPXA 1GL7A 4DV3M 4X64M 4WW0A 2E5LM 2Y0QA 4B7FA 4NXMM 4FCVA 3VFDA 5IZ7D 4LRTA 4MGHA 4BLCA 3FTDA 3GLFA 2EUCA 2UXCM 5BR8M 2L6OA 1C1KA 3TPZA 3A45A 3FKEA 1IN8A 1IN4A 1QQWA 2DHRA 4KO8A 4K0KM 3KOZE 1W5TA 4XBOA 3FTFA 4AI6A 1R2ZA 3E4RA 3GPYA 3AKZA 2M60A 3FTCA 1XHBA 3SYLA 1N77A 4LGYA 4X62M 2X8AA 2FOIC 4DR6M 3THGA 3BOSA 2QCUA 2XSZA 3GQ5A 4AKGA 3DA1A 4LJ8A 4QHTA 3I4YA 4GHLA 1S3SA 4TUWA 1IXZA 4LJ5A 3U5ZB 4NRWA 2D7EA 3C58A 3U61A 3L25A 4IIWA 1J7KA 3L28A 1E9SA 1HQCA 1YE9A 4NRVA 4QNRA 4JI2M 1QZMA 4JYAM 2QP9X 5EP4A 2XZUA 1OFHA 4II7A 1NNJA 2KZUA 3SAVA 3HJ8A 2H1RA 4LF7M 2YR0A 2D7GA 3U6LA 1XMOM 3AFHA 3VDUA 3E9SA 1G3IA 2G5GX 2O5RA 2XF3A 4JI6M 3HHZA 2Y21A 1IXSB 1QAMA 2DZOB 4EIWA 3FYDA 4JI3M 4CGYB 4M0WA 2XSZD 1NSFA 1HQYE 3JAMS 5ITUA 1T3TA 3VDPA 2DWNA 4JI7M 5FSWA 2XFTA 4LGMA 3R8FA 5KPTA 3OTOM 1IQPA 1H6UA 3PNYA 2UUAM 4AG6A 3LMMA 3HGIA 1IXRC 2K47A 1TH4A 4B7HA 1QAQA 1PJIA 2CHVA 5ITRA 3U6CA 3NWLA 3SC3A 2C96A 2QBYB 3AOEC 1N34M 1SXJB 2XH9A 1SXJE 3ZCBB 4M9ZA 2D7HA 2C98A 1N78A 2R65A 3SBJA 1R7RA 4HLQA 1KYIA 3JR5A 1JQJC 4R7GA 5EXTA 4B7GA 3TWKA 4CISA 3L27A 4W5WA 3AOGA 1HNXM 2HL7A 4MH0E 1IN6A 3GQ3A 3RGSA 2UXBM 2DWLA 4KLNA 1QAOA 4IBBA 3DOAA 3GQ4A 4DV5M 4DR5M 2XGNA 4NXNM 4DV0M 5C18A 3SHFA 3FD9A 2LH0A 3I4VA 1TH3A 4DR2M 4AZFA 3KP0E 3HWSA 4B08A 5ITXE 2AHMA 2CEAA 1HR0M 1IBLM 3SATA 4IBJA 4DR4M 4I81A 3U60B 4OVZB 2QZ4A 5FTMA 4LJ6A 3J7AS 5EP2A 3CF6E 4GITA 1IBKM 4QOSA 3U6QA 3U6DA 3Q8XA 1GVNA 1Z5AA 3T15A 1HNWM 4JV5M 4Z6YA 3B9PA 4LJAA 4I8OA 3KVWA 2Z4RA 1W5SA 3PVSA 1FNNA 1I4WA 1XNRM 2L09A 4B3RM 1IN7A 4FWHA 4LG2A 4L15A 2C5RA 2G8LA 4FWDA 1G8PA 4LJ7A 3K8ZA 3R9XB 4AKHA 3GLIB 3SAUA 4LFAM 4NL4H 1LV7A 1TH2A 3UGJA 1MU5A 3SMPA 3GLHB 1E9RA 5EXSA 4JI4M 4GKKM 1Z59A 3L2AA 3ILKA 3HU3A 3I51A 2LWXA 1IY1A 4PCZA 5F3WA 4ITQA 2KZSA 4D80A 4LF6M 2HKJA 3QWLA 3SFZA 3TWLA 3SARA 1SXJD 1XWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHH M;  1J5E M;  3T1H M;  3JAM S;  5LMN M;  2XZF A;  5ITU A;  3GO8 A;  1IBM M;  4JI7 M;  1HNZ M;  5IWA M;  3OTO M;  3J81 S;  4AQY M;  2OPF A;  4LF8 M;  5ITQ A;  4X65 M;  3U6O A;  2UUA M;  2F5P A;  2ZM6 M;  1PJI A;  1EE8 A;  2VQF M;  5ITR A;  3U6C A;  3SAW A;  4JI1 M;  1R2Y A;  1L2C A;  4LFC M;  4G4Q A;  3J80 S;  3A46 A;  1N34 M;  3W0F A;  5FLX S;  4LF4 M;  3GPP A;  3U6S A;  1L2D A;  4GKJ M;  1N33 M;  1XC8 A;  4DV2 M;  2UXD M;  3T1Y M;  1Q3C A;  5ITX A;  2F5O A;  3SBJ A;  3JR5 A;  3GP1 A;  4KHP M;  4DV1 M;  4DR3 M;  3TWK A;  4DR1 M;  3U6P A;  1KFV A;  4CIS A;  5LMU M;  4DR7 M;  2EA0 A;  2Q2E B;  1HNX M;  3GQ3 A;  2UXB M;  4PD2 A;  3U6M A;  3A42 A;  3DOA A;  3GQ4 A;  4DV5 M;  4DR5 M;  4NXN M;  1Z5C A;  4DV0 M;  4LFB M;  3U6E A;  4YHH M;  4G4N A;  4DR2 M;  4DV3 M;  4X64 M;  1I94 M;  1MX0 A;  3VK8 A;  1N36 M;  2E5L M;  4JI0 M;  4NXM M;  4DV7 M;  1XNQ M;  5ITX E;  3TWM A;  1HR0 M;  1IBL M;  3JR4 A;  3SAT A;  4JI8 M;  4DR4 M;  4B3T M;  4JI5 M;  2F5Q A;  2UXC M;  3VK7 A;  5BR8 M;  4G4O A;  3J7A S;  3A45 A;  3SAS A;  1FJG M;  5ITY A;  4DV6 M;  2UU9 M;  1Z5B A;  4K0K M;  5IT9 S;  1IBK M;  2UUC M;  4OX9 M;  3U6Q A;  1Q3B A;  3U6D A;  4DV4 M;  2F5N A;  2F5S A;  1R2Z A;  1Z5A A;  1HNW M;  2VQE M;  3GPY A;  1XMQ M;  2UUB M;  1PJJ A;  4B3S M;  4DUY M;  4JV5 M;  4X62 M;  1Q39 A;  4DR6 M;  4DUZ M;  1XNR M;  4B3M M;  4B3R M;  3GQ5 A;  1TDH A;  4NRW A;  4PDG A;  3C58 A;  4G4R A;  1TDZ A;  4JI2 M;  4NRV A;  3SAU A;  4LFA M;  1PM5 A;  1L1T A;  4MB7 A;  4X66 M;  1L1Z A;  4LF9 M;  4YY3 M;  4JYA M;  3GPX A;  2XZU A;  4PDI A;  1MU5 A;  1NNJ A;  2F4V M;  5A2Q S;  3SAV A;  1K3X A;  4JI4 M;  4LF7 M;  2OQ4 A;  4GKK M;  1Z59 A;  1L2B A;  3U6L A;  5ITT A;  1XMO M;  3GPU A;  1K82 A;  1K3W A;  4PCZ A;  1N32 M;  4ITQ A;  4LF6 M;  4JI6 M;  2ZBK B;  2HKJ A;  3TWL A;  4LF5 M;  3SAR A;  4JI3 M; 
#chains in the Genus database with same CATH topology
 5KQ8 A;  3HU2 A;  2X49 A;  4R71 A;  5EP3 A;  5FTJ A;  5LMN M;  2XLJ A;  4FW9 A;  3GRY A;  4D81 A;  1IBM M;  4P16 A;  1VQ1 A;  1V92 A;  2OOA A;  4IJF A;  3J81 S;  2RGH A;  2OPF A;  5ITQ A;  4X65 M;  4GH9 A;  4LCB A;  1TGU A;  3AJI B;  3E46 A;  3A98 B;  4XK8 F;  2ZM6 M;  3GLG A;  1G59 A;  4JI1 M;  2V6Z M;  3SAW A;  4R3D A;  2JP7 A;  1NY5 A;  1YUB A;  2C9C A;  4G4Q A;  5E6J A;  3A46 A;  1E32 A;  3M6A A;  5FTL A;  1ZQ9 A;  3GPP A;  1OJL A;  3PNV A;  3U6S A;  1L2D A;  1IM2 A;  2R46 A;  4AKI A;  2MGW A;  2UXD M;  1Q3C A;  5H37 D;  2KXE A;  2K9D A;  1YSY A;  2O01 F;  4BB9 A;  2F5O A;  3LVV A;  4IBF A;  3HJQ A;  3UK6 A;  2KEB A;  2CE7 A;  2L4E A;  4MGZ E;  4DV1 M;  4KHP M;  2FNA A;  2A5Y B;  1DGB A;  4DR1 M;  2HCB A;  3U6P A;  3RGP A;  2MJ5 B;  3UZU A;  2QEN A;  2BNK A;  2OOB A;  4OU7 A;  3U6M A;  3LQR A;  4MGI E;  1HT1 E;  4M9X A;  2MH8 A;  4FCW A;  3U6E A;  3F92 A;  2J5Y A;  5C1B A;  3HZJ A;  4GMQ A;  1MX0 A;  3GRU A;  4BBA A;  3TQS A;  3UJN A;  3VK8 A;  1KSF X;  1OQY A;  3KDS E;  4JI0 M;  1CUK A;  1XXH B;  4QHS A;  1XNQ M;  2JZ0 A;  2BJV A;  3TWM A;  3MJ5 A;  3ZQJ A;  1QYR A;  4JI8 M;  3KS8 A;  5DYG A;  4B3T M;  3FUU A;  4HL4 A;  4JI5 M;  3HJS A;  3DFZ A;  4Z8X A;  1SG9 A;  3VK7 A;  4G4O A;  3U5Z A;  1DV0 A;  5KQD A;  2DZN B;  4GRI A;  5DYI A;  3L26 A;  2Z3X A;  3SAS A;  2R6F A;  3TE6 A;  5ITY A;  2UU9 M;  1Z5B A;  1EFU B;  3FYC A;  2DZL A;  3MHV C;  4KOD A;  2UUC M;  4GHA A;  5IT9 S;  4OX9 M;  1Q3B A;  2JY8 A;  1V34 A;  3D8L A;  2R4J A;  2EO2 A;  5KPZ A;  2F5N A;  4RF1 A;  2KRU A;  2J7O A;  2WZJ A;  2F5S A;  1NHG C;  3HHY A;  1L8Q A;  1NV9 A;  1PJJ A;  4DUY M;  4JXJ A;  1Q39 A;  3RFW A;  4L8R C;  1WXQ A;  1IXS A;  1IN5 A;  4LY6 A;  4MGY E;  4B3M M;  3FUT A;  2ZTD A;  2JNH A;  2JZ1 A;  3C9P A;  1ORY B;  3BXW A;  3W0L B;  2VF8 A;  5IRE B;  3GLF E;  1TDH A;  3GLF B;  1JR3 D;  1WHC A;  4PDG A;  4G4R A;  4IJE A;  5BPV A;  1DO0 A;  1QZE A;  1PM5 A;  1IY0 A;  4IBE A;  3L29 A;  2NQ8 C;  4IBD A;  2I7N A;  4MB7 A;  1G41 A;  4YY3 M;  4A3V B;  1J09 A;  2V1C A;  3FUX A;  3KXE C;  5KO3 A;  4PT5 A;  4GC9 A;  2KA6 B;  2RKO A;  3CF2 A;  4L4U A;  7CAT A;  2OQ4 A;  3D8B A;  1L2B A;  4MM3 B;  2LNH C;  3WHK A;  4S12 A;  5ITT A;  3AOE A;  1GL6 A;  3KP1 E;  1K3W A;  1K82 A;  2P5T A;  4F2L A;  3KW6 A;  2QBY A;  3KS4 A;  1NHW C;  1UM8 A;  3CF0 A;  1SXJ A;  3FRH A;  2R4E A;  2RGO A;  2QNJ A;  2L4F A;  4M9S A;  2XZF A;  2DKL A;  3GO8 A;  1E94 E;  3HU1 A;  1PJT A;  4DBG B;  3KOX E;  4NOO B;  1GKI A;  3U6O A;  4REZ A;  1OTR A;  2ZAO A;  3J7B A;  3H4M A;  1EE8 A;  2WSE F;  2CUZ A;  3GRR A;  2K6B A;  2VQF M;  3NBX X;  3KFU G;  1R2Y A;  1L2C A;  4IBG A;  1QUT A;  1D0M A;  3LQQ A;  2GNO A;  3J80 S;  2YQZ A;  2Z4S A;  3AV0 A;  5FLX S;  3VKH A;  4GKJ M;  2ZTC A;  1NY6 A;  1N33 M;  2JUJ A;  4DV2 M;  1QVR A;  3EIE A;  3T1Y M;  3EIH A;  1DGF A;  4GC5 A;  1N75 A;  1QDR A;  2CP8 A;  4LZZ A;  1R6B X;  3C3D A;  2DI0 A;  4NSR A;  5ITX A;  1GJS A;  4JN6 A;  4D82 A;  1G4A E;  1GO5 A;  3MK6 A;  4DR3 M;  3U60 A;  1DGG A;  4OVZ A;  2C99 A;  1BVS A;  2XFS A;  2WSC F;  4LJ9 A;  5JI2 E;  3M0E A;  2BWE A;  2W82 A;  3A42 A;  4G6Z A;  1G71 A;  3K1J A;  2CHG A;  3VKG A;  5JI3 E;  3HHX A;  1Z5C A;  4LFB M;  4YHH M;  4G4N A;  3Q8G A;  2DWN A;  3TWL A;  3WHL A;  2R45 A;  4P17 A;  1I94 M;  1IY2 A;  3VLF B;  1N36 M;  4DV7 M;  1GAB A;  4RF0 A;  2YNM D;  1F4I A;  3FRI A;  3JR4 A;  3SMS A;  3ZH9 B;  4L16 A;  5E26 A;  1NJF A;  2KRK A;  2CV2 A;  2F5Q A;  1VDD A;  3B7N A;  2DWZ B;  1OFI A;  1WR1 B;  2DVW B;  3FE3 A;  1X37 A;  4FWG A;  1FJG M;  3GLI A;  3HHW A;  3LVW A;  1D2N A;  4DV6 M;  3IG8 A;  3W68 A;  2DHY A;  2ERC A;  1D0L A;  8CAT A;  5GKN A;  2Y0T A;  1WJ7 A;  2DEN A;  3GLH A;  3IHP A;  4DV4 M;  1OKS A;  1ZAE A;  2I7P A;  3I04 M;  2KNV A;  2VQE M;  1XMQ M;  2UUB M;  4B3S M;  1YLA A;  3KSX A;  3DZD A;  4QNM A;  3AL0 C;  1DGH B;  2KHH A;  4DUZ M;  3H4J A;  2FFJ A;  2X4A A;  3IG5 A;  3TL4 X;  1XXH E;  1DO2 A;  2YFQ A;  1JR3 A;  3KOW E;  4M0D A;  1RU3 A;  2FS1 A;  2BJW A;  3ZC7 B;  2M5Z A;  3K2L A;  2KNZ A;  1OIP A;  1TDZ A;  2N35 A;  3FTE A;  1L1T A;  4X66 M;  1L1Z A;  4I4L A;  4LF9 M;  3HKP A;  1IFY A;  3K9P A;  1PJQ A;  3J2P B;  3GPX A;  3LCV B;  1VEG A;  4MGK E;  4PDI A;  2VII A;  2F4V M;  4FD2 A;  5A2Q S;  3KSJ A;  1K3X A;  4FVM A;  1GLN A;  2L7H A;  5FTN A;  3K92 A;  2R18 A;  3B7Q A;  3FUV A;  3PFI A;  3I01 M;  3GPU A;  2LXE A;  4LZJ A;  1N32 M;  2Z7J A;  2BWB A;  1WGL A;  4HEO A;  4XGI A;  4RNA A;  1SXJ C;  1AIP C;  4OW0 A;  2ZBK B;  2KW0 A;  3KOY E;  2FE8 A;  3SYK A;  3T38 A;  4LF5 M;  2WSF F;  2HHH M;  1QAN A;  5EP1 A;  4WUR A;  1J5E M;  2DXI A;  2JA2 A;  3T1H M;  4WP2 A;  4I5S A;  5FTK A;  2JWS A;  3UMM A;  5KPR A;  1HNZ M;  1MN3 A;  5IWA M;  2C9O A;  1NVM A;  4LJ4 A;  4AG5 A;  4AQY M;  1PJS A;  4LF8 M;  1Z6T A;  3PXG A;  4CIZ A;  2CV0 A;  2F5P A;  2CHQ A;  3B74 A;  2CFO A;  3CTW B;  1VDL A;  4L6V 6;  5EQT A;  3BBZ A;  2L7I A;  3NBI A;  3W67 A;  3QAU A;  4LFC M;  3MMP A;  3FUW A;  3W0F A;  4LF4 M;  2JY6 B;  4LRS A;  5EXX A;  1NNU C;  2CRU A;  5DNY A;  1DGH A;  1XC8 A;  3HX3 A;  2Y20 A;  3M7G A;  4IBK A;  4L78 A;  3SHG B;  2JY7 A;  2QPA A;  5EJC A;  3V76 A;  1XXH A;  4IBI A;  1QUS A;  3RE8 A;  4GIP A;  3U61 B;  2ZAN A;  3GP1 A;  2LVQ D;  2V1U A;  2J7N A;  2XEP A;  5EXP A;  2JXN A;  4DR7 M;  1KFV A;  4QOZ C;  5LMU M;  4AW4 A;  1NJG A;  2Q2E B;  2EA0 A;  1HT2 E;  2B3T A;  4IBC A;  4PD2 A;  1JR3 E;  4NSO B;  3GLG B;  2CV1 A;  2ZAM A;  3J27 B;  2DWM A;  4CHT B;  1WGN A;  2HAK A;  1TF0 B;  4FCT A;  3GRV A;  1VG5 A;  3E21 A;  2R62 A;  2Z8Y M;  4ZPX A;  1GL7 A;  1D0K A;  4DV3 M;  4X64 M;  4WW0 A;  2E5L M;  2DAK A;  2Y0Q A;  4B7F A;  4NXM M;  2H5X A;  4FCV A;  3VFD A;  1AUA A;  5IZ7 D;  4LRT A;  2DNA A;  4MGH A;  4BLC A;  3FTD A;  3GLF A;  2EUC A;  2UXC M;  5BR8 M;  2L6O A;  1C1K A;  3LW5 F;  4G3O A;  3TPZ A;  3A45 A;  3FKE A;  2MR9 A;  1IN8 A;  1IN4 A;  1QQW A;  1UFZ A;  2DHR A;  4KO8 A;  4K0K M;  3KOZ E;  1W5T A;  1XB2 B;  4XBO A;  3FTF A;  1MJG M;  1HJP A;  1ZV1 A;  4AI6 A;  2QSF X;  3E4R A;  1R2Z A;  3GPY A;  3AKZ A;  2M60 A;  3FTC A;  1XHB A;  3SYL A;  1N77 A;  4LGY A;  4X62 M;  2R44 A;  2X8A A;  2FOI C;  4DR6 M;  3THG A;  3BOS A;  2LBC A;  2QCU A;  2XSZ A;  1OAO C;  3GQ5 A;  4AKG A;  3DA1 A;  4LJ8 A;  4QHT A;  3I4Y A;  4GHL A;  1S3S A;  4TUW A;  1IXZ A;  4LJ5 A;  3U5Z B;  4NRW A;  2D7E A;  3C58 A;  3U61 A;  3L25 A;  4IIW A;  1J7K A;  3L28 A;  2EJS A;  2EKK A;  1E9S A;  1HQC A;  1YE9 A;  4NRV A;  4QNR A;  4CJ6 A;  1QZM A;  4JI2 M;  4JYA M;  2QP9 X;  2RRU A;  5EP4 A;  1WIV A;  2XZU A;  1OFH A;  4II7 A;  1NNJ A;  2KZU A;  3SAV A;  3HJ8 A;  2H1R A;  4LF7 M;  2LTU A;  2YR0 A;  2D7G A;  3U6L A;  1XMO M;  2LVA A;  3AFH A;  3VDU A;  3E9S A;  2LHG A;  1G3I A;  2G5G X;  2O5R A;  2XF3 A;  4JI6 M;  1GJT A;  2Y21 A;  1QDT A;  3HHZ A;  1IXS B;  2HWJ A;  1QAM A;  2DZO B;  2FH0 A;  4GEW A;  3FYD A;  4EIW A;  4JI3 M;  4CGY B;  2O25 A;  4M0W A;  1TR8 A;  2XSZ D;  1NSF A;  1HQY E;  3JAM S;  1R5L A;  1T3T A;  2DAE A;  2OO9 A;  4UN2 B;  3VDP A;  5FSW A;  2XFT A;  4LGM A;  5ITU A;  3R8F A;  5KPT A;  3OTO M;  4JI7 M;  1IQP A;  2DAI A;  1H6U A;  3PNY A;  2UUA M;  4AG6 A;  3LMM A;  2VF7 A;  3HGI A;  1IXR C;  2K47 A;  1TH4 A;  4B7H A;  1QAQ A;  1PJI A;  2CHV A;  3B7Z A;  5ITR A;  2LVO C;  3U6C A;  3IEC A;  3NWL A;  1Y8G A;  3SC3 A;  2C96 A;  2QBY B;  3AOE C;  1N34 M;  1SXJ B;  2LVN C;  2XH9 A;  1SXJ E;  3K9O A;  3ZCB B;  4M9Z A;  1ZMW A;  5L8R F;  4F1I A;  2D7H A;  1PGY A;  1NO1 A;  1T6O A;  1R4G A;  2C98 A;  1N78 A;  1VEK A;  2R65 A;  1R7R A;  2LVP C;  1KYI A;  3CGW A;  1JQJ C;  4HLQ A;  3JR5 A;  4R7G A;  3SBJ A;  5EXT A;  4B7G A;  1PRB A;  3TWK A;  4CIS A;  3L27 A;  4W5W A;  3AOG A;  1HNX M;  2HL7 A;  3C3E A;  4MH0 E;  1IN6 A;  3GQ3 A;  3RGS A;  2UXB M;  3LCU A;  2DWL A;  4KLN A;  2GQF A;  1QAO A;  2APL A;  4IBB A;  4Q7J A;  2JY5 A;  3DOA A;  3GQ4 A;  1TTE A;  4DV5 M;  4DR5 M;  2XGN A;  4NXN M;  4DV0 M;  5C18 A;  3SHF A;  3FD9 A;  2LH0 A;  3I4V A;  1TH3 A;  4DR2 M;  1P3Q Q;  4AZF A;  3KP0 E;  3QYB A;  2LHC A;  3HWS A;  1T43 A;  4B08 A;  4Y28 F;  4RKU F;  2QHO B;  4NC6 A;  5ITX E;  2AHM A;  2CEA A;  1HR0 M;  1IBL M;  2VDB B;  3SAT A;  4IBJ A;  5DFL A;  4DR4 M;  4I81 A;  1JB0 F;  3U60 B;  4OVZ B;  2QZ4 A;  5FTM A;  4LJ6 A;  3B89 A;  1LTM A;  2KDL A;  3J7A S;  3T6P A;  1EIJ A;  5EP2 A;  1A5T A;  3CF6 E;  2DAG A;  3GLG E;  4GIT A;  1IBK M;  2K0B X;  4QOS A;  3U6Q A;  3U6D A;  3Q8X A;  1GVN A;  1Z5A A;  3T15 A;  1HNW M;  4JV5 M;  1ZMU A;  4Z6Y A;  1V33 A;  3B9P A;  4LJA A;  3QYE A;  4KT0 F;  4I8O A;  3KVW A;  2Z4R A;  1W5S A;  3PVS A;  1FNN A;  1I4W A;  2MRO B;  1XNR M;  2L09 A;  4B3R M;  1IN7 A;  4FWH A;  4LG2 A;  1NV8 A;  1OAI A;  1VEJ A;  4L15 A;  2C5R A;  2G8L A;  4FWD A;  1G8P A;  2G3Q A;  3K8Z A;  4LJ7 A;  3R9X B;  4AKH A;  3GLI B;  3GLI E;  3SAU A;  4LFA M;  4NL4 H;  2L2D A;  2CWB A;  2QQ8 A;  1LV7 A;  1TH2 A;  3UGJ A;  1MU5 A;  3SMP A;  3GLH B;  1E9R A;  3GLH E;  5EXS A;  4JI4 M;  1OIZ A;  2KNA A;  4GKK M;  1Z59 A;  3L2A A;  3ILK A;  2LWX A;  1IY1 A;  3HU3 A;  3I51 A;  4PCZ A;  1Q02 A;  4ANR A;  5F3W A;  2KZS A;  4D80 A;  2R0I A;  1C7Y A;  2DAM A;  4ITQ A;  4LF6 M;  3HY5 A;  2EKF A;  1ZMV A;  2HKJ A;  3QWL A;  3SFZ A;  3SAR A;  1SXJ D;  1XWI A; 
#chains in the Genus database with same CATH homology
 5KQ8 A;  3HU2 A;  2X49 A;  5EP3 A;  5FTJ A;  5LMN M;  2XLJ A;  4FW9 A;  3GRY A;  4D81 A;  1IBM M;  4P16 A;  4IJF A;  3J81 S;  2RGH A;  2OPF A;  5ITQ A;  4X65 M;  4GH9 A;  4LCB A;  1TGU A;  3AJI B;  3A98 B;  2ZM6 M;  3GLG A;  1G59 A;  4JI1 M;  2V6Z M;  3SAW A;  4R3D A;  1NY5 A;  1YUB A;  2C9C A;  4G4Q A;  5E6J A;  3A46 A;  1E32 A;  3M6A A;  5FTL A;  1ZQ9 A;  3GPP A;  1OJL A;  3PNV A;  3U6S A;  1L2D A;  1IM2 A;  2R46 A;  4AKI A;  2UXD M;  1Q3C A;  5H37 D;  2KXE A;  1YSY A;  4BB9 A;  2F5O A;  3LVV A;  4IBF A;  3HJQ A;  3UK6 A;  2KEB A;  2CE7 A;  4DV1 M;  4MGZ E;  4KHP M;  2FNA A;  2A5Y B;  1DGB A;  4DR1 M;  2HCB A;  3U6P A;  3RGP A;  3UZU A;  2QEN A;  2BNK A;  3U6M A;  4OU7 A;  3LQR A;  4MGI E;  1HT1 E;  4M9X A;  4FCW A;  3U6E A;  5C1B A;  4GMQ A;  1MX0 A;  3GRU A;  4BBA A;  3TQS A;  3UJN A;  3VK8 A;  1KSF X;  3KDS E;  4JI0 M;  1XXH B;  1XNQ M;  4QHS A;  2BJV A;  3TWM A;  3MJ5 A;  1QYR A;  4JI8 M;  3KS8 A;  5DYG A;  4B3T M;  3FUU A;  4HL4 A;  4JI5 M;  3HJS A;  3DFZ A;  4Z8X A;  3VK7 A;  4G4O A;  3U5Z A;  5KQD A;  2DZN B;  4GRI A;  5DYI A;  3L26 A;  2Z3X A;  3SAS A;  3TE6 A;  5ITY A;  2UU9 M;  1Z5B A;  3FYC A;  5IT9 S;  3MHV C;  4KOD A;  2UUC M;  4GHA A;  4OX9 M;  1Q3B A;  3D8L A;  5KPZ A;  2R4J A;  2EO2 A;  2F5N A;  4RF1 A;  2KRU A;  2J7O A;  2F5S A;  1NHG C;  3HHY A;  1L8Q A;  1PJJ A;  4DUY M;  4JXJ A;  1Q39 A;  3RFW A;  4L8R C;  1WXQ A;  4LY6 A;  1IN5 A;  4MGY E;  4B3M M;  3FUT A;  1ORY B;  3W0L B;  3GLF B;  5IRE B;  1TDH A;  1JR3 D;  4PDG A;  4G4R A;  4IJE A;  5BPV A;  1DO0 A;  1PM5 A;  1IY0 A;  4IBE A;  3L29 A;  2NQ8 C;  4IBD A;  2I7N A;  4MB7 A;  1G41 A;  4YY3 M;  4A3V B;  1J09 A;  2V1C A;  3FUX A;  3KXE C;  5KO3 A;  4PT5 A;  4GC9 A;  2KA6 B;  2RKO A;  3CF2 A;  4L4U A;  7CAT A;  2OQ4 A;  3D8B A;  1L2B A;  4MM3 B;  2LNH C;  3WHK A;  4S12 A;  5ITT A;  3AOE A;  1GL6 A;  3KP1 E;  1K3W A;  1K82 A;  2P5T A;  3KW6 A;  2QBY A;  3KS4 A;  1NHW C;  1UM8 A;  3CF0 A;  1SXJ A;  2R4E A;  2RGO A;  4M9S A;  2XZF A;  3GO8 A;  1E94 E;  3HU1 A;  3KOX E;  4NOO B;  1GKI A;  3U6O A;  4REZ A;  2ZAO A;  3J7B A;  3H4M A;  1EE8 A;  2CUZ A;  3GRR A;  2VQF M;  3KFU G;  1R2Y A;  1L2C A;  4IBG A;  3LQQ A;  3J80 S;  2YQZ A;  2Z4S A;  3AV0 A;  5FLX S;  3VKH A;  4GKJ M;  1N33 M;  1NY6 A;  4DV2 M;  1QVR A;  3EIE A;  3T1Y M;  3EIH A;  1DGF A;  4GC5 A;  1N75 A;  4LZZ A;  1R6B X;  4NSR A;  5ITX A;  4JN6 A;  4D82 A;  1G4A E;  3MK6 A;  4DR3 M;  3U60 A;  1DGG A;  4OVZ A;  2C99 A;  2XFS A;  4LJ9 A;  5JI2 E;  3M0E A;  2W82 A;  3A42 A;  4G6Z A;  3K1J A;  2CHG A;  3VKG A;  5JI3 E;  3HHX A;  1Z5C A;  4LFB M;  4YHH M;  4G4N A;  3WHL A;  2R45 A;  1I94 M;  1IY2 A;  3VLF B;  1N36 M;  4DV7 M;  4RF0 A;  2YNM D;  3JR4 A;  3SMS A;  3ZH9 B;  4L16 A;  5E26 A;  1NJF A;  2KRK A;  2CV2 A;  2F5Q A;  1VDD A;  2DWZ B;  1OFI A;  2DVW B;  1X37 A;  4FWG A;  1FJG M;  3GLI A;  3HHW A;  3LVW A;  1D2N A;  4DV6 M;  3IG8 A;  2ERC A;  8CAT A;  5GKN A;  2Y0T A;  4DV4 M;  3GLH A;  1ZAE A;  2I7P A;  2VQE M;  1XMQ M;  2UUB M;  4B3S M;  3KSX A;  3DZD A;  4QNM A;  3AL0 C;  1DGH B;  4DUZ M;  2FFJ A;  2X4A A;  3IG5 A;  3TL4 X;  2YFQ A;  1DO2 A;  4M0D A;  1JR3 A;  3KOW E;  2BJW A;  3ZC7 B;  2M5Z A;  3K2L A;  1TDZ A;  3FTE A;  1L1T A;  4X66 M;  1L1Z A;  4I4L A;  4LF9 M;  3HKP A;  3J2P B;  3GPX A;  4MGK E;  4PDI A;  2VII A;  2F4V M;  4FD2 A;  5A2Q S;  3KSJ A;  1K3X A;  4FVM A;  1GLN A;  2L7H A;  5FTN A;  3K92 A;  2R18 A;  3FUV A;  3GPU A;  3PFI A;  2LXE A;  4LZJ A;  1N32 M;  2Z7J A;  4XGI A;  4RNA A;  1SXJ C;  4OW0 A;  2ZBK B;  3KOY E;  2KW0 A;  2FE8 A;  3SYK A;  3T38 A;  4LF5 M;  2HHH M;  1QAN A;  5EP1 A;  4WUR A;  1J5E M;  2DXI A;  2JA2 A;  3T1H M;  4I5S A;  5FTK A;  3UMM A;  5KPR A;  1HNZ M;  5IWA M;  2C9O A;  1NVM A;  4LJ4 A;  4AG5 A;  4AQY M;  4LF8 M;  1Z6T A;  3PXG A;  2CV0 A;  2F5P A;  2CHQ A;  2CFO A;  3CTW B;  5EQT A;  2L7I A;  3NBI A;  3QAU A;  4LFC M;  3FUW A;  3W0F A;  4LF4 M;  4LRS A;  5EXX A;  1NNU C;  5DNY A;  1DGH A;  1XC8 A;  2Y20 A;  3M7G A;  4IBK A;  4L78 A;  3SHG B;  2QPA A;  5EJC A;  1XXH A;  4IBI A;  3RE8 A;  4GIP A;  3U61 B;  2ZAN A;  3GP1 A;  2V1U A;  2J7N A;  2XEP A;  5EXP A;  4DR7 M;  1KFV A;  4QOZ C;  5LMU M;  4AW4 A;  1NJG A;  2Q2E B;  2EA0 A;  1HT2 E;  4IBC A;  4PD2 A;  3GLG B;  4NSO B;  2CV1 A;  2ZAM A;  3J27 B;  2DWM A;  4CHT B;  4FCT A;  3GRV A;  2R62 A;  4ZPX A;  1GL7 A;  4DV3 M;  4X64 M;  4WW0 A;  2E5L M;  2Y0Q A;  4B7F A;  4NXM M;  4FCV A;  3VFD A;  5IZ7 D;  4LRT A;  4MGH A;  4BLC A;  3FTD A;  3GLF A;  2EUC A;  2UXC M;  5BR8 M;  2L6O A;  1C1K A;  3TPZ A;  3A45 A;  3FKE A;  1IN8 A;  1IN4 A;  1QQW A;  2DHR A;  4KO8 A;  4K0K M;  3KOZ E;  1W5T A;  4XBO A;  3FTF A;  4AI6 A;  1R2Z A;  3E4R A;  3GPY A;  3AKZ A;  2M60 A;  3FTC A;  1XHB A;  3SYL A;  1N77 A;  4LGY A;  4X62 M;  2X8A A;  2FOI C;  4DR6 M;  3THG A;  3BOS A;  2QCU A;  2XSZ A;  3GQ5 A;  4AKG A;  3DA1 A;  4LJ8 A;  4QHT A;  3I4Y A;  4GHL A;  1S3S A;  4TUW A;  1IXZ A;  4LJ5 A;  3U5Z B;  4NRW A;  2D7E A;  3C58 A;  3U61 A;  3L25 A;  4IIW A;  1J7K A;  3L28 A;  1E9S A;  1HQC A;  1YE9 A;  4NRV A;  4QNR A;  4JI2 M;  1QZM A;  4JYA M;  2QP9 X;  5EP4 A;  2XZU A;  1OFH A;  4II7 A;  1NNJ A;  2KZU A;  3SAV A;  3HJ8 A;  2H1R A;  4LF7 M;  2YR0 A;  2D7G A;  3U6L A;  1XMO M;  3AFH A;  3VDU A;  3E9S A;  1G3I A;  2G5G X;  2O5R A;  2XF3 A;  4JI6 M;  3HHZ A;  2Y21 A;  1IXS B;  1QAM A;  2DZO B;  4EIW A;  3FYD A;  4JI3 M;  4CGY B;  4M0W A;  2XSZ D;  1NSF A;  1HQY E;  3JAM S;  5ITU A;  1T3T A;  3VDP A;  2DWN A;  4JI7 M;  5FSW A;  2XFT A;  4LGM A;  3R8F A;  5KPT A;  3OTO M;  1IQP A;  1H6U A;  3PNY A;  2UUA M;  4AG6 A;  3LMM A;  3HGI A;  1IXR C;  2K47 A;  1TH4 A;  4B7H A;  1QAQ A;  1PJI A;  2CHV A;  5ITR A;  3U6C A;  3NWL A;  3SC3 A;  2C96 A;  2QBY B;  3AOE C;  1N34 M;  1SXJ B;  2XH9 A;  1SXJ E;  3ZCB B;  4M9Z A;  2D7H A;  2C98 A;  1N78 A;  2R65 A;  3SBJ A;  1R7R A;  4HLQ A;  1KYI A;  3JR5 A;  1JQJ C;  4R7G A;  5EXT A;  4B7G A;  3TWK A;  4CIS A;  3L27 A;  4W5W A;  3AOG A;  1HNX M;  2HL7 A;  4MH0 E;  1IN6 A;  3GQ3 A;  3RGS A;  2UXB M;  2DWL A;  4KLN A;  1QAO A;  4IBB A;  3DOA A;  3GQ4 A;  4DV5 M;  4DR5 M;  2XGN A;  4NXN M;  4DV0 M;  5C18 A;  3SHF A;  3FD9 A;  2LH0 A;  3I4V A;  1TH3 A;  4DR2 M;  4AZF A;  3KP0 E;  3HWS A;  4B08 A;  5ITX E;  2AHM A;  2CEA A;  1HR0 M;  1IBL M;  3SAT A;  4IBJ A;  4DR4 M;  4I81 A;  3U60 B;  4OVZ B;  2QZ4 A;  5FTM A;  4LJ6 A;  3J7A S;  5EP2 A;  3CF6 E;  4GIT A;  1IBK M;  4QOS A;  3U6Q A;  3U6D A;  3Q8X A;  1GVN A;  1Z5A A;  3T15 A;  1HNW M;  4JV5 M;  4Z6Y A;  3B9P A;  4LJA A;  4I8O A;  3KVW A;  2Z4R A;  1W5S A;  3PVS A;  1FNN A;  1I4W A;  1XNR M;  2L09 A;  4B3R M;  1IN7 A;  4FWH A;  4LG2 A;  4L15 A;  2C5R A;  2G8L A;  4FWD A;  1G8P A;  4LJ7 A;  3K8Z A;  3R9X B;  4AKH A;  3GLI B;  3SAU A;  4LFA M;  4NL4 H;  1LV7 A;  1TH2 A;  3UGJ A;  1MU5 A;  3SMP A;  3GLH B;  1E9R A;  5EXS A;  4JI4 M;  4GKK M;  1Z59 A;  3L2A A;  3ILK A;  3HU3 A;  3I51 A;  2LWX A;  1IY1 A;  4PCZ A;  5F3W A;  4ITQ A;  2KZS A;  4D80 A;  4LF6 M;  2HKJ A;  3QWL A;  3SFZ A;  3TWL A;  3SAR A;  1SXJ D;  1XWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...